4I2PA

Crystal structure of hiv-1 reverse transcriptase in complex with rilpivirine (tmc278) based analogue
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
554
structure length
554
Chain Sequence
MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gag-Pol polyprotein
publication title A comparison of the ability of rilpivirine (TMC278) and selected analogues to inhibit clinically relevant HIV-1 reverse transcriptase mutants.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Hydrolase, transferase/inhibitor
total genus 155
structure length 554
sequence length 554
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4i2pA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4i2pA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4i2pA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4i2pA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4i2pA05
4FW2A 4I2QA 2Z1IA 2HHSA 4Y1DA 4IFYB 1ZYQA 2OPQB 1L3VA 3KLVA 3KK1B 4HKQA 1SH0A 4ED7A 4IG0B 3OS1A 4CERA 1JXLA 4CGIA 3SUNA 4W5OA 1N6QA 3QZ8A 1IKVB 2DFFA 2FVRA 5J2MA 2VA2A 1KLMA 2GC8A 3CDEA 4AHRA 1TL1B 4RW7A 3IGVA 4J2AA 1X9MA 1TKXA 3WNEA 1RTJA 2D0CA 4NCGA 4DL3A 2A1RA 1S6PB 2XY5A 2D41A 5CYQB 5KFJA 3RMBA 3AO3A 4CHPA 4F50A 4CF9A 3AO5A 4NYNA 3KHHA 1SUQB 1C0MA 5J1EA 1DLOB 3O4NA 1F21A 4DSEA 1IH7A 1BCMA 1TQLA 3K5OA 3WNGA 4CEZA 4HCCA 4PWDA 4ZP9A 4TY9A 2BQUA 3HPGA 2XI3A 2B6AB 4AHSA 4M3ZA 4B3OA 3V1RA 4R8UA 4FJ5A 1Z26A 2G8UA 4U7CA 3OVNA 3HP6A 3DDKA 1QQCA 4J9MA 4CHOA 1LWEB 5KFKA 3LPTA 5KFTA 5KFLA 3MEDA 3HKWA 4Q45A 1D0EA 3O3FA 4DS4A 4DTRA 4KHUA 1QE1B 3H08A 1DTTB 3V9ZA 1TKZA 4DQRA 1YVUA 2ASDA 4FJXA 4CGHA 5DG8A 1RTHB 3OYLA 1UAXA 4KFBA 4FJGA 3DOKB 5HROA 2IS3A 1LAWA 1JL2A 3HL8A 2V4RA 4R0EA 2HHXA 1S9GB 2JEFA 2JGUA 5KFSA 4AHCA 4FW1A 1U45A 1A5VA 1KVCA 2G8KA 1HJRA 4I2QB 2PZSA 5SWMA 5KGWA 3NBPA 2KW4A 3SUOA 5C24B 4IKAA 2HVHA 3LAKA 4OJRA 4DTJA 2RN2A 4YFUA 2ATQA 1N6QB 3NF7A 2IMWP 3GYNA 1W9HA 3ZSXA 4F4YA 4RW6A 2FC0A 5FRNA 1RDDA 1JLCA 2W42A 1KLMB 3ZT2A 4RNMA 4FS1A 1N48A 1U49A 4RW7B 5FRMA 1TKXB 3FQLA 1RTJB 3AVKA 4F4WA 3OSPA 2XGQA 4IRCA 4GC7A 3S3NA 3QIDA 1JLGA 3MXJA 3V9WA 3PX4A 3SUQA 4FM1A 2G8HA 2W7PA 2OPSA 5J1EB 3VA0A 4ELUA 4KTZA 4MFBA 4CFDA 4PWDB 4E89A 4ECTA 3GV5B 4KHWA 3ZSWA 4B3OB 3LALA 2RF2A 1RBRA 2OYQA 4R8UB 4Q43A 3KJVA 2D7SA 1WSGA 1NJXA 2RDJA 2R8GA 1J53A 3LWLA 3SCXA 3MEDB 3Q8RB 5EWGA 3IG1A 4KBIA 3CFPA 3ZCMA 5F8JA 4EP5A 1WSJA 4K4SA 3DYAA 3K58A 3K2PA 4ED1A 4J9SA 1WSHA 3VN5A 4KFBB 3HSTB 5HROB 3L3VA 4ZVGA 4RNHA 3T5KA 2ATLA 4NLQA 4HHTA 3LAMA 2BANA 3SI8A 3RMCA 3T3FA 4FJ8A 4I9LA 3S3MA 3HP9A 4C8OA 4ECQA 5F8NA 4CJPA 4KB7A 1KSPA 4FK0A 2FVPA 4CHNA 3LP2B 3NBPB 4DTUA 4CEDA 3KKRA 4HYKA 4RU9A 4LH5A 4CJQA 4CECA 2XY8A 3NAHA 3GQCA 4RZRA 2IM1A 3OYCA 4NLWA 4FM0A 1ITGA 4M95A 4DWIA 4RW6B 1NKCA 4O44A 1S49A 3H5UA 1U09A 4ECXA 4PUOA 1JLCB 2F8EX 4BWJA 3THVA 1I39A 3T5HA 3L2QA 1IO2A 1VSIA 3D28A 2E9TA 3L8BA 5DQGA 4WYLA 3G6YA 4DFPA 4IFVB 4DTXA 1JLGB 1GOBA 5L1IA 1C0UA 3QO9A 4M42A 2OPSB 4JS4A 4E7IA 4MFBB 3OYHA 3I5CA 4ZPDA 3BSCA 3BJYA 5F8IA 3OYMA 2RDIA 2FVQA 2HB5A 2RF2B 4Q8EA 3AVIA 1B9FA 3KJVB 2VG5A 2X74A 4QWCA 2QKBA 2AGQA 3AA2A 4FBTA 3DLRA 3SNNA 5KI6A 3IG1B 1UWBA 3CWJA 4FBUA 1RCHA 2V0NA 2HVIA 4N47A 3DYAB 3CJ3A 1TK8A 5KT3A 5DK5A 3MFHA 1FKPA 1YTAA 1XR6A 2XC9A 2BANB 4CF1A 4KAIA 2YKNA 1IKYA 3DLGA 3K59A 2C2RA 1RT7A 1QAIA 4KHMA 2VG6A 4ZP7A 1MU2A 1RBSA 1Z4UA 5EUHA 2UVVA 1WSIA 4FLWA 1TKTA 2IC3A 4XO0A 4DTPA 4KTWA 4YR3A 3H5XA 4J9KA 5KFUA 4R5PA 3NAIA 1RILA 1DTQA 4QWEA 4CJWA 3BQ2A 3CFRA 1IKWB 3ASMA 2LSNA 2BQRA 2JC1A 4J9NA 1D8YA 2VWJA 1KFSA 4YMEA 3SFGA 4O44B 4TYBA 3M8PA 3V9UA 4J9RA 4W5RA 5KFWA 4B9SA 1VRUA 3LP3A 3L2RA 3VA3A 2R7YA 3JYTA 2FLNA 4JV1A 3ZSVA 4O3QA 3HJFA 4MQ3A 1YVFA 3CIZA 1IM4A 5KT4A 1CXQA 5HRSA 1C0UB 3QO9B 1TK5A 1ASWA 3P83D 4JUZA 4ELVA 4CEAA 5KG2A 2IOCA 4MK9A 3V6DA 2CJQA 2E6LA 1HNVB 3HVWA 5KFBA 4EYIB 2JLEA 1S0NA 3ZT4A 4M45A 4RUAA 2XHBA 1NK4A 1JLEA 2VG5B 5FDLA 1NJYA 2QK9A 2XRIA 2P1JA 1SH2A 3RMDA 4H4MB 1JXEA 1LW0A 1TP7A 3QINA 3ZSQA 5L9XA 4CGGA 3HO1A 2V9WA 2F96A 4NCAA 1UWBB 1VSEA 3MR2A 4FJ9A 1RT2A 2YNGA 5E41A 2EC0A 4TYAA 4BACA 1VSJA 5DGBA 4DFJA 3RB3A 3C6UA 3E01B 1S1TA 1FKPB 3VQ7A 3AVBA 3RAQA 3HPHA 4O3RA 4B8CA 3G0ZA 3NGIA 3QIPA 1RDAA 1EP4A 3NMAA 2YKNB 1IKYB 3DLGB 3NAEA 1RT7B 4TQSA 1JKHA 4DSLA 3OL7A 1QSLA 2VG6B 3NGZA 5KTQA 1ZBLA 2O4IA 1MU2B 2RKIA 2AWZA 1D9FA 3NGYA 1NNDA 3TR8A 1SKRA 1TKTB 2IC3B 3NHGA 5I42A 1GX5A 1RNHA 4CJTA 2W9AA 1SKSA 1T05A 1X1PA 3PR4A 3VQ9A 4R5PB 4EZ9A 1DTQB 4FLXA 3SPZA 2C28A 4L8RB 4ID1A 3OS0A 4PQUA 3KIOA 3RR7A 3M8PB 3QGGA 1VRUB 4CEBA 1U48A 4NLDA 3ISNC 3QEPA 4RW8A 1GX6A 4Y2AA 5KT5A 4I2PA 4DL4A 4M41A 4ZP6A 3JYTB 4DQIA 2R8HA 1BI4A 2FVSA 3EZ5A 5KG6A 1WSFA 3V6JA 3C94A 4QWAA 3K5NA 3M9NB 3RTVA 3KNAA 5HRRA 1UOCA 3QNNA 2DFEA 4ID5A 3VQDA 2VWKA 3QETA 5F9NA 1J54A 4EZ6A 1SH3A 5HBMA 1JLEB 4DSKA 4HCBA 5DG7A 1LW0B 4ECRA 3WNFA 4BE2A 4N56A 4F8RA 2UVUA 4IDKA 3F9KA 3IRXA 2AGOA 1Y97A 1I6JA 3QGHA 1RT2B 2YNGB 1EX4A 4F2SA 3KHLA 2BGGA 1REVA 3DRRB 3KK2A 3M8SA 2R2SA 2FLLA 1S1TB 4O0IA 2WOMA 5HP1A 1FK9A 3DRPA 3HXMA 2B43A 2WCXA 3QIPB 1KLNA 4QCLA 1EP4B 3PW7A 3L2UA 1LAVA 4TLRA 1JKHB 2KQ2A 4Y2CA 2RKIB 4FJIA 4NRUA 4ZVHA 1NJZA 1SV5A 5I42B 5J2PA 1W25A 4CJVA 2PYJA 1A5WA 1T05B 4WE1A 1HQEA 3Q8SB 4TSXA 2OPPA 4PQUB 1KCFA 2YHBA 4B9TA 2HHQA 1BISA 2EX3A 4ELTA 2OPRA 4DS5A 4K4TA 4ZPAA 1C6VA 4RW8B 4NLGA 4RNNA 4I2PB 3VQSA 2QKKA 4GVMA 1BI4B 1ZBIA 3CJ4A 3CDUA 4WYWA 3EPIA 3FFIA 4AHTA 2R8JA 1LW2A 3ULDA 1HYVA 4YR0A 4W5NA 4ICLB 1ZTTA 2HHVA 2QXFA 2E6MA 1CLQA 3DRSA 5EWEA 2AGPA 4ID5B 2R8IA 4BWMA 4FZZA 5KFXA 3OL9A 2QE5A 4KO0A 5HBMB 4WFYA 4EBDA 4LD0A 4CJ4A 3QIOA 4HUEA 3C6TA 4F3TA 4IKFA 3AO1A 3N6MA 3I0SA 4IDKB 3TQ1A 3TAPA 3IRXB 4IH5A 2VA3A 1KVBA 4KI4A 1YTUA 2FJWA 3GIMA 3PW0A 1IG9A 1K1QA 5J2NA 3AO2A 2X78A 1REVB 3KK2B 3DMJA 2PYLA 3RB0A 2Z1JA 3VQ4A 2WOMB 5HP1B 3AA4A 1FK9B 3DRPB 4M3RA 1WAFA 4URQU 3P5JA 4CF0A 4DG1A 4ECWA 2AU0A 3MF5A 4NLYA 2BE2A 4ZPBA 2HAIA 4Z4IA 4I9QA 4HVJA 1TGOA 2P5OA 4CHZA 5KFFA 4B9LA 1JLBA 4X2BA 5KFVA 3CJ5A 1SV5B 5J2PB 1XC9A 4KI6A 5J2MB 2G8VA 1HPZA 5KFAA 2KZMA 2KTQA 4WE1B 5KFRA 1HQEB 3MR6A 4O5BA 4CJEA 4O3NA 3AVGA 4CK2A 3KLGA 3OYAA 4M94A 4K4ZA 4J2DA 1UA1A 4NCGB 1NKEA 3H4BA 4GMJB 5KFMA 2OPRB 3LPUA 4OGCA 4TN2A 1S1UA 2Z1GA 4ECUA 3AV9A 4CCHA 4DL2A 2R2TA 3FFIB 1KFDA 3MTKA 3OHBA 3QEVA 3QERA 4JLHA 5KG4A 5KFIA 1LW2B 3AVAA 1S6QA 2XCAA 3G86A 3V6KA 5KG0A 4ECSA 3CG7A 4F4ZA 3DRSB 4Z4GA 3L3UA 3PX0A 1NOZA 2R2RA 1NKBA 2W8KA 4KO0B 3KD1E 4M3WA 2DTUA 1TKZB 3AVMA 3GV8B 3NCIA 3O4QA 4ED8A 1EXQA 4NYFA 1HNIA 3F73A 3C6TB 2R2UA 3I0SB 4RUCA 1KTQA 3OYEA 4KB0A 4ECVA 1KVAA 2YHAA 2ALZA 3NL0A 3V1QA 4FJLA 5J2NB 4QW8A 3KK3A 5J2QA 4CEQA 1BGXT 4CIGA 3DMJB 3HVAA 2HMIA 3O3GA 4N5SA 2DPJA 2FLPA 4K4VA 4Z4FA 4EBCA 4DG1B 2BRKA 3OJUA 2BE2B 5SZTA 3MR5A 2C2DA 4Q5VA 4C8LA 2IM0A 2ASLA 1ASUA 4W5QA 3FSIA 4DQSA 3DI6A 3BREA 3BQ1A 4DTMA 2HW3A 1JLBB 3VQEA 2X6SA 4YR2A 2I1RA 4RNFA 5DGAA 1HPZB 1U47A 3TANA 5DG9A 4C8NA 3HVTA 4GC6A 3KLGB 3T5JA 2E9ZA 3SPYA 4J2BA 3BGRA 1JIHA 3LANA 2KFNA 5CYMA 4NRTA 4NYZA 1G15A 5KFEA 3HT3A 3H40A 4CESA 1VSFA 1NK6A 1WSEA 2GIQA 2AQ4A 4FCYA 4OLBA 1S6QB 4M3YA 3OJSA 1FKOA 5F8LA 1UA0A 3NH2A 2IAJA 4AILC 4RG8A 5DQIA 4K4UA 5DMRA 4BDPA 1BHLA 3Q8PB 4BDZA 3SQ2A 3DLBA 4Q44A 2AX1A 3RMAA 4IG3A 1HNIB 3OSNA 2W8LA 2BRLA 4DTSA 4NLVA 2FBXA 1BQMA 4KKOA 3KK3B 3H5YA 5J2QB 2FBVA 4QPXA 2HMIB 2XCPA 4IH7A 3SUPA 1N4LA 5EDWA 2OH2A 2ZQBA 1NK8A 4FJHA 1CSJA 2O4GA 3IN5A 3SYZA 1C1BA 3P1GA 4DQQA 1SKWA 4KHQA 2AJQA 3KD5E 1WLJA 4G1QA 1U4BA 3BDPA 2C2EA 4QWBA 2OZSA 4CJUA 2WK4A 3DI6B 2YNFA 4BDYA 3PW4A 4E1MA 1JLAA 4LSLA 4TY8A 3DOLA 5EWFA 5L1LA 1ASVA 1EKEA 2IJNA 4IH6A 2Y1IA 4DEZA 4YNQA 1B9DA 2R8KA 4PUOB 2YNIA 4XPCA 3K5MA 1TK0A 1S9EA 3HVTB 3DLKA 4WZQA 4F3OA 3RAXA 3I0RA 5DLGA 4NZ0A 4DSFA 3BGRB 3PJXA 5CYMB 3ITHA 1XR5A 4Z4CA 1RDCA 3WNHA 4XIUA 1VSDA 3MEEA 3SV3A 2RPIA 3CJ2A 1VSMA 4LY7A 1C1AA 3OS2A 4DFMA 1NK9A 3UQSA 1LV5A 1WN7A 4Y1CA 4CK3A 4J9PA 3MFIA 3NGDA 2Y1JA 4KB1A 4ED0A 5KT2A 3HM9A 3HHKA 2WONA 4ZP8A 1HYSA 2IGIA 1FKOB 1YT3A 4CFCA 4Q0BA 3MR3A 3TVKA 2IAJB 4NLOA 3PW5A 1A5XA 1RYRA 2FVCA 1BIUA 1XWLA 3TI0A 4FJ7A 3D45A 1RA7A 4CHYA 4UQGA 1BQNA 3LZJA 1SL2A 1KHWA 5KFQA 1D5AA 4IG3B 3HK2A 2BR0A 4EO8A 3RBEA 3PO5A 3OYIA 3N6LA 4CJKA 4MIAA 1D9DA 2VG7A 3AVCA 5KGXA 4H8KA 2ZD1A 1BQMB 4KKOB 1ZBHA 3NDKA 5KT7A 1T3NA 1LWFA 2ZKUA 3TAMA 2FBYA 4QW9A 3GILA 3OYFA 1C1BB 3H4DA 4LSNA 4FLTA 2YKMA 2DY4A 3KKSA 3I5AA 4G1QB 2BDPA 3V81A 1TVRA 2YNFB 1JLAB 4IRDA 4LSLB 4TY8B 3DOLB 4JRQA 3TWHA 4K4WA 1RT3A 2YNIB 5HLFA 4YP3A 3GIKA 1S5JA 5KRSA 1S9EB 5I3UA 5KFHA 1Q9XA 2D0BA 1HMVA 3EPGA 3CVKA 3E51A 1XI1A 3I0RB 5JXSA 3ITHB 5T7BA 1O1WA 3KMQA 4K4YA 4FK4A 2OZMA 4FZXC 3VQAA 3LDSA 1VRTA 3SI6A 2ITGA 3KHGA 3EYZA 2HNDA 1J9AA 4M3UA 4CJSA 1SUQA 4RW4A 3C95A 3V6DB 4M3XA 2WONB 4K8XA 4CFBA 4JV0A 4C8MA 1HYSB 5KFCA 4J9OA 2WHOA 4Q0BB 3OYBA 3RBDA 3CDWA 1C0TA 5FDLB 3OY9A 1JL1A 4F2RA 4Z4EA 3TARA 2W7OA 1FXXA 1NHVA 3QEWA 1BQNB 3SQ1A 1LWEA 4B08A 4LQ3A 3AA3A 1WAJA 2G8WA 2YNHA 4CEEA 4DU3A 1ZETA 3C6UB 4K8ZA 3KLHA 2VG7B 4CF2A 1X9SA 3T1AA 2ILYA 4IOBA 2ZD1B 3OLBA 4FS2A 3KOAA 2HNZA 1CZBA 3ISND 1LWFB 2UUTA 4FLZA 3UIQA 3TAMB 1T7PA 2XY6A 1EETA 3BQ0A 1U04A 4LSNB 5D3GA 2YKMB 3OYGA 3NF9A 3SV4A 3V81B 4OPKA 1QTMA 1TVRB 2NUBA 3MECA 5KG3A 5C24A 4FLYA 4PA1A 1RT3B 4WXWA 4B9NA 1N5YA 5HLFB 1QUVA 4ECZA 4E3SA 5I3UB 4PY5A 1HMVB 3AVHA 1I3AA 3VQQA 4ZMMA 3RB6A 4CIEA 1RT1A 1Q9YA 2JC0A 3RWUA 3CO9A 2IDOA 3NH0A 3K5LA 3VQ6A 1VRTB 4AHUA 4FJKA 2JEGA 3K57A 4H4OA 4O3SA 4N41A 1QSSA 2HNDB 3IAYA 4CEFA 3EZUA 1GOCA 4ED6A 3ICLA 4RW4B 3PJWA 3FDSA 4CGJA 5KRTA 1RT4A 3OL8A 1WNEA 3NF8A 5CZ1A 1HARA 1NK5A 1C0TB 4E0DA 4I7FA 1HQUA 1T03A 3QESA 1LWCA 4FLUA 1TAQA 4CEOA 2WB4A 3OLAA 2YNHB 3G10A 4DFKA 3UPFA 2DFHA 2XI2A 1HRHA 4F4KA 3V9SA 3SQ0A 3KTQA 3QEXA 5DLFA 3KLHB 4NLUA 2J6TA 3DM2A 4OL8A 4E7LA 3T5LA 3RRGA 5KFOA 3SZ2A 3UR0A 2HNZB 4MK7A 3V4IA 4NLRA 4E1NA 4KHNA 3AVNA 4KHRA 4MIBA 4DSJA 4ZVEA 3DLEA 4DL7A 2UVRA 3FRZA 5K14A 1EETB 3H5SA 4NLPA 5D3GB 2D5RA 3TABA 4E7JA 2HHUA 4DLEA 3OYDA 3LWMA 3ALYA 3LP2A 3MECB 4URSA 2OPPB 3LP1A 1NK0A 4J2EA 4OPJA 1C2PA 3AVFA 2HNYA 4J9QA 1N5YB 4FK2A 4DMNA 3TAQA 3LZIA 4YQWA 4HUFA 4KHYA 3U3GA 3QEIA 2KFZA 4J9LA 4O55A 1JX4A 1RT1B 1TV6A 4AHVA 1S48A 3HPOA 1RDBA 1MMLA 1RYSA 2HWHA 1TL3A 1T94A 1S0MA 5CY4A 4H4OB 4KTQA 4IFVA 4TXSA 3V9XA 5EU7A 3BSAA 3PX6A 1VK0A 3L2VA 4NCBA 1GOAA 3PW2A 1RT4B 3TAEA 4WXOA 1SL0A 1JLFA 4TQRA 1JXBA 3HYFA 3VQ8A 3GIIA 2XY7A 3M8RA 2IA6A 4HUGA 1IKXA 4I7FB 5KFZA 3JSMA 4FJMA 5KFGA 1HQUB 1T03B 1N56A 1LWCB 4CFAA 4CE9A 3T19A 1S97A 3PVXA 2GUIA 4KE5A 2F8TA 2D3UA 1K6YA 5L1JA 3KLFA 3I8DA 1RT5A 3ZSZA 4OLAA 3IS9A 4NLXA 1VSHA 3B6PA 3U3YA 4DSIA 4F4XA 3DM2B 4QWDA 2YV0X 4JV2A 2IJFA 4ED3A 3V4IB 1ZTWA 4ZPCA 1T8EA 1S1XA 5C42A 2I5JA 3G6XA 4ZHRA 4DTNA 3DLEB 5F8GA 4FLVA 5K14B 4IQXA 1RTDA 5C25A 2KZZA 3BSNA 1XHXA 4OVLA 3KLIA 4EO6A 4Z0UA 4FVMA 4E7KA 2W9CA 3QZ7A 4Y34A 1CXUA 1D1UA 3G6VA 4KV8A 3LP1B 3V1OA 1XR7A 2HNYB 2W9BA 3AVLA 4O3PA 1IKWA 3PV8A 1BL3A 5L1KA 1S1UB 4ED2A 1S1VA 1SL1A 3NH1A 4E7HA 2AX0A 3PHEA 2F8SA 4KSEB 1TV6B 4Q8FA 2G8IA 1RA6A 2V4QA 1QHTA 1TL3B 4CJ5A 1NK7A 4MKBA 2PY5A 3OYKA 2XGPA 2IBKA 1RBTA 3CYMA 4O4GA 4FXDA 4EYHB 4FZYA 1RBUA 1KHVA 2IM3A 5HRNA 2UVWA 4GW6A 2D3ZA 4U6PA 5KT6A 2ASJA 2OA8A 1JLFB 3I5BA 3AO4A 3CQ8A 2D0AA 3MAQA 3QYYA 1JLQA 4IBNA 4CHQA 4E19A 4BE0A 4Y3CA 1IKXB 1HNVA 2DPIA 3JSMB 3O3HA 3QGIA 4OKJA 3CM6A 3NE6A 3NFAA 4CJFA 4XPEA 4IRKA 4CJRA 4CJ3A 4H4MA 3NF6A 4O4RA 5F8HA 4FM2A 4RW9A 3RB4A 3KLFB 3U6FA 2HWIA 2IM2A 1RT5B 2J6UA 3RR8A 4G3IA 4C8KA 1RT6A 3IS9B 1S1WA 2ILZA 4ZTFA 1B92A 2A1SA 3M8QA 3QLHA 3E01A 4DTOA 1C1CA 4WZMA 4DL5A 5FROA 4JRPA 4B9UA 4DF8A 4FJNA 1S1XB 3ZSRA 5C42B 3D5MA 2I5JB 4CIFA 4ZHRB 3OYJA 3HVRA 5KFDA 1TAUA 4OKKA 4AH9A 4BE1A 1RTDB 5C25B 4NLTA 2B4JA 4EBEA 2GIRA 5KFPA 3KLIB 2P51A 1J5OA 4DQPA 1VSLA 3KMSA 2W9CB 3Q8QB 3VQBA 4KV8B 4KHSA 3H59A 4DL6A 1XHZA 2WTFA 2G8FA 3V6HA 2W9BB 4URGA 3MEGA 2HHTA 2Q3SA 3S3OA 4KREA 2E4LA 5C5JA 3OL6A 2QV6A 3MXIA 1S1VB 2FJXA 3EY1A 5CZ2A 3AVJA 2UUWA 3FQKA 4FJJA 1BIZA 1NOYA 1S10A 5JS2A 4DLGA 4ECYA 4HTUA 3ZT1A 4QAGA 4O4GB 4IR9A 2FBTA 3GIJA 3OYNA 3ZSYA 3DLHA 3CM5A 4FYDA 4EP4A 4ZVFA 1JLQB 1S0OA 2HHWA 2ZE2A 3QNOA 2J6SA 2JEJA 1CZ9A 3LP0A 3TAGA 3B6OA 1VSKA 3SJJA 4MKAA 3KLEA 4CGDA 5KFYA 4RW9B 1RBVA 5KFNA 4K4XA 3S9HA 2B5JA 3PR5B 1L3SA 1RT6B 3A2FA 1S1WB 4RNOA 2CKWA 4WFXA 3M8QB 1R0AA 3DRRA 3QLHB 2C22A 1Q8IA 1RTIA 1C1CB 4B9MA 4KRFA 5JUMA 1QS4A 3VQCA 2GV9A 3CFOA 3H2LA 4LH4A 1RAJA 3BSOA 4IFYA 2OPQA 3SQ4A 3KK1A 1Z25A 3BR9A 1BCOA 3GV7B 1ZBFA 4LQ9A 3VQ5A 4IG0A 1QAJA 4NLSA 5DQHA 3ZT0A 2Z1HA 1X9WA 2FJVA 1J5OB 5HRPA 2BQ3A 3VQPA 1QSYA 1ZBUA 1KRPA 1IKVA 4KPYA 2WRMA 4W5TA 3DLKB 3PUFA 4KAZA 4O3OA 2GBZA 1L5UA 4Z4HA 2XWYA 3N6NA 3MEGB 3ZSOA 4M3TA 1TL1A 4H54A 1RDRA 3L2WA 3UDLA 3MEEB 5F8MA 1S6PA 3MXMA 3SFUA 3PY8A 5CYQA 2JEIA 5T14A 4EEYA 5KG1A 4ZTJA 5F9LA 4MK8A 1L3TA 3NKYA 1DLOA 4B9VA 4JS5A 1TKDA 2XO7A 4CF8A 4DU1A 3RRHA 3TAFA 1W0HA 1WNSA 2P5GA 2X6NA 2B6AA 4ICLA 3M9MB 1S9FA 1NJWA 3PO4A 4N76A 1HYZA 4CGFA 1NHUA 2O5DA 3CJ0A 1OS5A 4O0JA 4OGEA 1K1SA 4DF4A 5KG7A 2ZE2B 4K50A 3ZT3A 3IGNA 1QE1A 3LP0B 1DTTA 4CJLA 2E9RX 5KG5A 3KLEB 3H98A 3OHAA 1RTHA 1S4FA 2EHGA 4CK1A 3D0PA 2B5JB 3DOKA 4IR1A 4MH8A 4DU4A 3AA5X 4B8AB 5JS1A 1S9GA 3M9OB 3KHRA 1R0AB 1RTIB 2ETJA 4QOZB 4OKEA 1L3UA 4WFZA 3PZPA
chains in the Genus database with same CATH superfamily
2B9YA 2Z1IA 1ZYQA 2OPQB 1L3VA 3KLVA 2ASYA 5HI7A 4DCPB 2VC0A 4HKQA 1WG4A 5HVFA 1HR0F 1SH0A 4W5OA 1FX2A 5DETA 3H42A 1IKVB 1NAQA 2FVRA 3M6WA 2UUCJ 4FF4A 3THXB 2FHOB 5AQIA 2P9SB 4NB4A 1FWKA 4FWMA 5M1NA 3C8YA 3IGVA 4GKKK 2PAVA 2HS0A 4X4TA 3ZETA 2D0CA 2CZ9A 3AXMA 2D41A 5CYQB 3AO5A 3PIPQ 4D3HA 1ZZFA 1SUQB 4OYMA 4ZA1A 5AQLA 1IH7A 1BCMA 1TQLA 3WNGA 4PWDA 4X4NA 2VB6A 5F41A 4AHSA 1YHQN 4PG8A 2XNRA 4B3OA 1FJ7A 3FEZA 3QWPA 1Z26A 4U7CA 1QQCA 5BR8K 4ATNA 1R6VA 5KFTA 5KFKA 3LPTA 5KFLA 3JXOA 3HKWA 3M1FA 1N8RO 1D0EA 1DTTB 2KU7A 1YVUA 1U02A 1VQ5N 5DG8A 4GVBB 3OBWA 2B0GA 1YGYA 4FJGA 2K7JA 3PNIA 3HL8A 3FZMA 2WVFA 2MZTA 1X60A 2FYXA 3NWGA 3H3NO 1Q16B 1A5VA 4MYUA 1HJRA 4I2QB 1NLVA 5KGWA 5C24B 1XIQA 4JI1F 1N6QB 3NF7A 2ZH4A 4DUZJ 2QC3A 3JTOA 1KLMB 5LL6d 4H03B 1TUYA 1K8AO 3J8AA 5FRMA 3PYFA 3FQLA 2QLFB 3CD6S 1RTJB 4PG6A 3AVKA 2QTWA 4F4WA 5D0GA 4FNIA 3OTDA 5CD4H 4IRCA 2U2FA 3J7ZT 4OI0A 2Y8WA 4H0TB 3S3NA 3QJJA 2HK3A 4LF7K 3PEJA 3EGZA 2CNLB 1CJTB 4ECTA 4A8FA 1I1GA 2UUAJ 4KHWA 3KYLA 3AJDA 3ZSWA 1X5OA 2IFXA 3CJ8A 1RBRA 4Q43A 1Q1KA 5D77A 3FZHA 3MTJA 2DRBA 2V8GA 2O8FB 4M63C 3W9IA 4B3RJ 5C2DA 1J53A 3LWLA 3SCXA 3MEDB 4WIQA 3Q8RB 4KBIA 1RWNB 3FRYA 2QA4N 1N33J 3KK7A 4AE5A 3KJNB 3VR1A 4OO1J 1WSHA 2DTJA 2GVZB 3HSTB 5HROB 3G2XA 4CLSA 4HHJA 3T5KA 2QXLA 2LVWA 1FKAF 2DO4A 4I68A 2BANA 3UNYA 3T3FA 3HP9A 4ECQA 5LMNF 4KB7A 4YOVA 4JN4A 3MX5A 3NBPB 3I87A 1NM1A 4HYKA 3C19A 2UXDJ 1Q7YO 2I7PA 4CJQA 2XY8A 5IT4A 2IM1A 3OYCA 1NSPA 4NLWA 4YDDB 4ECXA 4PUOA 1JLCB 4BWJA 3TA0A 2VKZG 3T5HA 3H6EA 3H0PA 1S6OA 2AJFE 4DPYA 2A2CA 3AD9C 1I51B 3FZKA 4WYLA 1GMVA 4IFVB 1JLGB 1P6TA 5L1IA 4HI1A 4LF9K 1C0UA 3QO9A 5HMWA 4M42A 2GMHA 1DEJA 2OPSB 4JS4A 1NSAA 3T1HF 3I5CA 1DT9A 1DARA 4OJ1A 2XS2A 4LF7F 5F8IA 3OYMA 4KGVB 3R7SB 1GLEG 1YJVA 4C97A 1O8BA 2RF2B 4Q8EA 3AVIA 3J7YI 1SS6A 2E7WA 4RKUC 5H1SQ 3AA2A 4F0MA 3DLRA 5JJBA 5KI6A 1ELOA 1RCHA 1KVJA 3DYAB 3CJ3A 1TK8A 4CVNE 1VQLN 5GMEA 5KT3A 1Q53A 3KG1A 1VC6A 1V3SA 2XC9A 1UFKA 2B9WA 3L4BC 4CF1A 1IKYA 3DLGA 3K59A 1CLFA 2L48A 4KHMA 4P7TA 4I6YA 2M3DA 1RBSA 4ALZA 1HBOA 2IC3A 4XO0A 2BUNA 2QZ8A 2CAJA 2V8PA 5KFUA 4R5PA 2EFQA 2P9PB 2AV5A 1RILA 1DTQA 2K1RB 4QWEA 3BQ2A 5LJWA 2JC1A 4J9NA 1D8YA 1UVNA 2VWJA 1KD1T 2W7AA 4YMEA 3SFGA 3OBYA 2MPUA 5A2QO 3MEKA 2MDAA 2QFJA 2F5GA 4M5DA 3ZSVA 4CLLA 2QEXS 4O3QA 1H6KX 2KM8C 2CGLA 1FTCA 1YVFA 4MLHA 1UJ6A 5KT4A 3KG0A 4B3TK 1TK5A 4AQYF 1YTYA 4AL7A 4LF9F 2PMZD 1FDBA 4ELVA 3IM9A 1OKJA 4BVOA 3W9JA 2CPXA 1EJ7L 1S76D 4AFFA 2LU1A 2E6LA 1HNVB 5BPNA 3L95X 5DDPC 2NYHA 4EYIB 1S0NA 5DJBA 4R0JA 3ZT4A 3W66A 2VC1A 1JLEA 5FDLA 4QR2A 1YBAA 1JJ2R 3SCJE 2HBKA 1Q18A 4H4MB 3D2FB 2XO6A 5CCLA 4NXNJ 4FSVA 3HO1A 1PO6A 3MX2A 1UWBB 2V4JB 2PI5A 4FJ9A 2A18A 2YNGA 3CO0P 4TYAA 5ETNA 3OTOJ 2E66A 2P9NA 3RB3A 1GXLA 2CWXA 2KG1A 1GTEA 2Y3YA 4O3RA 3NGIA 3HT0A 4I69A 1VQ9S 3CPEA 3VAGA 3MMVA 2YKNB 3OXLA 3ENHA 2J9CA 4JI6J 1JKHA 1QSLA 2DPNA 1AB8A 1ZBLA 1ACMB 4WPAA 1R43A 5L46A 1SKRA 3LUYA 4CJTA 2W9AA 1SKSA 2W6KA 2B9XA 1R8CA 4FLXA 5HQLA 2C28A 3M30B 4ID1A 5EVZA 4PG7A 3M8PB 1NMNA 4QOTA 1VRUB 1FDAA 4CEBA 1VQSA 4RW8A 3THYA 1U1KA 4M41A 1BI4A 2FVSA 4V1Ak 4K43A 2XYPB 3V6JA 4JI2J 3RSEB 2MQLA 4QWAA 3RTVA 4B3TF 5HRRA 3G6ES 5T7LA 1GLJO 4A8MP 3M2UB 1VQNN 4PQAA 3VQDA 5IOLA 2AZ1A 5CAAA 3CTRA 3KUGA 1UJ5A 5HBMA 4NLBA 3C2PA 3ZZZA 4W90B 1G6BA 4ECRA 1YX2A 3EZOA 3QBWA 4AXJA 2UVUA 3F9KA 2VIHA 2HIYA 4ANDA 5AJ3K 2ADCA 3QGHA 1RT2B 1WORA 2Z4PA 4YB7A 3QSYB 2L41A 2EG2A 4F2SA 2J9EA 3HM8A 1NWKA 2J8SA 3DRRB 4JKGA 2R2SA 4WQ5A 1S1TB 5HP1A 3DRPA 3HXMA 2B43A 4BR2A 2WCXA 1RKJA 4QU6A 4QCLA 2BEFA 1EP4B 3PM9A 3PW7A 3L2UA 1T02A 2IMOA 4JKDA 4TLRA 1RQ0A 2KQ2A 2R7WA 4C8YA 1G4CA 2HK2A 1Y11A 4FJIA 4NRUA 3MUMP 2B3TB 4ILLA 1Z2LA 1RHJB 2LYVA 3D68A 2ZH5A 1VI7A 1T05B 1NRKA 1HQEA 3MWTA 4M7XA 2VDHA 2OPPA 2BE7D 4PQUB 2VQFJ 2YHBA 1M1HA 2RS8A 2E1MC 3W2VA 3MAAA 4DS5A 2MB0B 1XTZA 4RNNA 4DUZF 3MOZA 1FVSA 4GVMA 4WYWA 2NRZA 4DUYF 3ULDA 1NDKA 1J6ZA 4D3GA 5D15A 4I4BA 2GWJA 3W8GA 4ID5B 4QR1A 4NA3A 3K17A 3PSIA 4WFYA 3CPWR 4HUEA 3QIOA 4MO4A 4IKFA 5GAGI 3NVMA 2VQEK 1YWXA 1YTUA 4YY3J 4CDIA 2FJWA 3CC2N 2D69A 2RQCA 5J2NA 4ZIWA 5AJ3F 4DV4K 4B3RF 2HQFA 4IQMA 4IFEA 3U9DA 3VQ4A 4XK8C 4M3RA 3ULHA 3P5JA 1YDLA 1YJ9S 4CF0A 4K2XA 3OHRA 1FRMA 1AFJA 2HVDA 5FIIA 2HAIA 1UVMA 1TGOA 3VEXA 4C3KA 3CCES 2V34A 3MM9B 1Y7PA 4K0KJ 4B9LA 1JLBA 4DX7A 3T69A 2XB2D 4X2BA 2Z58B 3CJ5A 2KG0A 1XC9A 4KI6A 2QW9A 4WE1B 2MY8A 3MR6A 1WHYA 4CJEA 4NLCA 3OTEA 1R6YA 1UVIA 2HFZA 4CK2A 3OYAA 4K4ZA 4NCGB 4LF8K 2V8VA 4GMJB 1DRZA 4DV5K 2VASA 3JS6A 2ZH6A 5H9FK 3VZHA 3FFIB 1U0SA 5HVHA 3MTKA 1X0FA 2WBNA 3BF1A 3AVAA 3QATA 5B0EA 4V19S 4OHVA 3G86A 3V6KA 3IC1A 3D0GE 4H0YB 4ECSA 3CG7A 4JHDB 3DRSB 1YVNA 1TL4A 3H46O 3K5PA 3KFWX 4HHUA 3ZNUA 2ZM6K 2LQ9A 1QAYA 1UW9A 2OELA 3O9SA 1TKZB 3AVMA 3P38A 4X65K 3O4QA 1D09B 3EMTA 4NYFA 3F73A 3HZ6A 3ETMA 4UW2A 2NZCA 3OBIA 5IC6B 2VQEF 1UPMB 3CD0A 4CEQA 5FPNA 2B51A 2HQIA 2VPXB 3TJ8A 3HVAA 2HMIA 2DXEA 2VFTA 2F7TA 4Z4FA 3SBGA 2D74B 2F9JA 3VGUA 4DG1B 4RJVA 4JI8K 4ERDA 2BE2B 5HMXA 5DZ7A 5SZTA 3MR5A 2VHGA 1Y3JA 3O9RA 1ASUA 4W5QA 3FSIA 4DQSA 3DI6A 2VPYB 3IRWP 2NNWA 4MKVA 3DGPB 4YR2A 2QA4G 2I1RA 4RNFA 1HPZB 4F7VA 2BOAA 4C8NA 3TWZA 2MXYA 1ITPA 3HVTA 4JK9A 1GMWD 3KLGB 2PEHA 4OIXA 4LF6K 1V4TA 3BGRA 5CYMA 3U27A 4NRTA 1YLXA 2NCKL 2KFYA 4LF8F 1DKGD 1LQ9A 1VSFA 3UKUB 1NK6A 1Q0NA 2W2MP 2JVRA 2GIQA 1NGCA 3NGTA 2JNJA 5KPTA 2YWEA 2F8MA 1FXLA 4M3YA 2Y1RI 4OZ1A 5BPMA 1VISA 3CJKB 2CG4A 1TYQB 1RLDA 4ZLNA 5JVHL 5DQIA 4TNOA 2VH7A 4K4UA 5DMRA 4L75A 2QWOA 1J2VA 1Y9OA 3VEZA 1OQ3A 1D9AA 4Q44A 2AX1A 3RMAA 1HNIB 3OSNA 4ZK7M 1FRLA 2O66A 4X65F 3EKUA 3S01A 2GQ2A 3TOQA 2NQPA 1XNRJ 1AXQA 2BRLA 4NLVA 1T44A 5CD4A 4QPXA 2XCPA 2DNMA 1N5SA 1RWVB 5HMYA 1NK8A 2O4GA 3CCLS 3VGSA 1C1BA 3J80U 4DQQA 4JI8F 1NZ8A 2HGMA 2G0CA 2C2EA 2D1CA 2GGPB 3CW2C 2QA1A 4GO5X 3UKRA 2IIRA 1YI2S 1SC6A 5EWFA 1EKEA 2V9KA 4JI6F 4DEZA 2R8KA 4U7UD 2OANA 2YNIA 2ZITA 1WSVA 4PXEA 2AYBA 1TUUA 2GTDA 3NEKA 4F3OA 3U02A 2DO0A 2YWFA 4NZ0A 5L8RC 3CD6N 4LF6F 4XIUA 1O51A 3VERA 2RPIA 4LY7A 1XEZA 3UQSA 1LV5A 1AFIA 4DR3J 2CQPA 3MFIA 1SKUB 4KB1A 1ZS6A 3HM9A 2ASOA 1MMNA 3M3ZA 1HYSA 2IGIA 1YT3A 3BP8A 4I64A 1E6YA 3MR3A 3AOBA 4YOXA 2R7OA 3EGWB 2QL5B 4L76A 1XWLA 1RYRA 3TI0A 4CWBA 2FHJD 3IBWA 1SL2A 3W63A 5ETTA 1U2FA 3FGUA 3CIPA 3I6PA 2BR0A 4FVUA 4OI6A 2BUPA 3AVCA 4V19J 2WVEA 3AA9A 4CYUB 1BQMB 1T11A 3A12A 2OFGX 4NI2A 5HMZA 1K73O 1T3NA 3SAFA 2SXLA 4IOCQ 2KXFA 2PMHA 3GILA 3OYFA 2K7KA 3VQTA 3O5TB 2NXJA 2YKMA 1N0VC 4JYAJ 1R59O 3V81A 3ILOA 1JLAB 2FXUA 1WACA 1XC3A 3JSRA 2DR8A 4NMLA 2M5YA 4WFNL 3HCXA 5HLFA 5CA5A 3P6YC 3NOCA 3DRXA 3CVKA 2P9SA 2UXCK 3I0RB 3NNAA 3OV7A 3BKUA 3ITHB 3QQCD 2OZMA 4H5TA 5LSRA 3VQAA 2Y1LB 1I94J 3H8YA 3FSYA 3DN9A 3SI6A 4RBVA 2ZBQA 3HZEA 1Y10A 1VQ8S 1TMMA 2RVJA 1BXNA 2W2NP 1SUQA 1KQSR 3DJCA 3C95A 1GLLO 4K8XA 4CFBA 4JV0A 4WU3A 4J9OA 4DR2J 2WHOA 4KR0B 3CDWA 3S7RA 2BJ1A 3HULA 2W7OA 1FXXA 3NCPA 1NBEB 3AA3A 4FKXA 2YNHA 2HRYA 4FP9A 1HA1A 3I31A 1YJWS 2GHWA 2VG7B 1PKUA 4GVBA 4UOGA 3GSIA 1M5OC 5DO2A 3TRGA 4DV0K 4FLZA 3UIQA 1WSRA 4YY3F 2KJVA 2QLBB 2Q43A 3OXFA 2O8CB 1EETA 4LSNB 4JK8A 4KQZA 4B02A 2KYXA 4M5LA 5DZ6A 4OPKA 3D67A 2NUBA 5C24A 5HL7L 4FLYA 2Q6BA 4PA1A 4B9NA 5I3UB 4CD1A 1H3DA 2MLZA 3AVHA 1NO8A 3A3OB 3VQQA 4LRCA 2CVIA 2UXCF 2C2ZB 2JC0A 3ULEA 3J81O 3K5LA 1VRTB 2W41A 3K57A 3C46A 3NNHA 1QSSA 3ENBA 4A47A 1R8HA 2VD3A 2B4UA 1EX8A 4NASA 4OZ2A 4NL5A 3I56N 2JZ5A 4JI0K 3OL8A 3CMES 5LMUJ 1FRHA 3E9OA 1HARA 4FF3A 5CZ1A 1C0TB 2HMPA 5F2RA 2RHSB 1YJRA 3QESA 4FLUA 2X3GA 3G10A 3ETOA 4DR6K 4KH1B 1YJNS 2DFHA 2R42A 1HRHA 3R9LA 9RUBA 5KPZA 3Q2TC 2HPUA 2E5HA 3QEXA 1Q86O 3KLHB 4E7LA 4OL8A 2KKHA 2BYCA 2R7SA 1B99A 2A40A 5ETRA 2UUBJ 5F0UA 1UEKA 3V4IA 3D3CJ 3QAEA 1BHNA 1JNZB 2FJAB 2MKSA 4KHNA 2VBZA 2HS4A 3DLLQ 1VHFA 3M32B 1SJRA 4DL7A 3FRZA 3IR5B 2YKAA 4NLPA 4QIEA 3OW2R 4DV6K 4DPXA 3ZX0A 4WQ4A 3LWMA 3ALYA 2IVYA 4URSA 4YS2A 4NYOA 2DYAA 4PEOA 2ROEA 4LFBK 4DV3J 1P9QC 2BZ2A 4Y00A 3VALA 1IQTA 2VGNA 1X7VA 2IJRA 4J5OA 2XZDB 4KHYA 2BMBA 3U3GA 4J90A 4JB8B 4AHVA 3CPWM 2DH7A 3P96A 1YJ7A 1XBWA 4HTJA 2U1AA 1TL3A 1LKZA 4H4OB 4KTQA 4IFVA 4TXSA 2M4MA 3G6EN 4ZVRB 2J0XA 4DR7K 2IRYA 4LF5J 3FBFA 4PXBA 3PW2A 4WXOA 1SL0A 4TQRA 1S57A 2X1GA 2HIQA 3GFXA 1O0PA 1CPZA 4HUGA 1IKXA 2M70A 5F0WA 5KFZA 3JSMA 1T03B 3TZZA 1LWCB 3WX4A 2F4VJ 4CE9A 3PVXA 1VLYA 3EWGA 2RU3A 2EKYA 3FKBA 2P9IA 3I8DA 4OLAA 4NLXA 4DB3A 1KDNA 1T3VA 2YWGA 1XNQK 3BYRA 4H5RA 4HACA 4IO1A 2V2QA 3BBFA 2C3PA 3LDQA 2MKCA 3L9ZA 4JI7K 5C42A 3G6XA 5F8GA 2D3OR 4FLVA 5K14B 3NWRA 1RTDA 1XHXA 2XG8A 1YIJS 4KHPJ 2F9WA 2W9CA 3G6VA 1CXUA 1SAZA 2MGZB 4RBUA 4DV6F 4IJAA 1H38A 3S1TA 2UXBJ 4LFBF 1K8KB 1RHUB 4E7HA 2MYFA 1SQKA 1Q8KA 2G8IA 1RA6A 2XGPA 3VAFA 3CYMA 1YQHA 4DX6A 5GADU 4FZYA 1U1PA 1G2EA 1SIWB 2IM3A 5HRNA 2UVWA 4GRSA 3VF4A 4M5KA 4GW6A 4OZ3A 4DR7F 3GG0A 3M2RB 2OA8A 3I5BA 4A8OA 4IO9Q 5M1OA 3MAQA 3QYYA 3BUZB 2YBVA 1NGAA 4IBNA 4E19A 4H4KC 1HNVA 3O3HA 3QGIA 4OV6A 4OKJA 3NE6A 4EK2A 1K0TA 2Z2LA 5EX5A 4CJRA 4H4MA 4FM2A 2GMLA 3BH6B 4RO0A 4AYBD 2J6UA 3RR8A 1YZ6A 1RT6A 4J91A 1A6LA 2ILZA 2BOPA 4CH0S 1B92A 3M8QA 2OUGA 1YJ9N 1GXTA 3THTA 3ZSRA 4ZHRB 1WJ9A 3CUNA 5KFDA 4OKKA 4PABA 1N36F 1NGHA 4PG4A 2NUUG 2P51A 1VSLA 3VQBA 3A8KA 3A13A 4DCOB 2N3OA 4KHSA 2ADBA 3IAM9 2UUCK 3SAGA 7FDRA 2CJBA 2G8FA 2W9BB 3HDSA 4URGA 2HHHJ 4JYAF 4EAHD 3S3OA 4B3SF 3OL6A 3C7NA 4B1VA 5C2FA 3P3DA 4HEA9 2CQGA 5CZ2A 3H7HB 2HBMA 3ZYYX 1WKKA 1BIZA 2W4PA 2KN4A 1VOMA 2XZTB 4DLGA 4HTUA 4QAGA 5AQRA 5D8HB 1T6DA 5AZJA 1WF0A 3OYNA 3ZSYA 3OUYB 3HKZD 2H4YB 1CQNA 1TR0A 4FYDA 2I7NA 4EP4A 4PKDB 3L09A 1YRUA 2ZH7A 1Q82O 2HHWA 4MLEA 3OTCA 2J6SA 2JEJA 4YDUC 3N0VA 5JLFA 2GVDA 3B6OA 1VSKA 2YH1A 2Q31A 4MKAA 3R97A 4DR2F 4DL0C 1M1GA 2ZNYA 5KFNA 1NLKL 3PR5B 2KXHA 2CKWA 3L0QA 3OVSA 3CMQA 2UV8G 1R0AA 3DRRA 2DVIA 2QGFB 4B9MA 1UCNA 1QQMA 1QS4A 3CFOA 1BG3A 1RAJA 3BSOA 2CJKA 3MD3A 4IFYA 4A8KA 3KK1A 1XMQJ 1KOOA 1X9WA 3CCMS 4F0HA 4H5NA 4JV5J 2A0FB 1GLFO 3BY5A 1VK8A 1RWPB 4UF4A 4M3TA 1TL1A 1JJ4A 1RDRA 2J76E 2VODA 2JVOA 1U6ZA 3AD8C 3PY8A 1HWKA 4DU8A 5AQXA 3R6GB 5F9LA 4MK8A 4FPAA 2DB1A 4DR1K 2XO7A 4X4RA 5DM7L 4DU1A 3CCQS 2QLXA 1W0HA 2BBEA 1Q78A 2UUAK 4IDHA 2B6AA 2E29A 4N76A 2QWMA 2DD8S 4I6WA 1SIZA 3J7YU 4YB1P 3MOJB 2D3O1 1OS5A 2QL9B 4O0JA 4WFBL 4IEIA 2PA8D 5KG7A 2WUSA 4EU0A 4K50A 3IGNA 1AYEA 3FSXA 5FPMA 2Z8QA 4YOYA 4B9QA 3KDOA 1NPRA 2HZAA 4UZCA 5KG5A 3KLEB 2H65B 2MHEA 3H98A 4XTTA 3PRBA 4EFHA 3W62A 3OHAA 1S4FA 3T41A 4BQLA 4WP8A 3VEYA 1Q8LA 3QRRA 3N5FA 3C65A 1MWYA 4JI3K 1F9FA 1IBLF 1S9GA 3RZAA 5LOQA 4TU7A 3CCLN 5AQVA 3ENVA 2L9WA 1YG0A 2QRRA 1ATNA 2J9DE 4Y1DA 1JCFA 2B7BB 1M90O 4U7BA 1LOTB 2UUBF 3IM8A 1OY9A 1IBKJ 1YI2N 2UXDK 1NGFA 5BPLA 3SUNA 3M1VA 3KWGA 1NBWA 4ID8A 6FD1A 4DPOA 2NSBA 1U8WA 3CDEA 3LW5C 3SBTA 1R89A 1X9MA 1TKXA 4DV2J 3WNEA 4NCGA 2A1RA 1S6PB 4U96A 4P2XA 5K5MA 2XY5A 5KFJA 2OEKA 1PJ7A 4NYNA 3ENWA 5J1EA 4Y0FA 3O80A 4DSEA 3IWLA 2D0OA 1LOUA 2RJZA 3HZGA 1RGIA 4DBQA 4TY9A 3Q2SC 4DR1F 2BTFA 1Q81O 2FTRA 2RSQA 2YY3A 3O3LA 1FJGK 2C2OB 2PN6A 3SJHA 3S41A 1HKAA 3AJ2A 3V1RA 2ZKTA 4R8UA 2G8UA 3HP6A 3DDKA 4J9MA 1LWEB 1WC6A 3P8BB 2FSKA 3EVMA 2Z57B 5B0AA 4DTRA 1QE1B 3MCMA 4DV1J 5IT9Y 4BQZA 3V9ZA 1TKZA 2V8DA 3KNGA 2POKA 4FJXA 2YKOA 1H7XA 1AA1B 2KT3A 4ZLJA 3EO3A 4KRWA 4KFBA 3DOKB 1BE4A 2HBYB 1LAWA 2V4RA 2F4VF 2M9KA 3QMQA 4KGKA 4IO8A 2XZWA 1R0CB 4JI3F 1HWUA 1QZ5A 3SDEA 1U45A 4N77A 4ED5A 3DXMA 2DR5A 1OY6A 2KYZA 3CCSS 4CLUA 1KAYA 1IXKA 4IKAA 2MQPA 3LAKA 4DX5A 5G4DA 5IZHA 4EHTA 2AA4A 1W9HA 2FC0A 1RDDA 2KDOA 2W42A 2GS8A 3ZT2A 1NDCA 3FNNA 2FSJA 4FS1A 4U8YA 1N48A 3CJCA 3ZETB 4DR4J 4JKEA 3OSPA 1T6CA 4C9DA 4GC7A 1HL6A 3V9WA 5AQUA 3K89A 2G8HA 4ELUA 4KTZA 4MFBA 4CFDA 3CJRA 1HNZK 4PWDB 4F25A 1M1KT 3MMAB 1C4AA 3JSYA 4B3OB 5B7WA 1NJIO 2OYQA 2W2OP 1FJGF 3KJVA 1HNWJ 1GLDG 1WSGA 3M2VA 1NGIA 1DBDA 5EWGA 1B70B 1U1NA 1K0VA 1YJWN 5F8JA 4EP5A 4ISEA 4GMKA 4K4SA 1MG7A 4ED1A 1EHWA 1VQ7N 2N7CA 2BW7A 3VAHA 3L3VA 4RNHA 2KL8A 2NXCA 4NLQA 4HHTA 3M6UA 3LAMA 1HI0P 2R7VA 3RMCA 4I9LA 4UOHA 3L7PA 4YHHK 2E20A 5E5NA 1Y4ZB 4BR9A 4CJPA 4ES3A 1KSPA 4FK0A 2PT0A 1O6XA 2CPDA 5L38A 3DXSX 2E7XA 3VMFB 2DR7A 4F04B 1ITGA 4M95A 4PL8A 4O44A 1S49A 3THVA 3MGJA 1UJ4A 2E5IA 4A62A 1S22A 1WKLA 1T9YA 2HFSA 1IO2A 1VSIA 4OHYA 2OSQA 2E9TA 1VYAA 1CJKA 4Y2IA 5HK4A 3G6YA 4DFPA 4ITSA 4BR5A 2PEBA 3O6QA 2O67A 4JI2K 4RLEA 2EFVA 2A6AA 3CMEN 1FFWB 2HQCA 2GWKA 1HNZF 2DGQA 1RBAA 3OT9A 4J37A 5H1SV 4YOUA 2NLWA 4GV9A 1FF2A 5HJXA 2QKBA 2ZDOA 2NYIA 5GAGU 3CXCR 1YJNN 4FBTA 3W5ZA 5GINA 1G3OA 1XN9A 4JI4K 2UU9K 3CWJA 2ZUAA 2CJXB 3J7A1 2ZJPQ 2OJ3A 2EK1A 2ZBRA 2P9LA 3CEDA 2IVOA 3MFHA 1FKPA 3ID6A 4C48A 1FWLA 5IM0A 1XR6A 2YWWA 4CYUA 1RAIB 1VLOA 3JS9A 3SMSA 2BANB 3LM9A 3NRBA 2JFKA 1VDHA 3BR8A 4LVOP 2FHMA 2E7VA 3CF5L 4YHHF 1WSIA 1X4BA 1TKTA 4DTPA 1DQ8A 1RADB 1HBUB 4YR3A 3IFEA 1YKWA 4J9KA 3NAIA 5B0DA 4CJWA 2AJ2A 3CFRA 3KXDA 4MKYA 2BQRA 2A3ZA 2V7YA 4Y65A 4KPCA 4QS8A 2VUGA 3V9UA 2MZRA 1B7FA 4ZPTR 2G0IA 2VBYA 5BRDA 5A6WA 5JLHA 4Q7AA 2X51A 3L2RA 3JYTA 5CHIA 4OZJA 3TZYA 2FLNA 4JV1A 3HJFA 4JNEA 5BYQA 4MQ3A 8ATCB 3WQUA 1IM4A 1CXQA 5HRSA 1C0UB 3QO9B 3ENOA 2CRLA 1MW7A 1WWHA 4OI1A 4CEAA 1S7HA 3B4DA 5KG2A 3M7VA 3CC4S 4CLTA 2V52B 2HGLA 5KFBA 2RU9A 1OSDA 1JJHA 4CT9A 2XMKA 4CH7A 1NJYA 1VK3A 2XRIA 1LW0A 1TP7A 3QINA 4CGGA 2E2OA 2WW8A 2F96A 3TSUA 1VSEA 4FDFA 3NGKA 2NPIA 5E41A 4A8WA 2UU9F 4JI4F 1GEHA 1VSJA 3SSRA 4WJBA 2G13A 2JWNA 3E01B 3FE1A 1Y5IB 3VQ7A 3HPHA 3QIPA 1RAOA 3FUYA 3HMJG 1QJHA 3CMAS 1RDAA 1YBTA 1IKYB 3DLGB 5E3AA 3J7AN 4TQSA 3OL7A 2DCLA 1U6BA 1ZM9A 3J81Y 1V4SA 1OY8A 1U1QA 1H2TZ 1ZPWX 2DGTA 2RKIA 1D9FA 1NNDA 1ZXOA 1HBOB 2IC3B 3BZQA 1Y5NB 5AQQA 3IR6B 1X1PA 3VQ9A 4R5PB 3NP5A 4EZ9A 1DTQB 2QLJB 3U8XA 4QIWD 2PDAA 1FNXH 2N4CA 3VTHA 3QGGA 3ZTOA 1SJ3P 2DNYA 2CQCA 1U48A 1J5EK 1KQKA 2ERRA 4Y2AA 4BVPA 5IWAJ 2R8HA 4CZMA 1U2CA 3LGNA 1BWFO 4A2BA 5K8MA 2JSXA 4AXIA 1GMUA 4C23A 3WXMB 3K5NA 3M9NB 2RIJA 3KNAA 1D4XA 3QNNA 2DFEA 3UD5A 2H3GX 1OVQA 4HI2A 2E1PA 3QETA 2GHPA 1YZ7A 5AQKA 5E3RA 4PPDA 5C7PA 1RLCL 3FFKB 5K8NA 4UTGA 3GPAA 3R5AA 3AHPA 1JLEB 1WHWA 3VTIA 2FDNA 4AL6A 4BE2A 1TL7B 4N56A 3MN6A 4IDKA 2VBWA 2AGOA 2AIRB 1I6JA 2YNGB 1EX4A 3DRYA 2KJWA 2LXFA 2MQNA 2BE9B 2R3VA 3KHLA 3HRGA 1FRIA 1REVA 2P9NB 3KK2A 2FLLA 1N5VA 4N8OA 2WOMA 2E5LK 1YSJA 1FK9A 3D2WA 3M6XA 1KLNA 2BKOA 5BXIA 2M8HA 2M2BA 1LAVA 4R79A 1JKHB 1F9EB 1Y5LB 2MZSA 5CE3A 5AQFA 3O1LA 4MYTA 1IWGA 1SV5A 1KKHA 1W25A 1LFWA 4CJVA 2J0QD 2RUSA 1U1LA 1A5WA 1UETA 3AD7C 2R7XA 2DGSA 4TSXA 3ZO7A 4FKYA 1H74A 4WTOB 5D4OA 2WTUA 2HHQA 2P9KA 1I5OB 1BISA 1GLBG 2EX3A 3WXIA 3BO3A 4K4TA 4B1ZA 1X4AA 3V5RA 4RW8B 3THYB 3D0IE 1F6TA 3VQSA 1OSCA 3FZFA 2QKKA 4HLBA 4P10A 1BI4B 2ZWPA 5EXWA 1V5IB 4BRDA 2R8JA 1NB2A 3W64A 4YR0A 3LDLA 4W5NA 1AUSL 1DQ9A 2ZEJA 4EMDA 5L39A 2BA9A 5T7LB 4DR4F 5E33A 3ET6A 4NYPA 2AGPA 4JEPA 3FGVA 2EPIA 1EB0A 2CJAA 3AQOA 4KO0A 5HBMB 1HNXJ 2D0PA 4WWSA 2FGOA 4I56A 5E2QA 4F3TA 2H5IB 1FWPA 5CZXA 1MROA 3N6MA 3AO2A 4U7UK 7FD1A 2XYHB 3DMJA 3RB0A 2QSFA 3PIPL 5HP1B 4CLWA 3DRPB 4X4PA 1WAFA 4URQU 3T1YJ 1HR0J 2ALYB 2CH5A 4ZPBA 4I9QA 2QWNA 2P5OA 1P90A 4CHZA 1FHTA 4ILHA 3TA2A 3CCMN 5KFVA 3POTA 4X62F 5J2MB 2G8VA 3MDFA 5BYSA 1HQEB 4P9SA 4ILRA 1Q95G 1S12A 3C66A 5F1XA 2RAQA 2HBRB 4M94A 2DHGA 3PYEA 3W2VB 3H4BA 3MAAB 2FB0A 1FI4A 4TN2A 2AJ4A 4IWVA 3BO4A 1Z05A 4CCHA 4DL2A 2R2TA 1U2VB 1VQ4N 3BF4A 3QEVA 2MQ8A 4KGXB 3VOVA 3CCQN 1TUVA 1S6QA 3U1NA 4ETZA 4DPUA 3TVYA 3O4WA 3PX0A 1NKBA 1NCLA 1HHSA 3UVJA 1OVYA 3UFCX 2W8KA 2E2NA 2O01C 1QDUB 1SJ4P 3BB5A 5GAHP 4M3WA 2DTUA 5BYRA 3GV8B 3NCIA 1IBMK 1EXQA 3GTYX 5AXNA 4CLZA 3M6GA 1KTQA 3G82A 4BC4A 1XMBA 4ECVA 2YHAA 1U1OA 3NL0A 2F9DA 5J2NB 4AT1B 4QW8A 4ER8A 3FC9A 4N5SA 2FLPA 4EBCA 3UE2A 3LM2A 1FNMA 6FDRA 3J7Z5 2BRKA 3OJUA 1FO1A 1J27A 2C2DA 3R5BA 1WUAA 4C8LA 3HI0A 1BA0A 1EARA 5JVHQ 2KHCA 2NREA 4CZEA 4YDXA 4DTMA 2HW3A 1JLBB 2C2KB 5LJVA 3VQEA 3R1XA 3NLCA 3JQKA 4OX9K 1U47A 3O44A 4GC6A 1IR0A 2IVNA 2E9ZA 3NVKA 3KZBA 1JIHA 3LANA 2KLAA 2CQ0A 1Y00A 3R5JB 5KFEA 3HT3A 5FPDA 3H40A 3AB4B 5F3TA 1S72S 2DIVA 4Y2MA 4WK3A 2QMXA 4I6AA 1XJWB 2LXUA 4FCYA 1N54B 2WBMA 5U47A 1FKOA 2E5JA 5F8LA 2CNOB 4AILC 4FWNA 3E1YA 1W26A 3TZXA 4BDZA 4ZVQB 3DLBA 4LFCF 4IG3A 1N8RT 3I4PA 1WD6A 1IBMF 4P75A 5CXTA 3HSCA 1WI8A 4CLYA 3VCDA 1NPKA 3H5YA 3A8EA 4BRIA 5LMNJ 2HMIB 1N4LA 2BXJA 5EDWA 2OH2A 3LPYA 5ETVA 2AT1B 3IN5A 3HOTA 3UDEA 3KD5E 3CJTA 4G1QA 3R1HA 2CJ9A 3CCSN 4QWBA 2DR9A 4CJUA 2WK4A 3DI6B 1WI6A 2YNFA 4H5WA 4E1MA 4P2FA 1NU0A 3DOLA 2BH1A 2Y1IA 5KOWA 4YNQA 1B9DA 3UWTA 1FJEB 1XK8A 2CQ2A 1UFLA 1S9EA 4OX9F 3B6BA 3OA9A 3HVTB 4WZQA 3BGRB 2A3JA 2XTJP 5CYMB 1XR5A 2IDLA 1VHIA 1ZBSA 3WNHA 2YHWA 2J0WA 1K8AT 3CXCM 1NU4A 2LFVA 4LRDA 1C1AA 2FZGB 1NK9A 4LF7J 2PGCA 4NOHA 1WN7A 1X3NA 4Y1CA 3CCUS 3NGDA 3ZZRA 1KC8O 4F3MA 3CD7A 5KOXA 1B4SA 2WONA 4ZP8A 1G1XA 2ZZNA 2RD5C 5IWAF 4CFCA 1EQYA 3KDNA 4Q0BA 2LQJA 5LMUK 3TVKA 3LO3A 4GNIA 3ZTPA 4B17A 2FVCA 4FWSA 1UW4A 4FJ7A 4WFNQ 3D45A 5ADZA 4DI6A 2WW4A 3BF3A 1D5AA 2RDDA 2GNKA 3HK2A 1S7IA 3R1LA 3TTCA 2HSTA 4FWKA 1X5PA 3OYIA 3MCSA 4MIAA 3E9PA 3O8WA 3N4QA 4BC9A 5DM6Q 1R7IA 3ADAC 1ZBHA 3VENA 4QS7A 3BGUA 1Z2ZA 4LFAK 1LFPA 1C1BB 3HD1A 4WKRA 1NNEA 2KHOA 2DY4A 2BDPA 4F67A 3N4PA 3UKRB 1X0PA 1Q7YT 3EE9A 2QYGA 3TWHA 2YPYA 1RT3A 4K4WA 4I0WA 1VC5A 4DV3K 2R9LA 2J5AA 4OYIA 2YNIB 4YP3A 1S5JA 1PYOB 2BM1A 3GIKA 3Q22A 5KRSA 3Q24A 5KFHA 1Q9XA 4P7VA 1HBMA 2CJYB 1XI1A 3BS9A 5JXSA 4BHQA 2E44A 3RU0A 3U7JA 2XS7A 1PC5A 4AQYJ 1CJVA 2CGKA 3JAMO 4LF9J 3O8MA 2JHEA 2I0XA 2YCHA 3D6FB 2UP1A 3A5OC 2HNDA 4CRJA 2FGCA 2FZCB 4I6MA 4XH5A 3T9NA 2XMTA 3DOMA 4LF5K 1BWEA 1HYSB 3UN5A 4BROA 2MLXA 1UKUA 2JLGA 3CULA 3MM7A 1E6YB 3MUTP 4ZKAA 3TARA 2RHKA 5IT9U 1NHVA 1N32F 3QEWA 1LWEA 4LQ3A 2G8WA 3SQGA 3MM8A 1RDWX 3G8TA 3ILIA 2CQDA 4ZS6A 4CEEA 2C42A 4DU3A 3GJTB 2VKRA 2DR6A 1TELA 4CF2A 3T1AA 3R2CJ 3NCRA 4IOBA 3THWA 2H51B 2FC9A 2NXUA 2EEYA 4LRFA 4FS2A 4NI2B 2W24A 1CBKA 4CM2A 2NSCA 5AQPA 2B8QA 2UUTA 2OMLA 5E0OA 1HPMA 3ENQA 1T7PA 2XY6A 4LFAF 3BQ0A 2AD9A 2YKMB 2DNKA 4A46A 1LEOA 3V81B 3T1YF 3WUHA 1P1LA 3E2EA 2AW0A 3P5TL 2XMAA 1FCAA 2FQQB 1REGX 5HLFB 8RUCA 4E3SA 5H9EJ 3QGPA 1NSKL 5M1PA 4YOEA 5LM7E 2RQKA 1DURA 1PAEX 4ZMMA 4CIEA 3I55N 1RT1A 3WIVA 4B3TJ 3RWUA 2DGVA 4LF4F 4C0OC 3J80O 3ILJA 5BRFA 4N41A 2ZDPA 4CEFA 2M52A 1GOCA 2WVDA 3PJWA 5GMKa 4CGJA 1RT4A 3CC4N 2XHCA 4DR5K 1WNEA 4BG8A 4DUTA 3MMAA 1WF2A 4B3MK 4Z7CA 4AF1A 3QFUA 4NZ7A 3IR7B 1DGKN 5SUHA 1VC0A 1R8BA 3OLAA 2YNHB 3UPFA 2V50A 2HF4A 2Q3PA 3V9SA 3Q83A 4CO4A 3BEXA 1OMSA 3EUNA 1VS3A 3DM2A 3T5LA 1YUWA 4GKJK 4ETXA 3CMAN 4BC7A 4MK7A 1BMQB 2Q97A 4NLRA 2HRUA 3BPSP 4YOTA 4L72B 5HO4A 4DSJA 4OYWA 1HJOA 2NRXA 3AOAA 3DLEA 1EETB 2HHUA 4E7JA 3UN2A 2CQ1A 1S0VA 2AEFA 3WDOA 4LRAA 1ZA2B 2XSJB 3LP1A 4OPJA 1C2PA 4C0BA 2OLWA 2HNYA 2MQMA 3TAQA 1WTFA 3K0JA 2OMOA 2A6MA 3QEIA 1D3WA 2KFZA 4LREA 1JX4A 3O1BA 4DUYJ 1TV6A 4XAKA 3WIUA 2ZFHA 1RYSA 1HLUA 3ULEB 3LF0A 3LGMA 4GKKF 2XM3A 3BSAA 5L9NA 4HTIA 2P9EA 4DOZA 4CJ7A 3L2VA 3TAEA 3D1QA 2J0SD 3VGTA 3D2EA 4OZNA 3HYFA 3VQ8A 1KQFB 4EFAC 3GIIA 3SQOP 3F2KA 3M8RA 2I8EA 5KFGA 2ZHOA 1HKBA 4ZCLA 4M5GA 4CFAA 1U0HA 2NS1B 4B3MF 2IDEA 5AJ3J 4WF9L 1K6YA 3EICA 5BR8F 2EFOA 3A1YG 3KLFA 1RT5A 1KTVA 3ZSZA 1HWJA 3B6PA 3U3YA 4DSIA 3A5MC 4QWDA 4FXWA 4ED3A 3V4IB 1ZTWA 1E6VA 3MN7A 1VIXA 2IVFB 1S1XA 1HHTP 2I5JA 2CG8A 1RAHB 3BDEA 3AAWB 1RJJA 2FUG9 3KLIA 4EO6A 4BGBA 3RBZA 5E3PA 4KV8A 1HBUA 1XR7A 1FVQA 5CYJA 4O3PA 1UMJA 1EKRA 3PV8A 4FWPA 1BL3A 5L1KA 1U2RA 4WQ4C 1SL1A 3BBCA 1RZMA 2MZ1A 3UD4P 1U7LA 2RRAA 4W4MA 2Y0BB 2HS3A 3GFZA 2O8EA 1ROFA 3TEGA 1QHTA 2KI2A 1TL3B 4CJ5A 1NK7A 4MKBA 4BCAA 2FPHX 1RBTA 1UZHA 2MTLA 3EE8A 4O4GA 4FXDA 2UV8A 2DJWA 1WOQA 3NMRA 3CC7N 3QNWB 2WVCA 3F41A 2FC8A 3LOUA 3M5RA 1CQMA 4OPHA 3PRDA 3AOCA 3CQ8A 4LBPA 3UO0A 2D0AA 4ZJLA 3G8SA 2EG1A 1IKXB 5F0XA 3JSMB 3IA0A 3NGUA 4HDGA 2Z2YB 2VQEJ 2O3DA 4CJFA 4JAXA 1UL3A 1FRJA 2RE2A 2CPZA 3QJPA 3C6AA 1F5AA 2HRTA 1Z1ZA 3VAKA 1RFQA 4RW9A 1OWXA 2P9IB 4DV4J 2IM2A 1CJUA 5LJ5Y 1S59A 4MJKA 4HACB 1IWAA 4X4VA 1OH6A 3E01A 2C3YA 4DTOA 3AXKA 4JKAA 4P72A 3ZTQA 1S6UA 2HFNA 3EEQA 4B9UA 2I6WA 4USKA 2Y9HA 3DU5A 5C42B 2O8BA 4QYZJ 3A0IX 4X84A 3HVRA 4ISGA 1WC1A 1TAUA 4C7QA 3DWLA 1RTDB 4YUDA 2B4JA 2CXEA 4EBEA 2GIRA 1N5TA 3N5BA 1J5OA 2W2QP 3VWSA 1RWXB 2WSEC 2W9CB 1ESVA 1KONA 2DY9A 4A59A 2N7YA 2BABA 1XHZA 4LC9B 1F2HA 4LF8J 4CZJA 2FD2A 1WC4A 4N7TA 3MEGA 3EXYA 4ZCMA 2BACA 1UTAA 2ZWHA 3AQPA 5C5JA 2QV6A 5ADXH 2JOQA 5H9FJ 2KM8B 3SEOA 5B09A 1VQ6S 4OZ5A 1W2BR 2UUWA 3FQKA 4CP5A 4ECYA 4CO5A 3D3BJ 3VF6A 2FF6A 1UVLA 3DLHA 1UPPA 5AXKA 4JK7A 4ZVFA 2ZM6J 2V7ZA 2HZVA 2E1CA 2MLYA 3I56S 4X65J 4NXMK 4J9UE 2ZE2A 3QNOA 1NHKL 3CSKA 4RL1A 3LP0A 3MPDA 5CH7B 4DV1K 2X1BA 1RHRB 1T9WA 3PJ9A 1TL7A 2F65A 1PGZA 3WXLA 5KQ8A 2B5JA 1K44A 1SC4B 3OR2A 1RT6B 4QS9A 2APOA 4RNOA 1MWQA 4WFXA 3TP2A 4JI8J 3M8QB 4WFAQ 4X66K 3R3TA 1JNRB 4HVZA 2C22A 5DM7Q 1RTIA 3VVTA 3O9TA 2W40A 1WC5A 4UUWA 2O8DB 2GV9A 2QN6B 4EGLA 3BR9A 1BCOA 2AP6A 1RTZA 4QYRA 4ZITA 2YH0A 4BG9A 4IG0A 3ZT0A 3GB0A 2Z1HA 5LJ3Y 2FJVA 2DISA 3W0LA 2BQ3A 1F60B 1KRPA 3B8HA 4KPYA 2WRMA 4W5TA 3DLKB 4LF6J 2DNOA 2Q66A 1L5UA 1O13A 3R5CA 2ITMA 1NGEA 2QTDA 3N6NA 4BRKA 1GXUA 4H54A 3L2WA 3CJQA 1VJQA 2X1AA 3C7NB 3PXGa 1XERA 2ZC3A 5F8MA 4BRNA 1BLUA 1S72N 2AJ1A 5KG1A 3UR3C 4OFZA 2RILA 1L3TA 3Q23A 1EQ0A 1DLOA 4B9VA 4JS5A 2HLTA 3WEEA 5AZJB 2RT3A 3BN4A 2X6NA 2BJDA 1NJWA 3QJLA 1UAWA 2GAHC 4CGFA 1NHUA 2CQ3A 3CJ0A 5A8WB 1VQMS 4OGEA 5HAOA 4RBTA 4X64K 4NXMF 2GVDB 5DRKA 3ZZOA 3ZZYA 2E5GA 4XH4A 3CJ9A 1NG9A 1RTHA 4KGZB 3MCNA 4CK1A 5GAEP 1VBKA 2C3MA 4MH8A 1RAGB 1I3OB 5GAHI 5JS1A 1X4HA 3M9OB 1JWWA 1R0AB 2OI2A 2OTJN 2ETJA 1DQAA 3BBBA 4OKEA 1H1VA 4WFZA 3PZPA 1N0UA 4FW2A 4K5RA 3EXCX 3QICA 5HATA 4IFYB 3KK1B 1ZPVA 2YVSA 2GEMA 4CZFA 4CGIA 1JXLA 1HD0A 3CE8A 5AE1A 4UZBA 3RRKA 4RR5A 4HH1A 5EN1A 4ZCIA 1JCEA 5J2MA 2BM0A 2VA2A 2P5VA 4AHRA 1TL1B 2IIHA 2GQCA 4RW7A 1U1MA 4J2AA 5MLCQ 3JSBA 4DL3A 3P5BP 1DJ0A 3CCUN 1L3KA 4CHPA 4F50A 5GIOA 2YX7A 1SZ2A 2AEMA 1U2VA 4OYBA 3SIPB 4CEZA 5BN9A 4HCCA 1MN9A 4ZP9A 3QFWA 2BQUA 3HPGA 2XI3A 1PBUA 2B6AB 1FD2A 3F9MA 2VV5A 3OVNA 2HBZB 3C3LA 2B56A 3O3FA 1WB9A 1AZSA 3H2UB 4PKHA 3C14A 1ZBTA 4DQRA 4WYBA 2WZ1A 4X64F 2ASDA 4OJGA 4S0MA 3OYLA 1UAXA 3PRVA 2IS3A 5C0YA 1A7GE 3GG1A 4R0EA 2HHXA 1S9GB 2JEFA 2JGUA 3PEHA 4MTPA 1GNKA 1K73T 1YK9A 2QO3A 1KVCA 2EW9A 2FJDB 1TZ0A 3G71N 5SWMA 1MDUB 3SUOA 1FXRA 2HVEA 4ZN1A 5B0GA 2RN2A 4JI5K 5IT0A 3M1VB 3GYNA 4RW6A 3EDRB 1VQON 1WKJA 5AFUA 2UXCJ 1EAYC 3VGMA 4M5MA 3U1MA 2G1DA 1U49A 4L73A 1TKXB 1PCAA 3NS5A 5KQDA 1HBNA 2XGQA 4CBWA 1M5HA 2DXDA 3QIDA 3VPZA 3PX4A 2ZJQQ 3A3PB 4K41A 3SUQA 5FLXO 4FM1A 2W7PA 5J1EB 3VA0A 3UN3A 2PFFB 4IOXA 4E89A 2Y8YA 3GV5B 2DHAA 1UEVA 3CGIA 2JX2A 3HBTA 4R8UB 3M4XA 1CC7A 1NJXA 2ASMA 1NDPA 2JFDA 3QSIA 2DHXA 3IG1A 5ITHA 3CFPA 4F9OA 5AQNA 3ZCMA 1RWKB 2PC6A 5HJYA 3FK4A 3K2PA 2KXNB 3VN5A 4KFBB 4PWWA 4ZVGA 3C16A 4DV0J 4IJNA 2ATLA 1RU1A 3VF0B 2H1YA 2CPYA 4U67Q 2EBGA 5C15A 4FJ8A 3S3MA 3HHLC 2OKQA 4DV4F 3SDEB 5F8NA 2HBLA 2A41A 3DXMB 2IHR1 2XQCA 1GTHA 4AUKA 4PL7A 2XMJA 3Q0AA 4DTUA 4CEDA 3KKRA 1HUXA 4RU9A 4DV7K 4CECA 3AAPA 3NAHA 3GQCA 5IFMA 3N28A 2QSWA 5B0FA 4JI5F 3VEOA 4IEEA 1LCUA 3H5UA 3W8PA 2UZAA 1I39A 4LT6A 4P2MA 3B8AX 1DZ5A 3D7EO 3ZX2A 4GVLA 3L8BA 4QIVA 5DQGA 4CLPA 4DTXA 1CG2A 2B4OA 3D1OA 3TX0A 3VAMA 3LL3A 2MKKA 4DV5F 5G0RA 4MFBB 5D4PA 3OYHA 2OSRA 2RMLA 4CZLA 3BJYA 4C8ZA 1CS4A 1NEEA 2QT7A 3BN7A 4CZKA 1B9FA 3KJVB 2VG5A 2MZJA 2X74A 2AGQA 3U1LA 1HHQA 3M2VB 4FWRA 2A6OA 3SNNA 2KH9A 1H73A 2CQBA 4FBUA 4O8KA 2GMJA 4BBYA 2ZM6F 5HOOA 4C2MA 2HVIA 3MD1A 4N47A 2BX6A 3AAQA 4LIRA 1X4GA 4FYVB 1N34K 1Q86T 1VGYA 5DK5A 3BZCA 1S3XA 2MSTA 3S8SA 4K59A 3OXGA 2NLXA 2C2RA 3HSDA 4LF2A 1RT7A 2DNGA 1QAIA 5JICA 3JAMY 2VG6A 5D78A 3DDNA 4ZP7A 4DV6J 1OQ6A 1MU2A 1Z4UA 3MAHA 1FE4A 2UVVA 4OI2A 3W2WA 4FLWA 4AM6A 2DCUB 3RBXA 3OFFA 4LFBJ 4BRHA 4USMA 4Z37A 3KWMA 4DV7F 3ASMA 2LSNA 4O44B 4TYBA 4A48A 2W25A 4W5RA 3IXQA 2WC9A 5KFWA 2FIUA 3LP3A 4PXDA 4DZ6A 2R7YA 3PACA 4N8NA 1BOTO 1CJKB 4L6V3 1SXLA 4DR7J 3SLCA 5MAOA 4FOIA 3M8ZA 9ATCB 1E4FT 1WDTA 3GYGA 4LF1A 2CJQA 3UCGA 2JLEA 3BKTA 1FDNA 2XHBA 1FFGB 5AE3A 2QK9A 3FBCA 2P1JA 1SH2A 4J7CA 2FZKB 4QBUA 2ZGYA 3MR2A 1XNQJ 2DNHA 3VGKA 3QB0A 5DGBA 4DFJA 2P9LB 1BDGA 1FKPB 1N34F 4B1WB 3G4SS 5DDOC 3FR0A 5IM0B 1N36J 1OO0B 2B7CB 4DSLA 4KIAA 1R8AA 4AD6A 3NGZA 2O4IA 3FEYB 1YITS 3F44A 2XLJA 1TKTB 1SQFA 3NHGA 3RGIA 5I42A 3SMPA 4QR0A 3PR4A 4B3SJ 4MDAA 2DNPA 3FCWA 5IS2A 4L8RB 1VQPN 3KIOA 2J7KA 3ISNC 3UB5A 4DL4A 5KT5A 4I2PA 4ZP6A 3JYTB 1FXDA 3FVYA 4QQBA 2WBRA 1JJ2M 3EZ5A 3I33A 5KG6A 3TO8A 1JCGA 4HH0A 5LY3A 1X5SA 3C94A 2F1FA 2HFVA 1UOCA 5D0RA 2C3OA 4FOEA 2F40A 1TUWA 5CABA 5F9NA 2VZ9A 1J54A 4QPTA 1SH3A 5D0HA 4ENOA 2V67A 2KT5A 4DSKA 3BZKA 4HCBA 2Q0RA 1LW0B 2W4DA 2WSFC 3WNFA 4F8RA 2COLA 3IRXA 4K25A 3IWXA 1Y97A 2RRNA 5ADXA 3NNCA 1RP5A 3R6MA 2BGGA 3D4JA 1H0HB 1OIAA 5AZIB 3CHWA 3MMCA 2CDQA 3H90A 3QIPB 2DNRA 1VQ7S 2PBDA 3CJSA 1Y0HA 3PYGA 4H0PA 4JI1K 2GO9A 2RKIB 4ZVHA 3RW6A 1NJZA 5J2PA 2A1BA 4USIA 2OEJA 3BYPA 3Q8SB 3CNQP 3QFHA 1RWWB 5F3ZA 2E1YA 2JJ4D 2OD4A 2XSJA 4IYQA 5I3QA 1NGDA 1VQ6N 1R31A 4ELTA 2OPRA 1D8ZA 1URNA 1C6VA 2ATCB 4FWLA 5IV3A 2HSEB 1SQGA 1FJCA 4AHTA 5GADI 3DDIA 1LW2A 3EJMA 2EFGA 2HHVA 2N82B 4RUBA 2E6MA 2AKWB 2R8IA 3CCRN 1PBAA 1SC1B 2QM1A 4G1IA 5KFXA 1VR6A 2Q2RA 2CQHA 3BM7A 3OL9A 2X3DA 1OPIA 4EBDA 4EWTA 1Q82T 2H48B 3EZWA 4H0VB 4CJ4A 4LR7A 3C6TA 1FD8A 3AO1A 1TTHB 4TU8A 1W97L 3HTVA 3I0SA 3HLUA 4IDKB 1WG5A 2ZOGA 4IH5A 4MMOA 5JMNA 1IBLJ 1UP1A 1KVBA 4O8UA 1VFJA 4MO5A 3ZLJA 4KI4A 3GIMA 2X78A 3BGFA 1REVB 3KK2B 1JMTA 5LMNK 5EX0A 4FPIA 2QWLA 2WOMB 1FK9B 3D9BA 1T3OA 4ZLPA 4NLYA 2FY8A 1NMDA 4PZVA 1NB7A 5KFFA 4LUBA 4DV0F 4KH0B 1SV5B 2CH6A 2KZMA 3LPEA 2KTQA 5KFRA 2VFVA 5D0EA 4LR8A 4FYYB 3AVGA 2H9ZA 1IN0A 1CULA 2QJ3A 3TSPA 4J2DA 1UA1A 2P9KB 2HKEA 1NKEA 1VCTA 3PG9A 3JTPA 1WHXA 4ZN3A 4Z7YA 4EIAA 3LPUA 4OGCA 1XMOK 1LWXA 5A0YB 2Z1GA 2PSZA 2BJ7A 3T1HK 5M2RA 4RWTA 4Z2XA 2VF3A 3MCPA 1TFYA 4DR1J 3MCAB 1IR2A 1KFDA 1BUPA 4JLHA 2Z56B 2MJUA 1FX4A 2XCAA 3LQVA 3RUBL 4GVEA 4F4ZA 3ET6B 2CPJA 1R8PA 2HBJA 1VQMN 1NOZA 5HQ8A 4KO0B 1HW9A 4JI0F 3KD1E 4J9VA 2J9DA 3NS7B 1MROB 1IR1A 2XHWA 3CCVS 4RUCA 2RRBA 4KB0A 1N5QA 1KVAA 3IBCB 3V1QA 4JI3J 4DN0A 5LSOA 5J1PA 1APSA 4DR6F 3KK3A 3MMBA 2V51B 5J2QA 1BGXT 4CIGA 3DMJB 3GWCA 1IUJA 4J8FA 3O3GA 1QVFR 3VEWA 1HIYA 5FD1A 5A2QY 2G2OA 3CDBA 2EC2A 1LXNA 4PYDA 4Q5VA 1M5KC 2IM0A 2ASLA 2JWLA 3BH7B 4HT5A 4DCJB 4CIOA 1M90T 3KJFB 3WZ0A 2GHVC 5E84A 1ZM3A 2X6SA 3POTB 3IMQJ 4RWWA 2DGXA 1BQXA 3OTBA 5DGAA 2LP4A 2JL9A 1K9MT 1HD1A 1X4DA 3O1WA 3SPYA 4NYZA 4HT7A 1G15A 4DPTA 3WC0A 4AQYK 1EQMA 2A42A 3C15A 3R8EA 2ZH3A 2OEMA 1XMOF 5B0CA 2ZZMA 1R3NA 2DXFA 5GMDA 4HR2A 1FJGJ 1S6QB 2P6SA 4U95A 3OJSA 2DHHA 4OLOA 1EKSA 4DDFA 1PIEA 1UA0A 2IAJA 4L3NA 5ETQA 2Q1NA 1Q81T 1KP6A 1NGJA 1RK8A 4RG8A 3HFZB 3HSGA 3UVJB 3T9ZA 3MM6A 5A8RA 1BHLA 3SSQA 3IP0A 1CVJA 3NY0A 4UY8T 2F63A 5D4LA 1WG1A 2V2KA 5AQSA 4G9ZA 3G82B 3R6LB 1OYDA 3X1LB 4DHYA 1ATSA 4DTSA 4ILMA 4FL9A 2G0JA 2OIHA 3CCJS 4KKOA 4IH7A 3G8QA 5RUBA 4FJHA 1CSJA 1XNQF 4OZLA 2R7UA 3P1GA 5GAEI 1SKWA 4RTFD 4KHQA 2O8DA 1WLJA 2QFIA 4ZLLA 1SC3B 2ABYA 4PXCA 2CZ4A 4LSLA 4TY8A 4JI7F 3HF5A 1BUXA 1RWOB 1ASVA 1FEHA 2IJNA 4IH6A 2CFXA 4XPCA 3K5MA 1TK0A 4UOFA 5H9EK 3DLKA 2ZJRQ 3M6VA 2ZJPL 5DLGA 4DSFA 3PJXA 4JKHA 3S6EA 1RDCA 3AARA 2RNEA 4WCEL 4CK3A 4KBOA 1TU0B 1HNZJ 1RE1B 5KT2A 3HHKA 4ZVUB 2HBQB 1B0VA 2MY7A 2CPEA 1FKOB 2A5XA 3QT7A 2YJEA 3KVGA 1A5XA 1BIUA 3MN5A 1NJIT 2NUHA 3W5YA 4UQGA 5A8WA 1BQNA 1Z6RA 5BREA 3MPUB 1KHWA 2CGJA 4IG3B 4KH6A 2WVBA 3TA1A 3RBEA 1FRKA 5C10A 3N6LA 1D9DA 4OV1A 2OHDA 5AT1B 4H8KA 3UE5A 2ZD1A 1S77D 1NMEB 2ROPA 1GH8A 1H72C 4ZJQA 3ZEUA 5KPRA 5JVGQ 2VU5A 1LWFA 3MWBA 4YHHJ 4FVCA 4L3KA 3TAMA 2FBYA 3H4DA 2AP1A 4FLTA 3F56A 4G1QB 2V2VA 1TVRA 2YNFB 2LDIA 1BA1A 5D4NA 3DOLB 5HQMA 1X4EA 2EWHA 3O2IA 3TUIC 5EGYA 7AT1B 1N52B 2H4WB 3H1VX 2JDJA 4DUZK 1S9EB 1B3TA 4A8SA 1HMVA 3EPGA 3E51A 3AGKA 2XBPA 4FYXB 2UUCF 4DUYK 4FPRA