4I2PA

Crystal structure of hiv-1 reverse transcriptase in complex with rilpivirine (tmc278) based analogue
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
554
structure length
554
Chain Sequence
MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A comparison of the ability of rilpivirine (TMC278) and selected analogues to inhibit clinically relevant HIV-1 reverse transcriptase mutants.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Hydrolase, transferase/inhibitor
molecule keywords Gag-Pol polyprotein
total genus 155
structure length 554
sequence length 554
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4i2pA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4i2pA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4i2pA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4i2pA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4i2pA05
1IKVA 3OJUA 4LSNA 4KAIA 4FJHA 3OYNA 1Q9YA 3LDSA 4O3OA 1RBSA 4J2AA 4ZVGA 3DRRB 2G8IA 5DLFA 4F8RA 5HBMB 4K4TA 3RAXA 3DYAB 3DLGB 4DTUA 4CIGA 2WB4A 1RBTA 4FW1A 4DTSA 4KHNA 3OYKA 3VQDA 2YNIB 4EYIB 3L2WA 3N6LA 3G6XA 1N5YA 1RT6B 3ZSVA 3IGVA 3S3OA 1HQEB 3GIMA 3NAIA 1NHUA 2WTFA 2W9BA 3CJ0A 3PV8A 1BQNA 1T03B 4KTZA 4ECYA 2BQ3A 1IKVB 4CJRA 3WNHA 3LP2A 1HRHA 2P5OA 5D3GB 4AHUA 3LWMA 1LW2B 3OS1A 2AQ4A 1CZBA 3DRSA 2AGQA 3SJJA 1KLNA 1QQCA 4CGJA 4DS4A 1C1BB 1S1UB 4HHTA 4KHYA 5EUHA 2D3UA 1C1CB 4FJ9A 3PR5B 3ZSYA 3LWLA 3KD1E 4FJXA 4WZMA 2RPIA 3MFIA 3F9KA 4IRCA 3OSNA 1HMVB 2ATQA 2WOMA 3HPHA 5KFQA 4DL6A 1XHZA 5F9LA 3QEPA 1L3VA 3M8QA 1RT5B 2X74A 3OS2A 4EP4A 3G6VA 2R8KA 3KLEB 1QTMA 1JLBB 2YHAA 4G3IA 1HQUA 4NLDA 4TQRA 1U45A 4MIBA 2AGPA 5F8NA 3NDKA 3BSCA 4NLYA 1UWBB 2E9ZA 4Y1DA 1NNDA 4EO8A 1G15A 2QV6A 3V9SA 3RBDA 5KFPA 3IAYA 3QIPB 3OLBA 2IGIA 4M3TA 1RBVA 1RA6A 4IG3B 1S0NA 3FDSA 3V6KA 4OVLA 2JGUA 3I5BA 4CEZA 4MIAA 1S6QA 5C42B 3RMDA 3VQBA 3OL8A 2FJXA 4NLXA 4ECTA 5C25B 1RT2A 3AVJA 4YQWA 2VG6A 1S1VA 4E3SA 1N56A 1TV6A 1UWBA 1RTHB 4EZ9A 1JLQA 1VSFA 4DF8A 1JX4A 3H98A 4ECVA 4LY7A 3ZSZA 4F2RA 3AO4A 2ETJA 1TAQA 4HYKA 3RWUA 3BDPA 1X9MA 4DSKA 5KFWA 4EP5A 2C2RA 4H4MB 4KB1A 1IKXB 3M9NB 3AVCA 3KJVA 4OGEA 4ED2A 3HVTA 2HVHA 3T5JA 3AO1A 3AVAA 4J2EA 2B6AB 3GIIA 4I2QB 4BWMA 3SYZA 2WONA 3NF8A 3T19A 4M42A 4FJMA 1RT1A 5DQHA 1LWEB 4LSLA 4CFAA 1JLEA 4I2PB 4OKJA 4DTNA 4B9LA 2F8SA 2HHWA 4LQ3A 5KG4A 2QKBA 3MR3A 4B8CA 3K59A 1IKXA 3HVWA 4KREA 3GYNA 4M3UA 3NAHA 2W7OA 4Q44A 4DFKA 1UA1A 2FJWA 3ITHA 4CJ5A 3QYYA 4FJIA 1YT3A 4JUZA 3P1GA 4C8MA 3ZT2A 4ECRA 4BE2A 2FLNA 4NLPA 2XRIA 3SQ4A 3ZT1A 3QZ8A 3VA3A 3DRRA 3RB4A 4Z4CA 1VSHA 4F2SA 1LAVA 2HNDA 5CZ2A 2OPQB 4Q45A 1S9GB 5C5JA 1GX6A 3IS9B 4RNMA 1L3UA 1RA7A 3RRGA 4ECWA 1S49A 3C6TA 4ZVFA 3Q8RB 4O0IA 5FRNA 2XCAA 1CLQA 1HNVA 3KLHB 4CGHA 3VQ7A 4C8LA 3DLRA 4RW8A 5KFNA 4M45A 1TKDA 3AA5X 5KFJA 3AVLA 3RBEA 1SH3A 4QCLA 2BE2B 3LP2B 3OHBA 4J9QA 5HLFA 3QEXA 5KGXA 5KFTA 1ASUA 4CE9A 4Y34A 4DWIA 2VG7A 1KVBA 5FRMA 3OY9A 2OPSA 3AVBA 3NGZA 4YNQA 3RB0A 2JEGA 3B6OA 4DQQA 2HMIA 2UVUA 4KHWA 5J2QB 3LAMA 3OL7A 3FQLA 1BCMA 3VQ9A 1ASWA 3AA2A 1RDDA 4XO0A 2FBXA 4TY8B 1RDRA 2R2SA 2PZSA 3K2PA 4YR2A 3UDLA 4K4UA 3CO9A 4NCGB 1WAFA 4EYHB 1HNIA 2QXFA 1EETB 2R8HA 4OPJA 2FVQA 4CJWA 3NH2A 1YVUA 4J9KA 3MXMA 4I9QA 3AVIA 4WFXA 4CJSA 1R0AB 4DMNA 2HHQA 1U48A 3VN5A 1U49A 3KIOA 4DFMA 1FXXA 4DL3A 2AU0A 5DK5A 3A2FA 3K5OA 2IAJB 1FKOA 3KK3B 1FK9B 3DYAA 4ED8A 4GC7A 1RT4A 4FJNA 1WSGA 1HYVA 4FJ7A 1ZTTA 2AJQA 4AHTA 3K5MA 3QIOA 1QAJA 4RUAA 1D8YA 2FLPA 4IKFA 2BRLA 3WNEA 2GIQA 1EP4B 4RNFA 1MU2B 4CESA 4B9SA 3V1RA 2YKNB 1RCHA 5CZ1A 4MKBA 3EPGA 1S6QB 4TSXA 3WNFA 5DLGA 3RRHA 4O5BA 1JLQB 4ED6A 4IFVB 2D5RA 2XI2A 1NKCA 3VQQA 2DY4A 2FVPA 4Q0BB 1SH2A 4O3RA 2RKIA 1IG9A 2Y1IA 5KFZA 3M9MB 3HJFA 3FQKA 1GOBA 3LAKA 4PUOA 3KJVB 2QK9A 4KTWA 3MFHA 5C24B 3H5XA 3QGGA 3IRXA 3CQ8A 4OLBA 3UR0A 3BSAA 4HUFA 2KQ2A 1C6VA 4DU3A 3SUNA 1U47A 1JXBA 1HQUB 4O3QA 4ZMMA 4RNHA 4FLWA 4DFPA 1VRTA 4RU9A 3GV7B 2QKKA 4G1QB 3FRZA 5DG7A 4J9MA 3U3GA 3QNOA 3MEGA 3M9OB 1NKEA 2CKWA 3IN5A 1D1UA 5EWFA 3PW0A 4E7KA 4Z4EA 4RW7B 5JUMA 2Z1GA 4F3TA 3OYAA 1ITGA 4DTPA 5I3UB 1T3NA 4O3SA 4NRUA 2YNFB 5KFGA 2AX1A 3V4IB 2OPQA 3OS0A 3V6DB 4JV0A 4KPYA 4I7FA 3AO5A 4C8KA 2HNDB 4K4XA 2G8WA 3FFIB 2HNYA 4NLOA 1S0MA 1ZBUA 1RTDA 3MEDA 2A1RA 3K5NA 4H4MA 4Y2CA 4N47A 3HVRA 2BQUA 2P1JA 3JSMB 3HM9A 3TAMA 1HYSB 3HYFA 1C0MA 3QNNA 2Z1IA 3V9XA 3SZ2A 5HLFB 1RYRA 2VG5B 4DSLA 5KFAA 3QINA 3GIKA 2FLLA 2HW3A 3QESA 3L2VA 2W42A 2V9WA 3KLVA 4ID5A 3Q8PB 3H59A 5FDLA 4DQIA 4M3ZA 4NZ0A 4DFJA 4CK1A 1NK4A 1K6YA 1VSEA 3GILA 3PW2A 4QW9A 4BWJA 3TABA 3H4BA 4Q8FA 3CDWA 5KFXA 2HVIA 2KZMA 5J1EB 3SCXA 3RMBA 3DOLA 4FM1A 1R0AA 2DTUA 4WE1A 1LW2A 4CF0A 4BDYA 2IM3A 5L9XA 5DG8A 1WNSA 4M3YA 4CGDA 1UOCA 4TXSA 3KLFA 3KMQA 4KKOA 3PJXA 2XCPA 2XHBA 1KVAA 3LP1A 3ZCMA 1T7PA 4NYNA 1KVCA 1WSHA 3AO3A 4FZXC 5L1JA 3OYHA 1XR7A 5KT6A 5DG9A 4FS2A 3SQ2A 2YNGB 3DLHA 1MU2A 4QWAA 3I8DA 4KFBB 1N48A 1KHVA 2ASJA 3F73A 1KCFA 1WSEA 3KOAA 2XC9A 3RTVA 3T3FA 4O4GB 3HL8A 4R5PA 3AVNA 4RG8A 4CFBA 1XWLA 1NHVA 4CCHA 2RF2A 3GIJA 4YR3A 2OPPB 1DLOA 4Z4FA 3AVKA 1CSJA 3H40A 3NF9A 2ZD1B 4IBNA 1VRUA 1JLAB 4F4KA 4KTQA 3DLKB 4FZYA 3VQAA 3MEEA 4CJLA 4DSJA 4IR9A 4ED1A 1WN7A 2OZMA 4KRFA 2D0CA 3T1AA 1K1QA 5KFYA 2W9BB 3BSNA 4IH6A 4B9UA 1QE1A 1T03A 3P83D 1OS5A 2XY6A 1RTHA 3T5LA 3EZ5A 3OYBA 5KFMA 4NLQA 1GX5A 4O3PA 4W5OA 1VRTB 4N76A 4MK8A 4ZPCA 2X6SA 2OA8A 2FC0A 1SH0A 4RNOA 2W9CB 4K4VA 2PYJA 1S1UA 5HP1B 1DTQA 1Q8IA 2D41A 4CEAA 4ELUA 1EXQA 4W5TA 3EPIA 4RW4A 4DL2A 1JIHA 5T14A 1LV5A 3KHHA 4LH4A 3D28A 3V4IA 4C8OA 3KHGA 4EBEA 4ZHRB 2R8JA 4QOZB 3SNNA 3V6JA 2IM0A 1TK0A 4ZP7A 3O3GA 2YNFA 3M8QB 3P5JA 3RB3A 4CGGA 2AX0A 4I2PA 2R2UA 2O5DA 4ZP8A 4HVJA 3ZSQA 1S6PA 2HHTA 2HWIA 2HNZB 4Q0BA 1WLJA 3CFPA 2RKIB 3PHEA 3ZSXA 4DTMA 4U6PA 3BSOA 4DQRA 4FCYA 4IG0A 3PR4A 3HP9A 3SUPA 1K1SA 3TI0A 4CIFA 4ZP9A 1X9WA 3MR5A 4CJQA 4M94A 3PVXA 2GV9A 4E1NA 4HTUA 3NH1A 2G8KA 4KO0A 1I3AA 3DRPA 4OGCA 1NK5A 2NUBA 2JEJA 4URGA 4ED0A 3N6MA 3SPZA 2FBVA 3BGRB 2I5JA 4IDKA 4CHQA 4IOBA 3NE6A 1T05A 4FLXA 4ID5B 4DSIA 4J9NA 3G86A 3KNAA 3DOKB 2UUWA 2V4RA 3PO5A 2DFFA 5EWEA 4HUEA 2EHGA 4J9OA 1LAWA 3PZPA 5J1EA 4TYBA 4RW7A 3PO4A 5KFSA 4K4ZA 3NFAA 1NJYA 2XY8A 4OPKA 5HBMA 4IH5A 1JL2A 3FSIA 5KT3A 4NLUA 2D0BA 3DOLB 5J2PB 1B9DA 3K58A 2OH2A 1RTJA 3VQEA 5KG3A 2WONB 2PYLA 3Q8QB 2ZE2B 3CWJA 3OLAA 3ZT0A 3S9HA 1NK8A 1C1AA 1BISA 1YTUA 4DS5A 3NL0A 1QHTA 2ALZA 1IKYA 4F3OA 1LWCA 4FJ8A 1S9EA 2I1RA 3NCIA 5HRRA 3ASMA 2Q3SA 3TAQA 3RB6A 4O55A 3HXMA 1TKTB 3V81B 1HNIB 3BR9A 3CDEA 4PY5A 4W5RA 3I5AA 4KFBA 4E7JA 1C1BA 1A5VA 4E19A 2CJQA 3THVA 1HARA 3BREA 2XY7A 3PJWA 2C2EA 3C95A 3VQ6A 4CIEA 1I6JA 5CYQA 3CFOA 1FK9A 4OKEA 5L1LA 3DLBA 4W5NA 1C0TA 4L8RB 1IKYB 1Z26A 1RT5A 1DLOB 3MEEB 1S9GA 3KLEA 2VA3A 1JLBA 3KKSA 1QS4A 1TL3A 1HMVA 2XGQA 4N5SA 3AVFA 4NLRA 1VSIA 2HWHA 1QE1B 4QAGA 4RW8B 1LW0B 4HCBA 5KT4A 3Q8SB 4OKKA 4Y2AA 3SQ0A 4CEBA 4FJJA 5JXSA 1TKZB 2IA6A 1YTAA 1WAJA 4TYAA 1ZBIA 1SKWA 4MH8A 1VSKA 2KFZA 2VWJA 3NF7A 4QWDA 4Q43A 4WZQA 1ZBLA 3ULDA 3QIPA 4DLEA 1ASVA 2ILYA 4R0EA 2E6LA 4WXOA 1RTIA 4ZVHA 3NHGA 2Y1JA 4J9RA 4O44B 3PUFA 3ZSWA 2HHUA 4GW6A 4PQUB 2J6TA 5CYMB 4JS5A 5KFOA 3KHLA 5C25A 5CY4A 3HKWA 3OYCA 2D0AA 2HNZA 3CVKA 4K50A 3M8RA 3CIZA 4ICLB 3MTKA 3U6FA 4PA1A 3H5SA 2IMWP 4JS4A 4Y3CA 3RMCA 1F21A 4IFYB 3NBPB 1RDAA 2OPPA 3LZIA 3VQ4A 4I2QA 3OYLA 5KRTA 4E0DA 4C8NA 4KO0B 1TP7A 1NK6A 4FLUA 3BQ1A 4DF4A 3QEWA 3KLGA 4MFBA 3H08A 4FVMA 1XC9A 1RT1B 3KK1B 3KK2B 1LWEA 3V6DA 3HSTB 3BGRA 5I42A 4DLGA 1VSLA 1CXUA 2D7SA 1S9FA 2YKMA 1HPZA 3DI6B 3DDKA 5J2MB 1T05B 2C2DA 3LPUA 2BANB 2W8KA 5KG1A 4YR0A 4DQPA 3TAGA 3ICLA 5HP1A 3NF6A 3JSMA 3OL9A 3OYDA 2GBZA 1BIZA 3SFUA 2R7YA 4RW4B 4U7CA 1U04A 4H4OA 1D5AA 4FZZA 1TL1A 2W8LA 4WFZA 1KHWA 4O3NA 3MECB 2J6UA 2GIRA 4ZPDA 2DPIA 1TK5A 2ASDA 4CJKA 1HYZA 3QERA 4DSEA 4N56A 1NJXA 1W25A 2EX3A 4NLTA 4QW8A 4NYZA 3C6TB 1HPZB 3DI6A 4HUGA 5K14B 3TAPA 3L8BA 4NCAA 4RUCA 3OYEA 4B8AB 2GC8A 4KV8A 3V81A 3PW7A 2P51A 4B9MA 3T5HA 5KFRA 1REVB 4KHSA 4CGFA 2D3ZA 3T5KA 5I3UA 3ZSOA 4MQ3A 2OPSB 3LZJA 2UVVA 2V0NA 1JXEA 2WCXA 5KFIA 2BRKA 3DLGA 4KB7A 3PW5A 4QWCA 4Y1CA 2YNIA 3KD5E 1RT6A 4TY9A 2XGPA 2B5JB 3AA3A 1HQEA 4GMJB 2KTQA 1RBUA 1N6QA 3UPFA 4KV8B 1BHLA 4J2DA 4J2BA 3OVNA 3HO1A 2F8TA 2JC1A 5KFDA 1SL1A 3MEDB 3HP6A 4IRKA 1LW0A 4KHRA 3B6PA 3DM2B 4CERA 4LD0A 4DL7A 5J2PA 2C28A 3CDUA 2IJNA 3RAQA 4X2BA 4O0JA 1S4FA 1T8EA 1TKZA 2LSNA 3CM6A 3RR8A 5KFUA 4IH7A 3M8PB 4R8UB 3ALYA 3NGDA 3QLHA 3KK3A 1EP4A 4FJGA 4ZP6A 1XI1A 3DLKA 2G8VA 3L2QA 1BL3A 4Q8EA 4YFUA 4DG1A 4BE1A 4NYFA 4CJVA 2XI3A 4E89A 1RYSA 3NH0A 3TAFA 1J54A 1SKRA 5EU7A 1ZBHA 4ECSA 4H54A 5HRNA 1J5OA 4IKAA 1WNEA 3HVAA 1QUVA 4WE1B 3MXIA 4HCCA 5KFFA 1NOYA 5HRSA 3O4NA 1S1XB 2E9TA 1L5UA 4OJRA 1IKWB 1C0TB 4JV2A 1JXLA 4ELTA 3DLEB 3SI8A 4DL5A 2IC3A 4DTRA 3K57A 3KLIB 3G10A 1S48A 2IJFA 2XO7A 3GV8B 4LQ9A 4RW9B 3EZUA 4F4YA 3KK1A 4FK2A 3OSPA 4ELVA 4MFBB 4AHVA 4M3XA 3MR6A 4QWBA 4EBDA 3KK2A 2IBKA 4R5PB 4FLZA 4M3RA 3ZT3A 2ASLA 5I42B 2IS3A 3VQ8A 2RN2A 3CJ3A 4CF8A 4CHOA 5J2MA 3AV9A 4LSNB 4ECZA 4BDZA 1B9FA 2IC3B 1JKHA 1JLGB 3V9ZA 5JS1A 1NJWA 4CEEA 3E01B 1RTIB 2UUTA 4MKAA 2VWKA 3KLIA 2DFEA 1U4BA 3TR8A 3AA4A 4H8KA 3HVTB 4ZPBA 2V4QA 3H2LA 4BACA 4H4OB 5HRPA 3TWHA 1W0HA 1TAUA 4E7LA 2JEIA 3IGNA 3CFRA 2E6MA 2KW4A 2OZSA 1TVRB 1HJRA 1JLEB 1YVFA 3LPTA 2FVSA 4I7FB 4KI6A 2BR0A 2FVRA 5KFKA 4CHPA 1SV5A 4TQSA 3PW4A 5KFHA 4CF2A 5FROA 2HHXA 4IFYA 1RT7B 2WHOA 1S97A 3S3NA 2OYQA 4DU1A 2B4JA 4EZ6A 4E1MA 5HROB 3I5CA 1X9SA 3DMJA 2HAIA 5F8HA 4NCBA 3AVGA 2IM1A 4XPEA 3ISND 4KHMA 3LP0A 3C94A 5FDLB 4ID1A 4NRTA 4JLHA 4CJTA 4EBCA 1L3SA 4FJLA 1RILA 4WYLA 3IS9A 3V9UA 2B5JA 5KFBA 5KI6A 3D5MA 1VK0A 5DGBA 4CK3A 5SZTA 2O4GA 2IM2A 3QETA 1S6PB 2C22A 1FKPB 4E7HA 4M95A 1VSJA 3SUQA 4DQSA 1SKSA 4NLVA 3G6YA 5KFCA 4YMEA 1RDBA 3C6UB 3JYTB 5HROA 2WRMA 3KLFB 4CFCA 4K8ZA 4CEDA 4B9TA 3HK2A 4XPCA 3RR7A 3DM2A 5F8JA 4FS1A 1WSIA 3DRPB 4IG3A 4IRDA 1D9DA 4ZTJA 4B08A 3ISNC 1S0OA 3H5UA 2X78A 2ILZA 4TY8A 1J53A 2VG7B 2F96A 4DTOA 3LP1B 1BQMB 5K14A 2ATLA 4WXWA 4FLTA 4RW6B 3QEIA 3S3MA 1S1VB 4JV1A 2OPRB 1DTTA 4PWDB 4CF9A 5JS2A 1CZ9A 1I39A 1C0UA 5T7BA 2UVWA 1BCOA 4NCGA 3TQ1A 4ZTFA 1NJZA 1UAXA 3RMAA 2RF2B 3HPOA 2QE5A 2KFNA 1KTQA 2IDOA 3ZT4A 4O4RA 3EY1A 2ZD1A 2FJVA 2E4LA 1C1CA 1VSDA 3ZSRA 2FBYA 1RTJB 2YHBA 1KRPA 2ZKUA 2G8UA 2YNHA 3CJ5A 1QSLA 3PX4A 2WOMB 2ITGA 3OYFA 2XY5A 2RDIA 3HPGA 4FM0A 1FKOB 3SPYA 1VSMA 1VRUB 5DMRA 4M41A 1KSPA 1RT4B 2BGGA 3KKRA 1LWCB 4CGIA 3AVMA 2OPRA 2A1SA 1C0UB 3H4DA 3OHAA 2FBTA 1S1WB 3IG1B 1TKTA 3L3VA 1A5WA 1QSSA 3SV3A 4BDPA 1BGXT 4URSA 5KG2A 1Z4UA 4ICLA 1ZETA 4KB0A 4KHUA 4GVMA 4PUOB 1GOCA 1ZBFA 2WK4A 3O3FA 3H5YA 1KLMA 5SWMA 3V1OA 3SV4A 3NBPA 4QWEA 1EX4A 3HHKA 3M8PA 4R8UA 4F4XA 5CYQB 4F4WA 2BQRA 3AO2A 1U09A 5KG7A 1GOAA 3TAEA 3MR2A 3K5LA 1JLCB 4WFYA 5C24A 4ZVEA 3E01A 1S1WA 1S1TA 3OYIA 1BI4B 4AILC 1XR6A 4CECA 1J5OB 1L3TA 4DSFA 5F8LA 4FBUA 4Z4GA 3NAEA 4J9PA 1D9FA 4XIUA 2W7PA 3LP3A 4B3OB 2IOCA 2AGOA 3QO9B 4J9SA 3VQ5A 4CEOA 3CJ2A 4G1QA 1RT7A 3SI6A 3MXJA 3TARA 1NKBA 3QEVA 4Z4IA 1SV5B 4TLRA 2BE2A 4EO6A 5EDWA 1NOZA 2B6AA 4FXDA 4DU4A 2F8EX 2R8GA 3L3UA 1B92A 5EWGA 1TL1B 1S1TB 1ZTWA 4LH5A 2O4IA 1TQLA 4URQU 2HMIB 2AWZA 4NLWA 1W9HA 4PQUA 3D45A 5CYMA 3OL6A 2I5JB 3SQ1A 4CHYA 2HNYB 4IDKB 4B3OA 1KFDA 1RTDB 4CJPA 3WNGA 4FLVA 1RT3A 3SFGA 3N6NA 3VQSA 1BQNB 3V9WA 4ED7A 1LWFB 3NKYA 4ECXA 3NGIA 4CJ3A 3FFIA 4MK9A 1TGOA 1REVA 4KE5A 3QGIA 4IQXA 2J6SA 3MAQA 4CJFA 5KT7A 4YP3A 3QZ7A 3SUOA 3I0SB 3TAMB 1HYSA 4KHQA 2W9AA 5KFVA 3OYJA 4ECQA 2R2TA 3OYGA 4CEFA 4CFDA 5KG5A 4FLYA 1IO2A 2Z1HA 2EC0A 5L1KA 3CM5A 4B9VA 2ZE2A 1TVRA 1RT3B 1UA0A 4OLAA 1RAJA 2DPJA 1Y97A 1LWFA 1N6QB 2YKMB 4DTXA 1S9EB 2P5GA 1HNVB 1JLFB 1DTTB 4PWDA 2BANA 2R8IA 4K4YA 1SL2A 3KLHA 3OYMA 4RW6A 5L1IA 4GC6A 2G8FA 4KSEB 4K8XA 1TK8A 4CJ4A 1A5XA 3KMSA 4FJKA 4ZPAA 4K4WA 2FVCA 5KFLA 5KT2A 3AVHA 3LP0B 1RDCA 4AHRA 4FW2A 4RZRA 1ZYQA 4AH9A 2YNHB 3MECA 3IRXB 1SL0A 4E7IA 4DTJA 1N4LA 3BJYA 4CJUA 3QLHB 1BIUA 3VA0A 2E9RX 5KFEA 4NLGA 4K4SA 4OL8A 5J2NA 2JLEA 4DG1B 5D3GA 1RT2B 4B9NA 1TL3B 4HKQA 1SUQA 1WSJA 2B43A 3DRSB 2YNGA 2UVRA 1TV6B 2DFHA 3JYTA 4WYWA 4KI4A 2R2RA 4EEYA 3MEGB 1QSYA 2PY5A 3QIDA 3QGHA 1NK9A 1KLMB 4BE0A 5F9NA 2IAJA 3CJ4A 4Z4HA 3GV5B 1JLAA 3V1QA 1S1XA 1CXQA 4AHCA 4O44A 1J9AA 3PX6A 1RNHA 3E51A 3LALA 2VA2A 3V6HA 4CHNA 1O1WA 3O4QA 4CHZA 1BQMA 2JEFA 5J2NB 1JLCA 1WSFA 5KGWA 1JL1A 2KZZA 3LANA 1SUQB 3I0RB 2YKNA 1IM4A 4JRPA 1BI4A 4LSLB 3O3HA 1XHXA 3TANA 3CYMA 2GUIA 3HT3A 4IFVA 4FK4A 3L2UA 2XWYA 1T94A 3U3YA 4IR1A 4AHSA 2W9CA 5KT5A 4W5QA 1NK0A 4FJ5A 1TKXA 5KG0A 4NLSA 1DTQB 4TN2A 4FM2A 4DEZA 3BQ2A 2ZQBA 2HB5A 2VG5A 3ITHB 5C42A 1JKHB 1JLGA 4CEQA 3KLGB 1Q9XA 3I0RA 5KTQA 4CJEA 4FBTA 3KHRA 3PX0A 4UQGA 2HHSA 2Z1JA 1C2PA 2VG6B 1Z25A 3IG1A 4ZHRA 3CG7A 4FK0A 2BDPA 3VQPA 3L2RA 1XR5A 1S10A 3BQ0A 4Z0UA 4F50A 4CK2A 1TKXB 5F8IA 5F8GA 3G0ZA 5E41A 4RNNA 4M3WA 3UQSA 2X6NA 4IG0B 4F4ZA 3EYZA 1D0EA 2G8HA 4ECUA 3TVKA 3NMAA 3M8SA 2HHVA 2RDJA 5KG6A 1S5JA 1NK7A 1IKWA 1KFSA 3DLEA 4CF1A 1EKEA 3UIQA 3DMJB 5KRSA 4KKOB 1RBRA 1X1PA 5DGAA 4JRQA 2JC0A 3PY8A 2YV0X 3D0PA 3I0SA 4ED3A 4QPXA 4RW9A 1IH7A 1MMLA 3MF5A 5J2QA 5F8MA 3DOKA 4I9LA 4FYDA 3KTQA 5DQIA 4N41A 3VQCA 1N5YB 1QAIA 3QO9A 4DL4A 1JLFA 4KAZA 5DQGA 1FKPA 3GQCA 3OJSA 1EETA 3NGYA 4Q5VA 4KBIA 4J9LA 4O4GA 3C6UA 4MK7A
chains in the Genus database with same CATH superfamily
3D1HA 4V19S 1VK3A 2VOPA 3QDKA 5DLFA 4F8RA 2ZBIA 5HBMB 2QT7A 1IBKF 4E2FB 3M1FA 1Y9OA 4DTUA 1VQ6N 3CXCR 3CC7N 2YNIB 4EYIB 5M1PA 1ZAVA 3L2WA 2GGPB 3CJSA 4V1Ak 1VMBA 1HQEB 2M3DA 3PV8A 2WTFA 2W9BA 2F5GA 3A4TA 4YOWA 1NG9A 4USKA 4H0TB 2V2QA 1S6UA 4CJRA 5D3GB 4AHUA 2QWNA 2AQ4A 2A2CA 3DRSA 2CQ0A 2GO8A 2AGQA 1KLNA 4CZHA 1UMJA 2N3LA 2E5IA 4KC5A 4FJ9A 4CBWA 1VAZA 3ZSYA 2WW4A 4FJXA 2RPIA 4BRKA 3F9KA 1GXLA 1R59O 3HPHA 2ZBQA 8RUCA 5KFQA 2HWTA 1P90A 5F9LA 4A59A 4H5WA 3IMQJ 5B8HA 2R8KA 3MX2A 4RU2A 1ZXOA 4M7YA 1EARA 2DGOA 3BH6B 1M90T 2XSJA 4NLYA 2E9ZA 4RL1A 3FGUA 1G15A 2G2ZA 1RBVA 2D9OA 3KXDA 1ZAWA 5F3ZA 1RKIA 2JGUA 1NWKA 4MIAA 1K8KA 3MEKA 1KAZA 5C42B 4JKAA 1RAEB 1JK9B 3B78A 1X4AA 4YQWA 1Q95G 2G1DA 1SZ2A 2RU3A 2NREA 1N56A 3C3LA 1NXIA 3VGLA 1RTHB 2GVZB 3H8YA 4NXMF 3SBTA 3ZSZA 3M6GA 4HYKA 1R8BA 2F4FA 2FZGB 1AB8A 4M5JA 4C4WA 2C2RA 2ZZTA 4WK3A 2ZH7A 1HBUB 3VGKA 2MY8A 3HVTA 2HVHA 4DHYA 2PDAA 3UKRB 2XNQA 3SYZA 2HRYA 2WONA 1Y5IB 1M5KC 3NF8A 3W5XA 4OX7A 3NGSA 4BRNA 4NZ7A 1IBCB 1VQSA 1LWEB 3D6MB 5FJ4A 3CCES 3MM5A 4RO0A 2QL9B 1VQ9S 3O08A 2XYPB 4P52A 4ZLLA 2E88A 1I3OB 2E7XA 5JMNA 5A76A 2UZAA 3UDCA 2VFTA 4F02A 2I8EA 4USHA 2ROPA 3TRGA 3K59A 1IKXA 3NAHA 4KH1B 2VDHA 4Q44A 2M8DB 4DPYA 4G65A 2GNKA 3MX5A 3GLJA 3B4MA 4BE2A 3MOZA 4OI6A 3W8PA 4JI5F 4NXNJ 2FLNA 4NLBA 2XRIA 3FRYA 4M63C 3ZT1A 3PLAA 2MSTA 3RB4A 3BY5A 2E1MC 1VSHA 5CZ2A 3TVZA 5LSLA 1GX6A 2DCUB 3IS9B 4RNMA 1WI6A 3LOUA 3RRGA 1F60B 1B99A 4ECWA 2IVNA 3Q8RB 5GADI 2GX9A 4A8OA 1IBKJ 4CTAA 2XCAA 4WF9Q 3KZBA 4HTLA 2AEJA 3CD6S 2FXUA 2ABYA 4RW8A 5KFNA 4M45A 3UR3C 2W41A 4LRCA 5KFJA 3AVLA 4QCLA 1N0UA 3LP2B 2LQ8A 4J9QA 3QEXA 4BC2A 4CE9A 3W2VA 4GV6A 4Y34A 2VG7A 1KVBA 5FRMA 2PGCA 1Q78A 3RB0A 3VOVA 3S6EA 4DQQA 1NGCA 2V5HG 1FWPA 3HFKA 2P9SB 3LDOA 3VQ9A 1WC3A 4P75A 1RDDA 4XO0A 4EK2A 5B0AA 1TYQA 5JVHQ 2UV8G 5BN9A 4B3SF 2QXFA 4ED4A 3W64A 1UKUA 3OD2A 3NH2A 3UO0A 4WFXA 4CJSA 2VGMA 4C1NK 2X3DA 1N36K 1U2CA 4DOZA 1VBXA 2PI5A 3HOSA 1UFKA 4DL3A 4A8XA 3G25A 1KN6A 3A2FA 4WF9L 1NGAA 1KD1T 3DYAA 3AY0A 4YDUC 3CULA 1NGDA 2Q1NA 4DR3F 4PG8A 3K5MA 3P38A 3WNEA 1GLJO 1MU2B 1PSDA 4DR6J 1DBDA 5DLGA 2DNHA 2CPZA 4O5BA 4IFVB 1FA0A 2XMTA 2XI2A 3VQQA 2DY4A 3ZZ0A 4Q0BB 4F0MA 2J9DE 1SJ1A 3LUYA 5D8HB 5KFZA 2Y0BB 3EGWB 4I6MB 1PYOB 3SCKE 4D3HA 2QK9A 5C24B 1NBEB 3H5XA 3O4WA 2RQKA 4USIA 2KRBA 3I96A 1CZAN 4HUFA 3L4BC 4DUYF 4CI0B 4BR9A 3G9CA 2UYTA 4XDCA 1F2GA 3SUNA 3CIPA 3CDAA 3I55N 1HQUB 4CBXA 4JHDB 2HYIB 1NDLA 1X5TA 4RUHA 1NGBA 2ERRA 1LQ9A 4J9MA 2YJFA 4ISFA 4UY8O 4Y2MA 2AMCB 5JLHA 4BBYA 1W7WA 2O8BB 1D1UA 5EWFA 1SQGA 5JUMA 1JMTA 1SQFA 3T6BA 1T3NA 4O3SA 2OTJS 1WEXA 1VQ5S 4WTOB 4DB3A 2AX1A 1T9UA 5EVZA 2R7WA 2FUG9 2K06A 4ENOA 3CJ7A 4P9SA 3P45B 5FLXU 1Z1ZA 3N5BA 2IDLA 1Q4RA 4KPYA 4I7FA 2F9JA 1X60A 3W9JA 1VQ6S 4K4XA 4BHQA 4K25A 2G8WA 1WOOA 5HSPA 2Z0GA 1GEHA 2XQCA 3K9KA 3ADAC 2A1RA 4OZNA 2DRDA 3VTIA 3G71N 2P1JA 3HM9A 3TAMA 1HYSB 5IM0B 4TKTA 3GU0A 1XQSC 3QNNA 2Z1IA 3SZ2A 1RYRA 3C66A 2AZ3A 3QINA 3AB2B 1Q79A 4ILMA 3HTVA 1H38A 2V9WA 1NPPA 2KU7A 4FWMA 1HWIA 3TW0A 2DR9A 3ZTOA 4X4NA 4RWTA 3H59A 2VGNA 2RH3A 4NZ0A 4DFJA 1RZMA 2N4DA 5U47A 4LF8K 3HI0A 2V34A 4DV2K 2DKOB 3KJNB 2CQPA 2DTUA 3HSJA 4WE1A 1LW2A 2LEBA 4BDYA 4AD6A 1RXOB 2IM3A 3THWA 1V4SA 1N32J 2XHBA 1RU1A 2DT9A 2AF6A 1T9WA 3HHLB 2CJBA 3QNWB 5CHIA 1RWNB 3AAQA 4YEAA 5L1JA 2NNWA 5DG9A 2YNGB 1SVDA 5GAGU 1X4FA 3MM8A 4ZS6A 2AYBA 4JKGA 1KCFA 2FY1A 4TU7A 1WSEA 3RTVA 4PG6A 1FRIA 1WOSA 3THXA 2IDEA 1CJVB 4AUKA 4CFBA 2VZ9A 3RSEA 1XMBA 5A0YA 3UE2A 2RF2A 3GIJA 1DLOA 2JJ4D 2RS2A 4OPAA 5AQNA 1VRUA 1JLAB 4KTQA 3DLKB 4G1PA 3BO2A 2WB1D 4X64K 4NYOA 3MAAB 4QS7A 2P9KA 2DGSA 4DSJA 2C3MA 4A8QA 3HZEA 4AT1B 1UVKA 4OI1A 4IH6A 2HLUA 4ZVPB 3MM9B 1NU0A 3J7A1 1F5AA 1UFLA 3SCJE 1VRTB 2FC0A 1SH0A 4FWNA 2QA4G 4K4VA 4PYAA 1G6BA 5F41A 2PYJA 1KOHA 2H5JB 3BP8A 3TTDA 3BZCA 1DTQA 3UDEA 2P6TA 3T1HK 4BC9A 1EXQA 3D66A 5IC4B 3SAHA 3KHGA 1EZZB 5ELZA 2IM0A 2HZCA 1U1OA 1YUWA 4I0WA 2YNFA 3PM9A 2Y8YA 1TFWA 4CGGA 2MHNA 1CJTA 4I2PA 2R2UA 1SI9A 3R3TA 3ZSQA 2HHTA 1HJOA 2HNZB 2CPJA 2XSJB 2UXDK 1HI0P 3CFPA 2RKIB 2HFOA 2P9CA 3EMTA 4P72A 2P9UA 2CRLA 3HHNB 2ZOGA 2POKA 1B7YB 2QTWA 2ZBPA 1UEUA 4IG0A 4DV3K 2C2OB 3HP9A 2ZH8A 3R7NB 4ZP9A 4CJQA 3PVXA 4E1NA 4HTUA 1I5OB 4RBTA 1Z2ZA 3MURP 1WBBA 2G8KA 1I3AA 2BV3A 1BDGA 2NUBA 2JEJA 4URGA 2EBGA 1YJRA 2FBVA 2HBKA 4IDKA 1R3NA 4DV7F 4CNZA 1XQIA 4FLXA 2VODA 1N5QA 4I6YA 4U7UD 3THPA 5CR4A 3KNAA 1D3WA 3DOKB 5AE2A 2UUWA 2QX0A 1GMVA 3ZXWA 3DKDA 4ZDNA 1FESA 1E4FT 4PKDB 4KBOA 3BBCA 2CWKA 2XY8A 4OPKA 5HBMA 2NUHA 4X64F 5KT3A 3AT1B 1HFEL 1FRMA 1SB6A 1TZ0A 1LWXA 2FY8A 2G0JA 5E3AA 3OLAA 3CWJA 2DNZA 3ZT0A 2JWLA 1HHQA 3SCIE 2G0IA 2PFUA 3UE5A 2EFGA 1TL4A 5MLCQ 3TAQA 4F9OA 3CGIA 4LFAK 3QT8A 2HZVA 2CG4A 2K1RB 2WVCA 4B1ZA 2XY7A 2QWPA 3PJWA 2GMLA 2C2EA 2ZITA 3CFOA 1FK9A 1QD1A 3EUNA 5KQDA 3MPDA 2UXCJ 3DLBA 1DQ9A 1H6KX 1OYEA 1RT5A 5CYJA 2HBRB 2LMIA 1BUPA 4PXCA 3V4MA 2R7XA 3TUJC 4BLGA 1QE1B 4CZEA 4LRFA 3WDOA 4RW8B 3LTOA 1ELOA 1K47A 1ZC6A 2KVQE 2JHEA 3IWLA 1WAJA 2RVJA 4P2SA 4TYAA 1SKWA 4MH8A 4KR0B 1FCAA 4FWSA 4X4TA 4EWTA 3QIPA 1M5SA 3THTA 1ASVA 3WQTA 1U25A 4R0EA 5CD4H 2YCHA 2MQPA 1HKAA 5AQHA 1NZAA 3NHGA 4CM2A 3SXLA 3PUFA 3BGLA 5D0GA 4CO3A 5CHCB 1TUUA 1IBLF 4PQUB 3GB0A 1WF2A 4X62J 5CYMB 3KHLA 2RJZA 3D1QA 5C25A 1JCFA 5HN0A 3CVKA 3DGVA 3C15B 3PYEA 3MTKA 4CZLA 4X65F 5M1NA 2JLFA 1T3OA 5EXWA 2PEBA 2VYPA 1RWUA 3RMCA 3H90A 1KD1O 1OY6A 2OPPA 3QBWA 3HX9A 5KRTA 3D1OA 3D0HE 3SLCA 2FJAB 3OR2B 4CO0A 4LF7J 3MPUB 4KO0B 4J9UE 5FPNA 4LF8J 4XH1A 3NNHA 2R7VA 2B9YA 3KLGA 2P8IA 1WG1A 1MSWD 4JKEA 4MFBA 5DZ7A 2EFPA 4CT9A 2CPXA 4FVMA 4C23A 5A2QY 1UVLA 3KK2B 1T02A 3V6DA 3HSTB 4DLGA 3OQ2A 3SAFA 1X4GA 2D7SA 1S9FA 4GVLA 3DDKA 3TWZA 3PCOB 2W4CA 5KG1A 2XZWA 2WFBA 2GX8A 1EWRA 2DH7A 4ILGB 1UPPA 1PYTA 3OYDA 1BIZA 3VF2A 4OYXA 3OV7A 1D5AA 1TL1A 1VS3A 3R5GA 3EXYA 1NLKL 4ZPDA 5D4NA 1TK5A 1IQTA 1VC6A 1HYZA 1GLEG 4N56A 1HPZB 5K14B 2IVMA 3TAPA 3U8XA 3L8BA 5ETOA 2DGVA 1GLDG 3MMAA 3PFEA 3MM6A 4B8AB 2HZAA 3BEXA 1WC5A 2QFIA 1QVFR 1MROA 4CVNE 1YTYA 4X4PA 1F5CA 2O8BA 4CH7A 8AT1B 2EVZA 1XIQA 1VI7A 2P9LB 4TVAB 2WZ1A 4UT4A 2V2ZA 3T5KA 1ROFA 3UD4P 3LZJA 2V0NA 1JXEA 2WCXA 5KFIA 4HI1A 2BRKA 2CNNB 3CQXA 1U6FA 1CS4A 5LL6Z 5IQ6A 1KQSR 1TYQB 1OH8A 2B5JB 3AA3A 3H25A 2KTQA 3VAIA 4DX5A 2ZOFA 2BM0A 4F0HA 3EKUA 2B3TB 2CADA 2DPNA 1UVNA 1WOPA 2QWQA 3HO1A 5ADXA 3MEDB 4PAAA 1U0HB 4KHRA 3L7PA 4LFCK 5DRKA 4K59A 1B7FA 3A5OC 1FNXH 1GNKA 3CCMN 4WFAQ 1S4FA 3RBZA 4LBPA 2XMAA 1RHKB 4MYUA 3EN9A 4DPXA 1QZ5A 1EP4A 1XI1A 4Q8EA 4YHHJ 2HF4A 1XNRK 4YFUA 4DG1A 2XI3A 4WIQA 4E89A 1WUUA 2RUGA 2VU5A 3CNQP 1ZBHA 2MZRA 4CH1A 3MN7A 1FDNA 2OMLA 3CCQS 4DR2F 4MO5A 3HVAA 1IJFB 4C8ZA 3MXIA 4HCCA 5HMWA 1YJVA 3ZZZA 5HL7Q 4WCEL 3O4NA 3KUHA 2E9TA 1T9XA 3CCUN 1IKWB 4LF9J 2WVEA 3CMEN 1HKBA 5A2QO 2IC3A 1M90O 3LGHA 1W2BM 2HHHF 3G10A 4JI4J 2K3IA 4XH5A 4UF4A 3GV8B 4LQ9A 3EZUA 3KK1A 4Y00A 3OSPA 4KHPJ 3C2PA 4X66K 2P9EA 1PAEX 1RHUB 4AHVA 3MR6A 4OYAA 3E8OA 4JI4F 2NPFA 2IBKA 3N5FA 4FLZA 3F41A 3ZT3A 4USVA 2ASLA 4USUA 3R5DA 2RN2A 2JNJA 4OYWA 3HZ6A 4FNIA 4U67Q 3IC1A 1B9FA 1JLGB 1RAGB 1NJWA 1RTIB 1AT1B 8ATCB 4J90A 3TR8A 1I94K 2B8PA 1Y5LB 2K7JA 3VGTA 4ZPBA 4BACA 3Q2TC 1WKLA 2DXFA 2OSQA 2Q66A 3C16A 2KHDA 4USJC 4KGZB 4YOXA 2E6MA 2KW4A 2F7VA 2MZ1A 1JLEB 1YVFA 3M8WA 2WUSA 4KI6A 1KVIA 1NZ8A 4JI7K 1SV5A 4TQSA 2YXLA 3AH6A 5ITHA 2C2NA 1FJCA 1FWKA 2HHXA 4IFYA 2IVFB 4LF5J 5L9NA 1S97A 3S3NA 4OI4A 1VQLN 4EZ6A 4E1MA 1FXLA 3I5CA 3R1XA 3CJ1A 5JVHL 3U9DA 2IM1A 2GQ2A 3PTWA 3C94A 3ZFVA 3DXMA 3RRKA 2UUBK 4BY9C 2HBYB 3VGUA 1E4GT 1RILA 4F67A 3V9UA 2B5JA 1YJ7A 2IM2A 3FGVA 4FVUA 5HO4A 2CXEA 1B64A 4YOEA 4DZ6A 1FKPB 4E7HA 2EXUA 2Z30B 1VSJA 5AE3A 4M5HA 2MZSA 4IOAQ 1GT8A 1B3TA 5KFCA 3C6UB 1SBRA 4CZJA 2XHWA 2L3MA 5LSOA 4CEDA 1HKGA 1HBNB 2HS4A 4X84A 3DRPB 4B08A 3ISNC 1U0SA 2ILZA 3ULHA 4LFAF 2F96A 2GGPA 3DLJA 1BQMB 1WJ9A 4Q2LA 1SXLA 2QIFA 4ANEA 1BQXA 3OUYB 2BKNA 2OPRB 4PWDB 5AXNA 1BCOA 4LF5F 3TQ1A 3QRPA 2HS3A 4CQ1A 3Q86A 4LVOP 4QU6A 3RMAA 2RF2B 3TZZA 1QQMA 2QE5A 4WKYA 3NRBA 4O4RA 3EY1A 2FJVA 2E4LA 3ZSRA 1BY9A 5GAHI 4PKIA 1RTJB 3TO8A 2HVDA 5AQMA 3CJ5A 1QSLA 1DFDA 1Y11A 3IWNC 4ZIVA 1LFPA 3OYFA 3SPYA 1N54B 4G6VB 4Y2KA 1VSMA 4M41A 1IWGA 3AVMA 2HBLA 2A1SA 2LXUA 3H4DA 4ES2A 3N4WA 4DX7A 2OCEA 2RDDA 2FBTA 2AJ0A 3R5AA 5BPMA 1QSSA 3VERA 4X4RA 4QIGA 1IM6A 2LU2A 5A8WB 3B6BA 4KHUA 1WKJA 3DXKB 3WT0A 2ZNZA 4JI3J 2DBBA 2UUAK 4PUOB 2OMOA 3V1OA 1DRZA 4L6V3 3X3UA 3SV4A 1NBWA 4DL0C 1W2IA 3PIOL 4R8UA 5CYQB 3WEEB 4BC5A 2BQRA 3QAEA 3TAEA 4JV5K 2F7TA 3JAMY 1VQOS 3LM2A 3H0PA 3DDNA 1CG2A 3I9V9 1O6XA 5A8KB 5DJBA 1BI4B 2X1GA 1CC8A 3DWLA 3EZOA 1L3TA 5F8LA 1HNXK 4HLBA 1D9FA 3M5RA 1ACMB 3QO9B 4J9SA 2Z2YB 2D0PA 5EOYA 4ZPVR 1RT7A 3Q22A 4KIAA 3MXJA 3TARA 1NKBA 4ISGA 2J5AA 3QEVA 3FK4A 1FJEB 3OFHA 5A8RA 3TJAA 2DGTA 4FXDA 4R0JA 1TUWA 2F8EX 4IYQA 1SC6A 2IVOA 5A8KA 5GMKa 2XYHB 4URQU 5BRFA 2AWZA 3P4UB 2SXLA 3QJJA 1W9HA 4PQUA 1VC5A 5CYMA 2I5JB 2NRRA 4IDKB 3BR8A 4A62A 4DR4K 1KFDA 4CJPA 4FLVA 3N6NA 4QPTA 1ITPA 3VQSA 1BQNB 3TZXA 4DJBA 4HHJA 1E6VB 4JI3F 3K0JA 1KAYA 4H0VB 3VENA 4PPZA 1FFGB 2ZUAA 2QGFB 3AFGA 1REVA 1F6TA 3ZZUA 2XG8A 4CJFA 3QZ7A 2W9AA 5BYSA 2QW9A 2DNMA 2IY5B 1FX4A 3JSBA 3OYJA 2R2TA 2VQFJ 4AL7A 2UUCF 1HI8A 2LA6A 2BJ8A 2KT2A 2W7AA 5IT9U 4B9VA 3J81O 2CQDA 2QWOA 1UA0A 4OLAA 1RAJA 2DPJA 5A2QU 2IBOA 2AP6A 5GMEA 4PWDA 4K4YA 4FWPA 2NZ4A 3A3PB 3KKFA 3AGKA 1HBMB 4JI2K 2M8HA 2QXLA 2H48B 4AE5A 3ETOA 4YB5A 3M6VA 4OHYA 2QN6B 2BOPA 5T7LB 4ANDA 3AVHA 3MN9A 3BS9A 1ZYQA 3C8YA 3NOGA 3GOIA 5KPTA 2JOQA 3LF0A 3VA0A 2E9RX 4HT7A 4OL8A 3M05A 5J2NA 4U96A 4BGAA 5D3GA 1XTZA 4HKQA 2E1AA 1SUQA 1RHQB 1URRA 2B43A 1QM9A 5F1XA 2DFHA 4JI1J 4JI6J 3WBZA 1RAIB 1H7XA 2XZDB 4WPAA 4EEYA 2PIIA 4LFBK 4Y28C 1NK9A 1RJJA 4BE0A 4Z4HA 2HVZA 4CDIA 5GVQA 1S1XA 2GMHA 5HL7L 2X7IA 3KG0A 3I6PA 4BRDA 2D3O1 2AJ4A 3ZTQA 4JI1K 3KDNA 1QQOA 1RWKB 1FNMA 1O1WA 3O4QA 2FHJD 1VQNN 2MKSA 2Q0UA 3VAJA 1VHFA 1JL1A 4YOUA 3CE8A 2ZHOA 4ITSA 4Z37A 2E5LK 2B9WA 1SJRA 2E20A 2C1EB 1NSQA 1X0PA 2GHVC 3T69A 2XMMA 2HG4A 4C48A 4ZVQB 4C3LA 4IR1A 4V19X 3W63A 1NK0A 5KG0A 1HD0A 4NLSA 1VQMS 2MMYA 3NOCA 3NS5A 4OQJA 4RKUC 4FP9A 3SCLE 2ZQBA 2VG5A 4KJIA 2Y0SD 2QG9B 3B8AX 1S6OA 3OT9A 3UN3A 4FBTA 4RTFD 4QU7A 4W90B 2Y1RI 2HRTA 4UQGA 2W2NP 4RBUA 5T41A 4ZCMA 2HHSA 3NP5A 2HBQB 1VLOA 1VGYA 1T44A 2XMJA 2PO4A 4JI1F 4ILLA 1TUGB 1S10A 2MEWA 3RBXA 4DPUA 2V51B 4Z0UA 4F50A 2DHSA 2BM1A 3SDEB 3W65A 2X1AA 1FRJA 4L3QA 1BWEA 2G8HA 3H2VE 1SKUB 3PXGa 4WU2A 2DH8A 3M2VA 1EWQA 1UVMA 1FXDA 1U26A 1IKWA 2KYZA 4H4KA 3I4HX 3F5TA 3S01A 1A7GE 3MMJA 4KKOB 1N8RT 2OEJA 2CGKA 3MM7A 4OI3A 1X5OA 2MGZA 1FKAF 1VBKA 4MMOA 3I0SA 3WXJA 4QPXA 2ZWHA 5ADZA 1IH7A 3DXSX 2LDIA 2ZC3A 1FVQA 3H2UB 2PEHA 1PC5A 1DURA 4N41A 3VQCA 3ZX2A 1KWMA 1N5YB 4GMKA 5EY4A 1AA1B 1YHQS 3B4DA 1EETA 3MWBA 4AF1A 4NA2A 3CHWA 4Q5VA 4KBIA 2GQQA 4J9LA 4OYZA 4KAIA 4FJHA 1IR2A 3N28A 3M6XA 3OYNA 4O3OA 2KT3A 4J2AA 2NXUA 3E9OA 1BOTO 3KHYA 3HSDA 2I7PA 3RAXA 4H03B 3DXBA 5HANA 4CIGA 2KO1A 4FW1A 4DTSA 4KHNA 2B4VA 5CZXA 2F8MA 2DNQA 3G6XA 3CC2S 1SC3B 5DZ6A 1N5YA 1YJNN 1RT6B 3S3OA 1MWKA 1QY7A 1NHUA 3CJ0A 1NGGA 2DNOA 1T03B 5AE1A 4KTZA 4B17A 4GV9A 2B4UA 2OSRA 1IKVB 3WNHA 3LP2A 1HRHA 3R7BB 2DHXA 5HOOA 1LW2B 2G13A 1CZBA 3CXCM 2YKAA 1FW6A 2WBRA 1C1BB 3G6EN 5EUHA 2H4WB 1S7HA 1EIYB 4LT6A 2BACA 2VBXA 4A8MP 4WZMA 4L3KA 3HF5A 4B3RF 5DM7Q 3A8YA 3KK7A 1TUYA 4IRCA 1HMVB 2CNLB 2VFVA 4OYMA 1Z2LA 3HD2A 1SJFA 1NMEB 4EP4A 5AXLA 2PN6A 3KLEB 3AQOA 1F2HA 4G3IA 4GNIA 1U45A 3B54A 2ZNYA 4UY85 3NDKA 3BSCA 1HW9A 1D9AA 4OYBA 1LEOA 2KHCA 3FZBA 3RSEB 3UI3A 4C3KA 2MYFA 2VJUA 1SS6A 3V9SA 3RBDA 3IAYA 1ZS6A 4M3TA 4EIAA 4N7TA 3W62A 2GW8A 4IG3B 3MDQA 1S0NA 3FDSA 4OVLA 3LPEA 3UNYA 4CRJA 2P9KB 3I5BA 2YWWA 1S5ZA 3BGFA 1Z6RA 1O5JA 1IG8A 2FJXA 5AQUA 4NLXA 1RT2A 3AVJA 4QQBA 3PKMA 3T41A 4NB4A 4RLEA 3D7EO 4EZ9A 3HMJG 1JX4A 2IPOB 4I6MA 4MIWA 2KM8C 4CO4A 2E2OA 5LL6d 3ZO7A 4EU0A 3QMLA 1NAQA 4OX9F 3BDPA 1X9MA 2RMLA 2PFDA 1Q81O 3R5BA 4KB1A 2PC6A 4M5GA 2YX6A 3VEWA 1EAYC 1WI8A 3KJVA 4OGEA 1WKKA 4ED2A 1K9MO 3AO1A 1JCGA 2QMWA 3ELHA 3W5YA 3J81j 4I2QB 4BWMA 2E7VA 3MHYA 4BC7A 1GXTA 1H1VA 3UKUB 4M42A 1RT1A 3EE9A 4F3QA 4RJVA 1JLEA 2H5EA 3K8WA 4OKJA 4B9LA 2L41A 2AEFA 2R42A 5D4LA 3MOJB 2ROEA 3C19A 3ILJA 2VV5A 4N8OA 4B8CA 1OSDA 4KREA 1G4CA 1BA0A 3A8KA 2ASPA 5KPZA 1UA1A 1X5SA 1D4XA 2LP4A 4CJ5A 4FJIA 1YT3A 4JUZA 2QYCA 1JB0C 4NLPA 4JBCA 1C4AA 3VA3A 3QZ8A 3ET6B 4ZVRB 4OHXA 1RE1B 4WQ5A 1NH7A 4F2SA 3HHLA 2OPQB 1CULB 4NASA 4GKKK 5LMUF 2Z2ZA 2LFVA 2HFZA 2RU9A 4CLSA 1Y10A 1UAWA 4AXJA 4I6WA 1Q7LB 1CLQA 4I67A 3KLHB 3DLRA 2M4MA 4OJGA 2AKWB 2H54B 2N7YA 3AAWB 1TKDA 3QFHA 3AA5X 3NMRA 1R0BG 3TYTA 2JL9A 4YY3F 3RBEA 3G4SS 1HWLA 1XEZA 4NZ6A 2M7SA 3OHBA 5HLFA 5KFTA 1ASUA 2DGWA 3AOCA 1Q8KA 3OY9A 3TUIC 3NGZA 4DV3J 4YNQA 1H73A 1Q5YA 2UVUA 4KHWA 5J2QB 1ASWA 3AA2A 2FBXA 1DKGD 1RB0A 1RDRA 1H2UX 2UXDJ 5M1KA 3K2PA 1HUXA 1HBOA 2PI4A 2XB2D 2NRZA 4OPJA 4CJWA 4DX6A 2DO0A 4J9KA 1XUPO 2VONA 2UXDF 4FOIA 2P2CB 3G82A 3F56A 1U49A 3KIOA 3PSIA 4JKCA 5DK5A 1BO5O 2GEMA 3K5OA 2IAJB 1FK9B 1Q53A 4N77A 3T1HF 4FJNA 4DV6F 1HYVA 2VQEF 4FJ7A 4ZN3A 4HL9A 3QIOA 2QEXN 1D8YA 2EFNA 4E1JA 4IKFA 1HNXJ 4RNFA 4CESA 4BRFA 2L9DA 4B3MF 3V1RA 2GV1A 5CZ1A 4CH0S 2CZVC 4MKBA 1S6QB 3WNFA 5A8WA 3RRHA 5BRHA 4U8YA 4ED6A 3LM9A 1S7IA 1WEZA 4LRDA 2D5RA 4ATNA 4CZKA 3OFEA 4PKGA 2XWXA 2ZUGA 2RKIA 1YLXA 3M9MB 3FQKA 5LOQA 4PUOA 2LU1A 3DGPA 3KJVB 4FF1A 3MFHA 3IRXA 1A6LA 4OLBA 4Z2XA 2O8EA 3WEEA 2A3ZA 2YQ3A 3O9QA 2O8CB 1QDUB 1OVQA 1C6VA 2CGJA 1MG7A 3UKRA 4DU3A 4DR1F 4ILRA 3NWRA 2HQIA 4ZMMA 4H0YB 2JSXA 3ID8A 2W6KA 2CA9A 4RNHA 5CH7B 4DFPA 5EX3A 3C15A 4RU9A 1T0TV 2DEJA 3D2EA 3MEGA 3M9OB 4V19J 1KAXA 2UXBJ 1Q82O 4K0KK 4E7KA 4Z4EA 4NL5A 5IXUA 5C12A 3E3XA 5E2QA 4DCPB 4NRUA 1PCAA 3BKFA 2YNFB 5KFGA 3D3CJ 4CLWA 1CLFA 4HDHA 1OVYA 2IRXA 1MMNA 1R7IA 3BBBA 1RDWX 3VEOA 3KNGA 3D2FA 4KT0C 3VAMA 4BRGA 4BC3A 3J7ZT 1NGHA 2F40A 2WAQD 3I56N 3V6DB 6FD1A 4GO5X 3AO5A 2BXJA 4IEEA 3FFIB 2XYGB 2HNYA 1M5PC 2XO6A 4NLOA 1UEVA 3EE8A 1ZBUA 5B7WA 4NXMJ 3L7UA 4OX9K 4N47A 1YKWA 1BWFO 2MQMA 2VKRA 3JSMB 2WVDA 2XLIA 3V9XA 4HT5A 2VG5B 1VC0A 4M5LA 3GIKA 2HW3A 4A61A 3F2KA 2W4PA 3MGJA 1B70B 3WUHA 3D4JA 1PKUA 4DUZF 5FDLA 4LFBJ 2J9EA 1NK4A 1M5OC 4QIWD 2R4FA 4B1YB 5LSRA 3GILA 2YQ0A 3PW2A 4QW9A 1SAZA 3JXUA 3CDWA 1TU0B 5KFXA 2HVIA 1OMSA 4E98A 1TL7B 4M5DB 3QFPA 1R0AA 3BM7A 3D0IE 4DCJB 1K73T 1P9QC 1XERA 1UW4A 1WNSA 4M3YA 4H0XB 4CGDA 3BGOP 4TXSA 3KLFA 3KMQA 4KKOA 1AZSA 3PJXA 2XCPA 5ETRA 3RG6A 3MM7B 2MGZB 1GTEA 3ENAA 3ZCMA 1KVCA 3UCZP 3VEXA 4XK8C 1XR7A 1C0GA 5KT6A 3TZWA 3AA9A 1VQ5N 1IWAA 1VQLS 4CTAB 5M1QA 4C1NI 2ASJA 3TA2A 3PIOQ 1LK5A 4CJ7A 3T3FA 2A6AA 4B1VA 3R6MA 3ZZRA 4RG8A 1J5EK 3H3NO 4PKHA 1XWLA 1NPKA 4B3MJ 4FSVA 2V8GA 2Y8WA 3DGPB 2Q31A 3AVKA 1XNQK 2Q6CA 2ZM6K 1NDKA 4GVBB 4L75A 4UOHA 4FZYA 2O8CA 2YHXA 2IHR1 3MEEA 5I4MA 3IFRA 1K1QA 3BSNA 2OFHX 1T03A 2VICA 1OS5A 3J81Y 4CI6A 3T5LA 4OZ1A 2Z8QA 1HLUA 1GX5A 4W5OA 2GA7A 4CD1A 1T9TA 4ZPCA 2X6SA 4C3MA 4RNOA 1RAHB 2D9PA 1H0HB 4L72B 5GAEU 3ZZPA 3ZZOA 1Y64A 4DL2A 1LV5A 3V4IA 4KGKA 3HM8A 3EJMA 3CCRS 2WTUA 2J8AA 3M8QB 1LNQA 3P5JA 3MUMP 3CCVN 2AX0A 4DV1K 1DARA 2W2QP 3M32A 2Z2MA 2NXCA 2G4BA 2E1YA 2W6LA 4DTMA 2PT0A 2G0CA 3BSOA 4FCYA 3EWGA 1UJ4A 2M52A 3HOTA 3BV8A 4NA1A 4USMA 1K1SA 1TTHB 1ATNA 3TR5A 3M2VB 1X9WA 2MTLA 1RLDA 3TP2A 2GV9A 3NH1A 2KRRA 3LPYA 2JFDA 3TNVA 4ED0A 3N6MA 2HIYA 3O44A 1N33K 2CQIA 4ID5B 2EG2A 1Y4ZB 1CQNA 3PO5A 3JTPA 2OEKA 1FX2A 4HUEA 1VFJA 3P31A 2EHGA 4J9OA 5LMNJ 3PZPA 2BZ2A 5J1EA 2DNYA 1GLFO 1FEHA 1PILA 1EQMA 5FIIA 2CQGA 2O66A 2HBMA 4IH5A 1BUXA 2MB0B 1QZ6A 3VALA 4YB7A 1JL2A 3FSIA 1T95A 4C0HA 5J2PB 5LM7E 2OH2A 3VQEA 1PJ7A 3KYLA 2PYLA 2MPUA 3Q8QB 2ZE2B 3AARA 4OYPA 3FKBA 1YTUA 4DCHA 3MCSA 1QHTA 4EI2A 2F9TA 5ETPA 1IJEB 1LWCA 4H0OA 1S9EA 1I94J 2CJ9A 2V7ZA 5H9EJ 1YJ9S 2P9LA 1TKTB 3V81B 3BR9A 3OTOF 4B3TJ 3HD1A 4PY5A 1JNZB 4KFBA 4E7JA 3J7AN 5HJXA 2CNKB 3AQPA 2D74B 1HARA 3IR6B 3C95A 4X4VA 2BW7A 2E2QA 3DCAA 3V2UC 1YBTA 2CJAA 4X4UA 4BRIA 4A46A 2NXEA 4DV4F 1C0TA 3W8GA 1Z26A 4XTTA 3DJCA 1IBKK 3MEEB 3KLEA 2VA3A 3UDVA 3G87A 2L9WA 3QT5A 1HMVA 4N5SA 3FLCO 3AVFA 4NLRA 4HH0A 1VSIA 2UXBK 2HWHA 1VQNS 4KGXB 2Z57B 1DHMA 1OSCA 1VYAA 3E2EA 4Y2AA 4AQYJ 5JXSA 2YWHA 3H20A 4U95A 2KFZA 2VWJA 2Z2LA 3NF7A 1FJGF 2NZTA 2LQBA 3SMZA 1U2VB 1ZBLA 2ROGA 1EQYA 2WC9A 4DLEA 4DN0A 2ILYA 3K8VA 2GO9A 4J9RA 1AYEA 3WQUA 5F0UA 2UUBF 5LJVA 2J6TA 4B3MK 2YWKA 1I1GA 5CY4A 3PYGA 3T1HJ 4CIOA 3MR7A 4K50A 3IM9A 4OZ3A 3U6FA 5AJ3F 1KDNA 3RYLA 4DV6K 4PA1A 1ZAXA 4FWOA 4IFYB 2CAJA 4DUYK 3ENVA 2DJWA 1ZBSA 4I2QA 1YZ6A 2KB2A 2A0FB 3FFKB 1OYDA 4DV4J 1OPIA 4C8NA 5LJ5Y 2Z4PA 1MN9A 2MJNA 4O0NA 2QWRA 1MMDA 2HK2A 1F5BA 1UETA 1XC9A 2CYYA 1P6TA 2EK1A 2AJFE 2F63A 4LR8A 5A6WA 3BKTA 5I42A 1CXUA 2YKMA 3DI6B 4LRAA 4P73A 2DGXA 3AA8A 3LPUA 2W8KA 2H3EB 1CQMA 2LXFA 3HSZA 4YR0A 3FZ2A 5HP1A 2KI2A 4FPIA 4DI6A 4F36A 4UQTA 2IIRA 3OL9A 2GBZA 3SFUA 2R7YA 4U7CA 3GZ7A 5I3QA 4RWXA 5GAGI 2J0WA 1YJTA 3IBWA 2KJWA 4CJKA 5DM6L 2Q1LA 3QERA 1CJTB 3H42A 4DSEA 4JKDA 1NJXA 4JP8A 2EX3A 5AQPA 3C6TB 3DI6A 5D4OA 4FKYA 3EO3A 4GRSA 2KXNB 2PA3A 5AQWA 4HUGA 3PNIA 1HNWJ 4NCAA 3HKZD 2OAUA 3OYEA 3TEGA 2YH0A 1JJ2M 2AA4A 3OUYA 4B9MA 3X1LB 3FBFA 3B8HA 2R7RA 4CLKA 1IN0A 3MCNA 5IS2A 5AQRA 5I3PA 3ZSOA 3VGMA 4JI4K 3GFZA 3C46A 2KYXA 1TFYA 4X65K 2ASMA 1U6ZA 2B4PA 2XMUA 3KD5E 1HQEA 4GMJB 4DR1J 1N6QA 5AJ3K 3E66A 1WHWA 2F8TA 2JC1A 2PAVA 3JAMU 4JKGB 2VOOA 1NSPA 4DR5K 3BO4A 5CE3A 3HP6A 1GQEA 2FSKA 3B6PA 2H1YA 1CEZA 4CERA 2VFUA 3R7SB 2GWKA 1UP1A 4ZLJA 4DL7A 1KC8T 3RAQA 4X2BA 3KG4A 1TKZA 3CD5A 1XC3A 3P49B 3VEZA 5DDRC 1HX1A 3NGDA 3KFWX 3G8QA 3DLKA 4MDBA 4TNOA 4JK8A 3L2QA 1WOQA 1WHVA 1HHSA 4BE1A 1RYSA 1X8DA 3I31A 1F1BB 5IZHA 3LGMA 5K8PA 4LMZA 2JRSA 4ECSA 5BRDA 1YI2S 4MO4A 1WNEA 2E7WA 1MLAA 4PG5A 4M5DA 4HWIA 2ALYB 1J5EF 2EW9A 4DZDA 3J80U 1NOYA 3O6QA 1R43A 5HRSA 1S1XB 4OJRA 3AD9C 3KLIB 4FPRA 3OPKA 3UWTA 3JXOA 4NXMK 4ELVA 4TU8A 4JI8F 4M3XA 3I55S 2FF3B 1NSKL 3KK2A 5HVHA 3A8IA 4JD2A 2HBJA 1CPZA 1FXRA 1OH5A 3VQ8A 4ZCKA 3K2YA 3WXKA 4CHOA 4QBUA 7FD1A 1Q86O 2OFGX 3HHLD 2MQ8A 3E01B 1ZM2A 2VWKA 1RISA 4MKAA 4RUBA 3TQEA 1AW0A 1U4BA 1WEYA 2LQ9A 5L39A 4USWA 1W0HA 5C2DA 4Q2MA 1REGX 2ZKTA 3IUCA 1T9VA 2VBWA 1NUEA 1NHKL 4MLEA 2FVRA 1FNOA 1RGIA 4HH1A 3UB5A 1R8AA 3KUGA 3VPZA 2OYQA 4DU1A 1IBLK 2J0QD 3O5BA 1N32K 2D69A 2ACYA 5HROB 2GCFA 2QA1A 3BH7B 1HPMA 1X9SA 3HDSA 2HEKA 4NCBA 1IBMF 5FDLB 5FLXO 2NLXA 1UVJA 4BCAA 1T6CA 4EBCA 1GLCG 1L3SA 4FJLA 1RHJB 1VOMA 5KFBA 5KI6A 2YY3A 5EGYA 5D78A 3ENHA 2ZHAA 1S6PB 4AXIA 3SUQA 1GXUA 3EVWA 3HJVA 3NVKA 2VPWB 3G6YA 2WVBA 5HROA 2NRWA 2WRMA 2BMBA 3GPAA 4K8ZA 2QI2A 4IOXA 1AUDA 2EFVA 4LFBF 1WD6A 1HR0K 4OJHA 4IRDA 4RWWA 3H5UA 3A1YG 2ITMA 1FD8A 1HQ2A 5IC6B 2E1PA 3EGNA 3LP1B 4QIEA 1KR4A 4ZVOB 3TTCA 4QIVA 4YOYA 1VQON 2E5LF 1HBMA 2NR0A 1HNZK 4JV1A 3VGSA 5CA5A 2N3OA 3C6HA 1CZ9A 1I39A 4FYXB 4RCHA 4KH6A 1FWLA 4PZVA 2EKYA 5B08A 2XLJA 1ZZFA 4ZTFA 1NJZA 1Q82T 3M6WA 1RBAA 1UAXA 3ATUA 3HI9A 4J91A 3HPOA 3ZT4A 3HHEA 4BS2A 1EKRA 3CJ8A 1VSDA 1RAFB 2RRAA 4HEA9 3GG1A 4G1IA 5F3TA 2G8UA 3FZLA 5D0HA 4DR7J 3PX4A 2UP1A 2ITGA 2XY5A 2RDIA 3A3OB 2V6AA 5DMRA 3QGPA 2BGGA 3KKRA 1LWCB 3R5CA 5AZJB 3P5TL 1S1WB 1TKTA 2KHOA 1RFQA 3SQGB 3CJ9A 5KG2A 1Z4UA 4FL9A 1ATSA 5BPLA 2KM8B 1ZETA 3N01A 3VTHA 2WK4A 3QAUA 3H5YA 4CO1A 3QRQA 1IV0A 3M8PA 1OJ4A 1U09A 5KG7A 3T9ZA 1RCOB 1YK9A 4AQYK 4WFYA 3WC0A 5C24A 1GFWB 1PO6A 1S1WA 3J7YI 5AFUH 1EJ7L 5H1SQ 5EN1A 2E2NA 2MDAA 1J5OB 2JLGA 4DSFA 4FBUA 4Z4GA 1WDTA 4J9PA 1XK8A 4XIUA 3T1YK 2W7PA 3U1NA 4I1TA 5AQQA 2J4RA 3VQ5A 3CJ2A 4G1QA 1VQ8N 1GTHA 5AZIB 4C8YA 4FOEA 1VBYA 3BF4A 2QJ3A 3BZKA 1NSAA 4CZCA 5BR8J 4TLRA 1R8PA 2UU9J 5EDWA 3OA9A 5H9EK 4DU4A 5IV4A 3DU5A 4OZJA 2R8GA 3L3UA 3G8SA 1ZM4A 2DY9A 2DR8A 3BF1A 4CZGA 1S1TB 1XBWA 2Z56B 2MQLA 1TQLA 1KONA 4JI6K 4OZLA 1S12A 3CMAS 1L3KA 3D45A 3OL6A 3H7HB 4B3OA 3HFVA 1RTDB 3WNGA 3SFGA 4MLHA 1XJWB 4K5RA 1LWFB 2CJYB 4P2XA 3HSGA 4BRAA 2ZGYA 1TGOA 4YY3K 1VBZA 4WFNL 3LL3A 3IP0A 2MKJA 3QGIA 2J6SA 1SC4B 4C2MA 3CI5A 4OZ0A 2XBPA 4NOHA 5KFVA 3QSIA 3OYGA 3JQJA 5E26A 3J7ZO 3TZYA 2CUYA 3ETMA 1IO2A 2W01A 3BBFA 1Y7PA 1RT3B 2B9EA 3FSXA 4DTXA 2P5GA 1JLFB 1DTTB 1Y3KA 3R97A 3R9PA 4KYZA 3OHRA 5L1IA 3I8BA 2G8FA 2HQFA 4KSEB 2X1FA 2R7TA 1TK8A 4B3SK 1A5XA 1X4CA 2QFJA 4ZPAA 1HNWF 4K4WA 2FVCA 3MPYA 5KFLA 1X7VA 1RDCA 2DO4A 2OGUA 2ZOMA 1UJ6A 2FHJA 2MQOA 2LA4A 4D3GA 4BREA 3ONQA 3O9RA 4E7IA 4DTJA 3U4LA 2D1CA 3QLHB 5L8RC 2V63A 3M30B 4LFCF 4M5NA 4ES3A 3QBCA 2FPHX 2GUPA 4PWUA 4WYBA 4B9NA 4DV7J 4YOTA 2NXNA 1XMQJ 3P8BB 2YNGA 3JYTA 3VAHA 2OANA 4C6AA 2DXEA 1ATRA 4DR1K 1G3OA 3QIDA 2BTFA 4FXWA 3WZ0A 3CC4S 3HZGA 1XMQF 4LIWA 1KLMB 3M2UA 5CABA 1GLBG 2IAJA 2ZM6F 3S7RA 3PYFA 3V1QA 1JLAA 3KWMA 3G2XA 1CXQA 4OHZA 1J9AA 1AXQA 3V6HA 1BQMA 2JEFA 2DYAA 3F44A 2O1PA 1WSFA 2HQDA 2HQ3A 2BABA 3EM1A 2YKNA 4LR9A 2GAGC 1IM4A 1NU4A 4LSLB 3MPVA 3CJCA 5LMNF 2GUIA 4FK4A 2XWYA 1WTFA 3TSPA 3U3YA 1E3MA 1LOUA 3OVSA 3M2UB 3DU6A 2ZVIA 4FWRA 4MTPA 4FJ5A 1TKXA 3TU5A 4JI2J 1P8ZA 3ZTPA 4FM2A 4DPOA 3UCUP 4WCEQ 1JLGA 1FJGK 4CEQA 1APSA 4JB8B 1VR6A 2RNEA 3HT0A 2Q43A 2KG1A 2BVZA 3KHRA 3DRYA 3PX0A 1VDHA 3C14B 3ZYYX 3I33A 3O5TB 5HK4A 1S4EA 4BRMA 2VG6B 3IG1A 5F2RA 3L2RA 2DVIA 3W3DA 4A8SA 5F8IA 3MD1A 2ZJQQ 1RWVB 5E41A 3N0VA 3R3LA 2FD2A 4F4ZA 4OJ3A 3TVKA 3NMAA 4X66J 2ZM6J 2HHVA 3AJDA 2AEMA 5KG6A 3Q23A 3VAGA 2J0SD 2QRRA 2QL7B 3DLEA 4CF1A 4JI8J 2A10A 1RBRA 2IVYA 4JRQA 3D2FB 3FZHA 1WC6A 3I87A 1HNZJ 2YV0X 3D0PA 2A42A 1VJQA 1RCXB 2FYXA 1MMLA 5J2QA 4MKYA 1H72C 5DQIA 4IOAL 1OH6A 4DL4A 5K8NA 1UJ5A 3OJSA 3V5RA 3FR0A 4O4GA 3DOMB 4CO5A 3OVBA 3L3CA 3GSDA 3OJUA 4LSNA 3THXB 5MLCV 5JMVA 3BGUA 1Q9YA 1T11A 3LDSA 2GJ2A 2YHWA 4ZVGA 3ET6A 3G82B 5LJWA 4AL5A 2G8IA 4JI7J 3P3DA 3JSYA 3O1LA 2KKHA 4GY2B 1CULA 1O51A 4MJKA 3VEVA 3F9MA 3CJQA 2WB4A 1RBTA 1WHYA 3OYKA 4BR4A 4IUFA 2W25A 1SQKA 2J7UA 3NXZA 3IGVA 2QC3A 3CCUS 3GIMA 1HD1A 4IO9Q 5C10A 1BQNA 1TELA 3CF5L 2PA8D 1T3VA 5THWA 2P9NB 3OS1A 3FBEA 2AJ1A 2W2OP 4NLCA 1IR1A 2RQMA 1YGYA 1QQCA 4LRBA 3D6RA 3IDHA 3FZMA 4DS4A 1S1UB 2YQ1A 4KHYA 3JTNA 1C1CB 3PR5B 3PHTA 2JX2A 3LWLA 1HHTP 3KD1E 1HNZF 3MFIA 1IQZA 4FPAA 2HRUA 1XN9A 3OSNA 2ATQA 3R27A 3QEPA 1L3VA 1N52B 2IRYA 4JI5K 3EEQA 3W9HA 1RT5B 3IAS9 1B0VA 1WB9A 1QTMA 1JLBB 2ASYA 4TQRA 1R8CA 1BMQB 4MIBA 3W60A 2H9ZA 3WIUA 1UPMB 1UWBB 3FCWA 3PRBA 4EO8A 4KQZA 1J6ZA 2OD4A 1BG3A 2H65B 3D9BA 5KFPA 4OYOA 3MK6A 4KH5A 3QIPB 3OLBA 4HDGA 2O8FB 3W1YC 4F4AA 4FNHA 4MAKA 2NZCA 3VF6A 3RJMB 1YJNS 2AT1B 2C2ZB 4DPTA 4LF5K 1S6QA 3OBIA 4B1WB 3OL8A 4ECTA 5C25B 2VG6A 2OTLS 1BLUA 5H9FJ 4NX9A 2OHDA 1UWBA 2VFSA 3W9IA 3J7YP 2YBVA 1O13A 1R27B 4DF8A 5HVFA 3NWGA 1NRKA 1PG5B 2Y1LB 4F2RA 3AO4A 2ETJA 3BO3A 3RWUA 4EHTA 3D6FB 5DM6Q 1U1KA 4EP5A 5E3QA 2E1CA 1IKXB 2CDQA 3OR2A 3PRDA 3M4XA 2CNOB 2FHOB 3T5JA 4J2EA 2DHGA 2UXCF 4WWSA 3W2WB 2VCPA 4BRQA 2E44A 3T19A 4FJMA 5DQHA 2U2FA 2MXYA 1PBUA 2AIRB 4YHHF 1V9OA 2HHWA 5GIPA 3FMWA 5KG4A 2QKBA 1RP5A 4JV5J 3IRWP 1VQ7S 4OV1A 4NI2A 1JJ4A 3ITHA 3CCSS 2HIQA 4ZPTR 3U9ZA 4W98A 3P1GA 2KT5A 3ZT2A 2DR5A 1Q7YO 1X4EA 1MWMA 5G0RB 1AZSB 3DRRA 4FYVB 1S22A 4Z4CA 1P27B 1LAVA 4UOFA 2ZHBA 1N5VA 5C5JA 3MM6B 3OXLA 3KUEA 1RA7A 3WXIA 1UFWA 1S49A 2R3VA 1AFJA 4CP5A 3HHLC 1HNVA 2VC1A 4LIRA 1V5VA 3FSYA 1SH3A 2BE2B 4DR4J 4DR5F 5CCLA 5KGXA 2GZOA 4CZFA 4Z94A 1FFSB 2OPSA 2E5JA 4F7VA 2JEGA 1YIJS 4DV1J 1VLYA 1HR0F 2HMIA 2QWMA 3FQLA 1BCMA 1P1TA 4TY8B 3FVYA 2R2SA 2PZSA 3OR1A 2N4CA 4KGVB 3LH2S 2ZH1A 3UDLA 2VPYB 4K4UA 4NCGB 4OZ2A 4JKBA 4EYHB 5M1FA 3I4PA 4L76A 1EETB 1EKSA 2R8HA 5KOXA 1YF5L 4JYAK 1YXQA 3D68A 1YVUA 4I9QA 3AVIA 2HHQA 4DMNA 4ZIWA 1TMJA 2O8DA 1FXXA 3P4IA 3BZQA 2YJEA 4GVEA 2YVSA 3KK3B 4IO1A 1UW9A 5IT9Y 2N82B 4ED8A 3J80O 4GC7A 3WQPA 1RT4A 4WQ4C 2F4VK 2AJQA 1QAJA 1QAYA 4UUXA 4OX8A 4BVOA 1RHMB 1EP4B 4IOCL 3Q7BA 2JWKA 1RCHA 1OQ6A 4OI2A 3EPGA 4TSXA 5IWAF 1S77D 2KKZA 2A3JA 1NKCA 4LF8F 2HSTA 3AB4B 1SH2A 3NCPA 3NS7B 2ZJPL 2Y1IA 1GOBA 2EPIA 3NGTA 5A0YB 1V3ZA 3LAKA 3FCVA 3IO1A 1HBUA 3QWPA 4DV2J 1SIWB 3QGGA 2P9IA 1URNA 3UR0A 2ZBCA 3BSAA 4K43A 3MAAA 3NNAA 3SBMA 1DEJA 3ZX0A 1FFWB 1AFIA 1JXBA 4DV2F 2MZQA 4O3QA 1Y0HA 4CLUA 4BG8A 1P9YA 2AYMA 4FLWA 2VQEK 3GV7B 5FPDA 4G1QB 4O8KA 5DG7A 3MCPA 3FMBA 2ZZMA 3U3GA 3QNOA 2WSEC 3GR0A 3CCJS 1PAUB 2NSCA 3IN5A 2V4JA 3T1YF 3PW0A 3A0IX 4RW7B 5ETVA 3VEYA 3SSQA 4DTPA 3Q24A 2XMWA 4DR3J 3VVTA 3HSCA 3VQTA 3EX7B 4LREA 3Q8VA 3WX8A 1U2RA 1I94F 2OO4A 3D6TB 2HNDB 2G9OA 4ZJOA 1SQEA 2MHEA 1S0MA 4OLOA 1RTDA 2JFKA 3MEDA 1ZM9A 3K5NA 4H4MA 2BQUA 1MNEA 3HYFA 1C0MA 1EO1A 4IJAA 2VD3A 3CT9A 3ZZYA 1GMWA 4DSLA 3SAGA 2M0GB 3FEYB 3QESA 3L2VA 2W42A 3D54A 2G2OA 4DUYJ 4LBHA 4ID5A 3Q8PB 4MKVA 3QJLA 3MMCB 4DQIA 4M3ZA 4BQLA 2EBEA 2E2PA 1K6YA 1U1RA 5BYQA 4FF2A 1VSEA 3AY9A 3A13A 4BWJA 3TABA 5KPRA 4O5FA 3CQYA 3H4BA 4ISEA 4Q8FA 3CB4A 4H5VA 1F9HA 3MM8B 2RE1A 4IO9L 1M5VC 1YITN 3SCXA 3RMBA 5GADP 1FTRA 3DOLA 2YX7A 5AQGA 2WSCC 4I6AA 2OD6A 1FD2A 3ILLA 5DG8A 1UOCA 2CWXA 4AYBD 2C42A 4EFAC 4F3MA 2HK3A 1YIJN 3M30A 1A9NB 5IT9O 4W92B 1CJUB 4DR2J 2PFFB 5H9FK 1T7PA 3EDRB 4CW7B 3AO3A 2RS8A 1FF2A 4M8LA 1MA9B 3BUZB 4FZXC 1S72N 5B0CA 3OYHA 3SQ2A 1KC8O 3CJKA 1MU2A 2BJDA 3I8DA 1UWAA 4KFBB 1N48A 1KHVA 3F73A 4TLQA 2CZ4A 5M1OA 1H98A 2Q97A 5AQYA 4K7QA 4O4GB 3DOMA 3HL8A 2HHHJ 3AVNA 1N88A 5ETLA 1FTCA 4X66F 1NHVA 4C7QA 2EI5A 2B56A 5IWAJ 1U1PA 4YR3A 2DH9A 4Z4FA 1CSJA 3MDFA 3H40A 2BUNA 2ZD1B 4IBNA 5CD4A 5GADU 3IA0A 4F4KA 4IOCQ 1NLVA 4HVZA 2GMJA 4CJLA 4K5SA 3EE3A 4IR9A 2KG0A 1HBOB 2OZMA 4KRFA 2NCKL 1CJKA 3T1AA 2W9BB 1QE1A 2BKOA 2XY6A 3UN5A 5ETKA 3ID6A 3CCTA 3ZETA 3EZ5A 3OYBA 5KFMA 4O3PA 5GINA 3K0SA 2QLXA 4WU3A 3W61A 1S1UA 5HP1B 3PEJA 1Q8IA 4E8UA 4BRHA 4DHVA 2M2BA 3O9SA 4W5TA 3EPIA 1JIHA 1RSCA 5T14A 3CCSN 4C8OA 1R8HA 1LXJA 4EBEA 4ZHRB 1QTNB 3L6QA 4LFAJ 4QS8A 3V6JA 3A5LC 1G7CB 4ZP7A 4HTJA 5DDOC 3O3GA 3GP9A 1NGEA 3RB3A 1Q86T 3H46O 1RI7A 2FC8A 3M3ZA 1KOOA 4HVJA 1UCNA 3THYA 3O3LA 2HWIA 4ERDA 4MT1A 3K7RA 2D4WA 3A5NC 4A5AA 4PXDA 3ZSXA 4U6PA 1RQ0A 1YRUA 1N34K 2C3OA 4ZVTB 5A8RB 2DIVA 3PR4A 3SIPB 1NJIT 3QQCD 3BB5A 3TI0A 4CYUA 3SJHA 4CIFA 4B9SA 3MR5A 3MCAB 1LK7A 4KO0A 1T9YA 3DRPA 4OGCA 3SPZA 3BGRB 2I5JA 3BN4A 1NMDA 3THYB 2LCWA 4IOBA 3VAFA 4USTA 1T05A 2YHYA 4DV0K 4F04B 2NRVA 2V4RA 1YG0A 2GVZA 2DFFA 2BJ1A 2QLJB 2CQ1A 2GAHC 4TYBA 3TUZC 4X62K 4A48A 2KDOA 4ETXA 2HAFA 4DV0J 5KQ8A 4Y0FA 4NLUA 3G71S 4M7XA 1RADB 2D0BA 3VV2B 1RTJA 5KG3A 2WONB 2CFXA 1NK8A 1C1AA 1EHWA 1KQKA 3NL0A 2ALZA 2R7SA 4FJ8A 2I1RA 3NCIA 2AJ2A 3NVMA 5HRRA 4GKJF 2Q3SA 4O55A 4WFBL 1HNIB 3CDEA 1MROB 2QSWA 3GG0A 4L3NA 1YAGA 2JDJA 1S57A 5K9FA 1A5VA 4E19A 1KQSM 3THVA 5JLFA 2Q6BA 3CEDA 3BREA 1BA1A 3M2RA 4GV3A 1VQ9N 1I6JA 5CYQA 5L1LA 4L8RB 1X4BA 1FRKA 4FWQA 1JLBA 3KKSA 2YPYA 1VK8A 1TL3A 3IKMA 2XGQA 1K0VA 4BR5A 4O8UA 3MI7X 1F0XA 4DU8A 2AV5A 2F3JA 1LW0B 1RBOB 4HCBA 5KT4A 3ILIA 2ZGZA 1WSVA 5L46A 3Q8SB 4CEBA 4FJJA 1TKZB 2IA6A 1YTAA 5AXKA 3S1TA 4ZCIA 4DR3K 1RWOB 3MWTA 1R89A 1RAAB 3EVOA 4QWDA 4Q43A 3BKUA 4WZQA 1VHXA 2ZF5O 4QR2A 2HOEA 4ZVHA 4WP9A 2Y1JA 4O44B 5IT0A 1G1XA 2HHUA 4QS9A 6FDRA 2X51A 1KVJA 4JS5A 3DFEA 3HKWA 3OYCA 2HNZA 2KH9A 3M6UA 1M1GA 3M8RA 3G6ES 1J2VA 4KPCA 4EMDA 4J5OA 2VFRA 5AQTA 3AXMA 5CXTA 1F21A 3NBPB 3KWGA 1GLAG 4DR5J 3CF5Q 3WC2A 1TMMA 3OYLA 1B0TA 3K5PA 2ADCA 4YDUA 1TP7A 4WJBA 2XS5A 4DF4A 3QEWA 4GKJK 3MM5B 2UXCK 3Q2SC 2ZH2A 4CZIA 3GCWP 3TX8A 1NJIO 3KK1B 1LWEA 5HAOA 3SK3A 5B0EA 2Q0RA 1Q8LA 2DGUA 1VSLA 3KDOA 2XSFA 3FC9A 1HPZA 4XDDA 2DNGA 2CQ2A 2C2DA 2BANB 4JI6F 1KQGB 1WHXA 9RUBA 2E5HA 2V52B 4DQPA 3TAGA 2R9LA 3JSMA 2FLOA 3HULA 1S59A 4RW4B 1BE4A 1U04A 1IUJA 1YDLA 3P39A 4O3NA 2I0XA 2ASDA 4H5RA 5L38A 3FUYA 1ULRA 1CS4B 1W25A 4NLTA 2P9GA 4NYZA 4X64J 5DETA 3QWUA 2J9DA 2B4OA 2XTJP 2P51A 3T5HA 4JI5J 2V4JB 5KFRA 4JK7A 3U1LA 5M2PA 4KHSA 5F0WA 4C9DA 4BVPA 2OPSB 4WIIA 4A2BA 2UVVA 1FJ7A 4WFNQ 2QA4N 2NRHA 3DLGA 1RABB 4UW2A 2HQCA 5BR8K 3OR1B 4LF7K 2GJIA 1RT6A 2XGPA 1RBUA 2WBMA 2BJEA 3US5A 4F26A 3GJSB 3UPFA 4K42A 4J2DA 4J2BA 4QIFA 1KBRA 2FTRA 2CIMA