4I2PA

Crystal structure of hiv-1 reverse transcriptase in complex with rilpivirine (tmc278) based analogue
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
554
structure length
554
Chain Sequence
b'MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gag-Pol polyprotein
publication title A comparison of the ability of rilpivirine (TMC278) and selected analogues to inhibit clinically relevant HIV-1 reverse transcriptase mutants.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Hydrolase, transferase/inhibitor
total genus 155
structure length 554
sequence length 554
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4i2pA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4i2pA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4i2pA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4i2pA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4i2pA05
1YTAA 3DRPA 1HYZA 2ASDA 3ICLA 5KFGA 4FJJA 1D0EA 4R8UA 2P5GA 4MFBB 2ZE2B 3OS2A 4NLVA 3BSAA 4CGDA 1CXQA 5CZ2A 4E3SA 1I39A 3OYIA 4I2PB 3O4NA 4FJIA 5HLFA 2YHAA 4ZTJA 2YNHA 1LV5A 4BE2A 2G8WA 4RNFA 4ZPCA 1F21A 4L8RB 2OPPB 1S0NA 4J2DA 1S0MA 4J9QA 1EKEA 4E7IA 4J2EA 3BREA 5KFFA 2WONB 2G8HA 3MEEA 3TQ1A 4N56A 4DWIA 3MEDA 2B5JA 4ZMMA 3G10A 2YNGB 1IM4A 2B6AA 1DTQB 2V4RA 4CEFA 1KLNA 3SI8A 1JLBA 2FJWA 4WZQA 4J2AA 1RT5A 1Z4UA 3VN5A 2BE2A 3V4IA 1C2PA 5KT4A 2HB5A 5KT6A 4J9NA 4ECXA 4BE1A 1LAWA 3VQQA 4DL7A 1NHUA 4O4RA 5DLGA 2R2TA 1HPZB 4KRFA 1S6QB 1KVAA 3V6HA 4CHZA 2FJXA 4U7CA 3DRSB 4FCYA 4EZ6A 3RWUA 2HHSA 3OVNA 3U3GA 2DY4A 2D0CA 1RYSA 3KJVB 5EWFA 2G8VA 4NZ0A 1C1AA 3AO5A 4HTUA 1CZBA 4TYBA 1TP7A 5DLFA 3MECA 1KVBA 3C95A 1JIHA 5KGWA 2OPRB 1ZYQA 5DQHA 3KLEA 4LSNB 4TY8B 3Q8RB 3SQ2A 1JLAA 4NLYA 3V6KA 3NGYA 1C0TB 2WTFA 3ISNC 1J5OB 4XO0A 4W5RA 4OLAA 1RCHA 1FK9B 2HNYA 4URSA 1LWEA 3K57A 3M8PB 5J2QA 3ASMA 4QWDA 3PR5B 1VSIA 4DG1B 3MXIA 3SYZA 4KKOA 3KTQA 2YNFB 1KFDA 4XPEA 1LWFA 1VSMA 2QE5A 1R0AB 1BI4B 1WSGA 2D41A 3AVIA 4AHRA 2DFFA 4DFJA 2ILYA 3BGRA 4Q8FA 2BR0A 2QV6A 3NAHA 1T3NA 3D28A 4ZHRA 3T3FA 2GIRA 2JEFA 1TKXB 3TR8A 1KFSA 4M3XA 4FBUA 4YR0A 3KLHA 3M9MB 3T5JA 4FW1A 3TANA 4NRTA 4CGFA 3DLHA 3QIDA 4LSLA 3GV8B 4JUZA 3P83D 3KD1E 4B9NA 2DTUA 3AO4A 3DYAB 3K2PA 4GC7A 3LPTA 1JLEA 1IKYB 2DPIA 4KV8A 1X9SA 4URGA 3SNNA 3ZSOA 3I5BA 1QAIA 4F2RA 1FKPB 3RMAA 3LANA 3Q8PB 2D3UA 3D5MA 3O3HA 3UPFA 1SKSA 4CESA 5CYMB 3RB4A 4K4TA 3V6JA 1HRHA 4ECYA 4CEOA 1NKBA 4ELVA 4J9PA 4O3OA 3K5OA 1S1XA 4DTJA 2G8UA 4O5BA 2LSNA 2P5OA 1S6PA 1HQUB 2C2RA 1S1VB 4FLWA 3HYFA 3OYLA 3LP3A 4KHNA 4J9KA 1ASVA 3UIQA 2YNIA 4DTPA 4RU9A 3CM6A 2KFZA 5EWEA 4ID5B 4DQRA 3QNOA 4ID1A 4DSLA 4GW6A 1W0HA 3ALYA 3SUQA 1HARA 3OYDA 3RR7A 3EPIA 4CIEA 3HVWA 3SFGA 1JXLA 1IH7A 5K14A 4CJSA 5F8GA 4N76A 1LW2A 3FDSA 4KPYA 3HL8A 4ECVA 3ZT2A 2XI3A 2XHBA 2D3ZA 3LP1B 2FVCA 2J6TA 1B92A 1BQNA 3QLHB 3FFIA 4HUGA 1FKOB 1RDRA 4Q0BB 2WCXA 3TVKA 2ASLA 3KNAA 1NK8A 1JKHA 4TN2A 4KHSA 2VA3A 1X9WA 3PJWA 2FVSA 3OLAA 3HP9A 1NNDA 4B8CA 4ECZA 4FK2A 2W9BB 1KLMB 1LWCB 4DQPA 3HK2A 1HNVA 3SV3A 3SQ0A 1RDDA 5J2PB 2YKMB 2Z1JA 1L3UA 4KTWA 1GOCA 3L2UA 2V9WA 1TKTA 4WFYA 3ITHA 4O44B 5FROA 2HMIB 3OYCA 3VQAA 3MXMA 1VSJA 4HHTA 5EUHA 5KFVA 3VA3A 4RW6B 3CJ2A 1HNIA 2G8FA 4RNMA 3NH2A 4QOZB 1WAJA 5DG7A 3IS9B 4W5QA 1NKCA 2QXFA 4KBIA 1L3VA 4KHWA 1DTTA 4ZPDA 4FK0A 2ZE2A 4K4WA 4NLUA 4CJUA 3NAIA 2AGPA 1RA6A 4M41A 4TSXA 1RTDB 4ZVGA 4JV2A 2IC3A 3RR8A 4Z4FA 4I2PA 2HHTA 1VRUA 2D7SA 4M3YA 3G0ZA 3KK3A 2CKWA 1MMLA 1TVRA 4NLGA 3DOKB 2OPPA 4FJ5A 5KRSA 4F4ZA 2E6LA 3VQ5A 4CJ3A 1J54A 3KKRA 3H4BA 2IM1A 1A5WA 3JYTA 3H98A 3K59A 2ASJA 1KVCA 4ICLA 2OA8A 1DTQA 2AX1A 5FRMA 1SKRA 5D3GA 4DL6A 3NH1A 2BRKA 4F2SA 4I7FB 4E7JA 5KFTA 4F3TA 4ED1A 2R8JA 1B9DA 1HJRA 3SUNA 4IG0B 3KLFA 4Z4GA 5HROB 4BDZA 4WFXA 4NCAA 4JRPA 4CFCA 3VQ6A 2BDPA 1WSHA 2IMWP 4ED2A 4LY7A 3TAGA 1C0UA 3SV4A 5C42B 2E9TA 4ED0A 5KG4A 1FXXA 4O3PA 4Z4HA 4FM1A 1NJWA 4CCHA 1JXBA 3TAEA 3DRSA 4QPXA 3BQ1A 4Z4EA 5DG9A 2X78A 4KB1A 3OYNA 4H4MA 1NOZA 4PQUB 4NLWA 1TAQA 3BSNA 1RBTA 1KHWA 4CFDA 4IG3B 3CDWA 4XIUA 1C0MA 1Z25A 4IFVB 5F9LA 3QYYA 1C1CB 4Y1CA 4IRCA 4LSNA 4FJ7A 5KFIA 4AHUA 2ZD1B 1C0TA 3DOLB 1ZBLA 3SCXA 3DM2B 4YFUA 2UVRA 1WSIA 1VSHA 4CERA 5L1IA 4CK1A 3QEVA 2R8GA 4EO8A 3ZT0A 3G86A 1SUQB 1QS4A 1N4LA 2GV9A 3U3YA 2ATQA 3L2QA 1IKXA 1K6YA 3AA2A 4IRDA 1R0AA 1GOAA 1JLGA 4MIBA 4K4XA 1UWBB 4CHQA 3RAQA 4NLQA 4ZVFA 5E41A 3SPZA 3IRXA 3I0SB 2J6SA 2A1RA 1YTUA 3EPGA 1HYSB 2IM3A 3OL6A 3HXMA 4ED6A 3ULDA 4Z4IA 2HHXA 4NLDA 3NL0A 4CHOA 3T5KA 1J53A 1IKWA 1JL2A 4O3QA 4F4WA 4KAZA 3KMSA 4PUOA 3DYAA 4J9LA 3PX6A 4AHVA 5CY4A 1N6QB 4CGIA 5J2MA 4NLOA 3NDKA 2BANA 1REVB 4NYZA 4CJPA 3PW7A 1JL1A 5CYMA 2FVPA 3VQDA 4CEDA 1BIZA 4E7HA 3G6XA 4QWBA 2Z1GA 4ZPAA 1C1BB 2C2DA 1JXEA 4QW9A 1ZBIA 5KFCA 4K4ZA 3AVBA 3H5XA 4QAGA 2C22A 1VRTA 3HVTB 1UOCA 4CJRA 4CGHA 2IAJB 2R8KA 4M94A 3LWLA 4N47A 2Y1IA 4DU4A 1QSSA 4JS4A 2BGGA 4ZVEA 4QWCA 2VG5B 4OPJA 1TL3A 4WE1B 1ZBHA 1TKDA 2JEJA 3GV5B 3K5LA 1QE1B 5KFOA 3PR4A 2XY5A 4ZP8A 1QSLA 4IOBA 3IG1B 3TAQA 4ZP9A 1S1WA 2KZZA 1RT3A 5HP1B 3OHBA 3DLGB 2VG6B 3B6PA 3LP1A 4DLEA 3FQKA 5KG3A 4RW7A 1GOBA 1VK0A 3SUPA 3RMDA 4LD0A 2D0BA 4KE5A 2HW3A 4TXSA 3V81A 1TK5A 4O3NA 1YT3A 3M8QB 1I6JA 1NK6A 2W9BA 2IM2A 4MH8A 1LWCA 3JSMB 5T14A 2R2SA 3G6YA 2EHGA 3C6TB 2W9AA 3KK2B 5JUMA 3HKWA 2D5RA 1SKWA 5DG8A 2YKMA 2I5JB 4OKJA 4M3RA 1EETB 4J9SA 4E0DA 1RTIB 4DF8A 4RW9A 3EZUA 2OZSA 5I42B 3RRHA 4FZXC 4B9LA 2PZSA 2UUWA 4ZPBA 3ZSVA 3QIPB 2XGQA 3ZT1A 2RDIA 1RT7A 4JLHA 2C2EA 3VA0A 3ISND 1S9EB 4HUFA 4O3SA 4KB7A 1C6VA 2RKIB 3NF9A 4RUCA 3CJ3A 3IS9A 1T03A 1EP4B 1TK8A 5I3UB 1QHTA 4ZP6A 4IFYB 4B3OB 3RB3A 4XPCA 3AO2A 2X6SA 1JLFB 3GIMA 1TGOA 2W7PA 4FJ8A 1TQLA 3L3UA 2XY7A 5HBMA 4URQU 4Q5VA 2HAIA 4FVMA 1T05B 1RTDA 2R7YA 5KFEA 5DK5A 3KHLA 1SL2A 1U47A 2IS3A 4NCGA 4CJQA 2YHBA 3LALA 4EO6A 1D9FA 3NH0A 2B43A 5KFYA 3THVA 1RTJA 4IH6A 2XCPA 4FLVA 4J9OA 3KIOA 3BQ0A 4BDYA 1LW0A 4Q8EA 1WNSA 3LZJA 3RAXA 2UVVA 3G6VA 3MR6A 3MR5A 1Q9YA 1YVUA 2WRMA 4I7FA 4TY9A 4IG0A 4KO0B 2DFHA 1NK5A 2FBXA 1S1TB 2QKBA 1TV6B 4Y2AA 1KRPA 3FSIA 2W9CB 5C25B 2WHOA 3TARA 2RF2B 2Y1JA 3H59A 4C8MA 3MEGA 3LP2A 3L2RA 5KFSA 4M3UA 2J6UA 2Z1HA 4QW8A 2PY5A 3K5NA 3Q8SB 4E1NA 1T94A 2P1JA 2XI2A 5KFLA 3V9ZA 4MQ3A 1BQMA 3AO1A 4PA1A 5F8IA 1RBSA 4OKEA 4IR1A 4BACA 4IG3A 3IGVA 3HSTB 4DQQA 2GBZA 3O3FA 1TAUA 4JRQA 2OPQB 2JC1A 5KFRA 1X9MA 4QWEA 3AVLA 3NKYA 3NGZA 3T5HA 2XY8A 3DM2A 4NLSA 4G1QA 3QGHA 4W5OA 3AA5X 1LAVA 4Z4CA 5KFDA 4CEEA 4I2QA 1RT6A 4WXOA 3NE6A 1DLOA 3GV7B 1RBVA 4DFMA 3TABA 3WNFA 4H4OB 3VQSA 1QAJA 4DSEA 4OPKA 3DLKB 1K1SA 3OL9A 3ZSZA 3F73A 3SPYA 2IGIA 1D1UA 2G8KA 1IKVB 1UWBA 1K1QA 4ECQA 2HNZB 3AV9A 2YKNB 3T5LA 3I0SA 4RW8A 4FZZA 3TWHA 1BIUA 1HYSA 3LWMA 1MU2A 1RBUA 2FBTA 1NK0A 4ECUA 4HCBA 4EBDA 5CZ1A 4F3OA 1KSPA 1NOYA 3CO9A 3IGNA 3PHEA 2Z1IA 3VQ8A 2E6MA 5FDLB 3OSPA 4MIAA 4NLTA 5KG5A 3MF5A 4NRUA 3KD5E 1HYVA 5J1EA 1SV5B 2OYQA 1RT1A 4O0JA 3KHHA 4DTSA 1RT2A 1XHXA 4FBTA 2KFNA 3M8RA 3V6DA 4CGGA 4G3IA 4E7LA 4DTOA 2HVIA 3V1QA 1RYRA 4R8UB 3T19A 3GQCA 4K8ZA 3CWJA 4RW4A 4R5PA 1RDBA 3OYHA 3I0RB 1IG9A 1C1BA 1X1PA 3IAYA 2XRIA 3VQCA 2W8KA 3E01A 4K4VA 4DFPA 3CDUA 1RBRA 2I1RA 1TKZA 2OPSB 4K4YA 2IAJA 4LH5A 3WNHA 4ZP7A 2WK4A 3KK1A 5KFXA 4CHPA 4KI4A 1NKEA 3CFPA 2BQRA 4YR2A 1IO2A 3AO3A 5F8LA 4Q43A 4WE1A 4MKAA 1QQCA 3MEEB 3CDEA 3OYEA 4KHRA 4IRKA 1JLCB 3MEDB 4DU3A 5DGAA 1S10A 4OGCA 4CF0A 4BWJA 4J9RA 4EYHB 3H5UA 2B6AB 4FJHA 4MK9A 1S48A 1L3SA 2FC0A 4EBCA 3VQPA 2HWHA 1L3TA 4MFBA 1Z26A 4FJGA 3V4IB 2E9ZA 2AX0A 5L1KA 5HP1A 3N6MA 3DLGA 4UQGA 2Q3SA 4CJTA 3T1AA 4H54A 1SL0A 1U4BA 3AVKA 4FZYA 4KTZA 3VQ4A 2DPJA 4DTMA 1G15A 1RILA 4CK3A 3NHGA 5KGXA 2FLLA 3DLRA 2CJQA 4DS4A 4DQIA 2F8SA 3M8QA 3CFOA 3VQBA 5J2NB 1NJXA 2IDOA 2WONA 3JSMA 4ED3A 4B8AB 3C6TA 4ELTA 1A5XA 2YNGA 2XCAA 3V9UA 2GC8A 2O4IA 1EETA 3MECB 4FLUA 3OYBA 4FLZA 5FRNA 1WSJA 4OJRA 5I42A 1U45A 3PW5A 3KLEB 3BQ2A 4FM2A 2PYJA 3SQ1A 2HNYB 5HRPA 4LQ3A 4JV0A 1LWEB 1U48A 1HMVB 2C28A 2F8EX 4B9VA 3QINA 3QGIA 1HPZA 4K4UA 1S6QA 5I3UA 1S49A 4B3OA 3QEXA 2KZMA 3P1GA 3V9WA 4FJNA 1JLFA 5KFNA 3GIKA 3GIIA 4LH4A 3BSOA 2ZKUA 2ITGA 3PUFA 4OKKA 3PO5A 5JXSA 2HNDB 3PX0A 1T05A 3KJVA 3QESA 2W8LA 1XR6A 2FBYA 4YR3A 4K8XA 2HHWA 4KHYA 3DDKA 4ZHRB 3AVJA 4PWDB 2AQ4A 4IR9A 1GX5A 2OPRA 4Y2CA 4KHUA 3N6LA 4TY8A 2WOMB 3U6FA 4NLXA 4LSLB 1J5OA 3LZIA 4F4YA 3DI6B 3H5YA 1FK9A 4TQRA 3BDPA 4O4GB 1RA7A 1OS5A 3RBDA 3M8PA 1L5UA 4BDPA 4DG1A 3S3NA 4EP4A 4FJMA 4DMNA 3NGDA 3ZSRA 5KFUA 2YNFA 4KO0A 1S1TA 3V9SA 1BI4A 3PV8A 4KREA 5C25A 4KB0A 1NK9A 4C8LA 2XWYA 5KFJA 1UAXA 1TKXA 4KFBB 1VSEA 3M9OB 3KOAA 3OHAA 4NLPA 2IBKA 3H2LA 4CEQA 3SJJA 2RDJA 3M9NB 2WB4A 4HVJA 4O55A 4NYNA 3OJUA 4E7KA 3H08A 3RBEA 4CGJA 1IKYA 3ZT3A 4CEBA 1FKPA 2OPQA 1CSJA 3KLGB 1D9DA 5K14B 2AGQA 5KT2A 4DSIA 1HQEB 1WSEA 4RNNA 4IBNA 4B9MA 4KAIA 4ELUA 4DQSA 3H4DA 1VSDA 3QEIA 3HT3A 2O4GA 3KMQA 1HQUA 3CJ4A 1S1VA 1ZETA 4N5SA 4EYIB 4H4OA 4TQSA 4CE9A 4C8KA 2O5DA 4ID5A 2AWZA 2E9RX 2JEGA 2HNZA 3I5AA 4ECWA 2RPIA 3PJXA 2ALZA 1XI1A 4B9TA 4AHCA 1BHLA 2YV0X 3VQ7A 3TAPA 4CECA 3UR0A 5KG1A 1NJZA 3MXJA 4MKBA 1TKTB 3ITHB 3NAEA 2IM0A 3L8BA 5F8JA 5FDLA 4Y34A 1U49A 1JLQB 3PZPA 3QLHA 3DLBA 2XC9A 1FKOA 4C8NA 1ASWA 4Q0BA 2KQ2A 4CJLA 3WNGA 3NBPB 4M45A 3UQSA 1XR7A 4FM0A 3HJFA 1DTTB 3I0RA 3L2VA 3ZCMA 4IKFA 4WFZA 3QNNA 2UVUA 1KLMA 1CZ9A 4DL3A 4CHNA 3KKSA 2IC3B 4R0EA 1VRUB 4DFKA 1JX4A 2OPSA 5J2PA 1SH2A 4CF1A 4O0IA 5F9NA 3KK3B 1TVRB 4M3WA 4K4SA 4CF2A 4FLTA 4O44A 2QK9A 4IQXA 3B6OA 3HPHA 2HMIA 5KT5A 4DTUA 1VSKA 4YQWA 1Q8IA 3JYTB 4RW6A 4C8OA 3DMJB 1S5JA 3ZT4A 4AILC 1JLCA 5HRRA 2HHUA 1U09A 3E51A 3DLEB 4ICLB 3CVKA 5D3GB 4B08A 2QKKA 1QSYA 3QZ7A 1TL1B 3D45A 4FK4A 3HM9A 1BGXT 2A1SA 2BQ3A 3KLFB 4ECSA 4FLXA 4CJWA 2R2UA 4WYWA 3OYFA 4JS5A 1ZBUA 4RNOA 2R8HA 4TLRA 5CYQB 3MR3A 3RB6A 3MAQA 3NCIA 1NJYA 4DTRA 3LPUA 1KHVA 1C0UB 3K5MA 3DOKA 4F50A 3LDSA 3N6NA 1XC9A 4ECTA 1CLQA 5J2NA 3QERA 1U04A 1XHZA 4GC6A 3FRZA 3KLIB 4H4MB 5C24B 3SFUA 4DS5A 3HPGA 4DSFA 1I3AA 3GIJA 1T8EA 3EY1A 4F4XA 5SWMA 1GX6A 4I9LA 1ZTWA 4FJ9A 1WN7A 4CJ5A 4EEYA 5KFKA 4CK2A 2PYLA 5HROA 2V4QA 4M95A 3V1RA 3RB0A 4YP3A 5HRSA 4DSKA 1HMVA 4YNQA 4YMEA 5KG7A 4Q45A 5KG2A 4CFBA 3C6UB 5C42A 2HHQA 1IKXB 2R8IA 1D5AA 1RTHB 1RNHA 3O4QA 5EWGA 2UUTA 3VQEA 3BSCA 2X74A 4NYFA 3QO9B 1JLGB 5DQGA 4F4KA 4OL8A 3GYNA 5L9XA 2HNDA 3OYGA 4HUEA 2V0NA 1S1UB 1S4FA 3ZSXA 2AU0A 5F8HA 4RNHA 2VWJA 4PQUA 3IRXB 4Y3CA 4PWDA 2IA6A 3LAMA 4X2BA 4OGEA 5KRTA 1RAJA 1SL1A 4CEZA 1RT4B 4IFVA 2AJQA 1C1CA 3LP0B 5KFMA 3PW4A 2WOMA 2ZD1A 3DOLA 3QGGA 1NK4A 5KFQA 5C5JA 1IKWB 5JS1A 2FVQA 3DI6A 2FJVA 4GVMA 2EC0A 3CG7A 1XR5A 4PUOB 1J9AA 4O4GA 3CYMA 3HVRA 4IDKB 2UVWA 1S9GB 3TAMB 2ZQBA 4CIFA 5KFAA 2KTQA 1D8YA 1SUQA 1KTQA 5KFHA 1RDAA 2E4LA 5J2MB 4FW2A 3PW2A 2BANB 1ASUA 1W25A 3AVFA 1N5YB 3EZ5A 4N41A 2FLNA 3NGIA 2OZMA 4WYLA 4DSJA 4WXWA 3DRRB 3H40A 3RMCA 4E1MA 3D0PA 4EP5A 1ZTTA 2NUBA 4KFBA 4CJVA 1XWLA 4CJ4A 4DL2A 1VRTB 4FJLA 4JV1A 4Y1DA 3K58A 4CFAA 1NK7A 4WZMA 1VSLA 2VG7B 4F8RA 3PVXA 1SH0A 2XY6A 3QEPA 2EX3A 4ED8A 3NMAA 1TL3B 4CHYA 4M42A 3QETA 1N6QA 1S97A 5KT7A 4I9QA 3AVAA 3DRPB 3KLGA 1REVA 1HQEA 3S3OA 4CEAA 3NF8A 4GMJB 1BL3A 4B9SA 4EBEA 2XGPA 2D0AA 1S1WB 5EU7A 4AHSA 2GIQA 1RT3B 5KFZA 2ILZA 4U6PA 3SZ2A 4RW7B 3PO4A 5HLFB 2YNHB 3EYZA 3I8DA 3HVTA 4NLRA 1N56A 4E19A 3ZSWA 3V81B 2X6NA 3O3GA 3MTKA 4B9UA 3OLBA 3RTVA 2ETJA 2VG5A 3KLVA 3WNEA 1QUVA 3AVMA 3FQLA 2AGOA 4CJFA 3Q8QB 2B5JB 5KG6A 4ZTFA 4KSEB 4OVLA 1QE1A 3OL7A 4FLYA 1JLBB 2G8IA 2IJFA 4RW9B 2ATLA 4K50A 1RDCA 3OJSA 2F96A 3OSNA 3OYJA 1RT5B 5KG0A 1EX4A 2W7OA 4DTXA 1WNEA 3IG1A 1ITGA 2BE2B 3OS0A 3P5JA 1RT7B 4FS2A 2VG6A 2RN2A 1JLQA 1S0OA 4KTQA 4ECRA 1VSFA 3OS1A 1T03B 4DL4A 3NBPA 2FLPA 4W5NA 5DMRA 3OY9A 3BR9A 1S9FA 3CJ5A 3HO1A 3HHKA 3SI6A 4DEZA 3RMBA 3AA3A 5HBMB 1SH3A 3KK2A 3NF7A 4OLBA 2I5JA 4NCGB 3CFRA 3I5CA 5KFWA 1RTIA 1Q9XA 4M3TA 3RRGA 2F8TA 1EXQA 4BWMA 4RZRA 3ZSYA 4IH5A 3LAKA 1RTJB 1JLAB 3QIPA 4E89A 3C94A 2XO7A 4IKAA 3AA4A 3DMJA 3PX4A 1LW0B 1S9EA 4CF8A 3ZSQA 4FJKA 2OH2A 1CXUA 3L3VA 1B9FA 3DLEA 3AVHA 2RKIA 2P51A 5J2QB 1WLJA 1EP4A 4CJEA 5T7BA 1TL1A 4IFYA 4KKOB 4FYDA 2R2RA 1W9HA 3NFAA 3OYAA 1LWFB 2IOCA 4HKQA 1TK0A 5DGBA 4MK8A 1O1WA 5SZTA 1A5VA 3L2WA 3HP6A 3PW0A 4W5TA 3BGRB 1NHVA 5CYQA 4DF4A 1T7PA 4ED7A 3VQ9A 3MEGB 4DLGA 3LP2B 4IH7A 2FBVA 1ZBFA 4QCLA 4RG8A 3MFIA 3KLHB 1WAFA 2VWKA 3OL8A 4DU1A 3TI0A 4FJXA 3MR2A 4NCBA 3SQ4A 3KHGA 3KLIA 5C24A 2VA2A 4TYAA 4FS1A 1BQMB 1JLEB 2BQUA 2IJNA 4KV8B 3MFHA 4AHTA 2HVHA 3OYMA 3A2FA 5EDWA 4HCCA 3H5SA 4MK7A 1TV6A 4G1QB 3M8SA 2W9CA 3NF6A 4ZVHA 2RF2A 1S1XB 4I2QB 1RT6B 1UA1A 4J9MA 1S6PB 4LQ9A 3QZ8A 3V1OA 1DLOB 3C6UA 3CJ0A 2B4JA 2HWIA 4EZ9A 1RTHA 3AVGA 3AVNA 5KI6A 4M3ZA 2YNIB 2JC0A 3QO9A 4KI6A 3UDLA 2BRLA 5F8NA 1S1UA 3QIOA 4Z0UA 4KHQA 3SUOA 3V9XA 3CQ8A 4RW8B 2W42A 4J2BA 4Q44A 1RT4A 1MU2B 1YVFA 1N48A 4BE0A 4AH9A 3LP0A 2JGUA 2HHVA 4RUAA 1LW2B 3GILA 5KFBA 3TAFA 2JEIA 3S9HA 4IDKA 4HYKA 1S9GA 3TAMA 3HVAA 3IN5A 3BJYA 3HPOA 3KHRA 5J1EB 5KT3A 1RT1B 5L1LA 3S3MA 5DQIA 1RT2B 5KFPA 1BQNB 3FFIB 4CIGA 5KTQA 3CM5A 1BCMA 1WSFA 3V6DB 3PY8A 3CIZA 1QTMA 1JKHB 3DLKA 1N5YA 4H8KA 4O3RA 1IKVA 5HRNA 4RW4B 4R5PB 1BISA 5L1JA 3DRRA 4DL5A 2GUIA 2YKNA 2FVRA 4QWAA 3OYKA 4FXDA 3E01B 4DTNA 1HNVB 1TKZB 3F9KA 4CF9A 4CJKA 4KHMA 2DFEA 3QEWA 1BCOA 3KK1B 1KCFA 5JS2A 2VG7A 2JLEA 3AVCA 1SV5A 1Y97A 1UA0A 4PY5A 1HNIB 5F8MA 2KW4A
chains in the Genus database with same CATH superfamily
3TX8A 5FIIA 4R8UA 5GVQA 3OS2A 1NLVA 1NDKA 4CGDA 1CXQA 1U1QA 5A6WA 4DV7F 4ANDA 4BE2A 4B1XB 1H3DA 1F21A 3EZWA 4OV6A 4L8RB 2OPPB 4J2DA 4BS2A 2LP4A 4JHDB 1MNEA 2H3GX 1G2EA 5KFFA 1UVLA 4OJ3A 2MQ8A 2KM8C 3TQ1A 3MEDA 4ZMMA 2AMCB 1KKHA 3VF6A 4CEFA 3LO3A 1JLBA 3DGPB 5ETRA 1RT5A 5LSRA 2YKOA 4AM7A 1Z4UA 1DT9A 1NMEB 2BE2A 1C2PA 5KT6A 3CIMA 1VQMN 4YOEA 1LAWA 4DL7A 1TTHB 2BJDA 5DLGA 3C16A 2YWGA 2YH0A 3W8PA 1PC5A 3RU0A 1KVAA 3V6HA 3KWMA 5TKYA 1CQMA 4WF9L 2FJXA 3WX8A 3JQMA 4K59A 3RWUA 3OVNA 1YQHA 4ZITA 1C1AA 2FGCA 4P7TA 4Y00A 1MSWD 3MECA 2WTUA 1WELA 2OPRB 3FZHA 2H54B 4LSNB 3GYXB 3SQ2A 1JLAA 4NLYA 2QWQA 3FCVA 5RUBA 2X7IA 3MCSA 3GFZA 2HNYA 3RG6A 1W7AA 3GR1A 3G2XA 1R43A 2PMHA 3K57A 4BG8A 3SQGB 3D9BA 1VSIA 2HFZA 4DG1B 3SYZA 3VEVA 4DX8H 3KTQA 4BRIA 2N3OA 3ET6A 1KFDA 4XPEA 1VSMA 1R0AB 1BI4B 2DFFA 3QT7A 3GCWP 3M7VA 4Q8FA 2DRAA 3NAHA 4PZVA 2Z2MA 1KR4A 2GIRA 4FW1A 1UVIA 3A8EA 3TANA 3R3TA 4A59A 4HHJA 3KD1E 4DR4F 4N77A 4URGA 2B0GA 2MQMA 2C3PA 4F2RA 2LYVA 3OPKA 3UPFA 1RSCA 4CESA 1DKGD 1Q4RA 1HRHA 4ECYA 3ZZRA 3QRRA 3H1VX 2G8UA 4UUWA 1FEHA 2D3O1 4QJVA 3WXJA 3PFOA 2MZTA 4DSLA 2P9NA 4GW6A 1W0HA 5GAHU 1AT1B 2OHDA 3RR7A 4MLHA 2WVBA 2XMMA 4Y2KA 1JXLA 1IH7A 5K14A 4TU7A 3EXCX 4CJSA 1JCGA 5F8GA 5F0UA 4QPTA 3QFHA 4JI4K 1JJHA 4CTAB 3R6MA 2XI3A 1UMJA 1BXNA 2Q31A 3LP1B 2J6TA 1S7IA 1BQNA 5DZ7A 1YTYA 2OGUA 1RDRA 2P9EA 1BHNA 4IO9Q 4RL1A 4LUBA 3HHDA 3VESA 1OWXA 3ZX0A 4ECZA 4FK2A 2W9BB 4DV5F 1LWCB 3RYLA 4ZVPB 3SQ0A 3MWBA 4CI6A 4DR3F 1XNRJ 1VLOA 2YKMB 4BRKA 1YBUA 3ADAC 1WHXA 4CZKA 5BRHA 2HMIB 2BJ9A 3OYCA 4PG8A 5C15A 5CH7B 3CTRA 3VA3A 2RE2A 2WBMA 4F02A 4Y0WA 4QOZB 4JD2B 5DG7A 1R0CB 1NKCA 5HQMA 5CXTA 1I94K 4IWVA 2DT9A 2YHXA 4KHWA 4FK0A 5LMNK 4NLUA 4MO4A 3VVTA 2XB2D 1M5HA 4CJUA 3CJ1A 2DXFA 4M41A 3C6HA 3RR8A 4ZVGA 3A13A 2IC3A 3IO1A 2D7SA 3HX9A 4M3YA 4QU6A 1OVYA 5DDPC 2DYAA 4KH4A 2CKWA 4OI4A 4FJ5A 3BYPA 1VQMS 3GOIA 2E6LA 2HBZB 4O5FA 4HLBA 5JVGL 1VFJA 4GKJF 2VKZG 3PSIA 1A5WA 4C7QA 5IFMA 9ATCB 4LF8K 5FRMA 2E29A 5GAGU 3CXCR 1Q8KA 3E9PA 4A8MP 3HOSA 1CJTA 3FMWA 4F3TA 4ED1A 3SUNA 3CHWA 3UVJB 2B8QA 3SCIE 1B3TA 5FJ4A 3ILOA 3FC9A 1FJGJ 4NCAA 3VQ6A 4NA2A 2BDPA 2IMWP 5EOYA 2ZC4A 1AZSA 1M1KO 3TAGA 1DARA 3W63A 3SV4A 3WZ0A 3OVSA 2AJ0A 1BOTO 1FNXH 4FM1A 4BBYA 4ENOA 3MCAB 3NNAA 3IWXA 2PMWA 2J0XA 1X4EA 4HACA 4KB1A 4Y2IA 1NOZA 3K9JA 3ENWA 4NE9C 3EL2A 3BSNA 3U27A 4IG3B 2RS8A 4XIUA 4A8OA 2QA2A 3G71N 1B0TA 1RACB 4AHUA 2CWXA 5AZJB 4LRBA 2ADCA 5HJXA 3SCXA 1HA1A 4NPOA 1FVQA 4H5WA 1PJ6A 3SIPB 3QRQA 1SUQB 3BZCA 2RAQA 2ADBA 2ATQA 3AA2A 3J7YP 3SBGA 1T44A 4AYBD 4IO9L 3N79A 3RAQA 4NLQA 3KYLA 1TL5A 3QB0A 1NSKL 5B0BA 3SPZA 4A2BA 2FY1A 1VJQA 4OX9J 2HHXA 3ULDA 5EX0A 4F4WA 3OTEA 4PUOA 3KMSA 1URNA 2UUCK 4ITSA 3BR8A 4AHVA 5CZVA 2BMBA 2EEYA 2CJ9A 2LEPA 3G82B 1XQIA 5L8RC 2FTRA 3IC1A 4DMZA 2YWFA 2FVPA 2YX6A 2X1AA 3L09A 4DPYA 3HZGA 5LJ3Y 1F5AA 4R0JA 2C2DA 3ZZZA 2YPZA 1WBDA 2LVWA 4LRAA 1YJWN 4CH0S 3H5XA 2K7JA 4PHTX 2MKIA 2R8KA 5C2CA 3NY0A 2Y1IA 3JAMO 2CQPA 1EKRA 4ILMA 4LF1A 2V2QA 4J8FA 1NDPA 4NMXA 3KXDA 3M05A 3TNVA 2O8BA 1TKDA 2JEJA 1AFJA 4LFAF 1YKWA 1QE1B 3HD2A 2OTLN 2XY5A 2IRYA 3CW2C 1WUAA 1KQSM 3ZETA 4MYUA 5A8KA 2DH7A 4ZP9A 1S1WA 2KZZA 4ZJOA 3S7RA 3FEZA 2VG6B 4DLEA 1NU0A 3FZBA 4OI6A 4RW7A 1GOBA 4E98A 1T9WA 3IM8A 4OYIA 1LOTB 2XMJA 3U9ZA 1TK5A 3EICA 1NK6A 3M8QB 5G0RA 4YOXA 2MLYA 2IM2A 3AOBA 2R2SA 3G6YA 2EHGA 1WD6A 5AQJA 5DG8A 2ZHOA 3R27A 1ZAXA 1RE1B 4FZXC 2XS7A 5HAOA 1DHMA 3ZT1A 1WC3A 1VGYA 4RUCA 3DXMA 2QX0A 4QR2A 2FSJA 4HT7A 4B3TJ 4ZP6A 1PG5B 3RB3A 4XPCA 3MUVP 1SIZA 1VBXA 3AO2A 3G87A 2W7PA 4DR4K 4FJ8A 3L3UA 3MD3A 4JI3K 2MHNA 4Q5VA 3OFEA 5BYQA 2R7UA 2R7YA 3NRBA 1DBDA 1WEYA 2HQ3A 3KG0A 1SL2A 1U47A 2D74B 3HHLC 5FPNA 2HBQB 3GE9A 1HWLA 5B08A 1KS2A 4UT4A 1D9FA 3THVA 4FLVA 4U8YA 3BQ0A 3SAGA 5HJYA 3VAIA 1HX1A 3H25A 4Q8EA 2L9DA 2RDDA 3LZJA 2CQIA 1XERA 3G6VA 4RBUA 1ROFA 3AODA 1FDAA 1Q9YA 3GR0A 3MAAA 3M2VA 3T6BA 8AT1B 3F0NA 5EGYA 1T9UA 1S1TB 2QKBA 3R8YA 5AE3A 1J5EJ 4RU2A 2H5EA 4BGAA 2JFDA 3G71S 1YI2S 3ELHA 2WHOA 4JI7F 5AQPA 2IMOA 3LP2A 1U25A 3K7RA 1RAEB 2LDIA 3N4WA 3DXKA 3K5NA 2OTJN 3C66A 4JYAK 3I6PA 1R59O 3O9RA 4I56A 1TL7B 2HVEA 2CPFA 1BQMA 5F8IA 4USWA 4BR7A 2O66A 4IR1A 3LGHA 4DQQA 4JRQA 3E8OA 2NRZA 3P38A 4DV5K 3J7YI 3T1YJ 3DHWC 2CJKA 5AQRA 3NGZA 2XY8A 4G1QA 2UXCJ 3AA5X 2OI2A 3ID8A 5KFDA 4CEEA 2HBKA 4H4OB 3MD1A 3VQSA 1RHQB 3OR1B 1K1SA 4UW2A 2IGIA 1D1UA 1UWBA 2HFVA 4ILHA 4C1NI 2CJBA 2YKNB 4USKA 3CDAA 4RW8A 1EQ0A 4FZZA 5LSLA 1BIUA 3MM9B 2R7VA 1NK0A 2U1AA 2QN6B 4GKKF 1B0PA 1YJWS 3TUPA 1KSPA 1NOYA 4C3KA 3PHEA 1JQGA 4UOHA 5LOQA 5FDLB 3LH2S 1HYVA 3M2UA 2OP5A 3CJBA 2MYFA 4CZLA 3F2KA 1WDTA 1XHXA 2OSQA 1NSAA 2LKZA 4FBTA 1AFIA 3V6DA 2V8DA 3W3SA 5AQXA 2HVIA 2DCUB 2HEKA 4EWTA 3V1QA 3VV2B 1GXLA 1FTCA 4R8UB 5IT4A 2W1BA 4R5PA 1ULRA 5EN1A 3OYHA 2GTDA 2OTLS 2AF6A 1KXPA 2OAUA 4LRFA 5E26A 1TKZA 3M2RA 4CO5A 1NKEA 2BQRA 2IRUA 3B4DA 1RQ0A 1IO2A 4WE1A 2ZBRA 4MKAA 1QQCA 3FZMA 4KHRA 5FLXO 5THWA 1JLCB 3HHNB 3MEDB 1N32J 1K0TA 4AUKA 4J9RA 4EYHB 2VPXB 2W7AA 3M6WA 1L3SA 2CQ4A 1Z26A 4FJGA 4USTA 1BA1A 2AX0A 1YGYA 3DLGA 4ZVTB 3R3LA 1P1LA 4FZYA 1ITPA 2DKOB 1F3VA 2DPJA 2ZZTA 1G15A 1XNRF 4DUYJ 3W1YC 4C6AA 3RW6A 3CFOA 5J2NB 3KG1A 2WONA 4B8AB 3C6TA 1VK3A 4BROA 3UD3P 2XCAA 2AW0A 1EETA 3R2CJ 3MECB 2HZCA 5FRNA 2ZH5A 2C3UA 2J0WA 1U45A 1NJIO 4NXMK 1RHRB 4E2FB 2ZVSA 2QA1A 1W97L 5AQLA 4FM2A 1JNZB 3SXLA 4I1TA 2HNYB 1EQMA 1XQSC 3MPWA 1VQ5N 1S99A 3RJMB 1ATSA 2F8EX 4LVOP 5E5NA 4DCHA 3QGIA 3CCRN 1HPZA 5LXRA 4ANCA 1S6QA 5I3UA 2Z30B 3THWA 2HFNA 3VEOA 4IUFA 3V9WA 1C0GA 3ET6B 1JLFA 3GIIA 1UJ4A 4LH4A 2MJUA 2ZKUA 2BXJA 4DPOA 2A0FB 1GXTA 1GLCG 3MPYA 1FESA 4CW7B 2M4MA 1XR6A 2V69A 5L46A 4YR3A 4HDGA 2Z57B 1YDLA 2V6AA 5DDQC 1VR6A 1GX5A 2E66A 4KHUA 3A8KA 5IC4B 2PFDA 2CNLB 4X4PA 4AD6A 2ZEJA 3UNYA 1XUPO 2MKYA 2Y8WA 3BDPA 2OTJS 4PKGA 4D3GA 4K25A 4DOZA 3M8PA 3UCGA 1FJGF 2J76E 4BDPA 3S3NA 4EP4A 3I31A 3LDQA 3D2EB 3ZSRA 4KO0A 3QPIA 1BMQB 2X1BA 3V9SA 1Y3KA 2DCLA 4JAXA 2KJWA 4HH0A 5ADZA 4KREA 4KB0A 3KFWX 2IVYA 4LFAK 5BPNA 2FB0A 2AJ2A 3PKMA 2IY5B 4I68A 4LFBK 4QR0A 2VBYA 2BEFA 3M9OB 2AT1B 2IBKA 2KKHA 1QTNB 2A40A 5D4OA 4ZPTR 2WBNA 4WK3A 3ZTPA 4CO2A 5JICA 3OJUA 4E7KA 1CLFA 1IKYA 5DRKA 3QNWB 4M7XA 4CZEA 2VFVA 1CSJA 3KLGB 1GMUA 1D9DA 4DV1J 5K14B 2XMUA 4OJGA 1HBOB 4IBNA 4B9MA 4IO1A 2VPWB 4KAIA 3KNGA 1T9TA 2EC2A 3H4DA 5AQZA 2O4GA 1HNZK 3BH6B 2VU5A 4L3KA 5T41A 3KMQA 1V3SA 1HQUA 4BRAA 1BWVA 6FDRA 2VD3A 3MUTP 1S1VA 1ZETA 4NL5A 4E8UA 5A0YA 1Z1ZA 2LDYA 4FWPA 1FA0A 4OX9F 2MSSA 5AXMA 3R7SB 4ID5A 1R7IA 2AWZA 4ECWA 1T9YA 1QDUB 2UV8G 3MHYA 4B9TA 1UEVA 2AYBA 4GVBA 1RADB 3IXQA 3TAPA 3BY5A 4CECA 3W5XA 4B1UB 5DZ6A 2YXLA 4XTTA 2IM0A 3CMEN 3L8BA 4JI6F 4UY8O 3GLJA 4C97A 3CCVN 2KO1A 3GL1A 3CJRA 4IJAA 2M3DA 1SPBP 2G1HA 5IV3A 3PZPA 1NO8A 4CLKA 2XC9A 3DLBA 5BPMA 5ETTA 4C11A 4Q0BA 2KQ2A 4R79A 4Y0FA 1XR7A 4F36A 3TVZA 3I0RA 3ZTRA 3ZCMA 1LKZA 1TUYA 2ROPA 4EIAA 2UVUA 4EFHA 1CZ9A 3LQVA 3P5BP 3RSEA 2G1DA 2E7VA 4C1NK 4FDFA 3K9KA 2IC3B 4R0EA 4DFKA 3Q2TC 4ZVRB 2L3MA 4O0IA 5F9NA 3SQOP 3GPAA 4K4SA 3HHLD 4CF2A 2CRLA 4CLZA 4O44A 2QK9A 4IQXA 5H9EK 4JI7K 1NU4A 3HPHA 5M2UA 5KT5A 4YQWA 2CXEA 2XYHB 3VVUA 3DMJB 4AILC 3UFCX 3UW1A 3A5OC 1H73A 3S01A 1S79A 4X66F 1CJTB 1NAQA 4U8VA 2VQFJ 8ATCB 3J7YU 2BQ3A 3O1LA 2R2UA 3PIPQ 4WYWA 5GAEI 5E3PA 3K0SA 2QWLA 1YITN 2R8HA 2CG8A 3MAQA 5CYQB 3ZYYX 5AE1A 3NCIA 4DTRA 2BTFA 1WF2A 1UAWA 3LDSA 1VQ5S 2C2ZB 5EX3A 3N6NA 1XC9A 1ZA2B 1YLXA 3QERA 3HHLB 1JWWA 1SC6A 2ATCB 5CZXA 4BR4A 4HACB 3FRZA 3KLIB 4U67Q 3FFKB 3H45C 2UP1A 3SMZA 5HROA 4AXJA 2D3OR 4P71A 4GNIA 2XSJA 2KLAA 5HRSA 2KJVA 5K5MA 3D2WA 4YMEA 2V51B 1JNRB 2YCHA 5KG2A 4GKKK 3U1NA 3C6UB 1G1XA 3TPQA 5AQHA 3R5CA 3O4QA 3M32B 3BSCA 3CPEA 3QO9B 2GELA 3GYNA 4A8FA 3BZKA 1SJQA 1IQTA 4PKHA 3OYGA 1MWQA 2W24A 2V0NA 2VQEK 1S1UB 3ZSXA 2AU0A 4RNHA 4DJBA 4USMA 3AARA 4PQUA 2UUAF 4Y3CA 1S3XA 4X2BA 4OGEA 5KRTA 1RAJA 2DGTA 4QU7A 2V50A 4CEZA 3O8MA 5KFMA 3CE8A 1S4EA 3Q23A 3EE8A 3EDRB 5B8HA 5C5JA 4TNOA 5JS1A 4WU2A 3B6BA 4ZKAA 3DI6A 4GVMA 2EC0A 3CG7A 4PUOB 3DC2A 4O4GA 1VI7A 1J9AA 2QG9B 1J5EF 1IQZA 4CIFA 1GT8A 4FW2A 1W25A 4JI5J 4YUDA 1H6KX 3CCSN 2CFXA 4H4KA 2CZ9A 4Z94A 1N5YB 3EZ5A 2FLNA 1VQ4N 3H40A 3RMCA 4AL7A 4E1MA 2MQNA 2IYGA 3HI0A 3AXMA 2YVSA 4ES3A 2GMHA 4B02A 1F9HA 1XWLA 4FJLA 2E88A 4C0BA 4Y1DA 5A8RB 1NK7A 4YB5A 3OBIA 2PGCA 3M30B 3AGRA 5CABA 3T1YF 1P9QC 1SH0A 2EX3A 4ED8A 2D0OA 1MWYA 4M42A 5AZIA 3DN9A 4DDFA 2XSFA 4WCEL 2DGOA 1REVA 1Q5YA 2D1KA 4PWWA 2KHOA 2UV8A 4B9SA 5BN9A 3ZETB 2JWNA 1S1WB 1B70B 4AHSA 2GIQA 3IMXA 4ISEA 2WAQD 3PDNA 2ILZA 4U6PA 3TP2A 4RW7B 1V3ZA 3MMAB 4JI1F 3KUEA 2DNLA 5HQLA 1VC6A 4QBUA 3HVTA 1UETA 2WBRA 2XLJA 2EBEA 4K2XA 4FPBA 2OCEA 3O3GA 3MTKA 3I56N 4LREA 3FE1A 5G0RB 1NPPA 3W9IA 3RTVA 2NXUA 2Z2LA 3MN6A 4G1PA 2MKHA 2B5JB 5KG6A 3OTBA 4ZTFA 3Q8YA 5LL6d 4K50A 2IJFA 3CD0A 4MIWA 2ACMA 2QWMA 5A76A 3C15A 2W7OA 4DTXA 4M5GA 1ZBSA 4FXVA 3OS0A 3P5JA 2ITMA 3KVGA 1D9AA 2RN2A 1JLQA 1FD2A 5AFUH 3DXMB 1IBLJ 1Z6RA 4CWBA 4V1Ak 1RAOA 4KH6A 4CBWA 3J7AN 4Z7YA 3SMPA 4QIEA 3J7A1 4DR1J 1S9FA 5K8NA 5IV4A 3SI6A 3OW2R 3RMBA 3AA3A 2BJ8A 4DCPB 1JJ2M 3KK2A 2P9IA 2AA4A 3NF7A 1C4CA 4W98A 1O5JA 2I5JA 1IR0A 3I5CA 4A8WA 1RTIA 4M3TA 1YITS 1EXQA 3L4IA 1NRKA 2BJ3A 1F60B 3QIPA 1CULA 4E89A 3LPYA 2HOEA 2HGMA 5I9EB 3ZSQA 2PC6A 1D09B 2PN6A 3L3VA 3DLEA 2J8AA 5J2QB 2CNKB 2K8GA 3PCOB 1EP4A 2H48B 4IYQA 3MAAB 1TL1A 3KWGA 2FJBB 3OVAA 1YRXA 1Y64A 4NXNJ 3AAQA 4HKQA 2CPXA 5DGBA 4DPWA 4NEZA 5H1SV 4JI8J 2QWPA 3FR0A 3PW0A 2NRTA 3VEYA 4H0PA 4DLGA 3LP2B 2HFOA 1WUUA 4IH7A 4C2MA 1N0VC 1QZ6A 1WAFA 2PFUA 3TI0A 3MR2A 3BF3A 1FJEB 5I3PA 4NCBA 3NGKA 2QWOA 5B0EA 1V4TA 3FKBA 3NOCA 1QVGR 1F0XA 4TYAA 4CZGA 1BQMB 3MAHA 3MFHA 2HVHA 3A2FA 2BBEA 4BC5A 2BACA 2OFHX 4YDUA 1HL6A 1OMSA 1WOSA 5AQFA 4G1QB 4O8KA 2MLZA 1U1OA 3NF6A 4CT9A 1Q86O 5HVGA 4J9MA 3QZ8A 1TYQA 2N7CA 5HMWA 2KI2A 1QLNA 1BDGA 4JI6K 2MPUA 1RTHA 1YBTA 1M1GA 2DH9A 3N4PA 2BRLA 3D3BJ 2GIFA 3QIOA 4Z0UA 1WTBA 3CCSS 5D4LA 1HBMB 4RW8B 1VQ4S 2Y0BB 4FF1A 1RT4A 4J7CA 3LOUA 1OPIA 1NMDA 1LW2B 4ZVUB 3GILA 3WHIA 1BWFO 2ZH1A 2V52B 2H3EB 5FD1A 3SJHA 1S9GA 3TAMA 3HVAA 1OO0B 2DGWA 2VBXA 5L1LA 3S3MA 5DQIA 2BE9B 2VYPA 2A2CA 4CIGA 2XNRA 4L75A 3A5LC 3V6DB 2O67A 1QTMA 1JKHB 3DLKA 3MI7X 2FJAB 1SB6A 4R5PB 1V4SA 3DRRA 2FVRA 3QBXA 4X66K 3W66A 1FF2A 1TKZB 4KHMA 2FF3B 2ZH9A 4B9QA 1KCFA 3M2RB 2CNOB 4DV1F 2B9YA 2OIHA 3AVCA 4CLPA 3TZWA 1SV5A 1UL3A 3D4JA 3E9OA 1VLYA 3SCLE 4X4VA 3BEXA 3HCXA 4FVUA 4BRDA 5KFGA 4RWWA 2P5GA 4NLVA 2KVQE 2LA6A 1PJ5A 3BSAA 5E3QA 3UD5A 2CVIA 4U96A 2OEJA 1RAFB 1OH7A 5LMUK 3ID6A 4ZPCA 2H4WB 2HPUA 2DO0A 1PYOB 3BREA 4JK8A 4B3MJ 3TEHB 2WONB 3AY0A 1K8AO 1N33J 4DWIA 2F4VJ 3VAMA 3MCMA 2RMLA 1KLNA 1IJEB 1J2VA 3GWCA 4OHYA 4S0MA 4RWXA 2FJWA 4YB1P 4J2AA 1XNQF 2PMZD 3AFGA 2C1EB 2K3KA 1HD0A 1MROB 3VN5A 3A3PB 5KT4A 2UUAK 1DAXA 4LJMA 4ECXA 3VQQA 1NHUA 3MM5A 3IWLA 1UEUA 4M5MA 3TOQA 1HPZB 3QMQA 1S6QB 3THWB 4EI2A 3IAS9 2XTJP 2UUBK 1NGFA 1YJ9N 4JI0F 5BREA 2E7WA 1RAAB 1B99A 1RYSA 1VQON 4NZ0A 3PRBA 1FRLA 3TU5A 3AO5A 2GCFA 2V2KA 4HTUA 4CNYA 2RUGA 3W8GA 2DEIA 1KVBA 4ES2A 2F65A 2UXDK 3M6VA 2A3JA 3KLEA 3O6WA 3Q2SC 2VL1A 1C0TB 1S6OA 2WTFA 3ISNC 4CLTA 2QTDA 4XO0A 4UY8T 1JJCB 1G6BA 4NMLA 1RCHA 2R7RA 2D4WA 3M8PB 3ASMA 4QWDA 5ETMA 3PR5B 1EIYB 4KKOA 3ULEA 4EGLA 1LWFA 3QRPA 2QE5A 3R5GA 3VAGA 4PG7A 4CDIA 1X4DA 2OD6A 3AVIA 2L9WA 5B0AA 3UN5A 3I8BA 3VGLA 3BGRA 2BW7A 2P9LA 2BR0A 4LF2A 1KFSA 2DPNA 3T5JA 1FDNA 4QYRA 4NRTA 5SUHA 3DLHA 2GW8A 3GV8B 4JUZA 4KC5A 4PL7A 5AFUA 2FDNA 4IDHA 3K2PA 4GC7A 1IKYB 4KV8A 1X9SA 3BUZB 2GHVC 3E3XA 3RMAA 3LANA 2I7NA 4ZCLA 1SKSA 5CYMB 1Y0HA 4WTYA 3T7ZA 1O51A 4K4TA 1NKBA 4ELVA 4J9PA 5E7OB 2DHXA 2MGZA 1S1XA 4DTJA 4O5BA 2P5OA 2F8HA 1HQUB 3WXMB 1S1VB 2HHHF 3DNCA 4CJ7A 5A0YB 3ZXWA 4IJNA 2CH6A 2YNIA 4RU9A 4ZPVR 4ID5B 4DQRA 1LFPA 3QNOA 2FD2A 5D0EA 3PYGA 2XS2A 2BOPA 3ALYA 2ZH8A 3GJTB 3HMJG 3SMSA 4GVBB 2YJEA 2LA4A 1X4BA 3OYDA 3HVWA 3SFGA 2DHSA 1Y7PA 3QQCD 3NWRA 4FF4A 4KPYA 3Q22A 3S41A 1I1GA 2BABA 2XHBA 2D3ZA 1GXUA 1YF5L 1GLDG 4M63A 4I67A 3A0IX 2R3VA 1OJ4A 2Q66A 4LF7K 5K8PA 4Q0BB 2ASLA 3KNAA 2V4JA 1R31A 2VA3A 4J9VA 1NNDA 4ZK7M 1RZMA 1SC4B 4OFZA 1CC8A 2EG1A 5CQGA 3RVCA 4DQPA 3HK2A 3RSEB 2E5HA 4BHQA 2V5HG 2KHDA 2IFXA 3IFRA 2Z1JA 4MKVA 3L2UA 4BR0A 4JI4J 2UU9K 3ITHA 4O44B 1HBNA 3D6FB 1LXJA 3VTHA 4OZ3A 2KN4A 2X1FA 3VQAA 2V8VA 5BYRA 1VSJA 2FC8A 1NSPA 1KVIA 1HKGA 4BRLA 4W5QA 1YRTA 4P2MA 1DTTA 4LF4K 5H9FK 3KWIA 1NGAA 3D54A 4TSXA 5HN0A 2OSRA 3IP0A 2W4DA 1U2RA 4DKWA 3G0ZA 2VICA 1Y5IB 2OPPA 3UD4P 1K9MO 5KRSA 4F4ZA 3C46A 3JAMU 1J54A 3KKRA 5C2DA 3H98A 4ZLJA 1KVCA 3FGUA 1KAYA 2OA8A 2AX1A 2F9JA 5D3GA 4DL6A 4LFCK 3DGPA 3CCES 3NH1A 4WKRA 4I7FB 1IBLF 5KFTA 1B9DA 5EY4A 1SQKA 4IG0B 1IBKF 1T0TV 5LMNJ 4DR1F 5HL7Q 5HROB 4BDZA 1KNZA 1RWNB 4F04B 3MMJA 4AT1B 5ETOA 2FHJD 1XMBA 1JXVA 2E9TA 1FX2A 4O3PA 4LR7A 3GCXP 3S6EA 1JXBA 3E9LA 3TAEA 5MAOA 4JKFA 2E5GA 2ZJPQ 3BQ1A 4ZIWA 1RAGB 4Z4EA 2YTCA 5LXYA 3R1LA 4PQUB 4NLWA 1R8AA 1RDWX 4PPDA 3CC4N 4LF8J 2GX9A 3H8YA 3H7HB 3MEKA 2NPFA 1KHWA 1RBTA 1REGX 5E33A 4LSNA 1ELOA 4HH1A 4KHPF 4KPCA 1KDNA 1ZBLA 5AQTA 4RPFA 4RO0A 2UVRA 4CERA 4JI8F 2ZF5O 2GHPA 3AD9C 4EO8A 5CYJA 3BF1A 1B64A 2GV9A 3JSRA 3LW5C 3L2QA 2XMKA 5C2FA 4DZDA 2QL9B 3R2DJ 1R0AA 1YJRA 4B3SK 3HD1A 1D3WA 4K4XA 3FZKA 4P74A 1OY9A 1NB7A 5E41A 3I0SB 4Y6IA 1O6XA 1TU0B 3ENVA 4X64F 2PT0A 1X4FA 3BKFA 2LU2A 2HAFA 1BWEA 1IKWA 1FFSB 4KAZA 2CPJA 4J9LA 1P90A 5FPMA 1VC0A 3S8SA 1RJJA 3MWTA 5CY4A 4CGIA 4FPAA 5AZIB 4K41A 5J2MA 4NLOA 2LMIA 1EKSA 3NDKA 1REVB 4CJPA 7FDRA 2Y1LB 2EK1A 1AW0A 3VF2A 2QXLA 4E7HA 1IBCB 6FD1A 1VQKN 2LXUA 1SAZA 1C1BB 2RHSB 1HNXF 3VEXA 1XNQK 3AD8C 1DGKN 4DR5F 3AVBA 1WG1A 4QAGA 4FWNA 3HVTB 1UOCA 4CJRA 2IAJB 4F4AA 4CIOA 1WC4A 4BRFA 4FN5A 4N47A 2YPYA 3CMAS 4DU4A 4N8OA 5AQGA 3JQJA 4EK2A 3P49B 4ZVEA 4QWCA 4OPJA 5KOXA 2UUCJ 3HM8A 2GUPA 2MZSA 4JI0K 1RUSA 3K5LA 3L0QA 4K8RA 2APOA 4EMDA 5E0OA 4CTAA 4F3QA 2N82B 3TAQA 2GAGC 5HP1B 2AZ1A 3J8AA 3MDQA 3CD5A 3B6PA 3LP1A 1KOOA 3KJQB 4WQ5A 2ZH6A 4DV3F 3VERA 4F7VA 2YHWA 2HGNA 4ZN1A 4KE5A 2HSTA 1IXKA 3KUHA 1VQ7N 1ZZFA 2VZ9A 1I6JA 2QTWA 2J4RA 2W9BA 2B56A 4FWKA 4MH8A 4I64A 1LWCA 3JSMB 3TW0A 3ZTQA 4J37A 3KK2B 2P9IB 3P4UB 1SKWA 1X5SA 2HQFA 2YKMA 1ZM3A 2I5JB 3VQTA 2EWSA 1RTIB 1RTZA 3K0JA 4DF8A 4RW9A 2OZSA 1WOPA 5I42B 2YX7A 4IOAQ 4IO8A 4ZPBA 3QIPB 1CULB 2XGQA 4RCHA 2IBOA 4KQZA 2ABYA 3VA0A 4Z2XA 3ISND 3CQXA 1EP4B 1W7WA 1TK8A 4OHXA 4B3OB 5JMNA 3BO4A 1IN0A 4HVZA 4FWRA 1TQLA 1YX2A 2XY7A 2FQQB 3RAMA 3A3NB 5KFEA 5DK5A 1VCTA 4RUHA 4PXBA 3ZEUB 4FXWA 2F4VF 4L6V3 3LALA 3R6LB 1B0VA 4B3RF 3OD2A 1MMDA 3G96A 5IT9O 4DQ8A 4J9OA 3DFEA 3KIOA 4FZVA 4GO7X 5FLXU 2HHHK 2NXNA 2GQQA 2CQ2A 3PYDA 5LL6Z 3VCDA 2B7CB 4LR8A 3C3LA 1YVUA 1JCFA 1RLCL 3UVJA 3TA1A 3CC4S 3CO0P 2H5JB 5D4PA 1NK5A 1KRPA 4DR4J 5C25B 3LM9A 3TARA 3OBWA 1TYQB 1S12A 4FF3A 4BR5A 2Z1HA 4EAHD 2PY5A 2DHAA 2HBJA 1ZPVA 2RU3A 3GB0A 1K8AT 1KD1O 1CG2A 2XI2A 5KFLA 4MQ3A 5KPRA 3NNHA 3AAPA 2RE1A 4IG3A 2FHKA 3A1YG 2GBZA 2OPQB 1X9MA 4QIFA 5AZJA 1DZ5A 3NKYA 1LAVA 4DN9A 3VAHA 1X0FA 1RT6A 1W26A 3IAM9 3BBFA 3NE6A 1DLOA 3GV7B 4M5JA 2PI4A 3TABA 3WNFA 2ZH7A 3N5BA 5M1PA 3LL3A 4GV9A 1DQAA 3DLKB 3T9ZA 3SPYA 4JYAJ 2M88A 3ETOA 1K1QA 4ECQA 3BKUA 4H5RA 2Q2RA 4DZ6A 2HNZB 3AV9A 2ZH3A 1SJFA 4JKHA 4JKDA 3GMGA 2J9DA 3UNGC 1VQKS 2CQGA 4YOUA 2M7SA 1NGGA 2V68A 3P31A 2FBTA 4WWSA 4M5KA 3VGVA 1X3NA 5AXLA 4ECUA 1PBUA 1PKUA 4DV5J 4EBDA 3FMBA 3TSUA 5CZ1A 4F3OA 3J81j 3DOMA 3P6YC 4IOAL 2E6MA 4NRUA 1HWUA 1SV5B 1WTFA 1RT1A 5CE3A 4GV3A 3OT9A 2KFNA 3GP9A 3M8RA 4CGGA 2HF4A 3CWJA 4RW4A 1IG9A 3HBTA 3CCQS 2G0CA 2XZWA 3KJFB 3VQCA 3AQPA 1QHAA 2W8KA 3E01A 3OTCA 1YWXA 4LBHA 3CDUA 4M5HA 2LEBA 2G9OA 2RQMA 2QFIA 2OPSB 1IBKK 2FIUA 1FWLA 1CJUA 2FHMA 4LH5A 3WNHA 4ZP7A 3FZFA 5KFXA 4KI4A 2ZBIA 4QS9A 1R0BG 3DDNA 3AO3A 3SDEB 4Q43A 3OFGA 3W2WB 3IA0A 1VQ7S 2VC1A 3LDPA 3HJVA 4IRKA 1DJ0A 4X65F 5U47A 4BY9C 3H5UA 4F0MA 4GKJJ 2KB2A 4EBCA 2E2OA 5CHCB 1KVKA 2ASYA 1FE0A 2P5VA 4KBOA 4H54A 4MDAA 3PJ9A 3EJMA 2PEHA 3CC2N 1NSQA 3FLCO 1ESVA 4KHPK 2BH1A 1RWXB 4RJVA 3VQ4A 4FSVA 3OQ2A 1WKJA 1FJCA 1XIQA 4DS4A 2QL5B 4DQIA 3TTCA 5KGXA 2F8SA 3M8QA 2VPZB 1SJ1A 4JI4F 3QWPA 1VQYA 3K8VA 1HW8A 5GIPA 4PCQA 1A5XA 2YNGA 3POTA 4J90A 3PIOL 3V9UA 5IXUA 2RJZA 2R7OA 3IR6B 2JLFA 2O4IA 1E4GT 4FWLA 4FLUA 1Q8BA 1BG3A 3KLEB 1X31C 2EXUA 1VHIA 3VZIA 2EBGA 4CLSA 4X64K 2PYJA 5HRPA 4CO3A 4AE5A 1S6UA 4JV0A 1U48A 1HMVB 2C28A 3OTOK 2XYPB 4XK8C 4ZVSB 4K4UA 2DJWA 2KZMA 1FRMA 1PJ7A 3LUYA 1TZ0A 1FFWB 3VPZA 5D78A 1HKAA 2GWKA 5B09A 3CUNA 5BRDA 2HNDB 3W3DA 5A2QO 1H2TZ 3ZZ0A 2O8CA 2W8LA 2NRRA 3QT8A 4V19J 4P73A 2P9LB 4JKBA 3ZZTA 3FZLA 3H90A 2CQ0A 1KQSR 1U8WA 3DDKA 4PWDB 3RRKA 3EX7B 4TY8A 1F2HA 4NXMJ 4ALZA 1HNXK 2WOMB 3HTVA 1I94F 2E1AA 1EQYA 1AXQA 4F4YA 4DR5K 1EWRA 3CNQP 3B8AX 3H5YA 1KC8O 2NSBA 5ADXH 3RBDA 1YHQN 2F9DA 3OVBA 4FF2A 1FRIA 1CEZA 5CCMA 5E3AA 5KFUA 3UI3A 3ZNJ1 1NM1A 1S1TA 1RAHB 3HFZB 3PV8A 5ETPA 1T9VA 4JP8A 1NK9A 1Q8LA 4OYMA 4B1WB 4C8LA 2MGZB 1KN6A 1A9NB 3K8WA 1UAXA 2P9GA 4KFBB 3LGNA 1VSEA 3OHAA 2E1ZA 1K9MT 4I6YA 2GO9A 4K0KK 4FNHA 2CZ4A 3H3NO 1PC4A 4DV3K 3DWLA 1YJVA 2G2YA 3ZX3A 4DX5A 4A47A 4YDDB 1TL7A 4NYNA 4CGJA 3BEGB 1SJ4P 2DNMA 2DBBA 1WEXA 1FKPA 3W5YA 4DV6K 1VISA 5JLHA 4ELUA 2B51A 2CA9A 3FBCA 1CPZA 1AB8A 4HDHA 4LFAJ 4P72A 2IYIA 3C65A 4CM0A 1Q1KA 4ZVQB 2D0PA 5AQVA 4LFBJ 4H4OA 2A2DA 4X4OA 4CE9A 1UPMB 3ZFVA 2B9EA 3PKYA 4C8KA 4LMZA 1BO5O 1MN7A 2GZOA 2F9WA 4WQ4C 3LDOA 1U6FA 5F3TA 3M6GA 2HZAA 3PJXA 4F0KA 4PXEA 4P7VA 1XMQK 2MB0B 1G4CA 2FSKA 2ZBQA 3TUIC 1PSDA 5KG1A 3MXJA 4MKBA 3ITHB 3MCPA 1H7WA 3J7AP 5T7LA 5FDLA 3IBCB 4ZA1A 3PG9A 1HNZJ 1LWXA 4K7QA 4B3RK 4ZCMA 2CJYB 3QLHA 3P39A 1YG0A 4LSZB 5AQQA 1EWQA 3WNGA 1FXRA 4JK7A 3NBPB 3GJSB 4NZ6A 1DTTB 5AR0A 4IKFA 3C8YA 4WFZA 2D69A 1KLMA 1RFQA 1PO6A 1TR0A 4WJBA 2UUCF 1SH2A 4CF1A 4OHZA 3BGFA 4BVOA 8RUCA 2WFBA 2CGLA 3VAKA 2XMWA 3CC2S 4NO7A 5LSOA 4DTUA 1VSKA 1ACMB 2KG1A 4C8OA 3FSYA 3ZT4A 1JLCA 1U09A 1EARA 3OUYB 2X3GA 2FJDB 1QZ5A 2LXIA 5D3GB 1A7GE 3D6HB 1T11A 3SCJE 4FK4A 1BGXT 4FLXA 3D6TB 3HHEA 1HNWF 5D0RA 4JS5A 3OV7A 4RNOA 2RIJA 2AJ4A 1HLUA 3QDKA 5IQ6A 3FRYA 1NXIA 4OX8A 2V2ZA 3K5MA 1NGCA 1SC3B 1CLQA 4G65A 5J2NA 2A5XA 4JI7J 5H9EJ 1U04A 3P3DA 1Q78A 3JXUA 1KVJA 3J7ZO 3PM9A 5C24B 3HPGA 4DU8A 3BYRA 2ROGA 4DSFA 3W62A 1I3AA 1NGIA 3EY1A 1GX6A 4MTPA 2CH5A 4CJ5A 4ILRA 2YKPA 3O1BA 1H38A 3W60A 2HQGA 2UXCK 2PYLA 4NI2A 1Q79A 3V1RA 4FNIA 4MMOA 1ZS6A 1WG4A 3TSQA 2OEKA 1Q7YT 3S1TA 4NLBA 2HKEA 2HHQA 2X51A 2AYEA 1D5AA 3MMCB 2UUTA 4PXCA 1U0HA 4H0XB 4NYFA 5DQGA 4F4KA 5K9FA 3HI9A 1S4FA 4C0OC 5F8HA 2BZ2A 2DEJA 1M5OC 3LAMA 1SL1A 1FNMA 3AA9A 1S0VA 5JVGQ 4IFVA 1C1CA 2NUUG 1Q82O 1M90O 5D0GA 1X5PA 3LP0B 2Z8QA 2HWTA 3DOLA 2IHR1 5KFQA 1IKWB 2JX2A 3BDEA 3HVRA 4IDKB 4RBTA 2ZQBA 5KFAA 5DDRC 4JI3F 2DD8S 2KTQA 4FWQA 3LDLA 1RDAA 5J2MB 4GKKJ 3D2EA 1N36K 2PDAA 3SSQA 3J81O 1WG5A 3MTJA 3UCUP 3AVFA 3WX4A 4X65K 4DR6K 1X4HA 1YK9A 1UVNA 3N9UC 2VQEJ 2QL7B 4EP5A 4W90B 2A6AA 2QA4N 1H98A 4AXIA 1VSLA 3NGSA 3MMVA 5CR4A 3O8WA 5AE2A 3QETA 1N6QA 1MWZA 4CZFA 3LTOA 2DR9A 3DRPB 3KLGA 2QFJA 1O13A 3Q86A 1HBOA 1K0VA 1VBKA 4GMJB 1WC0A 1PBAA 2XGPA 5EU7A 4JYAF 4ILJA 1VS3A 4O23A 5IT0A 5KFZA 1GNKA 4FWMA 3SZ2A 3PO4A 5HLFB 2YNHB 1FXDA 1FNOA 2XZTB 2XZDB 1B7FA 5EXWA 3NGUA 3OLBA 2JH3A 4ER8A 1UPPA 1HHQA 5ADXA 2GS8A 3KLVA 3WNEA 2MMYA 4PPZA 4QS8A 3O1WA 2CYYA 2W4CA 4JK9A 3J7Z5 4AL5A 3SCKE 3G6EN 4DV0K 2ATLA 4RW9B 3WBZA 2F96A 5KG0A 1EX4A 1WNEA 3IG1A 1ITGA 2JL9A 2AEFA 2FJEB 1S0OA 4ECRA 1U0SA 1FDBA 1NNEA 3P96A 4PYAA 3BF4A 3KJNB 5DMRA 3ILLA 5M1NA 3NCPA 4DEZA 3W7BA 4HTJA 2YWHA 1SH3A 2DISA 2RSQA 1FRJA 3R8EA 3QAEA 2A42A 3EE3A 5KFWA 3RRGA 4IFEA 1HIYA 3DJCA 4Y28C 2G13A 5D0HA 2XO7A 3AA4A 3DMJA 2OUGA 4CF8A 5HQ8A 1DQ9A 1BD6A 4FJKA 2OH2A 4AFFA 3AVHA 1WLJA 5FLXY 3IR5B 1M5KC 2KG0A 1K44A 2CQCA 4IFYA 1W9HA 2DNOA 5HMXA 1ILYA 4MK8A 5SZTA 1A5VA 2NQPA 3HP6A 3U7JA 2Q97A 5CYQA 1F2GA 4BC7A 1S57A 3KDOA 4UZCA 2A41A 2H5IB 4WP9A 3W9JA 3MFIA 3KLHB 4DU1A 1SJ3P 3HHLA 1KTVA 3G8QA 2ERRA 2IVMA 2HQIA 1ZBTA 5AQIA 2QSWA 3KLIA 3AY9A 1JLEB 4CLLA 3R6GB 2IJNA 2HMPA 3OYMA 3J80Y 3EWGA 4CLYA 4MK7A 1TV6A 3R7NB 2W9CA 1GAOA 4PQAA 3D68A 2RF2A 3W9HA 1RT6B 2L48A 5LJ5Y 1S6PB 4LQ9A 1DLOB 3C6UA 2B4JA 2HWIA 1ZC6A 5KI6A 3M32A 2JC0A 3QO9A 3U1LA 4RLEA 3M6UA 5F8NA 1S1UA 4NXMF 3V9XA 3CQ8A 1DFDA 2AV5A 5GMKa 4M5DB 2W42A 3M8WA 3FZ2A 3OW2M 3MWPA 1YVFA 2HYIB 1Q18A 4BE0A 4CLUA 2HFUA 2JGUA 2HHVA 4RUAA 4BRPA 2ZJRL 2Q43A 3DOMB 2JEIA 4OMFG 5IWAF 1N34F 1V6HA 2HRUA 3IN5A 3BJYA 3HPOA 2V8HA 5I3QA 2ZHAA 1RT1B 5H1SQ 3FFIB 5KTQA 1WEZA 3EN9A 4BQZA 4JI6J 2UYTA 3KG4A 3TO8A 1N5YA 2VFUA 2E5LF 1IKVA 4CYUA 4RW4B 4WIIA 5L1JA 2IVPA 4CT8A 3OYKA 4ATNA 3E01B 1HNVB 3HZEA 3AJ2A 4CO4A 2JVRA 4A4JA 3F9KA 5JJBA 2O01C 3MPUB 4CP5A 4CF9A 4JV5F 2NRWA 1CJUB 2DFEA 5A8RA 1HNWK 2DGUA 4XDDA 3M30A 5BPLA 3UB5A 3WQPA 4NLCA 2LU1A 1Y97A 4PY5A 2F5GA 1HNIB 2PO4A 2ZBCA 2M70A 2ASDA 1TMMA 4FJJA 4LFBF 3KUGA 1QVGM 1CJKB 3GFYA 1IWGA 3VENA 2ZE2B 3Q8UA 3G6ES 2EG2A 4E3SA 3U02A 4X66J 3T1HF 1K73T 4I2PB 3MMAA 1HKBA 3O4NA 4FJIA 2YHAA 3KKFA 4OYWA 4OI0A 5KOWA 1NGHA 3WXKA 2G8WA 4RNFA 2NSCA 3OA9A 1EKEA 4E7IA 4J2EA 1SQFA 3GJQB 3CJKB 2G8HA 3MEEA 1GLFO 2G0JA 2OANA 2NUHA 2B5JA 2HK2A 1KQFB 3G10A 2YNGB 3POTB 5BYSA 2B6AA 1DTQB 1HNZF 3SI8A 4UUXA 3CC7N 2KYXA 3B4MA 2KM8B 2HHPA 4IXCA 3HSJA 4XH1A 2HB5A 4BRHA 1RISA 3HSDA 4BE1A 2JWLA 4C3MA 2OJ3A 3C6AA 2EWHA 2V9KA 2N4DA 4OZJA 1E6VB 4AQYF 2FC9A 2R2TA 3BKTA 2LFVA 3PRDA 3CJSA 1FJ7A 4UQTA 2CQDA 3DAWA 5LMUJ 3W64A 2QWNA 1Q81T 3CJ9A 4CHZA 3DRSB 4FCYA 3PRVA 2QW9A 2O8FB 2D0CA 3AJ1A 2O8CB 1TP7A 3ZC4A 1U26A 5DLFA 2CQ1A 3OR2A 1Y5NB 2IA0A 1QUPA 3VZHA 1OY8A 1VRQC 4TY8B 3NGYA 2W6KA 4BC4A 1VQLN 4W5RA 2UUAJ 4OLAA 3M5RA 4OYPA 4TVAB 4KY3A 5J2QA 2ZDPA 1OKJA 3IDHA 1YJ7A 3MXIA 1CS4A 1APSA 2ZNYA 2UUBJ 4JEPA 1R6VA 2FY8A 4AHRA 4NB4A 5L9NA 3QT6A 4OHWA 1NHKL 4DFJA 2ILYA 2GQCA 1X7VA 1OYDA 1IJJA 2FZKB 3D1HA 2QV6A 2NNWA 4F0HA 2HRYA 2GQ2A 1T3NA 2KT2A 1X0PA 3T3FA 2JEFA 2EI5A 3TR8A 2C2NA 1Q16B 4M3XA 1HKCA 1CVJA 3M9MB 3NOGA 1RBOB 4LF6F 2UXDJ 3K2YA 2HFSA 2WVDA 2F7TA 4CGFA 5EHHA 2QMXA 3A8JA 2R7TA 4B9NA 3EUNA 3H2VE 4I6AA 4I6WA 1K47A 2DTUA 3DYAB 4KIAA 3F41A 1FDDA 2DPIA 3SNNA 2ZH4A 5A6PA 1FKPB 3NVKA 1WF1A 1JJ2R 2EKYA 2D3UA 3O3HA 2DR6A 2GVZB 1YUWA 1N5SA 2E44A 3RB4A 5ETLA 4OHVA 3BN7A 5HSPA 2ACYA 3OHRA 4O3OA 5LJWA 3U8XA 2BJEA 4PAAA 2C2RA 1HJOA 3QSYB 1U1PA 3BP8A 3X1LB 3O08A 3HYFA 2C3MA 3LP3A 3OYLA 4KHNA 4IEIA 4CO1A 3EXYA 3RW7A 4J9KA 1ASVA 3UIQA 4DTPA 1O8BA 3VGSA 3CM6A 4FOIA 5EWEA 2VOPA 1U1KA 5GIOA 4JI1J 2K7KA 2Z56B 1HBMA 4JKGA 3GONA 1HARA 1VHFA 1RI7A 2A6MA 1LW2A 4LF5K 3D0HE 4LBIA 5T7LB 1ZOTA 3HL8A 3ZT2A 3O80A 3I32A 5AT1B 4KGZB 2NPIA 2FVCA 3ISZA 3MCOA 2VQEF 1B92A 3QLHB 3QBWA 4HUGA 2J7WA 3TVKA 4DU7A 1LEOA 3TA2A 4B1YB 1JKHA 5F0XA 3OBYA 1PIEA 4KHSA 1X9WA 3MDFA 4PKIA 1KLMB 4DV2F 2GA7A 1E4FT 1K8KA 1RU1A 3CERA 4KTWA 1GTEA 2E5IA 4DR2F 1GOCA 1R8CA 1Q82T 5KAKA 1TKTA 3TVYA 1WI6A 5FROA 4FYYB 1KBRA 3MXMA 4HHTA 2XO6A 5KFVA 2QIFA 1IM6A 4K5SA 3CJ2A 3FNNA 3NH2A 3W61A 2D9PA 4LF7J 1U7LA 3IS9B 3JSBA 1P8ZA 4K2JA 3F56A 2AJ1A 4NXNK 5B0CA 4K4WA 3CC7S 4O8UA 2I9SA 5AXNA 5GAHI 5DJBA 3THXB 1RTDB 2GGPA 4JV2A 4QIGA 4Z4FA 1KP6A 5KPZA 1CJVB 2GVDB 4ILLA 4QS7A 1MMLA 1TVRA 3L95X 2E7XA 4CJ3A 1UCNA 2UU9J 2ZOMA 1RWOB 2IM1A 3D7SB 5GAEP 3JYTA 1M1HA 4DV4K 2RRNA 2VBWA 3I96A 2G2ZA 3CPWR 5CD4H 4A61A 2RRAA 1SKRA 1Z05A 4CLFA 3FGVA 3PHTA 4F2SA 2NRXA 3DRXA 4NZ7A 2R8JA 4TU9A 2H65B 1MROA 3KLFA 3O3LA 4LF4J 1X8DA 1FWKA 4WFAL 4JRPA 3IR7B 5H9FJ 4NI2B 1WSHA 1SQEA 4CD1A 4LY7A 1T3OA 4ZLNA 1YZ6A 1C0UA 2I8EA 5EX5A 2EKNA 4ED0A 2HZVA 2L08A 5IWAK 1N34K 4Z4HA 1NJWA 1U0HB 3D2FA 2XEXA 2RT3A 4QPXA 2DIUA 3OYNA 4H4MA 1TAQA 3PNIA 1HHSA 3UKUB 2E5LK 3B82A 4LFCJ 2DVIA 1Z25A 4IFVB 1V5VA 3QYYA 1C1CB 5F9LA 5AQSA 2HBYB 5KFIA 3HSZA 3PEJA 1C0TA 3DOLB 3DM2B 2YWWA 4YFUA 1CC7A 1VSHA 3CCWA 4JV5K 3JS9A 2I6WA 3QEVA 2R8GA 3ZT0A 1QS4A 3U3YA 1IKXA 1K6YA 3M3ZA 1FERA 4IRDA 2CZVC 1OPZA 1KQGB 1WOOA 3C14B 3R5JB 1JLGA 4MIBA 4CHQA 1IVZA 4ZVFA 4OZ0A 3DKDA 2A1RA 1YTUA 3EPGA 5GAGI 3UO0A 1HYSB 2IM3A 3OL6A 3HXMA 3SBTA 5IT9U 5IM0B 4NLDA 3NL0A 3C0BA 4CHOA 3T5KA 1J53A 3Q83A 1WHVA 3QWUA 3JSYA 2RHKA 1MWMA 3T1HK 2HVDA 2M0GB 3B8HA 2NZ4A 1P6TA 2XULA 5HANA 1VJWA 2FUG9 1N6QB 4KRWA 3CD6N 3PW7A 1JL1A 5CYMA 1SZ2A 2Z4PA 4P6QA 3VQDA 2DY9A 4B3SJ 4CEDA 1BIZA 3G6XA 3CJ8A 5C12A 2Z1GA 3EMTA 2R7QA 1JXEA 4QW9A 5KFCA 1M1KT 1ZXOA 3GU0A 3UDVA 4U95A 4K4ZA 3MXHP 4C23A 3PYEA 2PI5A 3Q0AA 1J27A 2QLFB 2MKKA 4M94A 3LWLA 2V8GA 3VGUA 4B3MK 1RU2A 2KL8A 5E3CA 4AQYK 1NGEA 1E3MA 1M5PC 3UN3A 2QT7A 2G2OA 2O1PA 3PR4A 3THPA 1QSLA 1WJ9A 4LIWA 1GMVA 4WBFA 4AM6A 3IG1B 4YOYA 1RT3A 3FVYA 3FQKA 2Q79A 2ZZNA 1FFGB 2MKCA 1XNQJ 3SUPA 3RMDA 2YI1A 2D0BA 1RHUB 3QJJA 2HW3A 4YEAA 2AYGA 4A8KA 1HQ2A 4FYXB 4O3NA 3BPDA 1UFLA 5IQQA 1WWHA 3WIVA 3MZIA 2M2BA 4FO0A 1GLBG 5JUMA 4ETXA 2D5RA 2POKA 4JI0J 1RK8A 1HR0F 2UUWA 3ZSVA 2K2PA 3M1FA 3T41A 1RT7A 5HOOA 2NS1B 4WCEQ 4O3SA 4KB7A 2O8DA 2BKPA 3CJ3A 4LF6K 1T03A 1RDUA 1R3NA 4AF1A 4IFYB 3W2VA 3VGMA 1BE4A 2YQ1A 2X6SA 2M9KA 3GIMA 1TGOA 3JTOA 2QLWA 1QAYA 4URQU 2HAIA 2GWJA 4DR7F 4FVMA 1T05B 2F7VA 4DB3A 1VQPN 2VHGA 1RWKB 3KHLA 3H20A 2IS3A 4NCGA 3VMFB 3JB9k 4EO6A 3NH0A 2B43A 2CGJA 2XM3A 1BU6O 1NZAA 3BB5A 4JBCA 3CCRS 3IBWA 5BJRA 4IH6A 2XCPA 3AQOA 4IOXA 2FPHX 1LW0A 1AA1B 3TEGA 4RKUC 1WNSA 4J91A 2UVVA 2DNNA 2B7BB 3MR6A 4JI2K 2AIRB 3MR5A 2WRMA 4I7FA 4IOCL 4IG0A 3TJ9A 2DFHA 1AROP 3NG8A 3FEXB 1TV6B 5LMUF 4N8NA 2W9CB 1RCXB 2ZM6F 2RF2B 4PRFA 3H59A 3H6EA 1XMOK 2ZOGA 4OI3A 1VQ6N 3TWZA 3L2RA 5KFSA 2IVOA 4QW8A 1SC1B 4FKXA 1WACA 1U1RA 3Q8SB 4ED4A 2P1JA 1ATNA 1RKJA 2HHHJ 4OZ5A 2E20A 1Y11A 3AO1A 4PA1A 4QZVB 4OKEA 1VIOA 3R97A 1TAUA 2CDRB 4NA1A 4QWEA 4DV2K 3MM6B 4NLSA 2UUBF 2NREA 4W5OA 3GJRB 1BA0A 1VBZA 4Z4CA 4I2QA 2M52A 4DR2K 2VC0A 4CH1A 3TRGA 2XMVA 1QAJA 4LT6A 2FHJA 3OL9A 2Y8YA 3F73A 3M4XA 2G8KA 1IKVB 5IC6B 4U7UD 4X4UA 4CYUB 5A2QU 2MJNA 4A46A 3CD6S 2UXDF 1WOQA 2YY3A 3T5LA 5CD4A 5AJ3K 5CA5A 3I0SA 4DBQA 4MT1A 3G25A 4LF9F 4LRCA 1FWPA 2XMAA 3LWMA 4BC3A 3W65A 1RBUA 4BC9A 5KPTA 2MQLA 3AT1B 4C8ZA 4D3HA 2B4UA 2AEMA 4DPUA 3VQ8A 1U24A 4NWBA 4NLTA 5KG5A 5J1EA 2AYMA 4O0JA 2KDOA 3GBTA 2EK6A 4DTSA 1ZM4A 1RT2A 2KRBA 1X3MA 4DX7A 6AT1B 4E7LA 5A8WB 3QFPA 3VHQA 4K8ZA 2DTJA 4H0VB 4UOFA 1C1BA 3IAYA 3UKRB 1MG7A 4B1VA 5FPEA 2JFKA 1HHTP 3TUJC 3CMES 4DFPA 1RBRA 3CCVS 2NRHA 2MZQA 4K4YA 2IAJA 1IV0A 3QJPA 4ILGB 1VC5A 4CHPA 2NCKL 2CUYA 1E6YA 4DCJB 3CFPA 4PKDB 2GNKA 4YHHF 4YR2A 1RWVB 2P9UA 3G8TA 3MEEB 3CDEA 2DXDA 4BRQA 2BYCA 3THTA 1W2BR 2EFGA 4CF0A 4BWJA 2XBPA 2XHCA 4F25A 5LM7E 2B6AB 4FJHA 1H7XA 4MK9A 2C2MB 2J7UA 4P75A 2IDEA 2EW9A 9RUBA 1BC6A 3VQPA 3PACA 3H2UB 4L73A 1TUWA 4MFBA 2ZNZA 2XNQA 2IIHA 3NVMA 2E9ZA 5HP1A 3MGJA 4UQGA 2OLWA 4QQBA 3T1AA 5L39A 2BUPA 1U4BA 3AVKA 3RZAA 3VALA 1YXQA 3A5MC 4KTZA 4DUZK 1IBKJ 2WC9A 4DTMA 1IBMK 1QVFR 2ZWPA 4CK3A 2DGXA 2FLLA 1OSCA 3DLRA 4TKTA 3GZ7A 4P9SA 1UJ6A 1NJXA 1GH8A 3JSMA 4ED3A 2EVZA 4L74A 3TJAA 4JOUA 4NA3A 4ELTA 4A57A 4FYVB 2M8HA 1PILA 2ZWHA 3OR2B 3OYBA 4FLZA 2CQ3A 1VQPS 3BGLA 1WSJA 5I42A 4OJRA 4LF7F 3NNCA 2W4PA 1N8RO 3PW5A 2BW2A 3BQ2A 4XH4A 3A3OB 3P5TL 3BPSP 1M5VC 2P9PA 4E1JA 3UCZP 2OELA 1X4AA 3RBXA 3SQ1A 4LQ3A 3B78A 3QINA 3CETA 4KHPJ 1S49A 1CS4B 4B3OA 5BR8F 3C7NA 1OVQA 4HL9A 3SEOA 2DR5A 2C42A 2N3LA 3HF5A 2AD9A 3BSOA 3N0VA 2R4FA 4K5RA 2HQDA 5DM7Q 3PUFA 2HK3A 3PX0A 4KYZA 2UU9F 3KJVA 4CM2A 4BR2A 3MUMP 3ENAA 4X62K 4K8XA 2HHWA 4ZS6A 4KH1B 3ZEUA 1YZ7A 1H2VZ 3AVJA 1LQ9A 4IR9A 1FVSA 3BGUA 4Y2CA 1YI2N 2X3DA 1VQ6S 5LY3A 3VOVA 1J5OA 2L41A 3LZIA 2UXBK 1FK9A 4TQRA 4JKCA 4LF4F 4X64J 5K8OA 1OS5A 1R89A 5GINA 2OMLA 1L5UA 4EU0A 5C7PA 3HLUA 3OTOJ 3CJCA 4FJMA 1N88A 2RU9A 3NGDA 2YNFA 1RP5A 4LBPA 2KHCA 2RHQB 2ASOA 5C25A 4H0OA 2XWYA 3O6QA 3CULA 2B9XA 3BBBA 4HHHA 1TKXA 4YY3F 2VKRA 3CEDA 4PR6A 3T6JA 4LFCF 4OQJA 3H2LA 1HNXJ 4KGVB 4DV7K 3AOAA 2RDJA 4DR5J 4DHYA 4O55A 2B4VA 3RBEA 4JKGB 2AJFE 1ZM9A 2E1YA 2MY8A 2MZ1A 2OMOA 3ZT3A 2OPQA 2AGQA 4DSIA 1HQEB 1WSEA 4Y65A 4I69A 1TUVA