4I2PA

Crystal structure of hiv-1 reverse transcriptase in complex with rilpivirine (tmc278) based analogue
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
554
structure length
554
Chain Sequence
MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A comparison of the ability of rilpivirine (TMC278) and selected analogues to inhibit clinically relevant HIV-1 reverse transcriptase mutants.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Hydrolase, transferase/inhibitor
molecule keywords Gag-Pol polyprotein
total genus 155
structure length 554
sequence length 554
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4i2pA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4i2pA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4i2pA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4i2pA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4i2pA05
1NJYA 4IRKA 4DTOA 3ZSQA 3JSMB 1IKXB 1VSLA 3T5KA 2C28A 2XY6A 2HHSA 1QUVA 3PR5B 3GYNA 4YR3A 1RTJA 1OS5A 2ILZA 4DQIA 1RT4B 4QWEA 3H5UA 5JUMA 2UUWA 5DGAA 1ZBLA 3MXMA 4Z0UA 1K6YA 4FCYA 1DLOB 4KB0A 1W0HA 2HVIA 4BE0A 4Q44A 4J9NA 1EETB 3GIMA 1C0UA 3D5MA 3CJ4A 1GOAA 3PX6A 4O55A 2PZSA 5KG3A 4O5BA 5KT7A 2BRLA 5KG0A 1U47A 2X78A 4BACA 3P1GA 4KI6A 3H40A 4N41A 4MKAA 5HROA 4E0DA 5KFIA 4FLZA 2WHOA 4TY8A 5KFQA 1N6QB 5KRTA 2IDOA 3AA3A 5C25A 1YTUA 2OPPA 3LP2A 4B9UA 4MKBA 5I42A 2IM3A 2DFHA 2XI2A 1XR5A 1RDCA 3QZ8A 4DFPA 3M8RA 3V6DA 4ZHRB 4DSIA 4DTJA 1J5OB 1S6PA 2BRKA 1KHWA 4HTUA 3I0SB 4PUOB 3BREA 1D0EA 2G8UA 4QWBA 1TKZB 3GV8B 2E9ZA 4ZVEA 4PQUA 4OJRA 4J9QA 2XY5A 2X6NA 3ICLA 3VA3A 5DLGA 4ECVA 3RR7A 4IBNA 4FVMA 1S9GB 3AVMA 3UIQA 1HMVA 4DQQA 4IDKB 4BDZA 3KD1E 4NZ0A 2R8JA 3OYAA 1SH2A 3BQ0A 4KKOB 3G10A 4FYDA 2W8KA 3O4NA 3OYCA 3G6VA 3HP9A 3HP6A 3ZT0A 4FJJA 4RW7A 2D0BA 1TKTB 1JIHA 4H4OB 4M3UA 1HYVA 5J2MA 1HNVA 2HHUA 5SWMA 2VG7B 1C1CB 5KFHA 3GIJA 3T19A 1N6QA 4LSNA 2HAIA 4XO0A 3I0RA 2Y1JA 1VRUB 2D3UA 1RT1B 4ELTA 5HBMA 3FQKA 4MIBA 5KGWA 3V4IA 1SUQA 2FVQA 4CGIA 4WYLA 1JLQA 4NRTA 2BANB 4J2BA 1I3AA 4I9QA 3KIOA 4FJ5A 3BSOA 3OHBA 4HUGA 4FW2A 3DOLA 5EU7A 4J9MA 1RT5A 4IFVA 1RTHA 4DLEA 5HLFB 1TVRB 3PHEA 3HXMA 3B6PA 2J6UA 4C8NA 2VWJA 5DG7A 1RBUA 3V9SA 3L2VA 3OYBA 3RMDA 4R0EA 1TVRA 3ZSVA 1LW0B 4JV1A 4TQSA 2V4RA 3QYYA 3MEDB 3WNEA 1U49A 3FRZA 4M45A 2WRMA 1L3TA 3DLGB 3TAMA 2P5OA 2BE2B 2VG6A 2VA3A 3CWJA 3PV8A 1D5AA 5F8HA 3MR3A 5I3UA 4ZP8A 1JLAB 2W9BB 1ASUA 4RU9A 1TV6A 3AVNA 3L2UA 4B9TA 2G8WA 4DF4A 3O4QA 2XRIA 3KHRA 5J2NB 4OGCA 4E1NA 4JV0A 4WFXA 5EUHA 4NLYA 4E3SA 3OYFA 1TP7A 3JYTA 5KFGA 3OJUA 3KMQA 4O3RA 3SNNA 1HQEA 3QIPA 2HNYB 4Q45A 3PX0A 1NKBA 5J1EB 3AVCA 3F73A 5KGXA 4YQWA 3KNAA 2QXFA 4AH9A 3AVFA 4DMNA 3KJVB 3M8QB 4KTQA 1A5WA 2YNHB 2CKWA 3QEWA 3IRXA 2Z1GA 1REVA 3L2WA 3NMAA 1LW2A 4FM0A 4ZVHA 3NGDA 1NOYA 3DOLB 3DRRA 4IDKA 1T03A 3M8QA 4MFBB 2B43A 3GIIA 4CFAA 4BE2A 4CE9A 2DPIA 1NKCA 3GV7B 3PW2A 2B5JA 4FJNA 4F50A 3RBDA 4Y1DA 3QEVA 4RW6A 2KZZA 5CYQB 4FJ9A 1QSSA 2QKKA 1QAIA 3LWMA 1BCMA 4KHSA 3KLFA 2R2RA 3ZT3A 3QGGA 3VQ6A 4DQPA 4RNNA 4DSFA 1F21A 4CGGA 4HKQA 5KT2A 4F4ZA 2DFFA 2UUTA 1JX4A 4Z4CA 3O3GA 1C1CA 2HWHA 2F8EX 1G15A 4NLQA 3SQ1A 3LP2B 1RTIA 2IGIA 4TN2A 4B3OB 5KG5A 2OPRA 4ZPAA 3LZIA 4U7CA 3C94A 4AHTA 4GW6A 4DWIA 3L3UA 3DRPB 1B9FA 1B92A 1WSGA 1MU2B 2NUBA 5J1EA 2OH2A 3NE6A 2G8VA 5FDLA 4DG1A 1RAJA 2HHQA 3K5NA 5KFKA 4XIUA 4O3PA 1S0NA 1IKYB 4Q0BB 2IM2A 4QPXA 1TV6B 4ED1A 3KLVA 3KTQA 5F9LA 2PYJA 1BIUA 1D1UA 3CDWA 4ZP6A 1J9AA 4E7JA 4ICLB 4LSNB 4MH8A 3V81A 3PW0A 4M95A 3DLEB 4EBEA 3QNNA 4HUEA 1HQUB 4F4KA 2HNZB 4ZTJA 3OYLA 2ITGA 1WNEA 4OKJA 1TKZA 3KLGA 1U09A 5KFAA 3PW4A 4OGEA 2D0AA 4J9LA 3Q8PB 1D9DA 3UDLA 1TKXB 5HP1B 3ULDA 4CGJA 3KLGB 5KG7A 3KKRA 4DU3A 4M3ZA 1S9GA 1S1UA 4O3NA 5J2QA 2HNZA 2HHWA 3HPHA 1IM4A 4MK9A 3OYMA 4KHWA 4FJHA 5C5JA 3KLEB 3EZ5A 5KG4A 4ECUA 2VG5A 3U3YA 2GIRA 4IG3B 1RT2A 1SKWA 4CJ5A 2B5JB 4KHUA 2Z1HA 1W9HA 2PY5A 3HPGA 1HYSB 4FLTA 4M3RA 1RBSA 4ED3A 2E9RX 4FK2A 2FVPA 4DTNA 3CFRA 2UVUA 1DTQB 4RW4A 2ETJA 2UVWA 3K59A 2Y1IA 3LP0A 4I7FB 3NBPB 1JLEA 1VSHA 2ZD1A 2HMIA 4H4MB 4FJXA 3OLBA 1RT6A 4W5OA 4IKFA 1RNHA 2EC0A 3K5OA 2F96A 4O0IA 5KFLA 3LALA 1BQNB 1YTAA 1RT4A 3MR5A 1I6JA 4HUFA 1NK0A 1MMLA 3RRHA 1J53A 3PJWA 4DFJA 1RCHA 2F8SA 2R2SA 5DG9A 3KKSA 1FKOB 4ECXA 4Q43A 4KBIA 4O3OA 4F3TA 2YKMB 1UA0A 5FDLB 4W5RA 4MFBA 1LWEB 4RW6B 5D3GA 3LP3A 1CLQA 1WSIA 4LSLB 2W8LA 4KV8B 5DQGA 4RW7B 2XY7A 3SUPA 3KHLA 3S3NA 3ZSWA 4FJIA 3TVKA 2LSNA 3C6TA 4DF8A 3AVHA 3NCIA 2JC0A 3WNHA 4TYAA 3V6HA 2GIQA 3OHAA 3BJYA 4ED2A 2P5GA 3KHGA 1SKSA 4MK7A 4RG8A 2V9WA 4ZMMA 1N4LA 3V1RA 1RT7B 4PA1A 4H8KA 3DDKA 3SJJA 4DS4A 4IR1A 2B6AB 3WNFA 3L3VA 3DLEA 4DS5A 1RTJB 4B3OA 4UQGA 1HMVB 3QIDA 4HHTA 1SUQB 2O4GA 2AU0A 4CJUA 4H54A 3JSMA 3QEPA 2R8HA 3FFIB 2IJFA 3QO9B 3BSCA 3FDSA 4CJ3A 4WE1B 3AVIA 3OYHA 2XY8A 3RMBA 4L8RB 5F8JA 3CG7A 3QEXA 3QINA 3NF7A 1QQCA 4K8ZA 3RB6A 1Q8IA 3I0SA 4ED6A 3N6NA 3MEEB 4LH4A 4DTMA 1CXQA 2HW3A 2IA6A 2XCAA 1FKOA 4CIEA 3PR4A 2AJQA 3DLHA 4IG3A 1VRTA 1HRHA 2W9CA 4Z4GA 1SV5A 4WZQA 3KLIA 3NDKA 2DTUA 3T1AA 4DL5A 1NK5A 4O3SA 4RNMA 3SUOA 1DTTA 1EX4A 3G86A 3LPTA 3SQ0A 5JXSA 1S1WB 4CF2A 4KKOA 1T94A 4CHQA 2HVHA 2IC3A 4EP5A 4HCCA 4LQ9A 2E6MA 1TAQA 4F4XA 3QZ7A 2C2EA 3VQ9A 2J6SA 4HYKA 1S0MA 1ZBUA 5J2PB 3SPZA 3VQSA 1SL0A 4ZVGA 3S3MA 1XR6A 2XO7A 4NCGA 4CEEA 1LWCA 1SH3A 4CGFA 5CYMB 1RTDB 4R5PB 3H5XA 3O3HA 3AA2A 5KT4A 5KRSA 5DQHA 1BHLA 1HNIA 3L8BA 1RT2B 2R7YA 2KW4A 2KQ2A 3KLFB 4QW8A 1C0UB 4DSKA 4IQXA 1LWFB 4F4WA 1Y97A 1NK6A 3V1OA 2FVCA 3U6FA 1IH7A 4EZ9A 4Q8EA 4ID5A 5KFWA 3DOKB 3B6OA 1DTQA 1JLBA 1L5UA 1RDAA 4FM1A 4EP4A 2OZSA 4K4UA 5DQIA 2Z1IA 4QWDA 1GX5A 1NJZA 2ILYA 2IC3B 4ECTA 1C0TB 1EKEA 1ITGA 3PZPA 4O4RA 3KMSA 4CF8A 3QGHA 4CGHA 1EXQA 1VRUA 2E9TA 2YNIA 4KO0B 1WAFA 5KFOA 4M3XA 4NLUA 2KFZA 3V4IB 3UPFA 5KFZA 1KLMB 3F9KA 2XWYA 3KK2B 2RPIA 1C2PA 2YNFB 3H4BA 4E1MA 4K4XA 3EPGA 3E01B 3M8PA 4W5TA 3SUNA 1ZBFA 2YKMA 1RTDA 4E7LA 4FLVA 4FXDA 3OSPA 4Z4HA 2D41A 4KE5A 3TABA 3T5LA 1S49A 4FBTA 4B9LA 2WOMB 3MXJA 1C1AA 2HHTA 1VSIA 1FK9A 3KK3B 4F3OA 4FLWA 1S48A 1N5YB 3TAMB 3SFGA 4ICLA 1JLBB 3IG1A 3OJSA 3NAHA 3MXIA 4ECZA 3V6KA 3RMCA 1RYSA 3FQLA 1XI1A 2JEGA 3NGZA 3NFAA 4CEOA 4C8LA 4DTSA 1RT1A 2IAJA 5CZ1A 4YR2A 1RDBA 3D45A 4DL6A 4G1QB 4KSEB 4B08A 2ZE2B 1NK9A 4IR9A 4G1QA 5DMRA 2G8FA 4KFBB 1K1QA 4J9OA 2IAJB 5DLFA 3M8SA 3HVWA 2IBKA 3AVBA 5K14A 3SI6A 4W5NA 4CEZA 4URQU 3H4DA 1TL3A 3HT3A 5C42B 4IFYA 3DRRB 4TQRA 1QAJA 4WFZA 4M42A 4WZMA 4ZPBA 3BSAA 3CFPA 4AHSA 4N76A 3QNOA 2WOMA 4CJVA 4CFDA 1KVBA 4NRUA 3O3FA 4ED0A 3H5YA 4RW8B 3KLHB 3V6DB 4O4GB 2D0CA 2IOCA 4FLYA 3GV5B 3OYIA 1UWBA 4J9SA 1BISA 3OYDA 1JLQB 1XWLA 1D8YA 3QGIA 4NYNA 4ZP7A 4XPCA 1IO2A 4KREA 4ELVA 1J5OA 2ASJA 2C2RA 3V1QA 1S1UB 1QHTA 4CECA 1XC9A 5KG1A 2EHGA 4J9PA 2XC9A 3SFUA 1A5XA 4MK8A 5KFMA 4QCLA 2QV6A 2YHAA 5CZ2A 1UWBB 5EWEA 4M3TA 4DFMA 2YV0X 1S97A 3IRXB 3MR6A 3G6XA 2ZKUA 2JGUA 1KFDA 4CJRA 3PW5A 2BGGA 3C6UB 2JEIA 5KFUA 3VQCA 4IH7A 3QERA 3FSIA 1WSEA 5EWGA 1JLGA 4I2QB 2R2UA 2FBXA 3LDSA 1L3SA 4JLHA 1SH0A 3CYMA 1N48A 4YR0A 3VQ5A 5DK5A 5DG8A 2FJXA 5KFXA 1NJXA 2BQRA 3CDEA 3THVA 1RTIB 3JYTB 1QE1B 3TWHA 2G8KA 3HPOA 4DSLA 1FKPA 3CM5A 4EBDA 4DL7A 3OYNA 4JRQA 2RN2A 4KO0A 2YNIB 3RR8A 3TAPA 5I42B 3H98A 1KLMA 2JEFA 4CGDA 3OYJA 1MU2A 3NF8A 5EDWA 2VG5B 2J6TA 4RNFA 4WYWA 1B9DA 4N56A 1S9EB 5KFTA 5SZTA 4K50A 3NAEA 1XHZA 2OPSB 2HNDB 4OPJA 4DU1A 3OY9A 5J2QB 1Q9YA 1FK9B 3KK3A 1U4BA 4ZVFA 1DLOA 2QKBA 1WLJA 2JLEA 2AX1A 5F8LA 1ZYQA 1Q9XA 3MEEA 5F8IA 1CXUA 3AV9A 4LSLA 2IM1A 3ALYA 3EYZA 2BQ3A 4QOZB 4I9LA 2WB4A 4O0JA 5FROA 1S6PB 3AO1A 4CEBA 4DQRA 3GILA 3PVXA 2XI3A 1UA1A 1TQLA 3SQ2A 5HBMB 3FFIA 4F2SA 2VG7A 2FBYA 3H5SA 2W7OA 2RF2A 4OLBA 3HKWA 3VQQA 4OKKA 1JLCA 4TSXA 3I5CA 4CHOA 1C0TA 4K8XA 3DRSB 4NLWA 1VK0A 2G8IA 2B6AA 2ATQA 2WONB 5KFCA 1BQNA 3BDPA 3OS1A 3OSNA 3QLHB 3CM6A 3OYEA 3NH2A 2OPSA 2AGQA 2JC1A 3CJ2A 5I3UB 4EYHB 4ECSA 1JXBA 1TK8A 4CJQA 4CFBA 1VSMA 5HRRA 5FRNA 5HLFA 3I5BA 4EZ6A 3NGIA 4M41A 3DYAA 1R0AA 4ID5B 3V9ZA 5F8MA 4GC6A 1C1BB 1ASWA 3QETA 4LY7A 4RUCA 1BI4A 3KLIB 3KK1B 3NH1A 1IKWA 1WN7A 4FJKA 1HYZA 3C6UA 3TAGA 2I5JA 4WXOA 2XGPA 4EO8A 4E89A 5J2NA 1VRTB 3ZSYA 3CDUA 4RW4B 2A1RA 1LV5A 1VSKA 4C8KA 1LWCB 3DRSA 3LANA 3MECA 1ZTWA 3RB0A 1WSHA 2KFNA 1CSJA 1RBTA 3OYKA 1LAWA 1U48A 4FLXA 2AQ4A 3Q8RB 3SYZA 1S9FA 5F8NA 5CYMA 1TKXA 5HP1A 3AVJA 4TLRA 3MTKA 2RDIA 1T3NA 3EY1A 3QO9A 3M9MB 3DRPA 1VSJA 4EEYA 4GC7A 4ID1A 1L3VA 2I1RA 4B9NA 2FLPA 3D28A 3K2PA 3AVAA 3V9XA 3ZT1A 3OYGA 4IH5A 3HHKA 1A5VA 3NGYA 2XGQA 4RW9B 1JL2A 4CIGA 3ZSOA 3TAEA 2OA8A 4C8OA 4BDYA 4Y2AA 4U6PA 4OKEA 5EWFA 3SUQA 2JEJA 1XHXA 1U04A 2E4LA 3IS9B 1BQMA 3T5HA 4E7IA 1KCFA 3V9WA 3NHGA 3QIOA 1HNVB 4CF0A 2FC0A 4CK3A 2RKIB 2FVRA 2HB5A 1QE1A 2DY4A 4J2EA 2IMWP 3DMJB 1ASVA 2AWZA 3BQ2A 3KLHA 4B8AB 4ZPCA 3BGRA 4LD0A 4ED7A 2FBVA 4FS2A 2W7PA 2FLNA 4F2RA 2OPPB 3VQDA 1KLNA 4K4WA 2AX0A 1RT3B 3PX4A 3PUFA 3RB4A 3DM2B 4NLOA 4E7KA 3GIKA 4XPEA 1KFSA 4DTUA 5KFNA 1VSEA 3VN5A 3NH0A 4CCHA 3ZSZA 1K1SA 1U45A 3M9NB 2D5RA 2BQUA 2VWKA 1CZBA 3CIZA 1TK0A 4DL2A 4FS1A 5KFJA 4ED8A 3QESA 3PO5A 4MIAA 3VQ7A 1JKHB 4B9MA 1Z4UA 2B4JA 1JXLA 1LWEA 4PWDB 2RKIA 4K4VA 4NLRA 4FW1A 5HROB 1YVFA 3TI0A 3I5AA 3C95A 2EX3A 3VQPA 2ALZA 4W5QA 3I0RB 1S6QA 4J2AA 1HARA 4R8UB 4JV2A 4JRPA 2RF2B 2W42A 5CYQA 1RA6A 5KFEA 5L1LA 3AVGA 5HRSA 4FJ8A 1W25A 4N47A 4NLTA 3RBEA 3T3FA 1BIZA 4J9KA 2ZD1B 1S1VA 3RTVA 2OPQA 4NLGA 3LP1B 1NHUA 1KTQA 2UVVA 3AO4A 3NL0A 3L2RA 5L1KA 4Y3CA 4FK4A 1UOCA 1KSPA 4ZTFA 4CJPA 3V9UA 5KFSA 4Z4IA 3LAMA 2Q3SA 2Z1JA 2F8TA 4HVJA 3RWUA 1T05A 5D3GB 2PYLA 4M94A 1IKVA 3IN5A 1LWFA 3CO9A 2IM0A 4CEDA 2HWIA 4WXWA 2YNFA 2GV9A 1S1XA 4CF1A 4KHRA 1RA7A 4CK1A 4CFCA 3OL7A 3KOAA 3ISND 4CJLA 1X9MA 1RDRA 1TAUA 3VQAA 1JLAA 3MF5A 2W9BA 4DFKA 3E51A 2RDJA 5J2MB 4CK2A 4TXSA 3H59A 2DPJA 4IG0B 4PWDA 5C42A 1D9FA 1TK5A 4IOBA 1UAXA 1SL2A 1EP4A 4IH6A 1S1TA 4RUAA 2HMIB 4CEQA 4AHVA 1L3UA 5DGBA 2V4QA 4RZRA 4FZYA 5KFVA 3QLHA 4NCBA 3BQ1A 2OZMA 1S9EA 2YNHA 3HJFA 3P83D 1RT6B 4RNHA 3G6YA 5K14B 4YMEA 2XHBA 1C6VA 3LZJA 3DI6A 1X9SA 4KHMA 3KK2A 4Y1CA 1QTMA 3CQ8A 3H2LA 1IKYA 3MEGB 3ITHA 4TY8B 1BQMB 3TAQA 3NAIA 3DI6B 1ZTTA 3DLBA 1HYSA 4RW8A 3D0PA 4K4TA 4DSJA 3MR2A 1QS4A 1TL1B 1WSJA 3SQ4A 3DLKB 4K4YA 3RB3A 2R2TA 5JS2A 4O4GA 3TARA 1GOBA 2BR0A 4KAIA 3LP1A 2GBZA 5KT3A 4OL8A 5KI6A 2HNDA 1JLFA 1T8EA 4I2PA 3KJVA 4YP3A 1C0MA 1S1VB 4IFVB 3Q8QB 3AO2A 3U3GA 4KV8A 1HNIB 3K57A 3ITHB 3OL8A 3HYFA 4KB1A 2ASLA 3ZT2A 4BDPA 1FXXA 3ZT4A 4CHYA 2G8HA 1IG9A 4Q0BA 3CVKA 4FJGA 3KD5E 3VQ4A 5F8GA 4KTWA 4CIFA 1WSFA 4HCBA 3LAKA 3GQCA 3IAYA 2FJVA 4AILC 3MECB 2E6LA 2D3ZA 1QSLA 4O3QA 1WAJA 5C25B 2QE5A 2WK4A 5FRMA 5J2PA 4CJWA 3OLAA 1RT7A 4E7HA 3IG1B 2I5JB 3N6LA 1TKDA 3H08A 4R8UA 3NBPA 4IRCA 5KFRA 2YKNB 4ECRA 3C6TB 5E41A 3T5JA 3OS2A 3CJ5A 3LPUA 4O44B 5HRPA 1HQUA 1LW0A 4NLVA 1RTHB 2P1JA 5KG2A 3TQ1A 3OS0A 1NJWA 2KTQA 4Q8FA 4J2DA 2FVSA 3OL6A 2X74A 2W9CB 3MAQA 4EYIB 1RT5B 4ZHRA 3V6JA 5HRNA 2YNGA 4CF9A 4O44A 2OYQA 4DG1B 4NLXA 3MEGA 4RW9A 4CJEA 2A1SA 4H4OA 3S9HA 2ATLA 1JKHA 1C1BA 3RAXA 5T14A 2BDPA 3IS9A 4X2BA 1S1XB 3NKYA 4AHCA 4CJTA 3NF9A 5C24A 3SI8A 3WNGA 4ECYA 4YFUA 4JS4A 2ZQBA 1RYRA 1QSYA 4FJMA 3HVTB 1RT3A 1JLEB 3EPIA 1I39A 1S1WA 3HSTB 4JS5A 2UVRA 3L2QA 4DLGA 4DL4A 4DTRA 5KFPA 2DFEA 2D7SA 1KVAA 4C8MA 3LP0B 4I7FA 4PQUB 5KFFA 3PJXA 2QK9A 2OPQB 4CESA 4CHPA 4KFBA 4URGA 4F8RA 1JXEA 2YNGB 4ZPDA 4FZZA 4NLSA 2V0NA 3ASMA 2BANA 4FZXC 3RMAA 2R8KA 3E01A 3M8PB 3DLRA 3ZSXA 4ECQA 3M9OB 2FBTA 1IKWB 4E19A 4QWCA 3MFIA 4DTPA 3HM9A 3AVKA 4CJFA 4TY9A 2X6SA 4GMJB 4CJ4A 4I2QA 4N5SA 4BE1A 1T03B 4M3YA 3ISNC 3HVAA 1TKTA 4NLPA 5KT6A 4Y34A 2IS3A 1SKRA 3CJ0A 4IKAA 1BI4B 3DOKA 4GVMA 1J54A 3HVTA 1TL1A 3PW7A 4KB7A 4KTZA 4FJ7A 1JL1A 4H4MA 3VQ8A 4DL3A 1YT3A 1S0OA 1ZETA 5JS1A 1S1TB 5L1IA 3SV3A 1RBVA 3HVRA 3DM2A 2HNYA 1TGOA 4TYBA 3VQEA 2P51A 3G0ZA 4NYFA 1JLCB 4DEZA 3OL9A 1YVUA 2R8IA 2ZE2A 3PO4A 3RRGA 3AO5A 4FM2A 4FLUA 3PY8A 3DLGA 3HO1A 4LQ3A 4DQSA 3CJ3A 3AA5X 1X9WA 4B9SA 3DYAB 1NNDA 5F9NA 3RAQA 4CJSA 4M3WA 4R5PA 4KI4A 1JLGB 4B9VA 1EETA 4CEAA 3IGVA 2GUIA 3AA4A 4FK0A 4DTXA 1NOZA 2CJQA 3EZUA 5KTQA 3HK2A 5T7BA 4KRFA 1XR7A 1REVB 5KT5A 3AVLA 1RILA 4OLAA 3MEDA 4MQ3A 2YHBA 5CY4A 4KHYA 2ASDA 2WCXA 5L9XA 4F4YA 4AHRA 2HHXA 4NCAA 4B8CA 4BWMA 3IGNA 2R8GA 3I8DA 1BGXT 4K4ZA 3KHHA 4Q5VA 3SPYA 1KHVA 2GC8A 1IKXA 1NK8A 4Y2CA 4PY5A 2C22A 3N6MA 1SL1A 4AHUA 4IRDA 1X1PA 4Z4EA 1S5JA 3DMJA 3SCXA 3VA0A 3K5MA 1BCOA 1HPZA 4RNOA 4WE1A 1NHVA 1Z26A 4CHNA 4Z4FA 4I2PB 3SZ2A 2AGPA 5L1JA 4K4SA 2XCPA 1IKVB 3S3OA 4KHNA 3KLEA 1LW2B 3A2FA 1O1WA 3LWLA 4IFYB 1S4FA 4QAGA 1GOCA 4NLDA 1N5YA 3HL8A 3DLKA 1HJRA 1KRPA 2IJNA 3KK1A 5C24B 2FJWA 2BE2A 2VG6B 2C2DA 1NK4A 4OPKA 1SV5B 4KHQA 1DTTB 4ELUA 4CERA 4ECWA 2YKNA 2OPRB 1CZ9A 4G3IA 1HQEB 3QIPB 4WFYA 3BGRB 2WTFA 3BR9A 3P5JA 4EO6A 5KFBA 3OVNA 1S10A 1FKPB 1HPZB 3SV4A 2HHVA 3UQSA 3Q8SB 3K5LA 2FLLA 3MFHA 1T7PA 4JUZA 4ZP9A 4YNQA 1NK7A 2W9AA 4BWJA 4NCGB 1T05B 4DSEA 3K58A 2O4IA 2AGOA 3UR0A 1R0AB 4QW9A 4EBCA 1BL3A 1RBRA 3TAFA 1JLFB 5KFYA 1RDDA 1GX6A 4KPYA 1N56A 1ZBIA 3TANA 4CEFA 3AO3A 4FJLA 4CJKA 1LAVA 1TL3B 4LH5A 3VQBA 4QWAA 1NKEA 1Z25A 4URSA 3BSNA 3QEIA 4NYZA 3NF6A 1VSFA 2VA2A 1KVCA 5KFDA 1EP4B 3CFOA 2KZMA 1S6QB 4J9RA 3ZCMA 1WNSA 1ZBHA 4IG0A 4PUOA 2WONA 3ZSRA 5KG6A 4CHZA 4DU4A 2O5DA 4KAZA 4OVLA 3V81B 1VSDA 4FBUA 3TR8A
chains in the Genus database with same CATH superfamily
3VAKA 4NLCA 1HR0F 1SXLA 2AD9A 2QXLA 3CC4S 4CYUB 2BEFA 2BV3A 4DV3F 1WDDA 4YR3A 1I94K 1GFWB 2OFGX 1OS5A 2ILZA 1MROB 4QQBA 3THPA 1RT4B 3C46A 3AD7C 2LCWA 2UUWA 5DGAA 4FO0A 1ZBLA 3CT9A 1PO6A 1K6YA 3UKUA 1HWIA 1XN9A 4CTAA 4Q44A 4CD3A 1X5TA 2HQGA 1GOAA 4C4WA 5KT7A 1TYQB 4DV7K 5KG0A 1U47A 5IOLA 3P1GA 2KJWA 3SDEB 4AXJA 5HATA 2H54B 1SVDA 3CCUS 4TY8A 2ZM6F 3BYRA 2EPIA 2IDOA 5KRTA 3NCRA 3UE2A 4ZJLA 4OZ5A 5AQIA 4RUHA 2IM3A 1U2CA 4MAKA 2XI2A 4NXNF 1RDCA 3M8RA 4ZHRB 1BOTO 1TUVA 4MIWA 2A10A 2FF3B 4HTUA 3QT5A 3IMXA 1GQEA 2IDLA 4QWBA 1TKZB 3GV8B 5ETQA 1HD0A 3ZTRA 4HTJA 4YUDA 2YJEA 2PSZA 4ECVA 3RR7A 1S9GB 4O8UA 4ILLA 1RSCA 2CQ2A 4NZ0A 2KDOA 1FKAF 1WBDA 4FYDA 5BPNA 3HP9A 1S12A 3GYGA 1TKTB 5LJWA 3OTDA 1HYVA 2HK3A 2DHGA 3AY9A 5SWMA 4X4TA 2VG7B 2K2PA 4OHXA 5KFHA 1AYEA 4UUXA 4DBQA 1U6ZA 1CG2A 4WJBA 3A8EA 3QJLA 4CBWA 1N6QA 2OTJN 2Y1JA 4MIBA 5KGWA 3BBFA 1R8PA 2KJVA 2HURA 1O51A 5ETVA 2GVZB 5T7LA 1I94J 5AQUA 3HHLC 4J2BA 2Z2LA 3KIOA 4NPOA 3OHBA 4IO9L 4XTTA 2FJDB 4OFZA 5HLFB 1QD1A 3PHEA 3B6PA 1SPBP 2NRVA 2VWJA 5DG7A 3RMDA 2Q0UA 4PR6A 1YBUA 2BUPA 2UXDF 4TU9A 3FRZA 4C7QA 4M45A 2G0CA 3CWJA 3K5PA 1HHTP 4ZP8A 1JLAB 1XUPO 3OTOK 3S01A 1TV6A 3LGHA 4DUYK 3NCPA 2G8WA 5AQJA 1OH5A 3KHRA 4OGCA 1PCAA 1H72C 4E1NA 3WXMB 1VQMS 4MO5A 4WFXA 4E3SA 4LFCF 3I82A 1ZA2B 2IYGA 1U7LA 3QBWA 2UU9F 2JWLA 5KFGA 3HSCA 2LMIA 3ULHA 4X62F 3CCJN 3SNNA 1HQEA 2B9WA 3K8WA 1NJIO 1A6LA 4NA2A 4FWNA 3OVSA 3F73A 1BO5O 4NEZA 4BGAA 1GAOA 1VISA 2RJZA 4QIFA 2KHCA 2CKWA 1IQZA 1GLJO 1U1QA 3QEWA 3IRXA 5F1XA 2E5LJ 3WEEA 3D4JA 4FM0A 3FZFA 3NGDA 2CNOB 3DRRA 4R0JA 3VGKA 2HGLA 1X60A 3OBYA 1VQMN 4F02A 4MLHA 3M8QA 3GIIA 4CE9A 1O8BA 5I4MA 5HSPA 1QVGM 4F50A 4RW6A 2BKNA 2KZZA 1HX1A 5HMXA 1HLUA 3AY0A 3MUTP 5JVGQ 1QAIA 1BA1A 1BCMA 3KLFA 1NGIA 3VQ6A 4YY3K 4RNNA 2EFPA 4AL7A 3MTJA 8ATCB 3UB5A 5GAGU 4FWRA 4HKQA 2DRBA 1YJWN 4LFAK 1FJGK 4Z4CA 1KTVA 7AT1B 3O1BA 3LP2B 5H1SV 2IGIA 4TN2A 4C0OC 3DJCA 2ZHAA 3VGVA 3C94A 2DGSA 2RDDA 4DWIA 4FOIA 2CADA 3I6PA 1B92A 2ZJQL 5CZVA 1BG3A 2NUBA 5J1EA 2RHSB 2Z58B 2E1ZA 3MZIA 2MDAA 4JV5J 5FDLA 2IMOA 3M8WA 2QIFA 4ZS6A 4ES2A 4O3PA 1VQNS 1VLOA 4EAHD 1K8KB 1N33K 1NDCA 4M5HA 4A4JA 3KTQA 2QLXA 4RBUA 4GNIA 3ZETA 3MCOA 4A8OA 3D9BA 3RUBL 4ICLB 4MH8A 3V81A 1OPIA 2R7TA 4YB6A 4M95A 3VZIA 1X3NA 3IAS9 2MZQA 3CPWR 3M2UA 2ITGA 1TKZA 1RGIA 3GG4A 4J9LA 2P2CB 3QDKA 2EI5A 5HP1B 2YHWA 2DGQA 2OJ3A 4M3ZA 4HHHA 1YJUA 1F2GA 1HBUB 5IQ6A 2HHWA 5TKWA 3JQMA 4CM2A 3G2XA 5KG4A 4ECUA 3QSIA 5HAOA 2GIRA 1Q82O 4JI0K 4I64A 1H2TZ 2FYXA 3G25A 4B3SF 1XQSC 2B5JB 1G7CB 1PBUA 1J5EJ 1HYSB 2RS8A 3LL3A 2AW0A 4ED3A 2E9RX 1YRTA 4FK2A 4HACB 5KQ8A 4P74A 5AQHA 1HR0K 2KG0A 1K8KA 2CG4A 4DMZA 3CGIA 1CJUA 1OJ4A 5AXKA 2ZFHA 3K59A 4C98A 1VSHA 3POTA 4DV1J 1WG5A 4DV2J 4DR2J 2F96A 2E5IA 1IR1A 4ZN1A 1C0GA 3LALA 2MZRA 1YJNN 2IRXA 2C3UA 2UXCF 1NK0A 3CCRN 4K41A 2MQPA 2F8SA 4DFJA 2QL9B 1RCHA 2R2SA 1Y11A 1FRJA 2FJAB 1NLVA 1SC1B 2O8DA 1VBZA 1NB7A 2Q97A 4KBIA 4LVOP 2QWPA 2DY1A 3ZZUA 4NE9C 3T1YF 2YKMB 1OQ3A 4MFBA 1TTHB 1S4EA 3JTOA 2ZC4A 4KV8B 1U1OA 4RW7B 1WG4A 2ASYA 2F3JA 3WQTA 2LSNA 3AVHA 2LA6A 2JC0A 3WNHA 4TYAA 2N82B 2GIQA 5DDOC 2KKZA 3BJYA 1SKSA 2V9WA 1HNZJ 2GJIA 2V4JA 4ZMMA 1RB0A 1R6VA 2LXFA 4ILGB 2G13A 1XNQK 3B8HA 3VCDA 3RSEA 2QMWA 3L3VA 3UVJB 2VFSA 1FESA 3D67A 4LT6A 4PG4A 2O4GA 2AU0A 4CJUA 4RX6A 4NO7A 2R8HA 2BXJA 3FDSA 4CJ3A 2QC3A 4DR7F 4YB1P 3WXJA 2GW8A 2E2OA 3QEXA 3QINA 2ZH9A 1QQCA 1X4DA 4L3KA 3RB6A 1Q8IA 1LK5A 2EXUA 5B7WA 2K1RA 3CEDA 3MEEB 5GAHU 2HW3A 2CJYB 2QLWA 3VV2B 1XMOJ 4RR5A 2MKKA 3OXLA 3KUEA 3FJ2A 1W2BM 1E4FT 2JVOA 1KOOA 4BC5A 1ZH5A 2CPYA 3T1AA 2DCUB 3DGPA 2DXDA 3SUOA 3BO3A 2KH9A 3G86A 2HVHA 5JXSA 4KKOA 1NEEA 3FLCO 3WDOA 3MM5B 4ZIWA 2E6MA 3QWUA 2Y8WA 1XNQF 2ROPA 3AOBA 2BZ2A 1S0MA 3E1YA 2HFNA 2NCKL 3WXLA 4W4MA 4A8XA 2A3ZA 3SPZA 4PRFA 2O8CA 5LMNF 4LRFA 3WQUA 3DXKB 2ZOGA 1V4SA 3LDPA 4AFFA 3G87A 1FWLA 4ANEA 2J9DA 2MLYA 5KRSA 5DQHA 3FGVA 1OY6A 1BHLA 2E2PA 2QEXN 2WSCC 5M1KA 3MPWA 3WZ0A 3L8BA 3BY5A 2ZWPA 3H90A 2KW4A 2VUGA 3THWA 4IQXA 5HQMA 1SJQA 1Y97A 3J7ZO 3V1OA 5K8NA 3BM7A 2VH7A 4EZ9A 3D6RA 1FT8A 4C0BA 3B6OA 2IVNA 4YOTA 4B3RK 3TO8A 3GJRB 5DQIA 4BC3A 4P72A 3HX9A 3MMAB 2JJ4D 2ILYA 3TX8A 2R9LA 2J9EA 1EKEA 1ITGA 2Z2YB 2VC1A 3TU5A 1EXQA 3VF4A 1WAFA 4M3XA 4JYAK 4CLPA 2KB2A 3UPFA 1KLMB 4DPTA 4WP9A 3FBCA 2RPIA 4DV5K 3F44A 3CJKB 1IR0A 2MKCA 3NNCA 3EPGA 4W5TA 4DR2K 2CFXA 1YGYA 2RRBA 4E7LA 2FZKB 3OSPA 2UUBJ 2WVEA 2V8DA 3PYDA 4Z4HA 1O6XA 4KE5A 3T5LA 3K2YA 2WOMB 1YQHA 3MXJA 2J9DE 4KPCA 1IBLK 1WHVA 2W1BA 2A42A 3WQPA 2K3KA 1N5YB 4JEPA 1VRQC 3LGMA 3UW1A 1QVFM 1FNMA 4DR3K 1Y10A 2KN4A 3NAHA 4LF4J 5BN9A 3V6KA 4LF9K 3P45B 1IBKF 3BPDA 4C8LA 3WUHA 3UN3A 4DTSA 1RT1A 1FDAA 4LF5K 4N7TA 3O6QA 3MMVA 1ZXOA 4JI5J 5GADU 4KSEB 1QHAA 5AFUH 1D3WA 1B0VA 2Q31A 2FC8A 2O66A 3MEKA 5M1PA 1VK8A 3L6QA 1S59A 1GXTA 4AT1B 5K14A 2HQIA 1U1NA 1VQLN 1RJJA 2MY8A 1TL3A 4M42A 3D2FB 3BSAA 1NHKL 1J5EK 1R3NA 4CNYA 1FJCA 3EZOA 3WIVA 2WOMA 2IJRA 2P9SA 1VCTA 4DR1K 4BC4A 4NRUA 3QAEA 3BZKA 3MOZA 3H5YA 4RW8B 1OIAA 4KHPK 2LXUA 3A3NB 2A40A 2D0CA 3FE1A 3QICA 1NDLA 5RUBA 4J9SA 1VBYA 1BISA 2MZJA 3OYDA 1ZZFA 2RE1A 1KP6A 1UAWA 3W64A 1IO2A 3A5MC 2C2RA 4FF2A 2R7WA 2DNHA 2XYHB 1QHTA 3EE3A 3NWRA 3SFUA 1RAEB 5KFMA 2QV6A 1UWBB 2G2ZA 1CC7A 2PMWA 3LQVA 1IVZA 3RBXA 3BKTA 4B3SJ 2GHVC 2O8FB 3IRXB 3OA9A 3F2KA 2JSXA 2JDJA 4WK3A 3PXGa 1UMJA 2JEIA 5KFUA 1TR0A 4O0NA 5LSLA 4F0MA 3WXIA 1NU4A 4DB3A 3H6EA 4FF1A 4DX6A 2FBXA 4RWWA 1P6TA 1H2UX 1UETA 3CJQA 4X84A 3QMLA 3BN7A 2Q36A 3CJRA 2BJ7A 5DG8A 1U6BA 3C6AA 4ISFA 3JYTB 3TWHA 3CW2C 3R7NB 2YNIB 2FGCA 3J7YU 3OYJA 3CJ7A 3BKUA 4JI8F 1OVYA 5EDWA 3IMQJ 4LF5J 2IIHA 1KVKA 2CQBA 4G1PA 1LOTB 5GIPA 4DU1A 5DZ6A 2DK2A 3MM6A 4L75A 4ZVFA 1X4CA 2QKBA 2JLEA 2KFYA 3E3XA 2AYBA 2E1RA 4OLOA 4A8FA 3R3TA 3JTPA 4I9LA 4OPHA 5FROA 1UVNA 3AO1A 4CEBA 1Q53A 1TQLA 5HBMB 2YWWA 5DDPC 3CC4N 2VG7A 3B6BA 2B3TB 4K5SA 3H5SA 3VTHA 1W7AA 5A8RA 4OKKA 1JLCA 4J5OA 4TSXA 3I5CA 5M1FA 4DL0C 5HL7Q 3F9MA 1UCNA 1B3TA 4NLWA 2I2YA 1VK0A 1Y3KA 4ZVPB 2HBJA 5G0RA 1AZSB 3BDPA 4B3TJ 1RWPB 2MKSA 2FJBB 3OSNA 2VQEJ 3QLHB 3NH2A 2JC1A 4H5VA 2DNNA 2KVQE 1TU0B 5I3UB 3AHPA 1JXBA 4F67A 1VSMA 3GMGA 4EZ6A 4RL1A 5JMNA 3DYAA 3CD5A 4CLKA 4LY7A 2DXEA 4RUCA 5ETOA 3KK1B 2ZH7A 2OFHX 4X66K 4CO0A 3KDNA 4JYAF 4FJKA 4WXOA 4ZVOB 1OVQA 3ATVA 3ZZPA 1NJIT 3ZSYA 2A1RA 4RW4B 1LV5A 3EVMA 4FPAA 4C8KA 2KI2A 3EEQA 1R59O 1LWCB 1EQMA 1X4GA 1ZTWA 2ZGZA 1CSJA 4B3RJ 1RBTA 2WZ1A 1U48A 2M7SA 4FLXA 2AQ4A 1XIQA 1H7XA 4DPUA 2VDHA 3SYZA 2ZJPQ 2ADCA 1GEHA 3B4DA 5HP1A 2U2FA 3UR3C 2Z30B 3VZHA 2LDIA 1EKSA 3GFYA 1J2VA 1T3NA 2KO1A 5GADP 2HQFA 1U0HA 1L3VA 2I1RA 4B9NA 3MM8B 1Q79A 3D28A 3H7HB 1ACMB 4U95A 3V9XA 4JI2J 1F6TA 1NM1A 3OYGA 3MXHP 4IH5A 1G6BA 4K8RA 3FR0A 1SAZA 4JI6F 5EY4A 2KXFA 1AXQA 2L9WA 1KXPA 2P9PA 4U6PA 5E2QA 1XHXA 4A8MP 1RAAB 3CO0P 2E4LA 2JFKA 5C15A 1S7HA 2DNOA 3V9WA 4PHTX 4BCAA 1FWKA 4GY2B 3KVGA 4U7UD 4YY3F 1IBLJ 3MWPA 2XZTB 5A76A 2HB5A 2GGPB 1QE1A 3DMJB 3CC2S 3M2RA 3BQ2A 3KLHA 3FBFA 4H0TB 3BGRA 1FHTA 4FS2A 2HF4A 2FLNA 4BG9A 4LFBK 2OPPB 2QGFB 3Q8VA 3VQDA 4USVA 4JKHA 1KLNA 2PFFB 1RT3B 3J80Y 1BWVA 4ES1A 3MAAA 3RB4A 3DM2B 2E7XA 5A8WB 3N4WA 4E7KA 3BB5A 4P10A 2DISA 3GL1A 2V69A 4DTUA 4DHVA 3ZZZA 2KRBA 3VETA 2MYFA 3K8VA 3VN5A 1QQMA 4CCHA 4WU2A 1U45A 3M9NB 2D5RA 2MHEA 2VWKA 1TK0A 4ED8A 1SQEA 1JKHB 2H4WB 4NXNK 4QZVB 1JXLA 1WTBA 2DIVA 1VBXA 1RCOB 2FIUA 4PWDB 4K4VA 1CJUB 3TI0A 4DUYJ 2HBYB 4JD2B 1VQ5N 2DGXA 1FTCA 2DR8A 4W5QA 2QFJA 5AQPA 2MZSA 3OHRA 3A5NC 3H45C 2EKYA 3EGWB 1HARA 4R8UB 4TNOA 2RF2B 2W42A 4JRPA 2K3IA 2VFRA 3U4LA 2GVDA 5HRSA 1W25A 5FLXU 1V5IB 1WOOA 3EDRB 2VQFK 1S1VA 2OPQA 3FZLA 2UVVA 3JAMO 3NL0A 3CCQN 5L1KA 4F36A 3V9UA 2GELA 1FDNA 1A9NB 1R6YA 2Z1JA 3HFVA 2F8TA 2ZWHA 3T6JA 3W8PA 3RWUA 4M94A 4ED5A 2I8EA 2V63A 3NOCA 3CO9A 3CJAA 4CEDA 4WXWA 1VFJA 2UP1A 1HD1A 2GV9A 1RE1B 4RTFD 1RA7A 1RWWB 2UV8A 2VWBA 2KM8C 1X9MA 5IWAF 3NNHA 1JLAA 2AKWB 2KT3A 3OR2A 4YY3J 3R9PA 3H59A 3W2VB 3LPYA 4B1XB 3MK6A 3SAFA 4CWBA 3TJAA 5D4NA 1BUXA 2WVCA 1S1TA 2BM1A 3TNVA 4AD6A 4AHVA 3DNCA 5DGBA 1RADB 1WC3A 4HDGA 4I0WA 1S9EA 4A62A 1PBAA 3P83D 4RNHA 3ZZYA 1WOSA 5A6WA 2MTLA 3LZJA 5H1SQ 2LXIA 4GVBB 5IC4B 3KK2A 1WI8A 4Y1CA 5D77A 3WT0A 4YHHF 1WC4A 1KDNA 3RBZA 3OUYA 1V4TA 4LF8K 3FC9A 5BYRA 3DLBA 1HYSA 1HHQA 4DSJA 3AGKA 3SQ4A 4K4YA 4FKYA 3W63A 3RB3A 2EG2A 3TWZA 2WW8A 2FDNA 2O8EB 2ROEA 5C10A 2BR0A 4L74A 2IBOA 5ETSA 1N8RO 5KI6A 3RRKA 3IC1A 4WYBA 1AT1B 1T8EA 4I2PA 1H73A 2L08A 4YP3A 2QL5B 3U3GA 2D3OR 4ID8A 3K57A 3OL8A 3HYFA 4WQ4A 2MLXA 1GTHA 3CVKA 4FJGA 3VQ4A 1K8AT 4JBCA 1G3OA 4IQMA 2R7RA 2WB1D 4KTWA 1WSFA 3LAKA 1RAHB 4TU8A 4DR4J 1Z2LA 2IVOA 4B3MK 1HJOA 1R0BG 3HD2A 4IXCA 1G4CA 1FE0A 2VKRA 3IBWA 1F5CA 5KPZA 5FRMA 3G8QA 3GJTB 4LR8A 3IG1B 4Q7AA 3N6LA 1TKDA 3Q7BA 3U1MA 4OJ3A 3HZGA 1WUUA 2G2OA 2HVZA 5KFRA 4ECRA 2KVIA 1RK8A 3CJ5A 1ICEB 5HRPA 1HQUA 2JLFA 1RTHB 3OS0A 5IT0A 3OL6A 2X74A 3MAQA 4BQLA 3DU5A 4ZHRA 3C15A 2P9GA 4HH0A 1F3FA 4O44A 3OXGA 2OYQA 1ZPVA 4DG1B 1NMDA 1U2RA 1S6UA 3NLCA 4JI4K 3CB4A 1GLLO 3FZHA 3RAXA 1JKHA 1C1BA 1D9AA 2R42A 5T14A 3R5DA 4X2BA 3RJMB 3NF9A 4WTYA 3CPWM 3CJBA 5F3ZA 2LEPA 2DO4A 2ZQBA 2J8SA 4BRDA 2GV1A 4HWIA 3EPIA 1XC3A 1S1WA 4JS5A 2UVRA 3PEJA 4DLGA 1RHJB 2BKPA 3MOJB 3VEVA 4I7FA 5KFFA 2PI4A 2OPQB 4CESA 4F8RA 5LXYA 3ZNUA 1JXEA 3O3LA 4ZPDA 2V0NA 4JI7K 2XSJA 2BANA 2R8KA 2L3MA 4DV5F 3D1OA 1NDPA 2G2YA 2FB0A 3HTVA 3M9OB 4H4KC 3CCSN 2QMUB 3BEGB 3O80A 4JI2F 3Q2SC 4A8YA 1N88A 2E44A 3ISNC 3BDEA 1EJ7L 3HVAA 2VOPA 5KT6A 4Y34A 2IS3A 2UXBJ 4IKAA 1AFIA 2XMMA 2DO0A 3PACA 1IWGA 3DOKA 3GBTA 2YVSA 3N5BA 1YJ9N 3HVTA 1TL1A 2DR6A 3FVYA 2QMXA 1OH8A 2LKZA 3VF0B 2LEBA 1YT3A 1S0OA 2XZDB 1ZETA 3KWIA 5JS1A 2UUCJ 1S1TB 5L1IA 4ZVUB 1WC5A 3HVRA 3DM2A 2H5EA 4BQZA 2A5XA 1TGOA 4TYBA 1V3ZA 1F5BA 3CCWA 3PO4A 3HHDA 5T7LB 3RRGA 3PY8A 3MM7B 3DLGA 1TUGB 3HO1A 3UE5A 2QO3A 1M5VC 3U1NA 3CJ3A 1X9WA 4B9SA 1NNDA 4KI4A 2L9NA 4I4BA 4LMZA 2OAUA 1U8SA 5KTQA 5T7BA 4KRFA 1REVB 4RBTA 3AVLA 2V9KA 1RILA 1RTZA 4MQ3A 3HOSA 1CQNA 3I32A 2WC9A 3O2IA 1SQGA 5THWA 2D9PA 4F4YA 2R8GA 4K4ZA 5AQFA 4ALZA 3G9CA 3SPYA 4IRDA 3HHLD 3DLLQ 4Z4EA 2UUBF 2VC0A 3UD5A 4CLUA 5C0YA 3TPQA 5DDRC 5E0OA 4RNOA 1NHVA 3H20A 3L95X 4USKA 4CHNA 4Z4FA 1E6VB 5EX5A 4KGMA 1LW2B 4ZKAA 3A2FA 3VVTA 4FVUA 5L46A 3Q0AA 3J81j 2PFDA 1N5YA 2HHHJ 4K59A 3OTOJ 1VQON 3DLKA 1KRPA 3KK1A 2FJWA 2VG6B 2KXHA 3QAUA 4DN9A 1VQ7N 2C2MB 1YDLA 4OJHA 1H74A 3J81Y 1UJ5A 3MCMA 5I9EB 2VODA 2Q66A 4M7XA 2OPRB 3C7NA 4FYYB 3P49B 1IJJA 4EI2A 3MGJA 4PAAA 1RWMB 4JAXA 4U67Q 1KVJA 3SV4A 3UQSA 3IXQA 2ZJRQ 3K5LA 4WTOB 4JI2K 4JUZA 4ZP9A 1NSQA 3W9JA 3A0IX 2YJFA 4BWJA 5HK4A 4NCGB 2DNLA 1T05B 2AGOA 1IN0A 2E5HA 3DHWC 1TL5A 3QJJA 1JLFB 5KFYA 4O23A 3TSUA 4DR7J 2HWTA 4W98A 3CXCR 2E20A 4CLTA 1A7GE 2E1MC 1T9WA 4LF2A 1KAYA 4LH5A 5JLHA 2V4JB 3VVUA 4E1JA 4JHDA 3QEIA 3NF6A 4NA3A 1IR2A 1KVCA 3SCIE 4Y00A 2QWLA 5FLXO 3R2DJ 4LR7A 3MMCA 3US5A 1UWAA 4CHZA 3WIUA 4DU4A 2CUYA 4OVLA 4YS2A 5JVHQ 2XLJA 2NLXA 4IRKA 1AUSL 3BO2A 1IKXB 2HHSA 1QUVA 3GYNA 3HBTA 4A2BA 1HI0P 4QWEA 2X1FA 4HLBA 5JLFA 2NPFA 2C3OA 3ZZRA 3MXMA 4FCYA 3VERA 5B0EA 1DLOB 5KPTA 1WOQA 1W0HA 1F3VA 4KB0A 2HVIA 4BE0A 5AXNA 2QT7A 4NASA 3GIMA 1C0UA 3W65A 3D5MA 1W97L 1UFWA 3PX6A 3J7AP 4O5BA 3SQOP 2RSQA 1SC3B 2DY9A 1B64A 2QWQA 1HNZF 1N34K 3G82A 3R97A 3CCVS 3CMAS 5F41A 2UXCK 4DCHA 5I3PA 5HQ8A 3J7YP 4DUYF 4MKBA 5I42A 4DR6K 4GKKK 1U1RA 1YXQA 2YTCA 5IT9Y 1Q7YO 1HKCA 3G82B 1S6PA 2BRKA 4BGBA 3EN9A 3OTBA 2H1YA 2KG1A 1D0EA 2O67A 2IVMA 1K0TA 2G8UA 4PWWA 2QA4G 1F5AA 2RHKA 2BMBA 3BPSP 3VPZA 2HFSA 2X6NA 3VA3A 3HFZB 2POKA 5DLGA 3DAWA 2DIUA 2NQPA 1RGVA 1CJTA 5B0BA 2VYPA 4WF9L 1SCJB 1ZAWA 2R8JA 3OYAA 4BRKA 4KKOB 3G10A 4CLLA 4S0MA 5AQVA 4P2XA 3G6VA 3OYCA 1WBBA 3F5TA 2M70A 4RW7A 2D0BA 1JIHA 3SSSA 4OJGA 3A5OC 4DR1F 2HHUA 1MDUB 4XEIA 5AQZA 3NNAA 3T19A 2HAIA 4XO0A 3I0RA 1VGYA 3R1HA 1VRUB 4DV6F 4ENOA 4ELTA 3FQKA 2G4BA 1SUQA 1DRZA 2CQ1A 3BV8A 4WYLA 1JLQA 3FSYA 2BANB 3WX8A 2O1PA 4LF7K 4WKRA 1I3AA 1VAZA 2XS5A 3WEEB 3BSOA 2E7WA 4K5RA 4FW2A 2XM3A 3DOLA 1NPPA 1S5ZA 3SBGA 2CGJA 3HI0A 1EB0A 2YPZA 4MYUA 3P96A 1PGZA 3HXMA 4JKAA 4C8NA 4MLEA 1T9VA 3OYBA 1LW0B 3I87A 3VTIA 5F0XA 2V4RA 3H1VX 1FEHA 2MMYA 3AXMA 1U49A 3WNEA 4C23A 1TMMA 3BUZB 1BQXA 2VG6A 2VA3A 3QQCD 1XMQF 3PV8A 5DZ7A 4IOAL 4AL5A 3I4HX 4F04B 3L2UA 2R4FA 4I6YA 1DY3A 1MG7A 2BE9B 4LF8J 2XRIA 5J2NB 4JV0A 4K42A 1R43A 5GAEI 1ZC6A 3NY0A 1OYEA 2UU9K 2VV5A 3KMQA 2NZTA 2DXFA 4O3RA 4BS2A 4KQZA 2XNQA 2VD3A 2JRSA 3U8XA 2AYEA 3AVCA 5AQGA 3KNAA 4YDXA 2QXFA 3JTNA 3FGUA 3KJVB 4DMNA 4PG7A 2GJFA 3DRXA 4L76A 2CQHA 1DEJA 4A48A 1A5WA 2YNHB 1JJCB 1H2VZ 1WC6A 3NMAA 1XMQK 1VQ8S 3IO1A 2PT0A 3KUHA 1YITN 4IDKA 4CT9A 2GHPA 4HR2A 1I5OB 4MFBB 4CFAA 4WCEL 4F3MA 1QVGR 4DV7J 3HCXA 5AQQA 4FJNA 3RBDA 3R8YA 3QEVA 4QYRA 5CYQB 3CE8A 3M32B 5DM7L 4KHSA 2R2RA 4DQPA 3IR6B 4DSFA 1F21A 2MB0B 1W26A 3T7ZA 4BRIA 2LQ8A 1KBRA 4F4ZA 2HWHA 1CEZA 3P4IA 3SQ1A 2Q6CA 4KHPJ 2OPRA 4ZPAA 5B8HA 4GW6A 2HS0A 1PJ5A 3ZTSA 3ZTQA 3IWXA 3B82A 1MU2B 3A1YG 1MN9A 3FEXB 2ZZTA 2UV8G 2OH2A 3NE6A 1N32J 4NI2A 1VQKS 4H5WA 4RUBA 2MGZA 2AYMA 4YORA 2BOPA 4XIUA 3CC7N 1KS2A 3HZEA 1IKYB 1TV6B 2MQOA 3VAMA 5E84A 4B1WB 2AMCB 2Y0SD 4LJMA 4FZVA 3M6VA 1H7WA 1BIUA 3S7RA 1VQPN 1U1MA 5DM6Q 3NVKA 4MMOA 3CDWA 3CCSS 4ZP6A 3VGLA 3VEOA 2CIMA 3ZX0A 1J9AA 1I94F 3J7A1 1EARA 3AARA 5IWAJ 5BRFA 4LSNB 2ZBRA 3KKFA 2WVBA 3PW0A 5GAHP 3NEKA 3KUGA 3DLEB 2HBMA 3TZYA 1HQUB 4F4KA 2C2NA 2V2KA 3CCRS 1EWRA 2FZGB 2H3EB 5KFAA 2D0AA 2CQ4A 1D9DA 3POTB 2BABA 3UDLA 1TKXB 2IHR1 5B0AA 2W6LA 3KLGB 3KKRA 2JWNA 3UD3P 4DV5J 4O3NA 5J2QA 2R3VA 2HNZA 5BR9A 1IM4A 2MQMA 3C16A 4KHWA 3R5AA 4FJHA 2VG5A 1K9MT 5LJ5Y 1YWXA 2K7JA 3R6LB 1RT2A 2EC2A 2DR5A 4B17A 2JFDA 2MJNA 2XO6A 4KHUA 2VJVA 3MUVP 4DUZK 4FLTA 1YHQN 1NSKL 4I56A 2A2CA 2N7YA 1T6CA 1T44A 4Y65A 4JB8B 4ED4A 1DTQB 2YY3A 5CCLA 2ETJA 3ENBA 2UVWA 4DU8A 5A2QO 1GH8A 4C11B 4F7VA 2CA9A 3LP0A 4OYIA 2ERRA 3SSQA 3OLBA 2D74B 3MUMP 4W5OA 1RNHA 3G6EN 2GO8A 1U2FA 2GMJA 3P39A 1JJ2M 4K0KK 2FZCB 3NS6A 1RT4A 2E5LK 3MR5A 3ENQA 3OXFA 2FHKA 4BR9A 2HBZB 2WFBA 3CMQA 4BRMA 2DKOB 2ACYA 4O3OA 3SMZA 5EX3A 1LNQA 4UZCA 4KC5A 1WEZA 3THYB 2JH3A 5D78A 2CPZA 3N28A 3LP3A 4LSLB 3ATUA 5DQGA 3S8SA 2XY7A 3SUPA 4B3MF 4CZGA 5F0UA 3C6TA 1RBAA 3EXYA 3NCIA 3LDNA 4GO5X 3CETA 3VESA 4ED2A 2P5GA 5BYSA 1MMDA 4RG8A 3W9IA 1N4LA 3ETMA 2R7XA 4DV4J 5L39A 4PA1A 3DDKA 1ELOA 4JI6J 1RAFB 3D68A 3DLEA 4DS5A 3WBZA 3UDVA 4H0OA 2Z57B 1HMVB 1LXNA 5AZIA 1SUQB 4OZLA 3M2UB 4OPAA 4DUTA 1MSWD 2W4CA 5GMKa 5GIOA 4JP8A 4M5GA 2M9KA 1NU0A 1XJWB 1FNOA 3FNNA 2XY8A 2NREA 3I0SA 4LH4A 5IC6B 4BROA 3D2EA 1FKOA 1HNXF 3PR4A 4CIEA 3W61A 2AJQA 2MPUA 4Z4GA 1PG5B 1WC0A 1ILYA 3NDKA 4KR0B 2XNRA 4AQYK 4DL5A 4CTAB 4O3SA 2P9PB 2YQ1A 3HLUA 1DTTA 3C65A 1T11A 3LPTA 2AJFE 4K2XA 4CF2A 2ROGA 4EP5A 4LQ9A 2P9KB 2KM8B 4F4XA 2QX0A 3QZ7A 4X4VA 4CZIA 3B8AX 5HMWA 4OQJA 3V5RA 3S3MA 3R5CA 4LBPA 4NCGA 2ASMA 1X5PA 4CEEA 3PDNA 5EHHA 1DJ0A 1PAUB 2P9IB 4CGFA 2J5AA 5A8RB 4R5PB 2RQ4A 3H5XA 1S79A 3O3HA 3AA2A 4A8QA 2AEJA 1HNIA 2BUNA 3GIRA 4PZVA 2PEHA 4OX8A 4EIAA 2GX9A 2R7YA 1EAYC 2UUAF 3PFOA 1GMWD 3U27A 2KQ2A 3KLFB 1C0UB 4OJ1A 4F4WA 1NZ8A 2FSKA 1NK6A 2CZVC 1AB8A 2DNPA 2QYCA 3E9OA 4Q8EA 4GKJF 1WEXA 3VOVA 1JLBA 1L5UA 1UEKA 2OTLS 2DH8A 4EP4A 3CXCM 4K4UA 2DRAA 2Z1IA 2CGKA 2RMLA 2IC3B 4C2MA 2NYIA 2GUPA 4PQAA 1C0TB 1QLNA 3OT9A 2B9XA 3AXKA 3PTWA 2YKAA 1SJRA 3PZPA 3KMSA 4CF8A 3QGHA 3L3CA 1SJFA 4CGHA 1RAIB 5C2FA 2YNIA 5AQOA 4NLUA 1KC8O 5KFZA 3QSYB 4WFNL 1N0VC 7FD1A 3F9KA 5M1OA 5DRKA 3JSRA 2A6MA 1C2PA 4ZCLA 4E1MA 3GWCA 3E01B 4FWOA 3CCMS 2DEIA 4EUVA 1R0CB 4FLVA 4NA1A 1FXDA 4OIXA 2D41A 2UXCJ 1K9MO 3J7AN 5M1NA 2HEKA 2Z56B 2PMZD 2MQNA 3OW2M 2HHTA 4LFAF 1J6ZA 2V7YA 4C3LA 4FLWA 4DV2F 1HBNB 2ZF5O 1K0VA 2HS3A 4GVEA 4A46A 1SKUB 2ZEJA 4RPFA 4HI1A 3RMCA 4ANCA 3FQLA 3MPVA 4USJC 3NGZA 2DB1A 5A8WA 3HJVA 2EVZA 5CZ1A 4YR2A 1RDBA 4JI5K 3D2WA 3D45A 2ZBCA 3CSKA 3CCVN 1N52B 4G1QB 1JWWA 4JI3K 1RHUB 4B08A 5BXIA 5D0HA 1K1QA 5DLFA 2BJ9A 3HVWA 3TRGA 5LM7E 3IM9A 4FNIA 4LF6F 1WHYA 1TYQA 3G71N 2ZZMA 4FWSA 3C16B 5AE1A 3SI6A 3HT3A 5SUHA 3M8ZA 3DRRB 1FRXA 5CABA 4JKEA 2CVIA 1JJ2R 3M6UA 4CLYA 4AHSA 4N76A 5IFMA 1IBLF 2CNKB 3DOMA 3KLHB 2E8AA 1X4BA 1XBWA 2IOCA 1FX2A 3GV5B 4FLYA 1UWBA 2EFVA 3TP2A 1JLQB 3UCZP 4NYNA 4ZP7A 4KREA 4B02A 5KPRA 1GXUA 2ASJA 3V1QA 9ATCB 3UN2A 1S1UB 2CH6A 4HL9A 4CECA 1XC9A 5KG1A 4PKIA 2XC9A 1A5XA 4MK8A 4J37A 2AEMA 4AE5A 3O1WA 5LXRA 3O9TA 5CZ2A 4X4SA 3HHLA 4WCEQ 2YV0X 3MR6A 2F4VF 2JGUA 2W2MP 1SIZA 5AXMA 3E2EA 4IH7A 2CQDA 3QERA 3FSIA 1WSEA 1K73T 5EWGA 3O8WA 4B3RF 4I2QB 2EFGA 3D2FA 3LDSA 1L3SA 4JLHA 2M4MA 4BREA 4OZNA 5FLXY 2KXNB 1N48A 4YR0A 4PG5A 5A0YB 5DK5A 1Y00A 4FXWA 5KFXA 2BQRA 3CDEA 3THVA 4DPYA 5LL6Z 3VAIA 1JQGA 2G8KA 4DSLA 4M5LA 5IV4A 3OYNA 4JRQA 1B4SA 3QFPA 5AT1B 5I42B 1T95A 2VF3A 2JEFA 4CLFA 1E6YB 1FERA 2ZKTA 4C6AA 4JNEA 2VG5B 1X4EA 4I69A 4M5NA 4OYWA 4WYWA 1Q4RA 1YG0A 3D6HB 3GFZA 3GB0A 3CMEN 4IJAA 2E5LF 2OPSB 2HNDB 2J76E 1K47A 1Q9YA 1N33J 1DLOA 1WLJA 1ZYQA 1Q9XA 3CD7A 3MEEA 1DT9A 1W2IA 3ENHA 3EYZA 4NXMK 3QBCA 5H9FK 4O0JA 1MWYA 5L8RC 1NXIA 3W2WA 3GILA 2B56A 3PVXA 3J81O 1RU1A 1BHNA 2YQ0A 4V19S 1S72S 1MWZA 4F2SA 3HKWA 4BRAA 3VQQA 1GXLA 2ASPA 3LO3A 1MLAA 1C0TA 1FI4A 5F2RA 2G8IA 3RSEB 1HWLA 1IUJA 4U7UK 4WQ5A 4FPIA 5DDQC 1MN7A 2HFUA 1KC8T 1WWHA 3EVOA 3CJ2A 3U9DA 4EYHB 4WP8A 1R31A 4A5BA 5FRNA 2VPWB 4JI8J 3I5BA 3NGIA 3MD3A 1NGAA 4CI0B 2BKOA 3DGVA 3V9ZA 1C1BB 3R8EA 4EGLA 3HHLB 1NMNA 2Q1NA 1BI4A 4BHQA 3W1YC 2ATCB 3E8OA 2G9OA 1IKWA 2PN6A 4CLWA 1BY9A 1SJ4P 2BJ1A 2I5JA 2PD1A 1VRTB 3TUJC 3CDUA 2A3JA 3AD8C 4CZEA 3HOTA 1KR4A 3R7BB 5BRHA 1NGFA 2HVDA 2KFNA 4W90B 4DR6J 4M5IA 3Q8RB 1MNEA 2IY5B 4JI4F 4OYOA 2NS1B 2EKNA 2U1AA 2ZH2A 3G71S 3DRPA 2B4OA 2ZBQA 3BZQA 4GC7A 2FLPA 1TMJA 3ZT1A 4I1TA 3M1VB 5ETMA 4MKVA 1PIEA 1EIYB 5D0GA 2HOEA 3FUYA 3NGYA 3D66A 2P9CA 4CIGA 2OA8A 4C8OA 1P1LA 4BDYA 3VEZA 2HK2A 2JEJA 2WAQD 2VPYB 3MM9A 1BQMA 4DX7A 3VGMA 2DNKA 1KCFA 2HBQB 2XHCA 3QIOA 3M30B 4A8WA 3C19A 5CYJA 4CF0A 1RUSA 3EWGA 2FC0A 2V5HG 4HI2A 2IMWP 2IVYA 1ASVA 2NXCA 2MLZA 1X3MA 1DKGD 4LD0A 2FBVA 2W7PA 4RJVA 3ZO7A 4AQYF 4DV0K 2XMAA 1Q95G 3DN9A 2HG4A 3PX4A 4UY8T 4DQ8A 4WFNQ 1O13A 1KFSA 5FD1A 3LW5C 4AYBD 2ZZNA 4CDIA 2EFOA 4IOCQ 3NH0A 3GE9A 3SXLA 3ZSZA 1P9QC 4B3SK 3M6GA 3EZWA 1H6KX 4FS1A 3PO5A 1UJ6A 1Z4UA 3THYA 1T3OA 4JD2A 1LWEA 1WKJA 4CVNE 2XLKA 2RKIA 2XS2A 3HMJG 1ZAXA 4DR4K 1YI2S 1FX4A 1URRA 2ALZA 3I0RB 4J2AA 3VALA 4LIRA 1VQ8N 3HSGA 1ROFA 2GZOA 4H5NA 4JV2A 5A0YA 3CCEN 5KFEA 5L1LA 4FJ8A 3AVGA 3O6WA 2YWEA 3IFRA 1N5VA 4NLTA 3RBEA 1M90T 1BIZA 5BJRA 4UTGA 3GG0A 2JOQA 5DM6L 3RTVA 4NLGA 1NHUA 1KTQA 3MMBB 3AO4A 3L2RA 3L09A 4Y3CA 3MAAB 4CLSA 2EWHA 4ZTFA 5T41A 1Z1ZA 3GFHA 4FP9A 1WOPA 5KFSA 4M1KA 3MPDA 3LAMA 4ZA1A 3S1TA 1VC0A 4X4RA 4K0KJ 2PYLA 3ONQA 1NGGA 4OMFG 1A0OB 1M5HA 1Y5IB 3HULA 2M52A 3CQYA 4KHRA 3KZBA 4CF1A 2LECA 4CK1A 2RHQB 4CFCA 1QJHA 3AT1B 3KOAA 8RUCA 4CJLA 3MF5A 2W9BA 4DFKA 2RDJA 1UFLA 5J2MB 2MSTA 3Q83A 4CK2A 2RQMA 1HNWJ 2RUSA 1EQYA 3ILJA 2W2NP 4IG0B 3O9SA 5C42A 1D9FA 2VL1A 1X4FA 1N5TA 4RUAA 3MMAA 3VQTA 3CMAN 1Y3JA 2ZC3A 3OTEA 2V4QA 3RU0A 1G2EA 4USUA 2O8CB 2OZMA 4UUWA 2NUHA 2F9TA 4H5RA 2DHSA 2VPZB 1RT6B 4MJKA 1GMUA 1FVSA 3R5GA 1N36J 2LQ5A 1C6VA 4KHMA 2XZWA 3EDQB 5LSRA 2X51A 3SIPB 4CZLA 4CNZA 2B7BB 1KONA 1VHXA 1IKYA 4DHYA 4TY8B 3TAQA 4BC2A 1JNRB 3JAMU 1ULRA 2MQQA 4IUFA 1JCEA 3GR1A 5HVHA 4OI0A 3MR2A 1HNWF 4QPTA 2VPXB 3M6WA 3EMTA 5IWAK 2R2TA 3VHQA 3RW7A 2DNRA 1SB6A 3CJTA 5HJYA 4LFBJ 1P9YA 5FPDA 3TARA 3KXDA 5HOOA 3Q22A 4KAIA 5KT3A 3QFWA 4OL8A 2QWRA 4FWLA 5A8KA 2HNDA 4XDCA 1KWMA 4K0KF 4IDHA 1REGX 4Y2KA 1C0MA 2IVPA 1QQOA 4WQ5C 3AO2A 2IPOB 5CA5A 1NG9A 5GVQA 1YRXA 1HNIB 3OUYB 3M1FA 4KB1A 2DNMA 2RU9A 4BDPA 3ZT2A 2GFFA 4LF6J 2XS7A 4ILMA 3DXBA 2BJ3A 3R1XA 1RABB 4DI6A 3VENA 3KD5E 4OO1J 3TVZA 3S6EA 3IAYA 1NRKA 1QUPA 4AILC 3MECB 4J9VA 2E88A 1WAJA 5C25B 3CPEA 2QE5A 2WK4A 5J2PA 1RT7A 4E7HA 2X7IA 5GMEA 5FPMA 2ADBA 1GLFO 1MA9B 4QIGA 2EWSA 4R8UA 1UVLA 3TUPA 1FA0A 1SQKA 2WVDA 1YKWA 2UXDJ 1GLAG 2ZGYA 3LPUA 1YF5L 1ZZNA 2GAGC 5KG2A 3TQ1A 1NJWA 3AAWB 2HQ3A 3FRYA 1VC5A 5MLCV 3GSIA 4WF9Q 4J2DA 2FVSA 3TSPA 4Y28C 1RT5B 2YHYA 2MQ8A 1R8BA 2Q1LA 4KH1B 4NLXA 2GEMA 3JAMY 4BVOA 4RW9A 1UTAA 3NGTA 2A1SA 2CJBA 3M8YA 5BPLA 4H0PA 3J7ZT 2BDPA 2IRUA 2XYPB 3IS9A 1URNA 1S1XB 5IM0A 3GFXA 2ZH3A 3UKUB 2KT2A 5C24A 5BPMA 4F3QA 4PYDA 4QBUA 4YFUA 3W0LA 1RYRA 1QSYA 5AZJA 3ISZA 4FJMA 5EX0A 5GINA 5B09A 4DCJB 5G0RB 5M2RA 4BG8A 5IM0B 4JK9A 3MWBA 2DFEA 1KVAA 4C8MA 2AP6A 3QMQA 3L7OA 3LP0B 4PQUB 4JYAJ 2W40A 2XMTA 5GADI 5LY3A 5HN0A 1CZAN 2AP1A 3MN6A 4URGA 4FZZA 2M8DB 4QJVA 2NPIA 3VMFB 5HVFA 4DZDA 3M8PB 3HM8A 2ZDOA 3ZSXA 4ECQA 4Z94A 3IR7B 1VQKN 2CPFA 3LA0A 1NAQA 3M7VA 4DTPA 3J80O 2OMOA 3ZETB 4NEYA 4JI4J 4CJFA 2OHDA 5CR4A 3M5RA 4N5SA 4BE1A 3VAJA 3ZYYX 1Q81T 1TKTA 4NLPA 1KVIA 1SKRA 1N34J 3ID6A 1AUDA 5B08A 2O8EA 4KTZA 1RHMB 4CZJA 1WJ9A 2J0WA 2GVDB 5IZHA 3R9LA 3VQEA 4ZCKA 3G0ZA 3MAHA 1JLCB 1YVUA 1YBAA 1ZM9A 1F2HA 2R8IA 2ZE2A 1ZOTA 4BRHA 2VGNA 4GRSA 1FNXH 2WW4A 4LQ3A 4FF3A 4LR9A 2CNNB 2OUGA 1LXJA 3DYAB 3WXKA 3RAQA 2MZ1A 4M3WA 3O9QA 4OZ3A 3BS9A 1S22A 2WBRA 4B9VA 3IGVA 3AA4A 5IV3A 1CULB 1WHWA 4HT7A 2ZH4A 2HZVA 2HQDA 3EZUA 3HK2A 3D7EO 4B1ZA 4KBOA 2OCEA 3FZMA 2YHBA 5CY4A 2GQ2A 4KHYA 3W3DA 2K7KA 4NOHA 2RU3A 2HHXA 1BGXT 5AJ3F 2NRZA 2MQLA 4Q5VA 1KHVA 1OSCA 4HDHA 5AZJB 1HQ2A 1NK8A 5A6PA 4PY5A 3AAPA 1EQ0A 4AHUA 1X5SA 4ERDA 2DH7A 4JI8K 2D3O1 4LSZB 3DMJA 3SCXA 2QL7B 3K5MA 1ZAVA 1BCOA 3SZ2A 2AGPA 5DETA 4K4SA 2XCPA 1W2BR 4LF7F 2YQ3A 2ZHBA 3S3OA 1CJTB 5D4LA 5LMNJ 3AB4B 3LWLA 1S4FA 1F9HA 3HL8A 3JQJA 3MX2A 2W7AA 4JKBA 1K73O 2XSFA 1B0TA 3VEXA 3EM1A 1SV5B 1T9XA 4ELUA 1T9UA 4LFCJ 4OX7A 4ECWA 3MCNA 1CZ9A 1XMOF 4U96A 4G3IA 1HQEB 2LDYA 4CP5A 3RYLA 4EO6A 3OVNA 2E66A 2HHPA 1HPZB 3Q89A 3AAQA 3ZTPA 2HHVA 4P7VA 4ES3A 4IO1A 1UJ4A 4M7YA 3DXKA 3KJNB 4DSEA 5K8MA 2I9SA 2Y0BB 2P6SA 4GVLA 2AEFA 1NUEA 4QW9A 1RBRA 2P9LB 3OW2R 1LCUA 3GYXB 4KPYA 2NRTA 1KN6A 4LC9B 3TANA 1ZS6A 4FJLA 4CJKA 1LAVA 3IDHA 4ZVRB 1QVFR 1TL3B 3VQBA 4YB7A 4UOFA 2ZJPL 3BSNA 1VSFA 2RQKA 2K06A 5KFDA 3FMWA 1NDKA 4J9RA 2CG8A 1T9YA 1ZBHA 4JK7A 4IG0A 3FCWA 4CYUA 3KG0A 3OFEA 2HIYA 3HSJA 5KG6A 2O5DA 2XMJA 4P71A 9RUBA 1YAGA 1VSDA 1D09B 4DR5F 3TR8A 1FFWB 1U1KA 1YZ7A 4R79A 3I56S 4DTOA 3ZSQA 1VSLA 1RDWX 4E8UA 2C28A 4QS7A 3PR5B 3VEWA 5GAGP 2J7KA 3PIOL 2Y3YA 3H5UA 1GNKA 5JUMA 4Z0UA 4J9UE 2H51B 4DV1F 2C2KB 2HS4A 4NI2B 1RKJA 4WQ4C 4J9NA 4O55A 1HR0J 5KG3A 1YI2N 4FL9A 4BVPA 1WELA 2VICA 5GMDA 3Q2TC 3H40A 5HROA 4E0DA 2ZM6J 2CJ9A 4KHPF 5C25A 3LDOA 2OPPA 4USWA 4B9UA 4L6V3 4CO5A 1C0FA 3M2RB 4L73A 2DFHA 1XR5A 2Q3PA 3PYFA 1J5OB 5ADZA 3R5JB 5EOYA 3F56A 4PUOB 3TYTA 2RILA 1PKUA 2OIHA 3NCQA 4J7CA 4AF1A 4OJRA 4ZVEA 4PQUA 4J9QA 5DM7Q 3PHTA 3ICLA 2YCHA 4FVMA 3R3LA 4DQQA 4IDKB 4BDZA 3MPUB 4FWPA 2HYIB 4P2SA 3CDBA 3SJHA 3BR8A 3L4BC 4DUZJ 4FJJA 4H4OB 1HLWA 2X1AA 3THWB 5J2MA 1HNVA 1PAEX 1PILA 1C1CB 2B51A 2YPYA 4ETZA 4LVNP 3GIJA 4QOTA 4LSNA 1N0UA 4Z7YA 1AA1B 1RT1B 5HBMA 1M5SA 4QIEA 4PG6A 3V4IA 4CGIA 1VQYA 2I7PA 4NRTA 1YVNA 4HH1A 1FF2A 1M5KC 3QJPA 2V2ZA 3F0NA 4I9QA 2LQJA 3KJFB 4HTLA 1HW8A 4HUGA 4IFVA 4UW2A 3I4PA 2YXLA 1TVRB 4UT4A 1YJRA 4CD1A 1RBUA 1NSPA 1SC6A 1TVRA 2FC9A 3ZSVA 3N01A 4BR2A 1O5JA 1L3TA 3DLGB 2P5OA 4FN5A 1D5AA 2ZM6K 5F8HA 3MR3A 5I3UA 2R7OA 1ASUA 4Y2IA 2ASOA 4RU9A 3IP0A 4B9TA 4DF4A 2NXUA 1CS4A 3O4QA 3T9ZA 5EUHA 1TP7A 4KY3A 1CLFA 1B99A 2CQ0A 2AZ3A 3JYTA 2C2OB 3PM9A 3O44A 3Q8YA 4WP3A 2HNYB 1FRIA 4Q45A 1NKBA 5J1EB 4EHTA 5KGXA 4AH9A 3AVFA 2DEJA 4R25A 5A8KB 1UPPA 4RLEA 4LREA 1YK9A 5HO4A 1REVA 2F7TA 3L2WA 3W5ZA 3ZX2A 4IEIA 3DOLB 2MXYA 2FQQB 2ZJRL 5KOXA 2PIIA 2GQCA 3CCQS 2VB6A 3ZZTA 3D2EB 4OI2A 1NKCA 2OSQA 3PW2A 3I9ZA 4H03B 3LUYA 2B5JA 1X0FA 4USTA 4EK2A 4Y1DA 3JSYA 2R7UA 4FJ9A 2CGLA 2QKKA 3LWMA 1TUWA 4CZMA 3QGGA 2QSFA 4CGGA 5D0EA 4FNHA 3O3GA 2UUTA 1JX4A 1C1CA 2F8EX 1VQOS 2RS2A 1RWUA 3P3DA 4OX9J 1M1KT 1PC4A 3MM5A 5KG5A 4WKYA 4U7CA 1IBMK 3NMRA 1FJEB 2B7CB 4M8LA 1J5EF 2KT5A 3L3UA 3DRPB 4DV2K 2ZH6A 3QGPA 4PWUA 2G8VA 4ZLLA 2UUBK 4PXDA 4DG1A 2CPEA 1Q7LB 1RAJA 3K5NA 1N36F 3CD6N 2F4FA 2N3OA 4BR5A 4Q0BB 2Y9HA 2IM2A 4WU3A 4DR5J 4QPXA 4ED1A 3PRBA 3R2CJ 1HA1A 2GMHA 3OBWA 3NXZA 5F9LA 4J91A 3I55N 1ESVA 1KAZA 1TFWA 4MO4A 2JNJA 3FK4A 4E7JA 3R6GB 2GS8A 5EN1A 1M1HA 1FCAA 3D0HE 4UF4A 2F4VK 2NLWA 1FDDA 4ILHA 1FEEA 4HUEA 4XH1A 1K44A 4YEAA 4FSVA 4OKJA 3PW4A 1DBDA 2XBPA 3C8YA 3UNYA 3TVYA 4OYBA 4L3QA 4WK1A 3DKDA 3HPHA 3SCJE 5E3AA 5C5JA 3EZ5A 2PI5A 1SKWA 4CJ5A 2L9DA 2IIRA 2Z1HA 1W9HA 3HPGA 1T6DA 4ITSA 4M3RA 2I6WA 1DQ9A 4DZ6A 2FVPA 1OSDA 2CQ3A 4OX9K 2UVUA 3CF5Q 1B7FA 3NS5A 3B4MA 4B1YB 1MWKA 1RHQB 3I31A 2JHEA 2Y1IA 4I7FB 1JLEA 2V8GA 3AJ1A 2RE2A 3A5LC 2HMIA 4FJXA 1FRLA 1NWKA 3HT0A 1GLCG 3L4QA 1NGJA 3X1LB 2P9UB 4A8SA 1BQNB 2C42A 4FPBA 1YTAA 1R8CA 2HMPA 5ADXH 3BGFA 3AOCA 4HUFA 1MMLA 1J53A 3PJWA 2QG9B 5DG9A 3KKSA 1FKOB 1HNXJ 4X4OA 3G4SN 4ZCMA 1UW9A 3BGLA 4DPXA 2DNQA 5ELZA 5AXLA 2A1BA 1HWUA 5FDLB 4W5RA 3DDIA 3MMJA 4GMKA 3BF3A 4RW6B 5D3GA 1FVQA 3BO4A 1CLQA 3TZZA 1WSIA 2W8LA 2J9CA 3SDEA 2DH9A 3KHLA 2P9KA 3ZSWA 4P2FA 4FJIA 3V2UC 5BR8K 3UNGC 4B3TF 4DF8A 6AT1B 1EKRA 3MCPA 1P8GA 3N4QA 3V6HA 1GT8A 4DV4K 4MK7A 4FWKA 2UU9J 4PL7A 3N5FA 1RT7B 4JHDB 1KD1T 5FPNA 4H8KA 3SJJA 4DS4A 3W2VA 3FZ2A 3HFKA 2XMUA 2B6AB 3MCAB 3BZCA 3C14B 2A41A 1CPZA 1OYDA 4B3OA 4NXMF 4UQGA 3ULEA 3QIDA 4HHTA 3K0JA 2LQ9A 2YX1A 3QEPA 2NXNA 3FFIB 2IJFA 3QO9B 2QLFB 2CPDA 3OYHA 4L8RB 5F8JA 2W41A 3L0QA 4K8ZA 2VDIA 2XEXA 4JKFA 4B1VA 3N6NA 1Y64A 1ZA1B 1SJ3P 2F8HA 3SQGA 2OEMA 4DV6J 1VRTA 1HRHA 1SV5A 3KLIA 2HLTA 1T02A 1VDHA 4RNMA 1N8RT 3HZ6A 4M5MA 1LQ9A 4I6MB 3SQ0A 1S1WB 2IC3A 4HCCA 1T3VA 3W5YA 3HKZD 2WVFA 2QWOA 2C2EA 4FYXB 4C8YA 2J6SA 4YOVA 1U1LA 1ZBUA 5J2PB 2CVEA 1SL0A 4C3MA 2ZVSA 2N7CA 2F4VJ 1LWCA 1SH3A 3UO0A 2QM1A 5CYMB 3HSZA 2AHOB 3CD6S 5M2UA 4LRBA 4OHWA 2OP5A 2HGMA 5K8PA 1RT2B 2DVIA 3F41A 4ZPWR 2PO4A 4XDDA 2ABYA 4QW8A 2LYVA 1HNXK 4DSKA 3U1LA 1LWFB 4NYPA 3QPIA 2PEBA 5I3QA 5ADXA 1EHWA 2H3GX 1IH7A 4ZVSB 4ID5A 3DOKB 1QY7A 1PYTA 1DTQA 4ANDA 3TZWA 1NZAA 1RDAA 3IRWP 1VC6A 4FM1A 3JXOA 1U6FA 2M88A 3W60A 2V67A 4QS9A 2NRRA 3UCGA 4ECTA 2KKHA 3NWGA 2QI2A 5G4DA 3OD2A 3TTFA 1SZ2A 3OFHA 4OYAA 1VRUA 4PG8A 2RIJA 1Z05A 2P9LA 1DZ5A 2HBRB 4DR7K 2XWYA 3KK2B 4F25A 1UVMA 2AIRB 3M8PA 3SUNA 1ZBFA 2GHWA 1QM9A 2YKMA 3IR5B 5AQYA 3EJMA 4FXDA 2DHAA 2CDQA 5DS7A 3C15B 2VQFF 3ZZOA 3TABA 2FPHX 2R7VA 4FBTA 3ZNJ1 1BWFO 1FK9A 3KK3B 5CE3A 2EBEA 4F3OA 2RAQA 2ZITA 1V3RA 5H9EJ 3TAMB 3SFGA 1JLBB 3OJSA 1ZPWX 2VU5A 5HQLA 3MXIA 4P73A 4ECZA 2I7NA 2BW7A 2QN6B 1XI1A 4OI1A 3P6YC 1NMEB 3NFAA 3KWGA 3EE9A 2YKPA 2IAJA 4LF8F 3HHNB 2ZHOA 1TL7B 5CXTA 1M5PC 4DL6A 4QYZJ 3O4WA 2C3PA 4YOXA 3B54A 2VIHA 3CQXA 2ZE2B 4IR9A 4JKCA 5DMRA 4WFBQ 4HVZA 4KFBB 1N33F 4J9OA 1WKLA 1V5VA 2IAJB 1BC6A 4L72B 2B9YA 1XQIA 2IBKA 1G1XA 2ZUAA 1JJ4A 2ZBPA 1XNRK 3RVCA 5C42B 4IFYA 3QNWB 1FO1A 4WFZA 3AA8A 1GMWA 4XH4A 1VQ6N 4NZ7A 4GKKJ 4CFDA 1KVBA 4ED0A 3FCVA 4Z2XA 4RWTA 3TOQA 1HI8A 3OYIA 2DGVA 4YB5A 3H2UB 1XWLA 2NRWA 1D8YA 3ZEUB 4PPDA 4XPCA 3CI5A 5A2QY 3KYLA 1NPKA 1WF0A 2EHGA 1QAYA 1WSVA 4QCLA 3W9HA 2HFZA 1SI9A 3UD4P 5EWEA 2YHAA 4M3TA 2UUAK 4YDDB 5HI7A 4DFMA 4IOAQ 2R7SA 4XK8C 3G6XA 2ZKUA 1KFDA 4CJRA 3T1HJ 3FCHA 2LEAA 2BGGA 4CO3A 3VQCA 3WC2A 4JI7J 5C7PA 1JLGA 1MWQA 2XMWA 1B70B 2UZAA 2ZH8A 2Y1LB 2XQCA 2JL9A 1NJXA 1HW9A 1Y4ZB 4HTIA 5MAOA 3I96A 2RD5C 2KRRA 3CM5A 4OV1A 4EBDA 2RN2A 4KO0A 3RR8A 3HDSA 1R7IA 4AUKA 3TAPA 3H98A 4IO8A 3H3OB 3D6MB 4FKXA 2BOAA 4IOXA 1IM6A 1CJVB 2CJAA 2FF6A 2J6TA 4RNFA 2MGZB 1B9DA 4N56A 1S9EB 2GQQA 4KT0C 5KFTA 5SZTA 4K50A 4CRJA 3NAEA 1XHZA 2CZ4A 4OPJA 1KKHA 3OY9A 1CJKB 5J2QB 1FK9B 3KK3A 3ID8A 4IEEA 4F4AA 1YJ9S 4I6MA 5F8LA 3LPEA 2BJ8A 2F9JA 2ZDPA 4UQTA 3UDCA 1ATNA 3AV9A 3IWLA 4QOZB 1S6PB 1IBKK 4J90A 4IO9Q 2ACMA 4DQRA 1AZSA 1Y5LB 2XI3A 3FFKB 5CCMA 2DCLA 3BGOP 3QT8A 2XYGB 2W7OA 2RF2A 2P9SB 3BYPA 2O01C 2B8QA 5H9EK 2NNWA 1PJ7A 4K8XA 3DRSB 4PXCA 3EL2A 2WONB 1OPZA 2CZ9A 4PPZA 1BQNA 2MKIA 3K0SA 3X3UA