4I2PA

Crystal structure of hiv-1 reverse transcriptase in complex with rilpivirine (tmc278) based analogue
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
554
structure length
554
Chain Sequence
MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gag-Pol polyprotein
publication title A comparison of the ability of rilpivirine (TMC278) and selected analogues to inhibit clinically relevant HIV-1 reverse transcriptase mutants.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Hydrolase, transferase/inhibitor
total genus 155
structure length 554
sequence length 554
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4i2pA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4i2pA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4i2pA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4i2pA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4i2pA05
1JLGA 4CECA 3KLIB 3AVBA 4QOZB 2F8TA 1K1QA 3QZ7A 3C6TB 2ILZA 2FBTA 3Q8SB 4C8NA 3VQ5A 4ZVGA 1D8YA 4YR0A 4FJNA 1I3AA 4ECQA 3AVCA 4KHYA 2JEJA 5KGWA 2YNFB 4C8LA 5DG7A 4DTSA 5EU7A 2QE5A 3FRZA 3BSAA 4TY8A 3WNEA 3H08A 1EP4B 5F9LA 3QEWA 1KFSA 4B9SA 2HHSA 1SL1A 3SQ0A 4ZTFA 4RW6A 3PUFA 2GV9A 4ID1A 3GIIA 4EBEA 4HCCA 4EZ6A 1WSHA 4Q0BA 1SUQA 4OVLA 3OS1A 3PZPA 2FC0A 4DS4A 3OSPA 3AVAA 4DLGA 2OYQA 2IGIA 5HRPA 4AHRA 1S1WA 4F3OA 4CGGA 5C5JA 3MR5A 4EZ9A 1JLBB 1C1CB 4NCAA 4K4VA 4F4YA 1TKXA 4HKQA 3ULDA 2YNIB 1S49A 3PW4A 1JLGB 3CIZA 4KE5A 2RDJA 1S48A 4QPXA 3ICLA 4CJPA 5CY4A 5JS1A 3MR6A 4HYKA 4QWEA 2VG6A 4HCBA 2KZZA 1RBUA 3HT3A 3QGGA 3G6YA 4URQU 1U45A 2O5DA 2RKIA 3BDPA 1KFDA 3AVJA 4CIFA 4ELVA 3P83D 4MH8A 4DL3A 2HNDA 4TY8B 5KFSA 3E01A 2R2RA 1FXXA 4M41A 4RNMA 4J9OA 3TAGA 4RW6B 1RDCA 4FM0A 1SKWA 1W25A 3OVNA 1C0TB 1OS5A 4QAGA 3V6KA 4Q0BB 3V6JA 4FVMA 1SUQB 4ID5A 4RNFA 1QHTA 3FSIA 2IA6A 1VSKA 1LWEA 1TL1A 4DTJA 1S1WB 4ECWA 3TVKA 3I0SA 1NK8A 1TKXB 2R8GA 4GC6A 4LSLA 4XO0A 2ASDA 5DQIA 5FDLA 3QEIA 5KFFA 1DTTB 2HWIA 3GYNA 5HROA 3ZT4A 2D5RA 4CEAA 2VG6B 1EETA 3LWMA 3DLRA 2HWHA 4FJ9A 2JEGA 5J2MA 2FJWA 1HNIA 2YV0X 3RAQA 2HNDB 1RA6A 3ISNC 3E01B 1XR7A 4KV8A 3NAEA 2IBKA 4CJEA 3MEGA 2Y1IA 1BQMA 5F8NA 2FLPA 1KHWA 3SQ4A 2D7SA 2DY4A 2KFZA 4ZHRA 4ID5B 3SV4A 2DPIA 5I42A 2ZD1A 4O4RA 1RNHA 1C1BA 2W7OA 1NKCA 1LWEB 1TL1B 4F4XA 1XHZA 5KG7A 3DOKA 3M8RA 3I0SB 3BQ2A 4BWJA 3AO5A 3CM6A 1REVA 3RWUA 3T1AA 2R2TA 4CFAA 4CJ5A 3Q8QB 2R8IA 3RB4A 4LSLB 4QWBA 5FDLB 4FZXC 3M8QA 2KTQA 4BDZA 4W5RA 3ZT0A 3OSNA 1KLNA 4B3OA 1EETB 2XY8A 4E0DA 3OJSA 3KHRA 3D0PA 5J2MB 1HNIB 4O4GA 4OJRA 3K5MA 3LPUA 3L3VA 3KKSA 3VQ4A 4E1MA 5C25A 3U3YA 3MEGB 1TL3A 5KFBA 1BQMB 5F8LA 2J6TA 2B43A 2OZMA 1VSMA 1WSIA 4EYHB 4XPEA 2AGQA 1TKZA 3KLFA 1RTJA 4NLYA 4O44A 3EPIA 3KTQA 3ITHA 4ZHRB 3RB0A 3GIMA 3OS0A 4XPCA 4DQRA 5I42B 2ZD1B 3LALA 1C1BB 4RW7A 5EWFA 3NGZA 2G8UA 1LWCA 5F8GA 2EX3A 4DTRA 4KHNA 3OLAA 5CZ2A 5KFLA 3QNNA 4FLTA 3OYIA 1REVB 3HXMA 3B6OA 1LWFA 1TP7A 1ITGA 2VWJA 5KFZA 4JUZA 4ZMMA 1T3NA 3DOLA 3ZT3A 4KB7A 4WFXA 1N6QA 4CF0A 4IOBA 1DTQA 3I8DA 4GMJB 1GX6A 3QINA 4CJWA 4B3OB 4NLTA 4NLUA 3GV7B 1HYVA 4KI4A 1BGXT 3OL9A 4O4GB 4B9NA 3QYYA 1RCHA 1I39A 1L5UA 4ZP9A 3SZ2A 3PW7A 3SFUA 1TL3B 1JXBA 2WCXA 4Y34A 3UPFA 3QESA 3MR3A 2D3ZA 4FM1A 3K59A 3OYKA 1S0NA 1TKZB 3KLFB 1RTJB 4IRCA 3ZSYA 4O44B 3ITHB 4HHTA 3KHGA 3D28A 5KG0A 5KFJA 2QK9A 2LSNA 4RW7B 3QZ8A 1LWCB 4CF9A 4B9TA 1CSJA 4FJ8A 3NAHA 2A1RA 3O3HA 4WZMA 4F2RA 3VQ7A 1LWFB 4EP4A 3AA2A 5HRNA 1VSEA 2VA3A 3OYNA 2HHVA 4KTWA 4E7JA 4FLVA 3DOLB 3VQPA 3CG7A 4F3TA 4YMEA 4CJRA 1N6QB 1DTQB 1NHUA 4U6PA 3NF9A 3CQ8A 3IGVA 4CJVA 3SUNA 4NZ0A 1LAWA 4BDYA 2XY5A 4FJHA 2W9CA 1MMLA 1S9EA 2XCAA 3M9MB 3S3OA 2VG5A 3B6PA 4EP5A 4K50A 1O1WA 5KFPA 3DRPA 3LANA 4WXWA 4O0JA 5L1IA 2F96A 4RW9A 3F73A 1HMVA 3EPGA 3TAQA 2D0AA 1SL0A 4CESA 4M3XA 4PUOA 4ELTA 1NHVA 2QXFA 2IMWP 4WE1A 4AILC 2KZMA 4M3ZA 4ZTJA 4CK2A 2HHTA 3AVHA 3V9WA 1KLMA 4E3SA 4FJIA 1RT7A 4QWCA 1JX4A 4KPYA 1SH2A 4NYFA 3OJUA 4DSEA 3NBPB 2UVRA 4FJ5A 5KRTA 1C0MA 3SPZA 3GV5B 1Q8IA 1A5WA 4DFMA 4CJKA 3NHGA 4J2BA 1ZYQA 1FKOA 2G8KA 4PY5A 4FJKA 3M8PA 4K4WA 2ITGA 3KLGA 1S10A 3NH0A 5KGXA 3P1GA 2W9CB 1ZETA 4DFJA 1D5AA 3OYLA 1S9EB 2XY6A 2DFHA 3ZSOA 4KHMA 2VG5B 4OKEA 2JLEA 4B8AB 5KFAA 3DRPB 3KK1A 2O4GA 3VQEA 4GW6A 3NH1A 3AA4A 4K4TA 3SV3A 4B9MA 2XGPA 4RW9B 1HMVB 4OKKA 5J1EA 1T8EA 1VSIA 4NCGA 3AVNA 1LAVA 3CM5A 4WE1B 3NF7A 2YNHA 4IFYB 2R2SA 3V6DA 3WNHA 1UWBA 4NLOA 5DG8A 1KLMB 4M45A 2DFFA 3QNOA 4NLWA 1RT7B 3ZSZA 1T05A 2BR0A 2D3UA 4JS4A 2E4LA 2F8SA 1B9DA 3OYJA 4DL2A 5KFOA 3RRHA 4OLBA 2HMIA 4MKBA 2X6NA 3G86A 1FKOB 5SWMA 4OPKA 4IRKA 3EY1A 3BQ0A 3M8PB 3SQ2A 1BCMA 3PX0A 3KLGB 3NL0A 4KFBA 3H5SA 3OHAA 3OL8A 1RT5A 4MK9A 5KFXA 1W0HA 3MEDA 3MR2A 3AVMA 3O4QA 4KO0A 4CIEA 4CHQA 4N47A 5KFDA 3KK1B 1QAJA 3S3NA 4CGHA 5J1EB 2ZE2A 3K5OA 4NCGB 4C8KA 1JLBA 1TQLA 5KG4A 2YNHB 3CFOA 4JS5A 1GOBA 3G10A 3V6DB 2DPJA 1S1XA 1UWBB 4F4ZA 4Q8EA 3U3GA 1HQEA 4K4UA 2HW3A 2V0NA 4NLSA 3TAMA 3PHEA 4ED6A 1T05B 2A1SA 5FROA 3MFIA 3S9HA 3JYTA 4BE2A 1X9WA 2XY7A 3MXIA 4Z4IA 2DTUA 3ZSXA 4E7LA 4FBUA 2HMIB 1JLCA 3G6XA 4FCYA 3O3FA 4E7KA 3N6MA 2AGPA 2Z1JA 5DLGA 4U7CA 1EKEA 5KFNA 2C28A 2IM2A 1ASVA 4KBIA 4KFBB 3TQ1A 3H4BA 4I2QA 5CYQA 3SYZA 3UIQA 4QCLA 1RT5B 3MEDB 5KT2A 1C0TA 4FJXA 4XIUA 3H59A 2XI2A 4KO0B 3VQCA 3NGIA 2OPQA 4M95A 2QKKA 1HYSA 3TI0A 1UA0A 4RNOA 2FVPA 3NMAA 3LP2A 5KFTA 3HVRA 4RNHA 4J2DA 2FVSA 4BDPA 1S97A 4DEZA 2JEIA 2ZE2B 1C6VA 4CHPA 3MEEA 3RBEA 4Y2AA 2G8IA 3RAXA 2HVHA 3TWHA 4MK8A 4IR1A 1L3VA 1S1XB 1TK5A 2BQUA 3NGDA 1HQEB 3GIKA 4JV2A 2E6LA 3CYMA 3TAMB 4FBTA 4HTUA 3SUOA 1DTTA 4DTOA 1RBVA 4IDKB 2WONB 4JRPA 2V4QA 4IG0A 3JYTB 1KVAA 3SI6A 3VQSA 3DYAA 4CEDA 2HHUA 1D1UA 1CZ9A 3TAPA 3QEXA 1D9DA 2IAJA 4I9LA 2GIRA 4HVJA 1NOYA 1JLCB 4CJSA 4RNNA 4ECZA 3T19A 5CZ1A 1LW2A 3VQQA 1S1VB 2R2UA 1B9FA 4M3UA 1IH7A 3AVKA 4J9RA 4I2QB 4ZPCA 5CYQB 4BWMA 2C2RA 2FBYA 4GC7A 2XGQA 5KT4A 3L2UA 4FZZA 2OPQB 2HNZA 3FQKA 5L1LA 4OKJA 2FBVA 5KI6A 1GX5A 4ED0A 1JLEA 1HYSB 1QSLA 2IC3A 3FDSA 3LP2B 1WN7A 3OYBA 1IKVA 3DRRA 3BQ1A 4Y3CA 1RA7A 3MEEB 3TAFA 4IFVA 3TANA 1C2PA 3C6UA 3CJ0A 2OH2A 1C0UA 3VN5A 3V1RA 3T5KA 3OY9A 3IGNA 2VWKA 4KSEB 3N6NA 4B8CA 3SCXA 1J5OA 4IG0B 3DYAB 3KHHA 2IAJB 2XCPA 4KHSA 2CKWA 1RYSA 4KB1A 1KHVA 1ZBIA 1TK8A 3HVWA 5KFGA 4LH5A 5KFKA 1WNEA 5DG9A 4ZVEA 3AO1A 5HBMA 1LW2B 4AHCA 4Q8FA 3Q8RB 3D5MA 4OPJA 4NLVA 3A2FA 4NLPA 3I5BA 3O4NA 2HNZB 4PWDA 1TAUA 1JLEB 2AWZA 2IM1A 4QW8A 1ZBHA 2IC3B 2BQRA 4R8UA 4ED8A 4EBDA 2FLNA 4ZPDA 1IKVB 1TVRA 3DRRB 1JKHA 4FJGA 1T7PA 3H5YA 4IFVB 2KQ2A 2ATQA 5EUHA 3C6UB 2XO7A 4FK2A 1HARA 1C0UB 5KFMA 2BGGA 4OLAA 4KI6A 1HQUA 1D9FA 1S1UA 4GVMA 5KFWA 4CHYA 2HNYA 4M3YA 1J5OB 1B92A 3NF8A 4K4ZA 2XC9A 3SNNA 4KKOA 3NE6A 4OGCA 2Y1JA 1KSPA 5HBMB 1XR5A 4JV1A 2PZSA 4YR3A 3HPHA 1L3UA 3IRXA 2GIQA 4PA1A 4MK7A 4KAZA 4CF2A 3I0RA 3PVXA 4PWDB 4CFBA 2UUTA 2R7YA 3DI6A 3CO9A 2AJQA 4ELUA 5J2QB 4R8UB 3VQ8A 3ZCMA 4NYZA 3QO9A 3T5HA 1TVRB 1JKHB 4CEOA 4PQUA 3GQCA 4YNQA 2P5OA 4J9PA 3TABA 4RW4A 1N5YA 3AVLA 4K4YA 1NOZA 1HQUB 1S1UB 3TAEA 4M94A 2HNYB 5C24A 3OLBA 1SL2A 3D45A 3UDLA 4TSXA 1JL2A 4E19A 2B5JA 3NH2A 3KJVA 4KKOB 4W5NA 3FFIB 4X2BA 5HRSA 1ZTWA 2IJFA 2XI3A 4W5TA 3PO4A 4Y1DA 1RT6A 4CJ4A 2BANA 1FKPA 1C1AA 2G8HA 4CIGA 3IRXB 3LP1A 5C42A 3O3GA 4HUFA 3RTVA 3I0RB 3RMDA 5KG3A 3VQBA 3RR7A 3NAIA 4H4MA 3RRGA 4ZVHA 3DI6B 2EC0A 4DU3A 3QO9B 4JRQA 1X9SA 1NK9A 4PQUB 1IKYB 3C94A 3MAQA 4CGFA 3MF5A 2WOMA 3WNFA 4TY9A 3HP6A 4RW4B 2GBZA 1N5YB 3GV8B 3V6HA 4KHWA 3NBPA 3AO2A 3BSOA 4H4OA 1JIHA 4K4SA 3Q8PB 2W9AA 1X1PA 4M3WA 1L3SA 1BI4A 5C24B 4ZP6A 1U04A 4DLEA 4DTPA 1RTIA 2D0CA 4AHSA 4CF8A 4MQ3A 2B5JB 1HJRA 3KJVB 3V1QA 1RDRA 4IRDA 3L8BA 4AHUA 1JLAA 1U4BA 4J9NA 3MXMA 3QIPA 3OYHA 3HKWA 1RT6B 2B6AA 4DQQA 3ZT1A 1XWLA 2BANB 1FKPB 4BE1A 4Y1CA 2BDPA 1YT3A 3T3FA 4EO8A 1HYZA 4N76A 3KK3A 3LP1B 3GIJA 4H8KA 1ZBFA 3LWLA 5C42B 2W9BA 5KG6A 1VSLA 3DMJA 5DLFA 3NFAA 3ZSRA 3NKYA 2GC8A 4CJLA 3DRSA 4DQPA 2CJQA 4H4MB 1VK0A 4IFYA 4FS1A 2D41A 4F2SA 2PYLA 2P51A 4YP3A 1J9AA 1SV5A 2WOMB 3RR8A 4NLGA 3CFPA 4ZP7A 4IR9A 1U48A 1Z26A 4WFZA 3I5AA 4H4OB 4R0EA 5KG2A 3NF6A 1Q9YA 4O3SA 4WFYA 1BCOA 4ZVFA 3M8SA 1BI4B 1RDBA 4O3QA 1RTIB 1I6JA 4WXOA 3VQ6A 4E1NA 3WNGA 4QWDA 4ECVA 4IBNA 2ASLA 3HM9A 3QERA 5I3UA 4O55A 1JLAB 5DGBA 1GOAA 4M3RA 5DK5A 3QIOA 2JEFA 1RTDA 3AA3A 3QIPB 2B6AB 3RBDA 3BR9A 4FYDA 4DL4A 3KK3B 3LAMA 3QGIA 1Z4UA 1CXQA 2W9BB 1UAXA 2ZQBA 3QETA 3PX6A 4J9MA 3DMJB 3KMQA 5F8MA 4KHUA 1BIZA 3DRSB 3OYGA 3SI8A 3LP0A 1BQNA 2XRIA 1VSFA 5KT3A 3L2VA 2WTFA 4TQSA 1NJZA 3LZIA 4URGA 4DSLA 3M9NB 3LZJA 3CJ5A 4FJJA 1SV5B 2AQ4A 1WAJA 2D0BA 3L2WA 1IO2A 3DLGA 3AO4A 3U6FA 1NK6A 1IG9A 3CDWA 4ED7A 4CHNA 4CJQA 3IAYA 3C95A 4RUCA 4MFBA 5EWEA 1A5XA 3KD5E 1YVUA 2WHOA 2KFNA 4CEFA 4KAIA 5KFHA 3V9ZA 4DL6A 1W9HA 1G15A 3KD1E 4TQRA 1YVFA 1RT2A 1RILA 4YQWA 5I3UB 1NNDA 3OL7A 2HHWA 2G8FA 1SKRA 3PJWA 4C8OA 1RTDB 2BQ3A 5KFVA 4K8ZA 3ZSWA 1TAQA 3TR8A 3SJJA 3DLKA 2AX1A 2FVQA 4F4WA 5EWGA 4DQIA 5HRRA 4CHOA 4DSIA 5J2PA 5HP1A 3RB3A 4CJ3A 4DWIA 4CJFA 4ECSA 2Z1HA 2ILYA 3HHKA 4CEZA 3OYEA 3V9XA 3LP0B 1BL3A 1BQNB 1JLFA 4J9KA 4DMNA 4ECRA 3UR0A 2KW4A 1QUVA 2G8VA 5L1JA 3DLGB 4IDKA 3AO3A 2WONA 4NYNA 2YKMA 2RPIA 1VSDA 5KG1A 4DQSA 3EZ5A 4DTMA 4ZP8A 4MFBB 4J9SA 3EZUA 3F9KA 4QW9A 4ECTA 3KMSA 3L2QA 3MECA 3E51A 2IDOA 4Q45A 3HO1A 3L3UA 1S1VA 1RT2B 2P5GA 4FJMA 5KT6A 2DFEA 3V4IA 2IS3A 3K5LA 3HVTA 3OYDA 3CJ3A 2J6UA 3RMCA 3DLKB 1IKWA 4CERA 3V1OA 1VSHA 5D3GA 4O3OA 3KKRA 4ICLA 4I7FA 5J2PB 5HP1B 1Z25A 4AHVA 4RZRA 1CXUA 5KFCA 3ZSQA 5L9XA 4E7IA 4FJ7A 4ED1A 4DTXA 1JLFB 3HPOA 4ECXA 3V9SA 4NLDA 4O3PA 4LD0A 3OS2A 4DF4A 4KHRA 4ED3A 4YFUA 3THVA 5JS2A 3FQLA 4Z4EA 4BE0A 2YKMB 2HHQA 4Z4HA 3AV9A 3TARA 4CGJA 5T7BA 3NCIA 2ZKUA 4JV0A 2JC1A 5FRNA 3CWJA 3VQ9A 5KT7A 2OZSA 3MECB 3PW0A 5DMRA 4H54A 1S9FA 4DL7A 1RYRA 3BREA 3ZSVA 4DSKA 1TKTA 3BSNA 4DSFA 3H4DA 3H5UA 3BJYA 1WSJA 3V4IB 3NGYA 4ZPBA 1J54A 2BRKA 3HVTB 4EEYA 1KRPA 2W7PA 1T03A 1D0EA 3VQAA 2FVCA 1HPZA 4Q43A 5HLFA 4Z4GA 1IKWB 5D3GB 3K2PA 4I2PA 4ICLB 3CVKA 2VG7A 5F8JA 4I7FB 2W42A 3M9OB 1UA1A 5F9NA 5CYMA 3KLVA 1YTAA 4B08A 1N4LA 3HYFA 1K1SA 4DTNA 1LW0A 1N56A 3K57A 4N5SA 4R5PA 4IKFA 2P1JA 1N48A 1WSGA 1RDDA 4DU4A 2RN2A 1NJWA 2C22A 4FLXA 1QSSA 3DLBA 2X74A 1KVCA 4J9LA 1ASWA 4E89A 2AU0A 1TKTB 4B9LA 1XHXA 2HB5A 2OPRA 4CEBA 4Y2CA 2V9WA 1XI1A 4OL8A 3KHLA 2BE2A 4WYWA 3T5JA 3OYFA 4BACA 1HNVA 1KCFA 1ZTTA 2B4JA 5L1KA 4LY7A 2RDIA 4KB0A 4TYAA 2RKIB 1T03B 1JXLA 2BRLA 1HPZB 3DM2A 4E7HA 5HLFB 4RG8A 4KRFA 4HUEA 4I2PB 4IH5A 4B9UA 5J2QA 3MTKA 2VG7B 5KG5A 4KTQA 4Z4FA 4O0IA 3PR4A 3H2LA 1HRHA 2IM0A 4G3IA 1KVBA 2ASJA 5CYMB 3KLHA 4DFPA 1A5VA 3K5NA 3HJFA 1LW0B 2QKBA 3OYAA 3LAKA 2GUIA 1BISA 2I5JA 1JLQA 4R5PB 2EHGA 2HAIA 2PY5A 4CJUA 4CK3A 4J2AA 2R8HA 4Q5VA 1Y97A 1EXQA 1RBRA 1NJXA 5F8IA 2Q3SA 2AX0A 3FFIA 3HK2A 4JLHA 3G6VA 4ECUA 1S0OA 5J2NA 2Z1GA 4RW8A 4M3TA 1QSYA 1TGOA 1F21A 4CCHA 5KRSA 5HROB 5T14A 3CFRA 2IM3A 3DDKA 2OPRB 2IOCA 2YKNA 5SZTA 2BE2B 2RF2A 2F8EX 1HNVB 5F8HA 4WZQA 3AVGA 2HVIA 4RUAA 3DM2B 3AVIA 4CK1A 5KFEA 4DS5A 1DLOA 4ECYA 2HHXA 4M42A 4KV8B 3S3MA 2FJVA 3RB6A 1U47A 2WB4A 3KNAA 1IKYA 3KLHB 2X78A 1K6YA 3KK2A 2W8LA 3IS9A 2WRMA 1NK4A 1U09A 2OPPA 4MIAA 3H5XA 4CGIA 2JC0A 3LDSA 3RMBA 3IN5A 5DGAA 2I5JB 1JLQB 1EX4A 2ALZA 5JUMA 3DOKB 4FLZA 4IG3A 1MU2A 3SQ1A 3HVAA 4O3RA 3UQSA 5KFUA 3HP9A 1UOCA 2Z1IA 4CFCA 3H98A 1QAIA 1WAFA 4F4KA 4LSNA 4B9VA 5J2NB 3OL6A 1ASUA 4RW8B 4DG1A 1VRUA 1NK5A 3M8QB 1CLQA 3PR5B 3QIDA 1QE1A 1J53A 1WSFA 2YKNB 1S6QA 2RF2B 4HUGA 3CDEA 3BGRA 3AA5X 2FJXA 1WLJA 4K8XA 2R8JA 1ZBLA 4Q44A 4CGDA 4Z0UA 4DU1A 4O3NA 1DLOB 1S1TA 3SUQA 4NRUA 3CJ4A 5C25B 1XR6A 2UUWA 1WSEA 4N56A 5FRMA 4DTUA 3KK2B 3IS9B 1R0AA 2YNGA 4ED2A 2OPPB 3ISND 3PW2A 3VQDA 2E9ZA 1NJYA 3LPTA 1TKDA 3MFHA 2J6SA 1LV5A 4KTZA 3P5JA 4IG3B 1MU2B 3CJ2A 4C8MA 2C2DA 4DFKA 1SKSA 4TYBA 1SH3A 4CJTA 1IKXA 1GOCA 3V81A 2OPSA 1U49A 4LSNB 3OHBA 1NKBA 3HPGA 4CEQA 4IKAA 4CHZA 2QV6A 3QGHA 1FK9A 4DG1B 1S6PA 2FBXA 4K4XA 3DLHA 5KTQA 1VRUB 2IJNA 4F50A 2W8KA 3PJXA 1QE1B 3JSMA 2ETJA 2VA2A 4O5BA 2UVUA 1S6QB 4DF8A 4FK0A 3BGRB 3K58A 1RTHA 4EO6A 4YR2A 3OYCA 2YHBA 3BSCA 2E9TA 5KFQA 1RBSA 3OYMA 4MIBA 3QEPA 4OGEA 4KHQA 3PX4A 5KT5A 1S1TB 1X9MA 2E9RX 1RAJA 4G1QA 1S0MA 4J2EA 3KOAA 4URSA 4IH6A 1QQCA 2UVWA 4NRTA 3SPYA 4ZPAA 1R0AB 3HSTB 2YNGB 1TV6A 4I9QA 4QWAA 1VSJA 3CDUA 2PYJA 2UVVA 1RDAA 2E6MA 3QLHA 3KIOA 3L2RA 1KTQA 5JXSA 3H40A 2R8KA 4FW2A 3EYZA 1S4FA 1IKXB 1YTUA 3V81B 2OPSB 5EDWA 3PW5A 4RU9A 1RT4A 1S5JA 4FZYA 3N6LA 5DQHA 1BIUA 1FK9B 3QEVA 1S6PB 5K14A 1QTMA 4TLRA 4EYIB 3PO5A 3I5CA 2V4RA 3JSMB 4EBCA 2G8WA 1S9GA 1VRTA 1ZBUA 5E41A 1RTHB 4L8RB 3DLEA 1RT1A 2I1RA 4WYLA 5KFIA 3IG1A 4AHTA 1IM4A 4NCBA 4TN2A 5KFRA 2WK4A 1BHLA 2NUBA 4AH9A 4G1QB 3KLEA 4Z4CA 1RT3A 1XC9A 4LH4A 3VA0A 4PUOB 5DQGA 4J9QA 2AGOA 1TV6B 4FJLA 3G0ZA 3HL8A 3ZT2A 4NLXA 4TXSA 3PY8A 4F8RA 3QLHB 4FW1A 4FLWA 2JGUA 1QS4A 1NK0A 4NLRA 1SH0A 3KLIA 1JL1A 1TK0A 1RBTA 3SFGA 1JXEA 3C6TA 1L3TA 1CZBA 4CFDA 3V9UA 1T94A 1WNSA 2YHAA 4FLUA 3RMAA 1RT4B 4W5OA 1NK7A 4N41A 2FVRA 5K14B 3NDKA 2ATLA 3AVFA 2YNFA 3LP3A 4W5QA 2XHBA 4FLYA 3SUPA 3ALYA 4UQGA 4DL5A 1Q9XA 4CF1A 1S9GB 1VRTB 2OA8A 1EP4A 3DLEB 1RT1B 4FS2A 3ASMA 4LQ3A 4CE9A 4MKAA 2O4IA 1NKEA 4NLQA 3IG1B 4FXDA 4KREA 3MXJA 2C2EA 3KLEB 2FLLA 3VA3A 1RT3B 5KFYA 4FM2A 4IQXA 4FK4A 3PV8A 4IH7A 2XWYA 4CEEA 4LQ9A 2X6SA 4DSJA 3GILA 1C1CA 3T5LA 2YNIA
chains in the Genus database with same CATH superfamily
1AW0A 2FIUA 3L6QA 3JTNA 1N5SA 4I67A 3R27A 1VK8A 1MWQA 1DURA 3C6TB 1UJ6A 2PFFB 1BHNA 2HQFA 1NDPA 5U47A 1D8YA 3A3NB 4FJNA 1F2GA 1I3AA 1S7IA 3JS6A 5FLXO 5KGWA 5DG7A 5EU7A 4RLEA 5HAOA 3P5BP 3LGMA 1JNRB 4B3RK 1EP4B 3PJ9A 2Z0GA 1RHJB 4B9SA 4B3SK 1XERA 4CZGA 3WXLA 4HVZA 2LLZA 3VZHA 3CCVN 4HCCA 1WSHA 4OVLA 1VC0A 4DS4A 4Y2MA 2IGIA 1WG4A 1XJWB 4F3OA 4CGGA 5IC6B 2X51A 5C5JA 4LF9F 1JLBB 2BX6A 4NCAA 4RCHA 4K4VA 4F4YA 5HMXA 1K47A 2QWPA 5D77A 2E1AA 4PQAA 5CY4A 2EVZA 5AQPA 4QWEA 3CT9A 3HT3A 5LJ5Y 1U45A 4MO5A 5CYJA 1KFDA 3AXKA 5DS7A 4MH8A 4HHHA 3OR1A 1JCGA 2RB7A 1Q18A 3E01A 2DTJA 1EZZB 2H48B 3CC4S 4B1WB 4J9OA 3TAGA 3UR3C 3OVNA 1C0TB 4N77A 4QAGA 2DGSA 3V6JA 1F9HA 4FVMA 1SUQB 4HH0A 4RNFA 2LQ5A 4B02A 2KRRA 1KOHA 4J7CA 1QLNA 1S1WB 1X4AA 4ECWA 2UUAJ 3M3ZA 2V9KA 2EFNA 4DV6J 1OYDA 2YH0A 2JH3A 4JI7J 2DO0A 4BRGA 5FDLA 2GVZA 2DR9A 2HWIA 2OTJN 2RRBA 2VG6B 2VU5A 2ZHOA 2EFGA 2KRBA 2WVBA 2FD2A 3AY0A 2HWHA 5J2MA 4K7QA 5D4OA 3TZWA 2RS8A 2AP1A 3TJAA 4M8LA 1RA6A 4KV8A 1IBCB 3MEGA 5IM0A 2Y1IA 2M88A 5JVHL 2FLPA 5GAHU 4PWUA 3JAMO 2DY4A 7FDRA 3H20A 4GKKJ 1FRIA 4OZ5A 3R9PA 2GUPA 2ZD1A 2W2PP 4O4RA 1C1BA 1HI1A 1YI2N 4BRKA 3LGNA 4LF7J 4JV5F 3M8RA 2X1FA 3L4QA 3BQ2A 3P8BB 4UW2A 3A8JA 3KHYA 3H2VE 2GA7A 2DEIA 2QA4N 2DIUA 2HS0A 1VQNN 2ZITA 3LDNA 3EO3A 4L6V3 3EL2A 3FC9A 2BMBA 2VFVA 3H45C 3NXZA 2QA2A 3OSNA 2IVOA 3RJMB 1V6HA 4DUYJ 3U8XA 3SAHA 3O5BA 3LPUA 1MWZA 3ULEB 4QU7A 1RDWX 5IT9O 3KKSA 2QW9A 2ZWPA 3J7AN 1TL3A 4U96A 3W0LA 4LRAA 2OZMA 2AGQA 4NZ6A 4USKA 5C2FA 5CHIA 4AL5A 4CD3A 2RRAA 1VRQC 4G1PA 2PI5A 4B1UB 3LALA 3CIPA 4RW7A 2HBJA 1Y10A 4M5IA 2G8UA 2FJDB 2EX3A 3CJBA 5CZ2A 3VF6A 3GG0A 3US5A 1BUPA 1EJ7L 4USMA 4DV7F 3IUCA 3B6OA 2YJEA 1ACMB 1VIXA 4K8RA 2DNQA 4JUZA 1T3NA 1G99A 1SJ3P 1BD6A 4KB7A 3MDQA 1HR0J 4BS2A 2YHWA 3BYRA 4CF0A 3I8DA 2G2YA 1GX6A 3MM9B 3SAFA 1T02A 2HG4A 1W26A 2LA6A 3GV7B 1HYVA 6AT1B 1WKLA 1BGXT 1XMBA 1LXJA 2IMOA 2E7XA 3TA0A 2R4FA 2O8CA 4B9NA 1FRJA 1L5UA 2MLZA 3MK6A 3MR3A 3ID8A 3NVMA 2H54B 3T9ZA 4FM1A 2Z56B 2MGZB 4ERDA 1TKZB 2B0GA 1UFKA 3KLFB 3OXFA 1RTJB 4H4KC 4I6WA 2Y1RI 2DY9A 2QK9A 4IFEA 2FYXA 4OYAA 1VR6A 1CSJA 2FZKB 3UE2A 1TZ0A 2A1RA 4WF9L 3PEHA 1SCJB 2BZ2A 2EW9A 1Y5NB 1R8AA 2VA3A 1S6UA 4A46A 4NA1A 2BJ3A 1FFGB 2MZQA 4LMZA 4F3TA 4YMEA 4JKHA 1N6QB 3C15A 4U6PA 5GADI 3IGVA 2M4MA 4CJVA 4DV0K 1RHUB 3NGKA 4NZ0A 3Q22A 4X62K 4X66K 3W5XA 3OBYA 4CLKA 4DR3F 3M9MB 1QVFR 2PBDA 3B6PA 3VTIA 4A2BA 3DRPA 4W4MA 4JI5K 4WXWA 5AQNA 2OHDA 2D0AA 4QR2A 4PUOA 1CJKB 1NHVA 5E3QA 4WIIA 2QXFA 2IMWP 4CLZA 4M3ZA 4GY2B 2CQ3A 3AVHA 1KLMA 4JYAJ 1JX4A 3ENHA 2WZ1A 2CJBA 2E5LK 1CJTA 1W7WA 2NRHA 3NBPB 5HQLA 4FJ5A 4ANEA 1BG3A 3KDOA 2AW0A 4AF1A 3DLLL 4HL9A 1NSPA 3BF1A 3CCSS 3CGIA 4LFBJ 3B4DA 1D5AA 4A4JA 1WUAA 2XY6A 5IT4A 2IRXA 4KHMA 2K2PA 3JS9A 2BOPA 5KFAA 4TNOA 3KK1A 2KO1A 3NH1A 2XGPA 2A6OA 3D7EO 3AVNA 1I1GA 1JJ4A 3NOGA 2YNHA 5TKYA 3WNHA 2OMLA 3J7YI 4NLOA 4LF8J 4TU8A 4FF2A 2PN6A 8ATCB 5BN8A 4DR2K 3ZSZA 2PDAA 2F8SA 1WJ9A 4LVOP 3RRHA 2HMIA 1WEZA 2X6NA 3G86A 4BQZA 1HW9A 2H51B 1OQ3A 3SQ2A 4JKGA 1LFPA 3IWXA 1RT5A 3ZZOA 1H74A 3MEDA 4J9UE 4KO0A 4CIEA 1E6YB 1JXVA 1N36F 2DNKA 5ETNA 1VJWA 3ZNJ1 4RO0A 4M63A 4M5DB 4X4PA 3SSRA 3NWRA 4C8KA 1R8HA 3BEXA 3SMPA 2B4OA 3CFOA 4HEA9 1S1XA 4Q8EA 1M1KT 1HQEA 2HW3A 2V0NA 5K8MA 3TAMA 2Q1LA 4ED6A 1T05B 1NDLA 5AQIA 4P2FA 4KGKA 2A1SA 2P9PB 2J9CA 2LQJA 3SQGA 2XY7A 2QC3A 4UTGA 3G82B 2VDHA 3NCQA 4FYWB 4FCYA 2AGPA 4JI3J 3VV2B 2YQ3A 5DLGA 1EKEA 4PR6A 1QDUB 3CF5L 4KBIA 4KFBB 3OTCA 2NXUA 2P8IA 3N28A 5CYQA 3SYZA 1J5EJ 3UWTA 2FGOA 4K5RA 4FJXA 4C0OC 3FJ2A 5B0FA 3NGIA 2OPQA 3P49B 4F7VA 4JI0K 4RNOA 5CQGA 1JCFA 1UEVA 1S97A 4DEZA 1YJ9N 3MEEA 4A8OA 2YWKA 4HDGA 2G8IA 3RAXA 5TKWA 2HVHA 4HTIA 4CO1A 3TWHA 1L3VA 2GHVC 1WG5A 3NGDA 1WB9A 3CYMA 2ZJQQ 1DTTA 2UP1A 4F26A 4IDKB 3VQSA 2M8HA 4CEDA 2CWXA 1CZ9A 2WVEA 4I9LA 4M5GA 2CZ4A 4DR1K 5GINA 4DV0F 3CE8A 1YJTA 3T19A 5CD4A 3TPQA 1R6YA 1LW2A 1VQ7N 5AXNA 4M3UA 2V51B 2MKCA 3HBTA 3AQOA 4LR7A 2LQ9A 4HH1A 3I55S 5KT4A 4JI6F 1TU0B 1K44A 5KI6A 3CCMN 1URNA 4ED0A 4ZCMA 2ITMA 2IC3A 1RP5A 1Q82O 3KG0A 1IKVA 4Y3CA 3BGUA 1NGEA 2IPOB 2JHEA 1Y9OA 3QNWB 3RAMA 3VAJA 4AXJA 1R27B 2X3DA 3TZZA 3QMQA 4FPRA 1O0PA 3JQMA 3OBWA 2DPNA 4KSEB 3N6NA 1GNKA 3LPEA 5IT0A 5BYRA 1RSCA 3H3NO 1RWXB 3TX0A 2XCPA 2F8MA 4U7UK 1KHVA 1TK8A 3BP8A 2B9WA 3HVWA 5KFGA 3VR1A 3QAUA 4LH5A 2E2OA 5AQUA 5DG9A 1LWXA 4AHCA 4Q8FA 2ZM6K 3Q8RB 3NMUA 3PSFA 2GX9A 2HEKA 1FXDA 3FK4A 3O4NA 3ZTRA 4PL7A 3OTEA 3VENA 1VIOA 2XSJA 1RZMA 4TLQA 3DKDA 4NWBA 4QW8A 1FF2A 3VPZA 1U7LA 4FJGA 3DWLA 3MX5A 3I32A 2KQ2A 4OZ3A 4FK2A 3CCJS 4OX6A 5DM6L 4DR2F 1YHQN 4MYTA 4JKCA 2BGGA 4OLAA 1ZAWA 4X62J 4GVMA 3ZETA 4N8OA 1DAXA 2J0XA 2XEXA 3OBIA 5ITHA 5GADP 1SZ2A 1ZS6A 3E9LA 1Q7YO 3FBCA 4F9OA 4WTYA 4C11A 3GPAA 3HLUA 3H0PA 2P2CB 5FLXU 1U1QA 2V34A 4X65K 1PYTA 1YZ7A 3I0RA 2YX7A 2RHKA 3NP5A 4CFBA 2OKQA 3NCRA 2UUTA 2W4PA 3R6MA 4DV4K 3M1FA 4DPUA 4ELUA 1EX8A 5J2QB 4I64A 2P9GA 2I38A 2AT1B 2E5LJ 3ZCMA 1TVRB 1JKHB 4CEOA 1P90A 3DXMA 4J9PA 2HKEA 4NLBA 3LDLA 1N5YA 2ZZMA 3QBWA 5LMNF 2NZTA 3I9ZA 4K4YA 2DNRA 1S1UB 3TAEA 4B3TF 2H4WB 4OZNA 2HNYB 2MQNA 4AYBD 4W98A 4WFAQ 3D45A 2DH7A 4TSXA 4E19A 3KJVA 4XDCA 5E3RA 1F1BB 3E9OA 1YJNN 4CZLA 1RT6A 2LEPA 1FDNA 3ILOA 2BANA 4FF1A 4ZVQB 2DNMA 3MEKA 3LP1A 4CM2A 4FVUA 5C42A 1Q8KA 2J8AA 3O3GA 3J7AP 4JI0F 4KYZA 4GKJK 5KG3A 3CJRA 1F5BA 1HJOA 4H03B 2RQCA 3DXKB 3M32B 3N79A 1FRMA 3IWLA 2EC0A 4LIRA 1X9SA 4RJVA 4PQUB 3PYDA 3CC7N 2OFHX 3TTCA 3MAQA 4CGFA 3O9TA 4RTFD 4KHWA 1NSAA 4CO3A 3W3DA 2MKJA 4X4NA 1U04A 3B78A 3THWB 4DLEA 2AF6A 1WOOA 4CF8A 4O8KA 3MUTP 2ASMA 4MQ3A 2R3VA 5C2GA 3K8WA 2XS7A 2PGCA 4AHUA 1U6FA 1BY9A 1M5VC 4J9NA 3MXMA 3OYHA 2XO6A 3HKWA 4DQQA 2XTJP 2E1PA 4Y1CA 1UPPA 4N76A 2YTCA 4EFAC 1HFEL 3HHLD 5GAGI 2GVDA 2B4UA 2PI4A 2GC8A 3HDSA 4ITSA 3DRSA 3AJ2A 3EZWA 3VETA 4IFYA 4FS1A 4F2SA 2P51A 1EAYC 2VKZG 3G71S 1S12A 2W6LA 1SJ1A 3VGUA 3VQTA 4CBUA 3O6WA 2QMUB 1Z26A 4WFZA 4ANCA 5KG2A 1NNEA 2IYGA 3A5NC 2DT9A 4ZVFA 1VC6A 4LBPA 2E5IA 3VQ6A 1D9AA 2IY5B 4E1NA 2HVDA 2XNRA 4ECVA 1LNQA 3MPDA 4BR0A 5AQXA 2DR8A 1WTFA 3LOUA 3AD9C 2JEFA 1JWWA 3FKBA 4DL0C 1SPBP 4BBYA 2HURA 1GTEA 2JRSA 3GSDA 3QGIA 2O8DA 5IT9U 3DMJB 1OSCA 3KMQA 3M2RB 2HMPA 2BKOA 4ISEA 2WSFC 2WTFA 1F5CA 2ACMA 1NJZA 4DSLA 2JX2A 4FJJA 2Q1NA 2DNNA 1SV5B 1WAJA 2L9WA 3L2WA 3VOVA 1RAGB 1IO2A 4X4VA 3A8EA 4FNHA 1UAWA 4RUCA 2F9WA 2V50A 4DR4J 1HKBA 5EWEA 5CAAA 3KD5E 2V6AA 3OD2A 4A5BA 2JDJA 1S79A 4KAIA 3TUPA 3V9ZA 1VQ5N 1ZA2B 3NNAA 1NJIO 1YVFA 3B82A 4B3MK 2VFUA 3GOIA 3IDHA 1U0HB 4C8OA 2AHOB 1RTDB 3ZSWA 2AX1A 2FVQA 2UU9K 4DSIA 5J2PA 1VQSA 2WUSA 1HQ2A 4ECSA 4OYXA 3J7Z5 3HHKA 1P9YA 3V9XA 4KRWA 2QO3A 3ILIA 4DCOB 3LP0B 1BL3A 1JLFA 3FEXB 1WACA 3W62A 1UETA 4OZ0A 1VMBA 1MMDA 3CMAS 3DLGB 3AO3A 2Q6BA 4NYNA 3KKFA 1ZBTA 2H1YA 4ZP8A 3ZZTA 4MFBB 3CJKB 1FRLA 2VUGA 2CQIA 1S5ZA 4QW9A 1QVFM 1FJGF 2HFUA 2NPIA 3KG4A 3O4WA 1K8KA 4ZN1A 1TL7A 2GS8A 4DR5J 1U1NA 4IOAQ 1GQEA 2P5GA 3ZTSA 1OIAA 3LW5C 3HVTA 5A76A 3OYDA 3CJ3A 3IM8A 2V4JA 2HHHK 2DR7A 2VBZA 4A59A 4GKJF 2MZTA 1Z25A 2YKOA 1G7CB 1CXUA 4DU7A 3GL1A 2YVSA 4PKHA 3HD2A 4E7IA 4MDAA 3J81O 3HPOA 3PRDA 3V9SA 4GKKF 4OHXA 3WC0A 4OI3A 4LD0A 3VAIA 4KHRA 4ED3A 3SK3A 2VONA 3W9HA 2ZFHA 5JS2A 3HSDA 4X4SA 4LF7F 4B1XB 3H25A 1ATNA 4Z4HA 2VODA 1JQGA 3CWJA 3VQ9A 4CW7B 5KT7A 3W5ZA 1UP1A 3MECB 3PW0A 4R0JA 4YDDB 1S9FA 3Q83A 1RQ0A 2YHXA 3K7RA 4CT8A 2PFUA 1OH7A 1TKTA 2VDIA 3H5UA 3BJYA 3BY5A 3R7SB 3V4IB 4DV4J 3NGYA 4DU8A 4ZPBA 1J54A 3GFHA 3VVUA 5A8WB 1KRPA 1D0EA 3VQAA 2FVCA 3ET6A 3WT0A 4Q43A 2XYGB 5EGYA 4CLWA 5D3GB 2A10A 3CDBA 4I2PA 4ICLB 3R5BA 2LMIA 3QWUA 5F9NA 3G6EN 2VKRA 3AJ1A 2GWKA 3VZIA 3NG8A 4NPOA 1K1SA 2E5HA 2G2OA 3MTJA 1UVIA 1KKHA 4IJNA 3W9IA 2OEJA 1N48A 5GAHI 2QSWA 2B8QA 2RN2A 3MM6A 1RWVB 1QSSA 3M8ZA 3K17A 4Z2XA 2HQIA 4Y00A 5HQMA 1RWNB 1IJJA 3I6PA 5C2DA 3CJAA 1YITN 4B9LA 1BO5O 3TO8A 2D3O1 4CEBA 4OL8A 4PKGA 3QJJA 3OYFA 5LL6Z 2RDIA 1SVDA 2XHWA 1NB7A 3NNHA 2NXEA 4RG8A 3F44A 1HBUB 5D0EA 4CRJA 2VG7B 1A6LA 1S22A 4O0IA 3H2LA 5CYMB 4CI0B 1GLFO 4DFPA 3KFWX 5T7LA 5KQ8A 2EEYA 1P6TA 2RIJA 2WAQD 2ZH1A 4Z7CA 3MMCA 1CJUA 2EHGA 2OEMA 4LJMA 4PPZA 2RU9A 4CJUA 4CK3A 5AQGA 1XEZA 1RBRA 5F8IA 2HHPA 2XMVA 3MM7A 4NXNK 3MM8B 1S59A 4ECUA 3G8QA 3RBZA 1QSYA 5HL7Q 4CCHA 4LF5J 3FZFA 3CFRA 1GXTA 2IM3A 2OPRB 2IOCA 3WEEB 2YKNA 2Q3PA 2BE2B 3ILJA 5F8HA 3L0QA 4H0VB 1TUWA 2RE1A 1FERA 4RUAA 2MKSA 2RQKA 3CD5A 4DS5A 1SC6A 1K9MO 2ZEJA 2CQBA 4LF6J 2E1ZA 4M42A 4KV8B 3S3MA 1U47A 1XMOK 3KNAA 3KLHB 4CZIA 4ZCIA 1EB0A 4LC9B 4GVBB 5DDQC 5EHHA 2DR5A 3G2XA 3VAFA 1APSA 2MY7A 1NCLA 3LDSA 3RMBA 3VAMA 2E44A 3FVYA 3I8BA 2I5JB 1JLQB 2FDNA 4BRAA 1WOPA 3KUEA 2ZBPA 3TP2A 4RUHA 3UQSA 3MM5B 1UOCA 2Z1IA 5E2QA 3ZTQA 2L48A 4LSNA 4CLYA 2NRZA 3RSEA 2KFYA 5AE1A 1MMNA 4RW8B 4DG1A 3PFOA 4ZVOB 1U1KA 3PR5B 3T1HJ 5B09A 4YOUA 1VQLN 1WSFA 5DO2A 2HHHF 1S6QA 3RW6A 4LFBF 4HUGA 3AA5X 1L3KA 3RRKA 1MDUB 1VCTA 2R8JA 1ZBLA 4Q44A 2HBLA 4QBUA 4KT0C 2M2BA 1O5JA 1DLOB 1ZBSA 1IXKA 1VQPS 4LFAK 3CJ4A 1XR6A 3CSKA 2NQPA 4OPHA 3KK2B 2CNOB 3ISND 4PG5A 1B7YB 3TYTA 1FEHA 1OYEA 5AQSA 2N3LA 1TKDA 4Y65A 1CJVA 4KTZA 2W1BA 2MZSA 5AFUH 1G1XA 4CH1A 1J6ZA 4IG3B 2D9OA 3CJ2A 4C8MA 4DFKA 2P9LB 4TYBA 1IKXA 2BW2A 1PAEX 4TVAB 4M5JA 2RRNA 4OYBA 3DLHA 1VOMA 2W8KA 1XN9A 3D2EB 2VA2A 2GIFA 2UUBK 4LT6A 1B4SA 2DISA 4TKTA 3TSQA 2YHBA 3MWTA 3DLJA 3G8TA 1RBSA 4MIBA 3QEPA 1XIQA 1FXLA 3S41A 4FPAA 1WBDA 1S1TB 1B7FA 3VGSA 1YG0A 3KOAA 3BBBA 4NRTA 4ZPAA 2YNGB 1NDCA 4I9QA 1FCAA 4ZVUB 5IQ6A 4USWA 3QB0A 2E6MA 3QLHA 3KIOA 1WC1A 2L3MA 2HF4A 4FOEA 4BGAA 2PEHA 4J9VA 3FEYB 3TW0A 5EDWA 3WXMB 1S5JA 3B54A 3N6LA 4OZ1A 3Q7CA 1N32J 4KH0B 2VQFK 4CH0S 1RCXB 5AQQA 3T7ZA 2PEBA 4CBXA 2GQ2A 1X4DA 1IUJA 2V4RA 1OY6A 4JI8J 4EBCA 4KGMA 1VRTA 5E41A 2QA1A 4IDHA 1RT1A 1J5EF 1AA1B 5AQWA 2PA8D 4WYLA 5KFIA 1WSVA 1IM4A 1H2UX 4F36A 4AH9A 3KLEA 4Z4CA 2AJ1A 1RT3A 1AB8A 1MNEA 1IQZA 3MCAB 4PUOB 5BRHA 2PO4A 1TV6B 2M70A 3G0ZA 3ZT2A 3IR7B 4TXSA 3JQJA 1KN6A 4H5VA 2VOOA 1QS4A 2L08A 2JWLA 1JL1A 4NXMK 4ISFA 3I56N 1JXEA 1KC8O 3C6TA 1L3TA 3V9UA 3O44A 4DQ8A 2QL7B 2UXDK 4DOZA 5D4LA 2KHOA 5E3CA 3I4PA 1NGDA 3CXCR 3MCSA 4AE5A 4JI2J 2OTLN 2QL5B 3ALYA 4CF1A 2OA8A 2CZ9A 4DDFA 1EP4A 3ZZPA 4AL7A 3ATVA 2CPJA 3VEOA 2WSCC 4LQ3A 4CE9A 4MKAA 2ZDOA 4QR0A 1NKEA 2WVCA 3IG1B 4JAXA 2J4RA 2XHCA 3IP0A 1UZHA 1Q4RA 3EGZA 4EI2A 4IQXA 3FZMA 3PV8A 4LRBA 2XWYA 5B0EA 2ZC4A 4QOTA 1FNMA 1BMQB 1LCUA 3TA2A 4U95A 1SQFA 4DV3K 4KIAA 4C0BA 3AVBA 2VFSA 4UY8O 1K1QA 3AXMA 4DV1F 4L72B 1ZC6A 4QIWD 2ILZA 1UEKA 3GYXB 4C8NA 2R7WA 3UVJB 2QT7A 2P9EA 4C97A 4ECQA 3F2KA 4KHYA 2JEJA 1KDNA 3POTA 2YNFB 5CHCB 2BTFA 3ZZ0A 3BSAA 3WNEA 2R7XA 3TX8A 3H08A 1KFSA 2WBMA 2A41A 4ZLNA 2HHSA 3SQ0A 5AJ3J 3PUFA 2GV9A 4ID1A 4EBEA 2E2PA 2L9DA 4EZ6A 2QLWA 1SUQA 3W64A 3HSJA 3PZPA 2RUGA 3OSPA 4OIXA 2Q43A 1S1WA 3CHWA 5ETRA 1Z1ZA 4LBIA 4KHPK 3MWBA 3O2IA 2YNIB 1JLGB 3CIZA 2KJVA 3TVZA 2RDJA 4QPXA 1E4GT 2N7CA 4P7TA 2Y3YA 4CJPA 4HYKA 1U2FA 2BKNA 2VG6A 4HCBA 3Q8VA 1RBUA 3QGGA 1AUDA 4WFNL 3V4MA 3BDPA 3F56A 3AVJA 4CIFA 2H65B 2UUBF 3P83D 5DM7L 3FSXA 1XNRJ 2H3EB 4TY8B 3SJHA 4ES2A 1U2CA 2BBEA 3Q86A 3O6QA 3E66A 1FXXA 4M41A 1NZAA 4RNMA 2Z58B 2ZJRQ 5A6WA 1CQNA 2LU1A 4ZIVA 1QHTA 1Q81T 2E7WA 2QLXA 2Q31A 3TVKA 1FKAF 2HBQB 1U1LA 4C1NI 1TKXB 1NGFA 2ABYA 2R8GA 4P2SA 5DQIA 5HK4A 5ADXH 1DTTB 3R9LA 3HI9A 1REGX 3GYNA 3ZT4A 2VQFF 3BBCA 1EQYA 1Q0NA 3AFGA 4LFAJ 3TA1A 4FJ9A 3BF4A 5A6PA 2ZZTA 5G0RB 3RAQA 4OPAA 3ULEA 1XR7A 4KH5A 2IBKA 4CJEA 2AZ1A 3J81j 2WBNA 1UFLA 2RHSB 3I82A 4QS7A 2W7OA 3H3OB 4JD2B 1LWEB 3GR1A 2MHEA 1XHZA 2OGUA 2NUUG 3AA9A 1VGYA 5AT1B 2GMJA 3W3SA 4JN4A 2R8IA 4QWBA 1IWGA 4ZVTB 1M0SA 3CQYA 4WK3A 4W5RA 3MM9A 1KLNA 5M1QA 1EETB 1V5IB 3C14B 3D7SB 3OJSA 1HNIB 4B17A 3K5MA 1GLDG 1JB0C 2DNPA 1N33K 1IR0A 3WXIA 1V3ZA 1VHXA 1VAZA 3FNNA 1K8AT 1CQMA 4P71A 1IR2A 1WSIA 4XPEA 2DKOB 2BE7D 2MGZA 1TKZA 2DRBA 3DCAA 3KLFA 1DFDA 1RTJA 2HIQA 3KTQA 1GAOA 1NLVA 4ZHRB 5LOQA 5I42B 1FRXA 2ZGYA 1ZAVA 1KQGB 3D4JA 5F8GA 4ILJA 3VEVA 4DV3F 4FZVA 2MQPA 1HNWJ 1REVB 4OI6A 3UN3A 5H9FJ 1UJ5A 1EKRA 2GMHA 1ITGA 2VWJA 5BR8J 2QJ3A 5A2QO 4X4UA 3ZT3A 4WFXA 3AT1B 1N6QA 3NOCA 2Q6CA 1RWUA 1MG7A 3D6TB 1IBKJ 4H5RA 1YK9A 2PA3A 2VC0A 4O4GB 3C16B 3D6FB 4IEEA 1RCHA 3H8YA 1RBLA 2XS2A 3QRRA 4HR2A 1CULB 1YJ7A 4DKWA 4ZP9A 3PW7A 1JXBA 4Y34A 3UPFA 1OH5A 2E1YA 4CJ7A 3K59A 2QRRA 1CJKA 1S0NA 3ZSYA 4O44B 4WFBQ 1CPZA 5FPNA 2KXFA 3O1BA 2NXCA 1FVSA 4EAHD 1LWCB 3CC2N 2CQGA 4B9TA 2CPDA 1XQIA 3DDIA 2RAQA 3NAHA 4M5LA 4WZMA 1JJ2R 2AIRB 2HRTA 1LWFB 4EP4A 5HRNA 4DR4F 4PKIA 2ACYA 4NZ7A 2ROEA 4NMXA 4KPCA 1SJFA 4E7JA 3DOLB 4K43A 3VQPA 3WBZA 1DTQB 2ZWOA 3BH7B 3CQ8A 2V68A 2RE2A 4YB6A 1KVKA 3D0HE 4Y0WA 2XY5A 3CCRS 1EWRA 1MMLA 3S3OA 2O8FB 4QYZJ 2E5GA 3MUVP 3ENAA 4PG7A 1BC6A 4K50A 2CPFA 4MYUA 1RE1B 4YB1P 4KQZA 7FD1A 2F96A 3CCSN 3F73A 2DK2A 1XC3A 3M5RA 5KOWA 4ELTA 4PPDA 2MQQA 2KZMA 5GMKa 2APOA 2HHTA 4C2MA 2QFIA 4E3SA 1M90O 5F0WA 2ZBRA 4LF4J 2W2MP 5KRTA 4K41A 4HI2A 3Q89A 4A8XA 1OO0B 1A5WA 4CJKA 2QEXN 2DH8A 4XH5A 4PY5A 3W2VB 4M7XA 2P9SB 4X64K 2KVIA 1TTHB 1ZETA 3OYLA 1XQSC 2B9EA 3ZSOA 3PIPQ 2VG5B 4OKEA 3O9SA 1VQON 1E6YA 4B8AB 2CUYA 4HT5A 1RLCL 2HFOA 4H4KA 1N8RT 4B9MA 4RW9B 1VHIA 3VF2A 1HMVB 3UD4P 1WC3A 4M5DA 4L73A 3QPIA 4EFHA 4BC3A 4BG9A 4IFYB 2BYCA 1NPPA 5DDOC 4KY3A 5HVHA 2GWJA 5HN0A 3TJ9A 3R6GB 4CH7A 3U02A 4M45A 2J5AA 2ZVIA 3M6VA 3QNOA 1T05A 2U2FA 3MAHA 2BR0A 3EXYA 2P9PA 1Y4ZB 3BKFA 3OYJA 4DL2A 5D78A 3BZKA 3CMES 4MKBA 1Q86O 3FR0A 4A8SA 3M8PB 3OUYB 1FWPA 2CADA 4KFBA 3A8KA 4OHWA 4A57A 2KN4A 3H5SA 4NOHA 3OL8A 4ILGB 4FWLA 5KFXA 1TUVA 5GAEU 3PIOL 3O4QA 2O8BB 4FWKA 5KFDA 2P9CA 1SBRA 2YX1A 5J1EB 2DY1A 3W65A 1XMQK 1VYAA 1EARA 4MO4A 1TQLA 4JS5A 3G10A 4JI4J 3V6DB 2DPJA 1KD1O 2KM8B 2MQLA 4K5SA 3HI0A 3PHEA 3FMWA 4QIVA 4WP3A 2NS1B 2O01C 2ADCA 3C65A 4RUBA 3MXIA 1FE4A 2J9EA 3LUYA 2PAVA 4FBUA 4L76A 1HNZJ 3VTHA 3O3FA 5GMDA 2P9NB 4Z94A 1HBMB 3NGUA 4RX6A 2FPHX 5DDRC 2JVOA 2Z1JA 4U7CA 2VD3A 2BABA 1ASVA 3TQ1A 5M1NA 3AOBA 2LXIA 2FF3B 1CG2A 3ZTOA 3UDEA 4QCLA 2FC8A 3OVAA 2XI2A 3V2UC 3TNVA 3CCUS 3DRXA 3TI0A 4CM0A 4CO4A 5KFTA 5HQ8A 5DZ6A 5LJWA 4BDPA 2KU7A 2KL8A 3ZNUA 2H9ZA 1OSDA 2ZE2B 3PLAA 1PG5B 4UOCA 3I55N 3N4PA 2MZRA 4UOGA 2VC1A 4MK8A 3GG4A 4UUXA 4UOHA 4FP9A 1X5PA 4RKUC 1SQEA 3MWPA 2OD6A 4FBTA 1C4CA 4A8YA 2J0QD 1RBVA 2HS3A 5FPEA 2V4QA 3JYTB 3SI6A 1KVAA 1XUPO 2ZBIA 1D1UA 2EPIA 1M5SA 2GIRA 1NOYA 1N33J 1JLCB 3GCXP 3CCVS 4CJSA 1K8KB 4RNNA 4CO2A 4ECZA 2GQCA 4A8FA 4LF5F 4BR2A 3K9KA 4CIOA 1HUXA 1W2BR 2R2UA 3TOQA 2ADBA 1B9FA 4IO9L 2UUCK 5GVQA 1ZM9A 2MMYA 4J9RA 4ZPCA 3IBCB 4BWMA 2C2RA 4WCEL 5LY3A 2XGQA 2RS2A 3L2UA 2HBRB 3FQKA 3VAGA 2FBVA 1GX5A 1HYSB 1QSLA 3LP2B 1WN7A 3M6UA 5B0AA 3BQ1A 3TAFA 1RHRB 2V8DA 1GH8A 2HFSA 3R5CA 3CJ0A 3ISZA 4BGBA 5GIOA 5ADZA 1BWEA 4XH1A 3E1YA 3VN5A 1TFWA 4OX9K 3CXCM 3T5KA 5CE3A 3BPSP 3I87A 2OEKA 3CTRA 4ZDNA 1QHAA 3OY9A 4DV5K 3IGNA 2VWKA 3E8OA 3CCEN 4YEAA 3CCJN 4LFCJ 5LXYA 2IAJB 1V3SA 1AYEA 2CKWA 2DH9A 1RYSA 1P1TA 3UDVA 1WNEA 4ZVEA 2QWNA 2UXBJ 1S76D 3C19A 4EHUA 3D5MA 2W2QP 3TSPA 1N34K 3FUYA 2CRLA 4NLPA 2O1PA 3I5BA 4DUTA 1TAUA 1SQGA 3I9V9 4RR5A 4YOXA 1NUEA 2IM1A 3N5BA 1P8ZA 1ZBHA 5AE2A 4DJBA 1IN0A 1URRA 4ED8A 2FLNA 4RL1A 1TVRA 1JKHA 4IFVB 3CI5A 2OTJS 2ATQA 3C6UB 2RDDA 3Q2TC 1M5OC 3ENBA 1HARA 4YOWA 4I68A 1D9FA 1S1UA 5KFWA 2HNYA 3ELHA 3ETOA 1MLAA 4BVPA 4M3YA 1J5OB 2FLOA 4IO1A 4R79A 1IBMK 4CTAB 2F65A 3SNNA 2GJ2A 3NE6A 2OSQA 2D4WA 2RT3A 4OGCA 2AJ2A 1BWVA 3KWIA 1T95A 2NXJA 5HBMB 2XS5A 1LEOA 3HPHA 1YI2S 3T1YJ 1HNXJ 4MK7A 1SC3B 4CF2A 2B3TB 3U1LA 3PVXA 2NZCA 5LMUK 3P3DA 2VFTA 4P2MA 4PWDB 2R7YA 1Y0HA 3CO9A 3DXKA 3M32A 4R8UB 4NYZA 3MMBB 3T5HA 4PQUA 3GQCA 4YNQA 2IFXA 1HLUA 3TABA 5T7LB 3M2VB 2MTLA 2RH3A 4LVNP 4RWXA 1ZZNA 1NOZA 2FC9A 1HQUB 4L3QA 1QTNB 4ZPWR 4GO7X 1Y5IB 2HQCA 3A5OC 4BC2A 1KOOA 1T9TA 3THWA 2C3YA 3OTBA 1KAZA 4G1IA 3H7HB 3UDLA 1JL2A 4KKOB 5ETMA 2OO4A 4Y2IA 2ERRA 2A0FB 4H5TA 1HHQA 1D8ZA 3PO4A 2FY8A 5JVHQ 1K0TA 1TUGB 4U7UD 4JKBA 1VQ9N 2ATCB 4JI8F 3IRXB 2F4FA 2BM0A 5ETTA 4HUFA 1KS2A 3MN5A 1EO1A 3VQBA 2VWBA 3R5AA 1B0VA 5L8RC 3CJ7A 1PJ7A 2KHCA 3LF0A 2DGWA 5D15A 4JI1J 4RBVA 1JNZB 1U1OA 4V19X 1NK9A 5JLFA 2YXLA 5HI7A 2RJZA 4HACB 3AY9A 4DR6J 3WNFA 3FZKA 3NGSA 4RW4B 3BF3A 2GBZA 3GV8B 3CCQN 5IWAJ 4C3MA 3B8HA 4LF9K 4K0KK 3G71N 4BRCA 5BPLA 5C24B 5AXKA 2D0CA 4AHSA 1KP6A 3CCTA 2NRXA 3FMBA 2B5JB 1HJRA 5B0CA 1NXIA 2IJRA 2QMXA 2R7VA 3PG9A 1LQ9A 2BEFA 4I0WA 1WC4A 1NG9A 3JAMY 4JI2F 1BE4A 3ZT1A 1FKPB 3SLCA 5B8HA 2B4VA 1U8WA 1GT8A 3LWLA 4P10A 4CP5A 3DMJA 5DLFA 3MN9A 3NKYA 3NRBA 1VISA 3M2RA 4MIWA 2CJQA 4H4MB 1UWAA 1VK0A 4LRFA 2AKWB 2VYPA 2PYLA 4YP3A 4AD6A 1J9AA 4Y28C 1SV5A 5HATA 4J5OA 2Y9HA 2KVQE 4OX9F 4C4WA 2A2CA 4ZP7A 4DV5F 1NU0A 3T69A 3FLCO 4H4OB 4R0EA 4C98A 4WFYA 3VGLA 4BC9A 3M8SA 3UN2A 4L3NA 1VLYA 4WXOA 3GTYX 3J7ZO 5IT9Y 4QWDA 1YRXA 1U2RA 4XTTA 4IBNA 4BC7A 4YY3J 5EVZA 4O0NA 1U0HA 1B99A 4B1ZA 5GAGU 4M3RA 5DK5A 1RTDA 3QIPB 2ZNZA 3OXGA 1N34F 4C23A 3PACA 1FX2A 2A40A 3BR9A 3G9CA 4H0PA 3UCZP 5H9EK 2COLA 4F0MA 3KK3B 3K9JA 4L3KA 2W9BB 1UAXA 2WC9A 5AQMA 3QETA 4GV9A 1S57A 4XEIA 2FGCA 3PX6A 4J9MA 2ZKTA 4KHUA 1B0TA 1WF0A 3OYGA 2LCWA 3GYGA 3LP0A 3ZX0A 2XRIA 3L2VA 2P6TA 2ASYA 1X31C 3MZIA 4WF9Q 1YDLA 3C46A 3TZXA 3OXLA 2D0BA 1YIJN 4CDIA 4ZJQA 1X4BA 3DLGA 2EXUA 1PYOB 4CHNA 2W7AA 4CJQA 2LECA 1H1VA 2QYCA 4MFBA 3CJKA 4OJ3A 4IWVA 3HKZD 3TJ8A 2UUCJ 1IBMF 1YVUA 1FDDA 2WHOA 3D0IE 2ZH8A 4CEFA 4WKRA 1UEUA 3OTDA 1AUSL 1W9HA 4TQRA 5A8KB 3EGWB 2ZWHA 1R31A 5I3UB 4UT4A 3KUHA 3BDEA 5AZIB 2M7SA 3PJWA 3K0JA 3HFVA 4K8ZA 2G9OA 1TAQA 3AJDA 3SJJA 2B51A 3D1QA 5EWGA 2BJEA 1VBZA 5CZVA 4CHOA 4G9ZA 1HWIA 4ES3A 4DWIA 2F3JA 4ES1A 1JJ2M 2ILYA 2LXUA 2EG2A 1U2VB 3EUNA 4XH4A 1PBUA 2CJYB 4ECRA 1RAIB 5AQYA 5D0GA 3D3CJ 2CGJA 2LYVA 5L1JA 2CG4A 1GK8A 3VESA 2RPIA 4PKDB 4S0MA 2K06A 3MI7X 4DQSA 3F9KA 4P9SA 4ECTA 1VS3A 4OYMA 3DLLQ 3KMSA 3D9BA 3MECA 4BRPA 4DV7K 3GU0A 3MURP 4Q45A 4BRDA 2B4PA 3L3UA 1RT2B 4YOTA 5KT6A 2F1FA 3V4IA 3J7A1 1PSDA 2OJ3A 2DJWA 5A8WA 4PABA 2J6UA 3RMCA 2Y1LB 4EGLA 4CERA 3V1OA 5D3GA 1FWKA 4O3OA 1S72N 4ICLA 1PBAA 3FZHA 2CAJA 4RZRA 1R8PA 1MSWD 1Q78A 3ZSQA 1MA9B 2BH1A 1CEZA 4ECXA 3DGVA 1SB6A 4NLDA 4O3PA 3JXUA 4YFUA 3IMXA 1RABB 2IHR1 3WX8A 5HMZA 1TUYA 4Z4EA 4K59A 1NGAA 4BE0A 2HPUA 3AV9A 4K0KF 5EX0A 3NCIA 4JV0A 2CNKB 5FRNA 3GBTA 2V2VA 1KWMA 4H54A 5BN9A 1RYRA 3BREA 3M8YA 1AROP 3ENVA 4DBQA 3BS9A 4FYVB 1DQ9A 1YJ9S 5AQRA 5HL7L 2W7PA 2DHXA 1N52B 3U7JA 1ESVA 3BO4A 3G4SN 4RBUA 4PAAA 1HBUA 3POTB 1IKWB 5THWA 2R7RA 3D54A 5JVGL 3PYGA 1H2TZ 4DR3K 3Q8UA 2VG7A 3W9JA 3M9OB 5HJYA 1UA1A 1RGIA 2OMOA 5CYMA 3KLVA 3M05A 5HOOA 1OH8A 4ALZA 4B08A 5KPTA 4OHYA 2XNQA 1VQKN 2A3JA 3MCOA 2FHJA 3K57A 1YX2A 4HI1A 4IKFA 2P1JA 2HZVA 4BCAA 2E1CA 4DU4A 1HNWF 2NSBA 1NJWA 3OT9A 3EXCX 3MM8A 1G4CA 4FLXA 3CF5Q 2QTDA 5HSPA 4J9LA 2EFPA 1WHXA 3CCMS 2AU0A 4NEZA 1TFYA 1M1GA 4JP8A 3H1VX 2RQMA 4AXIA 2OPRA 3WEEA 4Y2CA 2V9WA 1XI1A 2D0PA 2BE2A 3T5JA 2H5IB 4BACA 1ZTTA 2YWGA 2B4JA 2CGKA 4LY7A 1IBKF 4JKEA 4KB0A 4OI2A 1HW8A 2HFVA 3IBWA 5HLFB 1SI9A 4HUEA 3SCKE 3EEQA 4IH5A 2Y0SD 3MTKA 2G4BA 2HIYA 3PR4A 2PMZD 2RHQB 4FYXB 3S1TA 2HBMA 4WIQA 3KLHA 2W01A 3DAWA 4LF9J 1A5VA 4GVBA 2XBPA 3EE8A 4BR9A 2CH6A 2VPXB 1LW0B 2QKBA 5M1FA 2I5JA 1JLQA 4R5PB 2DRAA 2PY5A 1UVNA 4P2XA 4C8ZA 2VQEF 3LDQA 4Q5VA 1Y97A 3DC2A 1NJXA 4CNYA 1X7VA 3MM5A 2Q3SA 3QQCD 3R1XA 2ZHBA 2AX0A 3FFIA 3FFKB 4JLHA 1DEJA 2GELA 3HHLC 4DUZJ 2PMHA 3QT7A 4RW8A 4R25A 5KRSA 1T6DA 5T14A 3CO0P 5SZTA 4WZQA 3CERA 4QS8A 3N01A 1YJWN 1YHQS 1RWOB 1DLOA 4ECYA 3CDAA 3KZBA 3P6YC 2WB4A 5FJ4A 3JTOA 1N36K 5AFUA 1K6YA 3KK2A 2W8LA 1NO8A 2WRMA 3P96A 4MIAA 3N4WA 4WBFA 3H5XA 3AD8C 4H0YB 2JC0A 1SAZA 4DR7J 3EVWA 1EX4A 2ALZA 2GW8A 1W2BM 5JUMA 4FLZA 4IG3A 3SQ1A 2P9LA 4O3RA 2F7VA 5F3TA 1K73O 2CVIA 4B9VA 5J2NB 1XNQJ 1NK5A 3U27A 3GJQB 1CLQA 3OFFA 5C0YA 4OYIA 1I94K 3LM2A 2F4VK 1KR4A 3D2EA 4CLUA 3AB2B 2RF2B 3CDEA 2FJXA 1WLJA 3QICA 1Q79A 4EWTA 2MQOA 1DHMA 4CGDA 1BOTO 2LU2A 4C48A 5JLHA 1H7WA 4O3NA 1S1TA 5C7PA 4NRUA 5DM6Q 1HI8A 2E20A 2UUWA 2ZBCA 4JV5J 5FRMA 2DNOA 2CNLB 2IVYA 3CD7A 3IS9B 2KT5A 2YNGA 3J80O 4ED2A 2OPPB 3C6HA 3PW2A 3VQDA 1YJNS 4DV2K 4B1VA 1LV5A 1E4FT 2YJFA 2X1BA 3PSIA 3P5JA 1MU2B 3VGMA 3DU6A 4WQ4C 1SKSA 2IIRA 1RWMB 2B9YA 2I7NA 1YAGA 1NKBA 1GLJO 4CHZA 2QV6A 2AYBA 2UV8A 2FBXA 3D2WA 2GX8A 1EWQA 4F50A 4PG8A 2KYXA 1N5TA 4PZVA 5BREA 2ETJA 4O5BA 1F9EB 4DF8A 2P9UB 3BGRB 3CC7S 4EO6A 2BJ8A 3ZXWA 3BSCA 3QWPA 1A9NB 2HFNA 2OSRA 1X9MA 2E9RX 2NRRA 1R3NA 4JI6K 2HLTA 4ZA1A 3HZEA 2H5JB 2UVWA 1R0AB 1SQKA 1TV6A 3MN6A 3HOTA 4OV1A 4QWAA 4MLEA 3QJPA 3CDUA 2PYJA 4JI4F 2C1EB 3L2RA 2X7IA 1X0PA 1KTQA 4OFZA 1UFWA 3H40A 1P8GA 3HHLB 1Q16B 2VPZB 3U4LA 3V81B 3PRVA 3QT5A 4DN0A 4FZYA 3OR2B 1IJFB 1FK9B 4B3RJ 3NS7B 4EYIB 3PO5A 1H7XA 4NYPA 5A8RB 3I5CA 4B3SJ 1PJ5A 5BJRA 4QS9A 3JSMB 1VBXA 2JL9A 2IVNA 2G8WA 1RTHB 4L8RB 3K5PA 2A6AA 4U67L 3FCHA 2ZJPL 2ASPA 3IG1A 1RU1A 1BHLA 4K2JA 2QWLA 2OLWA 3OTOK 4G1QB 3DU5A 3P45B 4CD1A 5CZXA 1XC9A 1Q7LB 1ZAXA 1UMJA 5GMEA 4J9QA 5GAEI 3ZX3A 3GE1A 4J90A 3AD7C 2V63A 1VBYA 1IG8A 3R7BB 3PY8A 4WJBA 3RVCA 2JGUA 1NK0A 4YHHK 3OW2R 3QDKA 4UOFA 1CZBA 4CFDA 2M3DA 1WNSA 2YHAA 3RMAA 3UVJA 1KAXA 4W5OA 3BZCA 4N41A 2FVRA 4P73A 4DN9A 3AVFA 3WUHA 3CCLN 2YNFA 3FZBA 4ZLJA 2XHBA 1HA1A 1EHWA 2JNJA 1I5OB 1Q9XA 4ZCLA 1S9GB 1Q82T 4MKYA 3Q0AA 3W7BA 2GHWA 4CLSA 1UW4A 1N5VA 4NLQA 1VQ6S 3RW7A 1HD0A 1WEXA 3EMTA 3OVSA 5EOYA 3MXJA 3EVOA 2DITA 3VHQA 2FLLA 1YBUA 2Z30B 1NU4A 1YTYA 1RKJA 1VQ5S 3FGUA 2A6MA 1C4AA 1JJCB 3SCIE 4LQ9A 4DSJA 3O3LA 2YNIA 1HBOB 1JLGA 1IBLK 4CECA 4QOZB 5LMNK 1R43A 4PEOA 1SJRA 2FBTA 3MCNA 4PWWA 4B3TK 3Q8SB 1VBKA 3VQ5A 4K25A 4OHZA 5M1KA 4OYWA 4PYAA 4YR0A 1I94F 3SDEB 2F4VF 2V69A 3SXLA 3BN7A 1LXNA 4DTSA 4U9RA 3FRZA 4WQ5C 4TY8A 3I33A 1KQKA 3GJRB 5F9LA 3JXOA 2CQ0A 1SL1A 2ZOGA 1CVJA 3JSYA 1YJRA 1UCNA 1IVZA 3P38A 3GIIA 4Z7YA 1NRKA 2GMLA 5ETPA 3DXSX 2NREA 1HKGA 1R7IA 3AVAA 1GMWA 2VV5A 5HRPA 5ADXA 2C42A 3WQUA 3F41A 3MR5A 4DV2F 3FGVA 4EZ9A 3CNQP 2BJ7A 1C1CB 2HYIB 1NMDA 1LOTB 3ENQA 3K8VA 1TKXA 3ULDA 1S49A 3MXHP 3PW4A 1Q7YT 2EK1A 2WB1D 2R7QA 2MLXA 2K7KA 1WC6A 2J9DA 1QAXA 3ICLA 5AQLA 2NLWA 5BRFA 2XZWA 1GMWD 3MR6A 3MGJA 1R0CB 1HD1A 2JVRA 2CWKA 4GVEA 4FPIA 4ELVA 1ZOTA 2O66A 1EIYB 3HFZB 2XYPB 5G0RA 3AARA 2EI5A 1NZ8A 4IQMA 2R7UA 5KFSA 3T1YF 2BXJA 2FXUA 4JB8B 4P7VA 3EZOA 4RW6B 1RDCA 4FM0A 1W25A 1D3WA 1OS5A 4FWNA 4Q0BB 2D1KA 4F0HA 2IA6A 3THXB 2BOAA 1VSKA 4QYRA 4EU0A 3H2UB 3SBTA 4JD2A 1LWEA 4A48A 2OELA 4DTJA 2FHOB 4HTLA 4FO0A 1NK8A 2MXYA 3BGFA 3CMQA 4BC5A 3QAEA 2C2MB 2ASDA 2VH7A 3QEIA 5KFFA 2PSZA 3OVBA 4AQYK 5HROA 4Y2KA 3O9UA 4CEAA 3L7UA 2U1AA 4WU2A 3A8YA 2XYHB 1EETA 3C14A 4CO5A 1HNIA 1NH7A 1WUUA 4FWOA 1GMVA 2HNDB 4C3LA 3ISNC 2V8VA 3M6XA 5F8NA 3KDNA 5AQTA 1T44A 2GCFA 3OTOF 2KFZA 2ZH4A 4ZHRA 4ID5B 1QJHA 2DPIA 5I42A 3MMJA 1NKCA 1TL1B 4JI1F 4F4XA 1X8DA 1YITS 1NGBA 3I0SB 4Y6IA 4DR6F 3AO5A 3CM6A 2HZAA 1REVA 1FXRA 4PCQA 4YHHF 2YWHA 3T1AA 2R2TA 5IWAF 3CCZA 4Z37A 2HOEA 4CJ5A 3Q8QB 4DV0J 4LSLB 1OH6A 4I6MB 4X66J 4FZXC 3M8QA 4BDZA 5LXRA 1V5VA 2HWTA 3ZT0A 1X4GA 1OY8A 2Y8YA 3DFEA 4E0DA 5RUBA 4JI5J 3KHRA 3B6BA 4O4GA 4OJRA 3C16A 3J81Y 1U24A 3L3VA 1YVNA 1WF1A 4OO1J 1CULA 4BY9C 5C25A 2YX4A 3T6JA 1BQMB 4BHQA 5F8LA 4F04B 1VSMA 4EYHB 2ASOA 3W5YA 4O44A 3EPIA 4P72A 4AUKA 3GIMA 4XPCA 3K2YA 4CLFA 1BUXA 1LWCA 4DTRA 4FPBA 4KHNA 5KFLA 3ATUA 4FLTA 3UI3A 1Q53A 1IBLF 3D6MB 3OYIA 1VQYA 1LWFA 1H38A 2UUAK 1TP7A 5LJ3Y 1Q8BA 4OX8A 5FPDA 2H5EA 2UXCF 4DV6K 3DOLA 4FL9A 4KGZB 1G6BA 2RU3A 1DTQA 2BUPA 1FJGK 2CFXA 4GMJB 4I6AA 1BA0A 3BV8A 3QINA 4B3OB 4NLUA 2VB6A 4OJHA 1OY9A 1S3XA 2O8FA 4CVNE 3QYYA 3SZ2A 3SFUA 3M2UB 3HJVA 3HOSA 1U1MA 3JB9k 3ITHB 1FWLA 3VERA 3MCMA 4DR2J 3A5LC 5GAEP 4HHTA 3KHGA 4BC4A 2EKYA 2CPHA 3D28A 5KG0A 2GNKA 1OJ4A 4CF9A 3J7YP 3NMRA 4GKKK 1VQLS 3GFXA 4FJ8A 3P4IA 1NJIT 4OI1A 3DGPB 3SMSA 3AA2A 3PDNA 1VSEA 4QQBA 4LF7K 4KR0B 1YJVA 2M5YA 2HHVA 4KTWA 1PC4A 1QY7A 3CG7A 4CJRA 2WW8A 1FESA 1FA0A 3NF9A 1WORA 3ETMA 3SUNA 3W2VA 1LAWA 2P9SA 4LRDA 4FJHA 2XCAA 2VG5A 3KWMA 1O1WA 5KFPA 3CJSA 3LANA 5JMNA 3EM1A 4DUYK 1HHSA 4RW9A 1H6KX 4LIWA 1HMVA 4HTJA 1OWXA 1SL0A 4CESA 1CS4B 3H1QA 5EX3A 2GFFA 2BACA 1JCEA 2PC6A 3V5RA 3ZZUA 3ONQA 2XG8A 4OZLA 4ZTJA 4CK2A 3VEXA 2P9KB 2C3UA 4KPYA 4FJIA 4QWCA 2KKZA 3TSUA 2UVRA 4ILRA 4AQYF 1C0MA 1FO1A 3F0NA 1F3FA 1R59O 1VDHA 1Q8IA 2IDLA 4DFMA 1U6ZA 1VI7A 4J2BA 1ZYQA 4J8FA 1RK8A 4FJKA 3M8PA 3OUYA 1UPMB 1S10A 1HR0K 5K8PA 2W9CB 4DFJA 4JI0J 2PE8A 5MAOA 1S9EB 3AHPA 3CMEN 2XULA 5F2RA 2O8BA 2O4GA 1FNXH 4DCHA 3AA4A 3QT6A 4OKKA 5J1EA 1T8EA 2DNZA 1LAVA 4WE1B 2YQ0A 3NF7A 1FEEA 4CYUB 1NMNA 3V6DA 1O13A 3TTDA 5DG8A 5AXMA 5M2PA 2Z2MA 1RAOA 4DR1J 1RT7B 3Q2SC 2KXHA 4JS4A 2NRVA 1B9DA 4MTPA 2CIMA 3KXDA 5KFOA 1F9FA 4OLBA 5DZ7A 4OX7A 2NZ4A 2P9NA 4DZ6A 1HBMA 1FKOB 5SWMA 2GJFA 3BQ0A 4BRQA 3B4MA 4H0OA 3IC1A 3AOAA 2DNYA 3KLGB 4GV6A 3OHAA 4MK9A 1DY3A 1OPIA 2KB2A 4YOVA 3MR2A 2NYIA 4N47A 1QAJA 5MLCV 1Z2ZA 4PXEA 3WHIA 3S3NA 3KYLA 2P9IB 1Y64A 2ZE2A 3I56S 4N7TA 4NCGB 3PYFA 2PIIA 2E88A 3CCUN 1UWBB 3U3GA 4K4UA 3J80U 2YBVA 5JMVA 2OTLS 1HIYA 2FTRA 1DT9A 3IRWP 1H3DA 2UUAF 1HX1A 3N5FA 5FROA 3MFIA 3S9HA 3JYTA 4BE2A 4DV6F 4Z4IA 3AODA 1XK8A 1NHKL 3S7RA 4JYAK 4E7LA 2ZM6J 1JLCA 1T3OA 3G6XA 4E7KA 4JI7F 3AAPA 2WVFA 3T6BA 3SBMA 2D69A 3VAHA 2C28A 2B56A 2EBGA 4F67A 3H4BA 3HM8A 2VFRA 5AQZA 3DOMB 5KT2A 4W90B 3PXGa 2QLFB 3H59A 1F5AA 4USUA 3VQCA 4LFBK 1FJCA 3GSIA 5LL6d 3QRPA 2QKKA 1HYSA 3U1NA 1UA0A 2FVPA 5ETQA 3NMAA 2FHKA 2DR6A 3LP2A 3VMFB 2FVSA 4DI6A 4P52A 2NNWA 1MROB 4ETXA 3FBBA 2Z57B 1NEEA 3MMAB 4Y2AA 5DETA 4IR1A 3P5TL 4LR9A 5KQDA 3VEYA 2BQUA 3GIKA 2E6LA 1DZ5A 3NCPA 2HS4A 4DTOA 3WQTA 1A7GE 1PJ6A 1RCOB 4NMLA 4JRPA 1Z05A 3M7VA 1ATRA 4LF8K 2DYAA 2ZUGA 3TAPA 2IAJA 4HVJA 4DUZF 2B9XA 3NY0A 3KNGA 4X65J 2GV1A 1K9MT 2CPZA 4BG8A 3EX7B 5EN1A 1RAFB 2N7YA 3M30B 8RUCA 4H0XB 1AT1B 2WBRA 3AVKA 4I2QB 2V7YA 4UY85 1KTVA 2M9KA 4DUYF 3BYPA 3EDRB 5L1LA 4B1YB 1KBRA 3KJFB 2W4CA 3HHNB 2AEJA 1WC5A 1HBNB 2G0IA 3OW2M 1E6VB 3Q23A 1RA7A 4A8WA 4IFVA 4GMKA 4A47A 5AE3A 1VQMN 3TANA 1C2PA 3C6UA 3GZ7A 4LF2A 1GLCG 4FKYA 3M8WA 1CC8A 1FJGJ 4EK2A 1FDAA 2YI1A 3TTFA 2D9PA 2V8GA 4DR7F 2XMKA 2I7PA 1FTCA 3GJTB 5CH7B 4B8CA 1J5OA 1FI4A 4NLCA 2WW4A 4IG0B 3C66A 1Y00A 3DYAB 4CTAA 3UKRB 4KHSA 2JJ4D 1XNQF 5KFKA 1HR0F 3UNGC 3AO1A 5HBMA 4GKJJ 3QFHA 4WYBA 2C2OB 1I3OB 3BO2A 2XQCA 4JI3K 2V7ZA 4NLVA 3A2FA 1CZAN 4DPTA 2B8PA 4CLPA 1GFWB 2MSSA 4ISGA 1GTHA 2HNZB 4PWDA 4GRSA 5LSOA 1JLEB 3ZC4A 1J5EK 2BQRA 4R8UA 2LQBA 1WSRA 3VCDA 4EBDA 3C7NB 1YWXA 3MMBA 1NGIA 3DRRB 1T7PA 4YDUC 1DJ0A 4FWSA 5EUHA 2XO7A 3M2VA 3TEHB 3FSYA 3EKSA 3A1YG 4USIA 1C0UB 2VHGA 1R0BG 1DQAA 5KFMA 1HQUA 2HVEA 2XB2D 3AGKA 4WFNQ 1N0VC 5B0GA 3CJ9A 3WDOA 3NF8A 4K4ZA 5DM7Q 4KKOA 2CPYA 4U8YA 1RFQA 2K7JA 2QMWA 1UVKA 1NGHA 4JV1A 2ROGA 4NA3A 1FX4A 3IRXA 2MY8A 3LM9A 4PA1A 5D8HB 2JLGA 5BRDA 2HK3A 2V8PA 2GZOA 3VGVA 4E98A 2W41A 3HF5A 5GAGP 1WEYA 3OPKA 3ZEUB 4QIGA 2CH5A 1Y7PA 2AJQA 1U02A 3TZYA 3EICA 2QM1A 1LFWA 3L09A 5C15A 3CJ8A 3DJCA 4XAKA 2CPEA 4HACA 2P5OA 2LVWA 3QJLA 5KOXA 3M1VB 3M6GA 2E1RA 4RW4A 3R1LA 4DHYA 3IA0A 1ICEB 2AA4A 3W8GA 4DCJB 5C24A 3OLBA 1SL2A 4JYAF 1JMTA 2DD8S 3D2FB 3NH2A 2B5JA 4FWQA 4ZCKA 2KJWA 4W5NA 3FFIB 1MWYA 4DV1K 4X2BA 1ZTWA 2P6SA 4F3MA 1B3TA 4W5TA 3CJQA 4PXBA 4B3RF 4M1KA 4Y1DA 4B3SF 1FKPA 1C1AA 2G8HA 4CIGA 3PHTA 3HRGA 1YF5L 2NUHA 1S77D 3RTVA 1TYQB 3RMDA 4KC5A 3HCXA 3D1HA 4H4MA 3RRGA 2PD1A 4ZVHA 4K42A 3DI6B 4OQJA 3P31A 4OV6A 4DU3A 1RADB 3KVGA 3QO9B 3FZ2A 4JRQA 1AZSB 1TELA 3C94A 2MQ8A 1KC8T 4LRCA 3HD1A 3MF5A 4TY9A 1YKWA 3Q8YA 2LP4A 5AZJB 3AO2A 3BSOA 3CIMA 4H4OA 1JIHA 4K4SA 2W9AA 4B3MJ 4LF8F 5ETKA 2UZAA 4FF3A 3L3CA 3V1QA 2VASA 4V1Ak 1TL5A 1VHFA 2LQ8A 4NI2B 4YORA 1WKKA 2UU9J 3L8BA 1RWKB 2DHGA 4P74A 3QIPA 1RAEB 3EN9A 2F9JA 1CLFA 3DHWC 1XWLA 4BE1A 2HFZA 4IOCL 2BDPA 1YT3A 1HHTP 3CC2S 3D6HB 4EO8A 3KK3A 2F9DA 3GIJA 1ZBFA 2W9BA 5KG6A 2V2KA 2F40A 3RG6A 3GJSB 4CJLA 2D41A 3B8AX 2CYYA 3NVKA 2A2DA 3CUNA 4UY8T 4OI0A 1VQ4N 2WOMB 4DX7A 1IM6A 4ID8A 3PKMA 5BYSA 1N5QA 3NF6A 4O3SA