4I2PA

Crystal structure of hiv-1 reverse transcriptase in complex with rilpivirine (tmc278) based analogue
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
554
structure length
554
Chain Sequence
b'MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A comparison of the ability of rilpivirine (TMC278) and selected analogues to inhibit clinically relevant HIV-1 reverse transcriptase mutants.
pubmed doi rcsb
molecule keywords Gag-Pol polyprotein
source organism Human immunodeficiency virus type 1 bh10
molecule tags Hydrolase, transferase/inhibitor
total genus 155
structure length 554
sequence length 554
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4i2pA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4i2pA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4i2pA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4i2pA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4i2pA05
4N5SA 3ITHB 3BQ1A 2HNYB 3I5AA 1TVRB 1RA7A 3S3OA 2UUWA 5KFOA 2VG5B 1XR7A 1D9DA 3JSMA 4O0JA 1J5OB 2OA8A 5DQHA 2E9TA 4QWAA 3RMCA 2HWIA 4FK2A 1UWBB 5DQGA 1VRTB 3QYYA 2B5JB 5HBMA 1RTDB 2BRKA 2X6SA 3NDKA 3DLGA 2QV6A 3ZSQA 3KLEA 2IS3A 3TAQA 4LSLA 1SUQB 2JC0A 4KHSA 1J53A 3GILA 3KLIB 5KTQA 4BDZA 1KLMA 4KHNA 1WLJA 3GYNA 2G8FA 2C28A 4GC7A 4R5PB 4LSNB 4CFBA 3VQDA 2ZE2A 3BGRA 1S6PB 1GX5A 4K4UA 1U48A 4EP5A 4TQRA 4EBCA 3AVCA 4CGHA 4CHYA 4EZ6A 1U04A 4R8UB 2IBKA 2O4IA 3RRHA 4ICLA 1WNEA 4B3OA 2AU0A 3DOLB 1S10A 1JLGB 3AVMA 3HVRA 1RDRA 1BQNB 2R8JA 2KZZA 1ZTTA 4B9VA 3SI8A 3VQPA 3PVXA 1QAIA 2GIQA 2QE5A 3CDUA 5I42B 1TL1B 4CK3A 2XC9A 4JS5A 3L8BA 4ZVGA 4E19A 4IH6A 2G8KA 3OL9A 1JLQA 2JEGA 4J9LA 1BQMA 1LAVA 3HP9A 2O5DA 2HAIA 4CK2A 5KFPA 3OYDA 4PY5A 1B9FA 1RBRA 3G6VA 1O1WA 4OJRA 4LD0A 3HK2A 4BWMA 2JGUA 3V9WA 4CE9A 4F4WA 3M9MB 3IRXA 4JV1A 2DPJA 1CZBA 3SI6A 1XI1A 4DL5A 2W8LA 3DRPA 2IMWP 3NGDA 2Z1JA 3IS9B 1Z4UA 1IKWB 4O44B 1U49A 4O3RA 5DK5A 4RW7B 1W25A 4FLTA 3LALA 4F3TA 1RCHA 3HVAA 4YQWA 4B9TA 3KLHB 3SPZA 1GOAA 2G8UA 1DTQB 3DYAA 3QLHA 1QQCA 2RKIA 3UQSA 2XY6A 3AO5A 5KT6A 3OLBA 3KMSA 1RT2A 5F8MA 1DTTA 3RTVA 1N6QA 3SUNA 1TKZB 1HQUA 2J6UA 3T3FA 4XIUA 4DL7A 2W9CA 1JL2A 2E9RX 3DOKB 2IAJB 4DLGA 4YMEA 3GV7B 4KB1A 3SPYA 4Y34A 1BI4B 3IN5A 5KG5A 4CJLA 4C8LA 5KFAA 4H4MB 3PHEA 5J2MB 1RDCA 5KG1A 3HSTB 2X78A 4N47A 3PJWA 4O55A 3KK2A 3CDEA 3O4QA 1Q9XA 4MQ3A 5DG9A 4LSLB 4WE1A 3HYFA 1C1CB 5KG6A 4ED1A 3BSNA 3V81A 1RT6A 4IFVB 1N5YB 4CJRA 1J9AA 4BE2A 1C0MA 1SKSA 1LWEB 3BSOA 3I0RB 4KTZA 2QKBA 1C0TA 4FJGA 1S1VA 1T8EA 5FRNA 4FJ5A 3DLRA 1SV5B 4EO8A 3ZT2A 3DMJA 4MH8A 1K6YA 4DS4A 3VQAA 4QWEA 1VSJA 1JLFA 3Q8QB 2V0NA 4E89A 2FBTA 1VRUA 1NHUA 3KTQA 3KK1B 5L1IA 1SH3A 1N56A 1BCOA 3OVNA 3KK3A 2V9WA 4QPXA 1ZBIA 5F8JA 5HP1A 3F73A 4B3OB 4KBIA 1HYSB 3FFIA 4OVLA 1Q9YA 5JS2A 3TABA 5L1LA 3VQ9A 2IOCA 3B6PA 2PY5A 2YNIB 2E6MA 1JXBA 4O0IA 4FJLA 2GC8A 2BANA 5HROB 1BIZA 1BISA 3FQLA 3C6TB 4CIFA 4ECQA 3H59A 3L2QA 1S1TA 2XI2A 2O4GA 1SL2A 1UAXA 3IRXB 1BL3A 1XHZA 3QETA 4ZMMA 4ZPDA 3DRPB 3L3UA 3FDSA 2WONA 2D5RA 2OYQA 4NLQA 3RMBA 4CEZA 4JS4A 5KFDA 1SH2A 3U6FA 4W5RA 3OHBA 1MU2B 4CCHA 2ZD1A 1JX4A 3JYTA 4F8RA 2D3ZA 3QZ8A 1LW2B 2R2TA 2XGPA 2XRIA 3SFGA 5EUHA 2P51A 3PUFA 3NHGA 4CHOA 1WAJA 4DTUA 3AVLA 4CJKA 4JRPA 5KRTA 4KHWA 3ICLA 4DWIA 5KFNA 1RT7A 4O4GB 4F4ZA 3SUQA 1S0OA 3RB0A 3LWMA 5KG3A 2W9CB 2KTQA 2DPIA 1C0UA 5HRPA 5KFEA 2AGOA 5EWFA 2CKWA 1FKPA 2IC3A 4NZ0A 3KNAA 5L1KA 4MFBA 3M8QB 3M8SA 4IR9A 3HT3A 3KMQA 3IGNA 2FLLA 4CF9A 2HW3A 3MEDA 4RNOA 4EYIB 1WSFA 3OS0A 2XCPA 1FKOB 4ECRA 4WYLA 4Z4CA 1X9MA 1RT3B 4AHRA 4FJJA 1WSIA 4CECA 1U4BA 3TAMA 2WTFA 1RYSA 3NAEA 4RW9B 3EZ5A 3ZSZA 1S1XB 4NLOA 1JLCA 3CFPA 2HHQA 4NCGB 3KLGA 2YNHA 1CLQA 2KW4A 3VA3A 4KFBB 3OYEA 1JLFB 4JUZA 4RW4B 4Y2CA 3QERA 2EHGA 2FBVA 1RTJA 4ZTJA 1S1WA 5EU7A 3SV3A 4Y1CA 3O3GA 2Q3SA 3K58A 1EP4A 1SL0A 3RAQA 4IG3B 1IM4A 3FFIB 2IM3A 3UIQA 2KFNA 4F50A 3K5MA 4I7FA 3MECA 4XO0A 3H2LA 4LH5A 2C2DA 4IFYA 4NLWA 3H5YA 3PX0A 3MEGA 5I3UB 1YTUA 4OKJA 3ITHA 3QIDA 1KVCA 3BJYA 2HNZA 2HNYA 2R8KA 1TVRA 3AA4A 1U45A 3G0ZA 4K8XA 4NLVA 3ZSOA 1XWLA 2VG6B 2C2EA 4M3XA 3K2PA 1J5OA 4E7JA 4E7IA 3OYCA 4YR2A 3OLAA 3V9XA 1S1TB 2VG7A 2CJQA 1NOYA 1UWBA 1U47A 3RAXA 1VRTA 2B5JA 1RTDA 5CZ2A 2ZKUA 3AVGA 3CQ8A 2IJNA 4B9MA 4MK7A 4Y2AA 1ZBHA 3PR4A 4HYKA 1SUQA 4E0DA 3O3HA 3DI6B 2C2RA 4N76A 2I1RA 3LP1B 1HQEB 3KLIA 4QWCA 3WNHA 4KV8B 3P1GA 4ECZA 3QEVA 1ASVA 3AO2A 2E4LA 2Z1GA 1S9FA 1KSPA 4IQXA 3QZ7A 4CEBA 3QGIA 1HYZA 4IBNA 3C6UA 1S6PA 2XGQA 4NYZA 4J9PA 2G8HA 2EX3A 3KD1E 4DL2A 3T5JA 3DRRB 3PJXA 4R8UA 4CIGA 3RR8A 3Q8SB 2R8IA 4DQPA 2HHTA 3ZT4A 1ZBUA 3ZSYA 1IH7A 1HPZB 1BQNA 3RB4A 3OYMA 1FKPB 5KFYA 1NKCA 1RTHB 4E7LA 1TL1A 5CY4A 1Z26A 1LWFB 3LPTA 4YNQA 4CFCA 2VWJA 1EETB 4EEYA 4IR1A 3NGIA 1HYVA 3LAMA 3PW0A 4I9QA 1JIHA 4CESA 3KLGB 4J2BA 2E6LA 4ZPAA 3FQKA 3P83D 3VQ5A 3H5XA 2OPSB 3IS9A 1RTJB 4B9NA 1IKWA 4O44A 1DLOB 3VQ4A 4RW7A 2HNDB 3KOAA 1L3TA 2WRMA 2IM1A 4QW9A 1NJYA 3PW4A 2W42A 1DTQA 1IKVB 3HHKA 4CF1A 4DQRA 3T5HA 4F4KA 5HLFB 1K1SA 5KG2A 4IFYB 4FLUA 3MTKA 3NH1A 2YKMB 2IJFA 5JUMA 4KREA 3VQEA 1TKZA 4ZVHA 1RBSA 2HNZB 1RT5B 3QIOA 1Y97A 4K4XA 3CFRA 3SV4A 3DOKA 2IAJA 3AVIA 3HVTA 1BI4A 2UVRA 3VQBA 1ZBLA 4W5OA 2AX0A 2VG7B 2A1SA 4KO0A 1NK9A 2BR0A 3OHAA 4H4MA 1S9EB 5J2MA 3IGVA 4AHCA 3H98A 1KHVA 2ETJA 1JXLA 3NMAA 4FK4A 5J2QA 1REVB 4RW6A 5KT3A 4MIBA 2BQ3A 1C1CA 4PQUB 4EBDA 4IFVA 1N5YA 1LWEA 4Y1DA 2GV9A 4DTXA 4MIAA 1XC9A 5FDLB 3I0RA 2WHOA 5F8HA 1NKEA 3L2WA 3HVWA 4C8OA 2BGGA 1SV5A 5SWMA 1KLNA 3C95A 2RDJA 3Q8PB 5F8IA 5CYMA 4FLYA 3TAFA 3HXMA 3C6UB 4YP3A 3HO1A 5EWEA 2B6AA 5KFQA 4FZZA 3KK1A 3RWUA 1S5JA 1NK5A 3KHLA 3I5CA 3NL0A 4NLPA 4Q0BB 3Q8RB 1HYSA 3D5MA 3OSNA 4AILC 4PA1A 4TY8B 1BIUA 4IKFA 3FSIA 4C8MA 3LANA 4CEOA 5CZ1A 4MK8A 2JLEA 2R8HA 4H54A 3TVKA 3SJJA 4MK9A 2YNIA 5KFZA 4FJMA 3NCIA 4KHUA 4DQSA 2JEJA 1CZ9A 5HROA 3PZPA 4ZTFA 4DL6A 4KTQA 4JV2A 3H5UA 3DLHA 1QAJA 3C6TA 1F21A 3TARA 3AVFA 3IG1B 3SUPA 4W5QA 4ECWA 4CEFA 1VSLA 4X2BA 4K8ZA 4G1QB 1T3NA 4DFKA 4TYBA 2GBZA 4FZYA 4EYHB 2ASLA 4CF0A 1KRPA 1HJRA 3ZT3A 4AHVA 1MU2A 3CJ2A 5DLFA 3SQ2A 2HHSA 1XR6A 1Z25A 3OYNA 1LW2A 2X6NA 2IM2A 1S6QB 1RT4B 5CYQB 5C24B 4I2PA 3ISND 1X9WA 3TAEA 4O4GA 4OKEA 3OSPA 4CEQA 3QESA 3OYJA 4M3YA 1KVAA 3KKRA 1RDDA 3RMAA 4WYWA 3CDWA 2ZQBA 3HVTB 4AHTA 4K4VA 2OPPB 4FJNA 3LP0B 1NK7A 4KO0B 4ECTA 3QGGA 4FLZA 3M8QA 5KGXA 5K14A 5J2QB 3SUOA 4RW6B 4GVMA 4CJWA 1FKOA 3T5LA 1RT3A 3AO1A 4ZVFA 1VSEA 3BDPA 4TXSA 4OPKA 3ZT1A 4Q5VA 4DTMA 3H4BA 2ASJA 2FJXA 4RW9A 3AO3A 4RNNA 1S1XA 1TAQA 3SYZA 4NCGA 2HMIB 3I8DA 4AH9A 4ID5A 4Z4GA 4I2QB 4KKOB 5CYMB 4FVMA 2QXFA 3V6JA 4KTWA 4KFBA 2A1RA 5L1JA 3KKSA 4RW4A 4NLDA 2B6AB 4ECSA 2AWZA 1IKXB 3MXJA 3WNGA 4FZXC 4ED8A 4HTUA 2YHAA 4KAZA 2R2SA 1D8YA 2XY7A 4IG3A 5KFHA 4YR0A 2EC0A 4J9OA 4BDYA 4CIEA 3SQ0A 3G6YA 5C5JA 1K1QA 4JLHA 2W9BA 3BQ2A 4GMJB 3L2UA 3NF9A 4CEDA 3QNNA 5I3UA 1RT1B 2ASDA 4M3ZA 1TV6B 4IG0B 3O3FA 4M3UA 5KFLA 2VG6A 4RNFA 2FVPA 2HHUA 4CF8A 1TL3B 2IGIA 4I9LA 3CJ5A 1RBTA 4DSEA 1ZTWA 2WOMB 4O5BA 4NLSA 3RBDA 3D45A 1L3SA 3GV8B 3EPGA 4FW1A 2WK4A 1L3UA 2BDPA 3DI6A 1BGXT 1RBVA 4ED2A 4Q44A 3ISNC 1T03B 3LP1A 1HQEA 4RUCA 2Z1IA 4ED3A 2D0AA 4C8NA 4KV8A 4B9UA 1A5XA 2FLPA 4NLUA 2Z1HA 4M95A 4IKAA 2XY5A 3TWHA 3K59A 3CJ4A 3V6DB 4I2PB 4ZP8A 3CG7A 1LW0A 1TKXB 3NKYA 4QW8A 1IG9A 4DU3A 1WAFA 5T7BA 4NYFA 1ASWA 3DRRA 3L2RA 1SKRA 1JXEA 2W7OA 4E7KA 4DL3A 5F8LA 4W5TA 1HPZA 5J1EB 2FVSA 5KFWA 1I6JA 4DSFA 3MR2A 4FBUA 4B08A 1TKTB 4HHTA 2VWKA 4FJIA 3VA0A 1CXUA 1RTHA 4TYAA 4QAGA 4DSJA 1RBUA 5K14B 1KVBA 2RF2B 4PWDB 3SNNA 4J9SA 1LWFA 1D5AA 1WN7A 1QUVA 1S0MA 4NLYA 1EETA 4WZQA 5JXSA 2GIRA 3OL8A 4CGJA 4K4YA 4URQU 5KFRA 4ID5B 1RDAA 4QCLA 2AQ4A 1D0EA 1ASUA 2D41A 2OPSA 1IO2A 3V1OA 4IRKA 4U6PA 1DLOA 4TY9A 3N6NA 2HNDA 3KLFB 3RRGA 4QOZB 4CFAA 1D9FA 4ZPBA 1VSKA 1LV5A 3M8PB 5DGAA 2VA3A 1IKVA 3DRSB 5KFKA 4DFPA 1FK9B 1C1BB 3MFHA 3CWJA 2YV0X 4CHPA 4R0EA 5HLFA 1HNVB 1A5WA 4DTJA 4DSKA 2W9BB 2YKMA 3OL7A 2W9AA 1GOCA 3ZSWA 1VSFA 4KSEB 4KPYA 1CSJA 5EWGA 1ZYQA 5C42A 1RT5A 4RW8A 1HRHA 4DG1B 2XI3A 4KB0A 1SKWA 4O3PA 3EZUA 4ECUA 2PYLA 5KFCA 4OLAA 2YKNB 2UVWA 1X1PA 4FLVA 4LH4A 4O3OA 1S9EA 2F8EX 4WXWA 5F8NA 4N56A 2UVUA 4CGIA 1REVA 1RNHA 1X9SA 4FS1A 3C94A 3M9OB 4PQUA 4FCYA 1RTIB 2QKKA 3QO9B 4JV0A 3RR7A 2OPRA 1VK0A 4MKAA 4TN2A 5FDLA 3H40A 2XCAA 1NK4A 4DTNA 4UQGA 3VQ8A 4H8KA 4M3RA 1XHXA 1HARA 4DQQA 3SFUA 3V9SA 1LW0B 3HP6A 2P1JA 1QS4A 3OY9A 3KD5E 1QHTA 2G8IA 2JEIA 2RDIA 3PY8A 3G86A 3QIPB 4Q0BA 4FJ9A 4E7HA 1J54A 4ELTA 4TY8A 5FRMA 3NAIA 4FLWA 1WNSA 5DGBA 3NAHA 1SL1A 4DF8A 4WFYA 4ZP7A 3V9UA 2ILZA 1L5UA 1QE1B 4O3NA 2OH2A 3LP2B 3S3NA 3SCXA 1UA0A 5J2PA 3QEPA 4Q8EA 3ZT0A 3H4DA 3BREA 1RAJA 2OPQB 2UVVA 3NF8A 3F9KA 3KHRA 1WSGA 2YHBA 4ZP9A 4J2EA 5EDWA 3ZSVA 3NFAA 3IG1A 3K5OA 4M41A 5KI6A 4DTRA 3LP3A 3M8RA 2R7YA 3VQQA 4G1QA 3DM2B 3AV9A 5D3GB 4QWDA 3HPGA 3H5SA 1NK6A 3QNOA 1C1AA 3PW2A 3K57A 4NRUA 3I0SB 3OYGA 4H4OB 4J2AA 4RG8A 1JLAB 1JLBB 1S6QA 2XY8A 1RT4A 4MKBA 3AVNA 5CYQA 4FS2A 5C24A 1C6VA 2KFZA 1WSHA 3NBPB 1KFDA 5DG8A 4CJQA 3LZIA 1S1UA 5C42B 4JRQA 4ED7A 4RW8B 1UOCA 3GIIA 3OS2A 1KFSA 1TGOA 1YVFA 5KFVA 5J2NB 2YNGB 2OPPA 1JL1A 3LP0A 4PUOB 4ZHRB 4GW6A 4WFZA 2OZMA 3ZSRA 2AX1A 3I5BA 3KHGA 4EP4A 4K50A 2HHXA 4DU1A 5T14A 4NRTA 1HMVB 3DLKB 1JLEB 3NGZA 3SQ1A 5KG4A 3GIJA 2OPRB 3LWLA 1RDBA 4Q45A 4BACA 1GX6A 2HMIA 1OS5A 4I2QA 4KKOA 4L8RB 2D7SA 4U7CA 3MEEB 4WZMA 1IKYB 3OJSA 1T7PA 1T05B 1NJZA 4E1MA 1IKXA 3DLEA 2W7PA 3TR8A 2F8TA 3MR3A 4IRCA 2BRLA 3T19A 4B8AB 4URSA 3GQCA 1TQLA 2VA2A 3MR5A 4RZRA 3ASMA 5KT5A 4EZ9A 4IH7A 2J6TA 1S0NA 2P5OA 3BSCA 3U3GA 2BE2B 4ECYA 3E01B 2XHBA 1SH0A 4RNHA 1RT1A 5J2PB 5KT2A 1TV6A 4M3TA 4CERA 4NLXA 4IG0A 4FJKA 5KT4A 4XPCA 1YVUA 5E41A 3RB3A 4OLBA 3NF6A 1TL3A 5KGWA 2WCXA 4N41A 1L3VA 1HNIA 5KFIA 2WOMA 3B6OA 3CYMA 1R0AB 4CJFA 1N48A 3RMDA 4XPEA 1CXQA 3OYIA 3LPUA 1EXQA 2XO7A 3V4IB 3HPOA 3ZSXA 3QINA 2RN2A 4DTOA 4J9KA 3MXMA 3KJVB 4KHQA 1RYRA 1T03A 4GC6A 3K5NA 3G6XA 4B8CA 3GIMA 4FBTA 3HL8A 3QEIA 4HCBA 4CGGA 3V6DA 2FVCA 3CVKA 4CJPA 1TKXA 4DTSA 4ED0A 4FK0A 3OL6A 1S1UB 1XR5A 3IAYA 2P5GA 5KFSA 1NNDA 1ITGA 1VSHA 2B4JA 3NF7A 2HHWA 5J1EA 1ZBFA 4CGDA 2HVIA 1LWCA 4IH5A 1N4LA 5DG7A 3UPFA 1TKTA 2Y1JA 2DFEA 4OGEA 4ELUA 2R2UA 4J9MA 3V6HA 1KTQA 3ZCMA 2FC0A 2RF2A 4K4TA 4PWDA 3AVAA 3JSMB 1TK5A 2DY4A 4HUEA 3GV5B 4FLXA 2AJQA 4ECXA 4ELVA 2X74A 4FXDA 3LZJA 2DFFA 5HBMB 4BDPA 4HVJA 3DLGB 3VQ7A 4C8KA 3KLEB 3OJUA 3FRZA 3BR9A 4IDKA 4CJ5A 3HPHA 4LQ3A 5KFBA 4DL4A 3TI0A 1NJXA 1BHLA 2KQ2A 3DLEB 5JS1A 1KLMB 1NHVA 3AVKA 3AO4A 4FW2A 3KLFA 4CJ3A 2YNFA 4J2DA 3M8PA 2V4RA 1A5VA 4CJUA 4Y3CA 3DRSA 4TLRA 3QEWA 1FK9A 1C1BA 2AGQA 3MF5A 4HUFA 2ZE2B 1I39A 4DTPA 3MXIA 3BGRB 1HNVA 3PV8A 4M42A 3T1AA 4F2SA 3H08A 1S97A 3CFOA 3AA2A 1NKBA 4ICLB 3DDKA 4KHRA 5DLGA 3BQ0A 2KZMA 4NLRA 3OYBA 4DG1A 4LQ9A 3THVA 2W8KA 3DLBA 3SQ4A 2JC1A 2XWYA 2HB5A 2YKNA 4FYDA 1UA1A 4HCCA 2FLNA 2HVHA 4KB7A 3OYAA 3TAGA 1HNIB 1VSDA 3S9HA 1S48A 4AHUA 3NE6A 1NOZA 1KCFA 1JLQB 1BQMB 1YT3A 4F2RA 4M94A 4Z0UA 1RTIA 4ID1A 4Z4EA 3QGHA 3QO9A 3ULDA 2ALZA 4BE1A 5L9XA 4CJTA 3OS1A 2C22A 4CEAA 4NYNA 1ZETA 3HJFA 3N6LA 3S3MA 2FBXA 3D28A 2NUBA 3P5JA 4RUAA 4FM1A 4DS5A 3ALYA 1S4FA 3PX6A 2E9ZA 4DEZA 4LY7A 4FM0A 5KG0A 1EX4A 2QK9A 4J9NA 3TQ1A 5DMRA 4E3SA 5SZTA 2HHVA 3QIPA 1S9GA 4FJHA 4RNMA 4CJEA 3OYHA 3DYAB 5F9NA 4DF4A 4B9SA 3QLHB 3PW7A 3OYFA 3LDSA 2RKIB 5KFFA 3CM6A 1YTAA 3E51A 2BQUA 4BWJA 1RT2B 3TAPA 1DTTB 1N6QB 4F4XA 1LWCB 4CJVA 1QE1A 1HQUB 3LP2A 2FVQA 4NCAA 3BSAA 3NH0A 1QSLA 2FJWA 2IM0A 1I3AA 4G3IA 4CEEA 4FJ8A 1Q8IA 5KFJA 3A2FA 3LAKA 1JKHA 3CIZA 2OPQA 3V1QA 4Z4HA 4TSXA 2G8VA 4ZPCA 4YFUA 2AGPA 4FJ7A 4CHZA 4DFMA 3PX4A 4DSIA 1BCMA 1WSEA 3AA5X 1TAUA 2BQRA 2FBYA 3VQSA 2J6SA 1WSJA 5F9LA 3WNFA 2I5JA 1GOBA 1U09A 4ED6A 3KK2B 3V6KA 3V9ZA 1W0HA 4CHQA 5KRSA 4IDKB 4WE1B 3DM2A 1C2PA 2R8GA 3V81B 2IDOA 5D3GA 2UUTA 1RT6B 2WB4A 5F8GA 4IOBA 4EO6A 3MAQA 1C0TB 2PZSA 1S1VB 4K4WA 3I0SA 2YNFB 3HKWA 4H4OA 2FJVA 3DMJB 3OYKA 1JLAA 2ATQA 5KFXA 5HRSA 4DFJA 2D3UA 1JLBA 1RA6A 1S49A 1VSMA 1VRUB 4WFXA 4Q8FA 4K4SA 5DQIA 3NBPA 3KK3B 2B43A 4DQIA 3CO9A 5HP1B 3UR0A 4F3OA 4WXOA 2IA6A 1VSIA 2F96A 4M3WA 4KE5A 3NGYA 5C25A 3UDLA 3AVBA 3PO4A 1NK8A 1B92A 3VN5A 2ATLA 5J2NA 3AVHA 2YNGA 2GUIA 4ZP6A 4PUOA 2HWHA 5KFUA 4ZHRA 5KG7A 2R2RA 3KLVA 4TQSA 1KHWA 4OKKA 4E1NA 4K4ZA 4HUGA 2DTUA 2BANB 2VG5A 1G15A 4ZVEA 3VQCA 2ILYA 4J9QA 4BE0A 4ECVA 1HMVA 3QEXA 1W9HA 1D1UA 3DLKA 1JLEA 3RB6A 4OPJA 1TKDA 1NK0A 3O4NA 3K5LA 3NH2A 4CHNA 1QTMA 4AHSA 1RILA 3M9NB 2WONB 1TP7A 5KFMA 4DMNA 3MEEA 4EBEA 2F8SA 5KFTA 2G8WA 1LAWA 2ITGA 3G10A 4KHMA 1IKYA 3OYLA 1T05A 2PYJA 2D0CA 3SZ2A 4Z4IA 2ZD1B 3VQ6A 3EPIA 3JYTB 1S9GB 1T94A 3T5KA 1MMLA 4R5PA 4LSNA 2JEFA 5HRNA 1NJWA 1TK0A 4NCBA 3CM5A 3KIOA 2BE2A 5KT7A 1RT7B 3E01A 4NLTA 4DSLA 1C0UB 3MFIA 2FVRA 4CGFA 3KHHA 3DOLA 3PW5A 1JKHB 4Z4FA 1JLGA 3TANA 1EKEA 4KI4A 4FJXA 3AA3A 4Q43A 3PR5B 2IC3B 3RBEA 3L2VA 5KFGA 4MFBB 5I42A 4O3QA 1B9DA 4O4RA 2I5JB 4O3SA 1R0AA 3CJ3A 5HRRA 3MEDB 2LSNA 4YR3A 3V1RA 2D0BA 4KAIA 3L3VA 1FXXA 1QSSA 4OL8A 3HM9A 4J9RA 4CK1A 3V4IA 4M45A 3TAMB 3KJVA 2Y1IA 4HKQA 4DLEA 4RU9A 3EY1A 4IRDA 1JLCB 2OZSA 4CFDA 3GIKA 2YNHB 4KHYA 5FROA 2V4QA 1S1WB 4F4YA 4CF2A 4NLGA 4URGA 4QWBA 4B9LA 3WNEA 4W5NA 1EP4B 4FM2A 3KLHA 3N6MA 4OGCA 1QSYA 5C25B 3AVJA 1TK8A 3MECB 4I7FB 3D0PA 3PO5A 3EYZA 4KI6A 4CJSA 3CJ0A 4DU4A 3MR6A 4CJ4A 2RPIA 3MEGB 3U3YA 4KRFA 2DFHA
chains in the Genus database with same CATH superfamily
1HBUB 3ITHB 2B9WA 2D4WA 1XR7A 3AAWB 1D9DA 3JSMA 4KHPF 4OZNA 2OMOA 3FFKB 1JJ2R 3HHDA 3BH7B 2OA8A 5DS7A 3FEXB 2E9TA 2GEMA 1UWBB 4AE5A 4ZCIA 3DLGA 2QV6A 1X0PA 1FNMA 2ATCB 4WU2A 3TAQA 3UKRB 4LSLA 4NA1A 4JI1F 2R7UA 2JC0A 3MDFA 3QAEA 2DY1A 1K44A 1ZH5A 2G8FA 3CD0A 5FPMA 1RWMB 2CH6A 2ZE2A 3BGRA 1S6PB 2QC3A 1U48A 4USVA 4EP5A 4EBCA 2EFNA 4ICLA 4B3OA 1NSKL 3DOLB 2G13A 1S10A 2CXEA 2R8JA 2YJFA 2R9LA 3NEKA 1B0TA 2QWMA 2A3JA 3LM9A 3SI8A 3VQPA 1OH5A 2QE5A 3HFZB 4ZCLA 3CULA 3VHQA 4M5DB 3O1BA 3UB5A 3AB4B 3VAJA 1T9WA 4UUWA 4ZVQB 4CK2A 3OYDA 4PY5A 1B9FA 1RBRA 2AW0A 4CLTA 4AD6A 4F4WA 3CMES 2DPJA 2V8GA 1WKLA 4DL5A 3QWPA 5C15A 1E6YB 1R7IA 2Q6BA 5SUHA 2PFDA 4O44B 2QYGA 1U7LA 2DO0A 2GCFA 1P1LA 2B51A 5E3AA 1JJ4A 4K0KK 3MDQA 4NL5A 2DHAA 3LDQA 5AT1B 2G8UA 1DTQB 2CG4A 2H5IB 2FHJA 1XMOJ 1CULB 1QQCA 2RKIA 3TSQA 2XY6A 5KT6A 3KMSA 5F8MA 1DTTA 1SJFA 3RTVA 3SUNA 4MDBA 1Y3KA 3T3FA 3VESA 3TPQA 5H9FJ 3ATUA 1TTHB 4QIGA 1SJ3P 2W9CA 4GVLA 1WSVA 1JL2A 3DOKB 5FPEA 4KB1A 1BI4B 2CQPA 3OTOF 2AZ1A 3GMGA 3IN5A 3ZTSA 5CD4A 5KFAA 3IR6B 3PHEA 3HSCA 9RUBA 5KG1A 4N47A 3PJWA 2EKYA 4O8UA 4FPBA 4CNYA 2IDLA 2V7YA 2B4UA 2BW2A 1RT6A 4IFVB 4F3MA 4JKCA 3BSOA 4FJGA 2MB0B 2HBQB 4FJ5A 3DLRA 2C2ZB 1SV5B 1HWUA 2AJ0A 4DS4A 3I96A 3SDEB 4QWEA 3F5TA 3KTQA 5L1IA 1BCOA 2V9WA 5A2QU 1U2FA 3BBCA 2LVWA 4BRAA 2K7JA 1ZA1B 4WF9L 1Q18A 3P38A 3WXIA 4KBIA 4CLZA 2YY3A 1Y64A 1H73A 4WIQA 2MQPA 4YB6A 2ZDPA 1LK7A 4TU9A 3T9ZA 2IOCA 2MY8A 1U0HB 1VFJA 3W9JA 4WTYA 2P9KA 4I6MA 3CDBA 2Q66A 2GC8A 3QB0A 1G99A 1BIZA 3A8EA 4GKKF 2VGNA 2ZOMA 3H59A 1H98A 1IQZA 2O4GA 4ANDA 1X3MA 4UY8O 2D9OA 4CO1A 3IRXB 2P9LB 1XHZA 4ANCA 3DXKB 3DU6A 3M8YA 4K8RA 3RMBA 1EQMA 1ZM2A 3OHBA 2ZD1A 4PYAA 2NXNA 2RQCA 5F1XA 3ILLA 1X4HA 1GLFO 1U1KA 2KM8B 2P51A 2OGUA 5E3QA 4ZPWR 3MM8A 4DTUA 1WF1A 4YY3K 4B3TJ 1RT7A 1R0CB 1SI9A 4X66K 4ETXA 5JVGQ 3RB0A 5KG3A 4E98A 1FE4A 4A2BA 2KTQA 2QSWA 1BC6A 1IR0A 1Y00A 3GFZA 1IR2A 4A5BA 3JS9A 1FKPA 4V1Ak 2XMTA 4B9QA 1O0PA 3AODA 5ADZA 3DLJA 4RX6A 1JJCB 1H38A 3M8SA 4IR9A 2FLOA 3MEDA 5I9EB 4EYIB 1P27B 3OS0A 1X9MA 2AA4A 4AHRA 1Y0HA 1WSIA 1U4BA 3TAMA 3NAEA 3LO3A 3IWLA 1S1XB 3QRPA 3CFPA 2YNHA 1CLQA 2QLJB 3AY9A 3VGKA 3OYEA 4RW4B 4W98A 4ZTJA 1S1WA 5D77A 4P2XA 2ZEJA 4Y1CA 3O3GA 3OXFA 3QFPA 3BZQA 2YWGA 4IG3B 3FFIB 2IM3A 3UIQA 3K5MA 2HOEA 3MECA 4FWOA 4JV5K 2C2DA 1OPZA 2HBRB 4NLWA 1XNQF 2AZ3A 2VKZG 5DM7Q 2PA8D 3BUZB 1U2RA 1HBUA 4DV3K 3ITHA 3QIDA 1FNOA 3VR1A 1U45A 2GUPA 4PG7A 4IO9L 3H45C 2V50A 1HLUA 3ZSOA 3W2VB 4JK9A 4CLUA 2F8HA 2LEBA 4WQ4C 4A8OA 4ZITA 3EGWB 3ENVA 1UWBA 4DL0C 2ZM6F 5CZ2A 1HNWF 4DUZF 4B9MA 4GO7X 1XERA 3UKRA 3PR4A 4HYKA 4JI3K 3O3HA 5CAAA 4N76A 1IG8A 1HQEB 1S12A 4BRPA 3M8WA 1R6YA 4NMXA 4QWCA 1ASVA 1CC8A 1QZ5A 2MKCA 2LDIA 1GLDG 1S9FA 1HFEL 3AY0A 1H7WA 4CEBA 1S6PA 3H2UB 4NYZA 2VPWB 1Q7YT 4DL2A 2GHVC 5CH7B 4NXMJ 3IUCA 4OYWA 3LDLA 3PJXA 5ADXA 2ZFHA 4JBCA 3HBTA 3J7ZO 3O8MA 3ZT4A 4HI2A 3ZSYA 4DR2J 1E4FT 3ID8A 3NVKA 2UXBK 1VHIA 3THXB 1NGBA 1RTHB 3MI7X 1PO6A 1UKUA 4E7LA 4C11B 1AFIA 4G9ZA 3OW2R 2G0IA 1LWFB 5D4LA 4OHXA 2QM1A 4M5DA 3ZZ0A 4DU7A 2KG1A 2RDDA 4B3SJ 2OEMA 4DB3A 3W2WA 5U47A 2ZHOA 1JIHA 4WJBA 3G96A 1QQMA 1E6YA 3P83D 3VQ5A 3H5XA 3FMWA 4B9NA 1RHRB 4O44A 2ZWPA 4X65J 1FERA 2RRAA 3VV2B 2QWOA 1NJYA 2W42A 1NGCA 1DTQA 2OSRA 4CF1A 4DQRA 4YDXA 1CULA 1RABB 2L41A 4BRLA 3HMJG 4F4KA 1K1SA 2NXEA 5KG2A 3NH1A 2IJFA 5JUMA 4O8KA 1SZ2A 4WTOB 1YJUA 3BF3A 1HI1A 2QG9B 2KO1A 1RBSA 4PWUA 4A4JA 2DPNA 2HNZB 1RT5B 1RWKB 3NY0A 4BRMA 3C0BA 3QIOA 4K4XA 3DOKA 3EICA 2MQMA 1JMTA 5IWAJ 1BI4A 4F0MA 2AX0A 2VG7B 2J0XA 4NYPA 3OHAA 4PL7A 1GMUA 3C7NB 3H98A 1KHVA 2ETJA 2A2DA 1JXLA 4FK4A 3JB9k 1VQNN 2RQ4A 1RQ0A 5KT3A 3K0JA 3TZXA 4EBDA 3L4QA 4IFVA 2CQ1A 1FO1A 2GV9A 5FDLB 4J9UE 4ZKAA 5F8HA 4YDUA 1U1RA 2NCKL 4C8OA 1SV5A 1VQ4S 3MCOA 4Z94A 2GNKA 2RDJA 3SDEA 5F8IA 2NPFA 3J7YU 5D15A 5CYJA 2DBBA 1HR0F 3C6UB 4DV2K 1SCJB 1PJ7A 3KHLA 3I5CA 3NL0A 3ZX2A 3PIOL 2YPZA 3ATVA 4OI6A 4Q0BB 3Q8RB 4AILC 4QS9A 2DB1A 2PGCA 4TY8B 3FSIA 1F2GA 3ZX0A 4USTA 2MKHA 5D8HB 2LFVA 2L3MA 5K8MA 1N5QA 3KFWX 5KFZA 3NCIA 4DR6K 2HQFA 2R7OA 4LF5F 3W9HA 3D2WA 4DL6A 4LF6K 1RLDA 3DLHA 2JLFA 4RBUA 5KPTA 2E5LF 3TARA 3AVFA 1W2BM 1VJQA 2Y1RI 3SUPA 2P9LA 5AXNA 1N32K 3DXKA 4K8ZA 2NUHA 3NNCA 1T3NA 4DFKA 1RHQB 5B0AA 2ASLA 3HHLA 1AXQA 1KRPA 3ZT3A 3AJ1A 4K2JA 1MWKA 3EGNA 4L73A 2X6NA 1X8DA 4BG8A 3ZLJA 2BM1A 2UXDF 4WKYA 5BRFA 1WF2A 4OKEA 3LF0A 4ZOSA 4J90A 1XN9A 4C1NI 1AZSB 3RMAA 3ZZTA 2GGPB 3GTYX 3KDNA 4QR1A 4H5NA 4FLZA 3R97A 1TMMA 4Q2LA 3E8OA 3SUOA 3IRWP 1ICEB 3AO1A 4WFAL 2PMZD 4DUYK 3BDPA 3NOGA 1NSQA 4DTMA 3FBEA 3H4BA 2N3OA 3AO3A 2HBLA 1S1XA 3SYZA 4ID5A 4KKOB 1PJ6A 3VF2A 4FVMA 2H3GX 4RW4A 4LF7J 4NZ6A 4OX9F 4NLDA 2B6AB 3QFWA 2AWZA 1IKXB 4YB5A 2OTJN 2BX6A 4ED8A 4KAZA 1YBTA 2PD1A 2WC9A 5D78A 2UU9J 4IG3A 4ZIVA 4YR0A 2EC0A 3DCAA 5H9FK 2MGZB 4CIEA 2V2QA 1NMDA 4JLHA 3BQ2A 3CXCM 3E3XA 1GMVA 4CEDA 4DV1K 4W92B 1SC4B 4M3ZA 1RDUA 4X4VA 3A1YG 3OTCA 3W3DA 5DM6Q 1RP5A 2HHUA 1TL3B 4IOCQ 2F9JA 1ZTWA 2CRLA 4CQ1A 3R5DA 4H5TA 2EW9A 1UETA 3RBDA 2UUBF 3C16B 3NGSA 3D45A 3GV8B 4FW1A 2NLXA 4Q44A 4N77A 3ISNC 1HQEA 5BREA 4RUCA 2Z4PA 1GAOA 2D0AA 4B9UA 4DV6F 1A5XA 2V69A 4NLUA 2XY5A 4IKAA 3A3PB 1IM6A 4ATNA 3A0IX 1OSCA 4I2PB 4FWSA 2YWFA 4ZP8A 1AUSL 1IBLK 1PAEX 3AARA 3M32A 4QW8A 1IG9A 1N5VA 2KI2A 4JHDB 4QR0A 4NYFA 1NH7A 3SXLA 1SKRA 1IBKJ 2H54B 3VGVA 5F8LA 3QJLA 5HMWA 5M1OA 2QLWA 4DDFA 1K9MT 1DQ9A 3GJQB 4DSFA 3DDNA 2HWTA 1NSAA 3MURP 1K47A 4I67A 2IYGA 1FXRA 3CC4S 2FZKB 3THXA 4ZN3A 4JP8A 2PN6A 4FJIA 1RTHA 1D4XA 2HZCA 4PXBA 4DSJA 4C11A 1M90O 3M3ZA 1RBUA 4UF4A 5K14B 2RF2B 1ATSA 3U9ZA 2C42A 4J9SA 4YHHJ 1LWFA 5GAEP 3HKZD 3SBTA 4QOTA 4OZ5A 1VQ7N 5JXSA 1YJTA 2GIRA 1RK8A 1GXUA 4M63A 4CGJA 1AUDA 2FJEB 2V8PA 3VAFA 2VPZB 3DU5A 1UL3A 4CI0B 1X4BA 1RDAA 2BOPA 3F0NA 4CIOA 3UE5A 1RSCA 3CCMN 1I94F 1NGDA 2D41A 3VEVA 2MMYA 1MWQA 4IRKA 4U6PA 2E20A 3FEYB 2AYEA 3Q22A 3KLFB 4ZPBA 4B3TK 2RNEA 3TEHB 3TZWA 1C1BB 3CWJA 4CHPA 2K3KA 3L7OA 4J37A 1FWKA 2W9BB 1GOCA 2RHKA 2GQCA 5C42A 1HKBA 4BROA 1RT5A 1CJTB 1NXIA 4J91A 1X4AA 1SKWA 1SQEA 2EK6A 3D1OA 4WPAA 4ECUA 5KFCA 3BDEA 1KD1T 1FDDA 3IWXA 2QFJA 3PYDA 3C7NA 3O44A 2RHSB 2H5EA 2ITMA 4CGIA 2O3DA 4WFBQ 1HNZF 2O8FB 4CO5A 4PXEA 3M9OB 3D2EB 2RAQA 3RR7A 4PRFA 4MKAA 5FDLA 3U9DA 4ZVSB 3CJ9A 4UQGA 4H8KA 4GVEA 5TKWA 1UFLA 1HARA 5LJ3Y 1B4SA 3V9SA 1Q7LB 4M8LA 5EN1A 2P1JA 2JEIA 2X3DA 2OELA 1N54B 4KPCA 3T7ZA 3MWTA 2CQIA 3QIPB 4Q0BA 2V4JA 1I1GA 4TY8A 3W7BA 2MHEA 3SQGB 3NAIA 4DPTA 4FLWA 1Q82T 1DT9A 4AUKA 2HEKA 4ZP7A 4X4TA 3CF5L 4YDUC 1QE1B 1V5VA 4O3NA 1FA0A 2E88A 3IP0A 1UVNA 2BM0A 3T69A 5GINA 3SCXA 2EG1A 3WXJA 3MM9B 2BEFA 4B3RF 3NF8A 5RUBA 2DXEA 2R7RA 5HL7Q 1KN6A 3MPVA 3F9KA 2AJFE 2LA6A 5EDWA 1V6HA 4ILMA 2DGXA 4P71A 2E5JA 2MQQA 5KI6A 4DTRA 3C65A 1LK5A 3M8RA 2XMAA 2HRTA 3DM2B 1UEUA 4QWDA 1NK6A 1E6VB 3QNOA 4EI2A 4U9RA 3I0SB 4HTLA 2NXCA 4V19X 2CVIA 3BB5A 1JLAB 5AZJB 1C4CA 2XY8A 3UCZP 4MKBA 2DITA 3L6QA 2FPHX 3G87A 3N0VA 1S6UA 1FWPA 1KOHA 3NBPB 5LXYA 1WSHA 1KR4A 2Y1LB 4DR2K 3MGJA 4JRQA 4GKJF 1UOCA 3GIIA 3W1YC 1W2IA 1AZSA 2UP1A 1TGOA 1YVFA 1Z2ZA 3FJ2A 2LQ8A 2BMBA 1JL1A 2YHXA 1VK8A 4WYBA 3HDSA 3ZXWA 2KM8C 2YQ3A 4OFZA 3KHGA 4K50A 3H2VE 1FJGJ 3SCJE 2WUSA 3R2CJ 2CGKA 1OPIA 2GMHA 1HMVB 3DLKB 1JLEB 5A0YA 3SQ1A 4TU8A 2OPRB 3KNGA 3LWLA 3KDOA 3MAAA 4DV4F 1T3VA 4H0TB 2QMWA 1DRZA 4X65K 4TU7A 3CJTA 4KKOA 1TR0A 1HKCA 2NRVA 3VAIA 2V6AA 5CABA 1T05B 1YRXA 1IKXA 3DLEA 2LCWA 1N36F 2J9DE 3OR1B 3GOIA 1Z2LA 4NYOA 3ASMA 5KT5A 2C2NA 4JKEA 5BR8J 2MGZA 1VQ8S 2HFZA 1O5JA 1U8WA 5J2PB 1OH8A 2UXCF 4CERA 3VZIA 4NLXA 1WTBA 2QZ8A 5E41A 4OLBA 3NF6A 3TTDA 4JI6J 2A6OA 1TL3A 1YRUA 1FTRA 1H72C 3SMZA 2EWSA 2QWPA 3C16A 3LPUA 3O8WA 1RHUB 3E9PA 4GC6A 2J0QD 1REGX 1JCGA 4OYOA 2VBYA 3A8YA 4FL9A 2Z2ZA 2EFPA 3HRGA 4CZKA 1UEKA 2FVCA 2Q43A 4CJPA 2BJDA 3LOUA 3OL6A 4BRCA 4M7YA 4RUHA 2VBZA 1NNDA 3RVCA 1VSHA 2CPDA 3VEXA 2JH3A 2HVIA 1N4LA 2XMVA 1NU4A 4ELUA 1OSDA 3IR5B 3OVSA 4LF9K 2QFIA 1SC3B 2RF2A 5AJ3F 1TK5A 4HT5A 1Q95G 2CPJA 2UUCJ 2JWLA 3GV5B 2AJQA 2UV8A 5FPNA 4DR4K 4RR5A 3ZYYX 1WHXA 4B17A 4ECXA 1ZM9A 1KAZA 4FVUA 1YBAA 3IDHA 5H1SQ 3CQYA 3RRKA 3KLEB 1Q8LA 2DRDA 3FRZA 4BR2A 3NXZA 1OY8A 4M5HA 4UOGA 1VC6A 4CLFA 2KQ2A 1X3NA 3I33A 4ZPTR 1FDBA 3KLFA 2XHWA 2YNFA 2BE7D 3DN9A 3CJRA 2KKZA 3MPUB 5JVHQ 4C3LA 2V4RA 4Y3CA 3G4SS 2FUG9 4Y2KA 5ETNA 1C1BA 3VPZA 4OI4A 2E29A 1I39A 4HUFA 4M63C 4DTPA 2XULA 1BWFO 3H08A 3CFOA 1AA1B 4KHRA 2Q79A 2HFOA 2A18A 1CJTA 1FJCA 1NH8A 5AE2A 4OYMA 2W8KA 2F4VJ 1ZM3A 4FYDA 4P6QA 2OI2A 3J7Z5 2V63A 3TAGA 1Q0NA 2M2BA 3NE6A 2A1BA 1NOZA 4KH4A 2IA0A 1JLQB 5H9EJ 2O8FA 2KL8A 5KOXA 4MO5A 3D2EA 3QGHA 4ZVPB 2QXLA 3IMXA 4BE1A 5L9XA 2BKPA 4NPOA 3FRYA 4OLOA 1OVYA 3EVMA 4LFCK 4CEAA 3F56A 1ZETA 2HMPA 4CTAB 5MAOA 5EHHA 4FM1A 1HA1A 4JI7J 4KIAA 1YIJN 2QK9A 1SS6A 5M1FA 5DMRA 2J5AA 3QIPA 1BE4A 3OYHA 3DYAB 5F9NA 4B9SA 5IC6B 4A8MP 2XLKA 3SQGA 1GLLO 3VGLA 4A59A 1RT2B 2LQ9A 1LWCB 1Y3JA 1F5CA 1QE1A 1HQUB 3TRGA 2YH0A 4EK2A 3BSAA 1HWLA 4OX8A 2O8DB 1YJNN 3GFHA 4UOCA 1TL7B 3A5MC 1PBUA 3GE9A 3PSFA 4FJ7A 2CJ9A 1K8KA 4CLLA 4DSIA 2ADBA 3D6MB 2PT0A 4ZPVR 3QSYB 3R6GB 2YH1A 2I5JA 1GOBA 3THTA 3KK2B 5F3ZA 4WE1B 1EQYA 3DM2A 1C2PA 2A0FB 2IDOA 2HKEA 3R3TA 1JJ2M 4CZHA 3PRVA 3HSZA 3EDRB 1U6FA 2JJ4D 1B70B 1C0TB 5C2DA 1S1VB 2IHR1 4I1TA 3I0SA 3ENHA 3DMJB 1JLAA 5E5NA 2D3UA 5AZJA 4JI0J 4ISGA 1RA6A 3O9RA 2KHDA 3DHXA 1IBCB 4NXNJ 3NBPA 3KK3B 3NMRA 3QRRA 2DK2A 4M3WA 1NDCA 4C0OC 3NGYA 1KVIA 3FE1A 3I32A 5KAKA 2IIRA 1FRIA 3NOCA 3BYRA 5L39A 2V52B 3KLVA 3U02A 3JTNA 2BANB 4G65A 5E2QA 1Q79A 3LGHA 3D3BJ 2CFXA 1HMVA 4Z7YA 3DLKA 1JLEA 3K5LA 3EUNA 3EEQA 4JI1J 2WW8A 1RUSA 1HHSA 3B8AX 3PIPL 2HHHJ 3O80A 3GBTA 1D9AA 3OXGA 1VQ4N 2GAHC 2F8SA 4EBEA 4NLCA 3G10A 4KHMA 1T05A 3JYTB 2RRBA 4A47A 4KJIA 4KH1B 1T94A 2A42A 1U2VB 1NJWA 4LSNA 3BN4A 2KLAA 2CH5A 1IBMF 2I7PA 3HJVA 4DV0F 4ZK7M 2NREA 3KJFB 6AT1B 1CS4B 2P5VA 1N34J 2WBNA 1C0UB 2CPIA 3KHHA 2EG2A 1JKHB 4KGVB 4LFBF 3O4WA 4ZLNA 3TANA 3AA3A 1Q5VA 5LSLA 2IC3B 1EZZB 4JI4K 2ZJQL 3JQJA 2QO3A 4ES3A 5CD4H 1B9DA 3CJ3A 1J5EF 3V1RA 3L3VA 2XSJA 3MOJB 4K59A 2RUSA 4R79A 4LRDA 1N5TA 1Q7YO 2Y1IA 1Y5IB 4KC5A 3EY1A 3ET6B 2C2KB 3GIKA 4JK7A 4A61A 2POKA 5FROA 1WEYA 4F4YA 4CF2A 3HZGA 2NXUA 3GG1A 4X62K 3WNEA 4PXDA 2FY8A 4W5NA 1EP4B 1MA9B 5F2RA 3PO5A 1M1GA 5IQQA 2OKQA 2W2PP 1EKRA 3PRBA 2VL1A 2RPIA 4KRFA 1N5SA 3AD8C 4BC2A 2LXFA 3Q89A 3CETA 3OTOJ 3T41A 3I5AA 3S3OA 2ZVSA 2VG5B 5LJ5Y 3TP2A 1HHTP 4RPFA 3ZTQA 3QYYA 1RTDB 3UN3A 1O13A 4NWBA 2BRKA 4UUXA 4CO0A 4NEZA 5LMUK 3KLEA 5LMNK 2UV8G 2CWKA 2FQQB 4L6V3 4DPUA 4H0OA 4CM0A 2AP1A 1SUQB 1S3XA 1VK3A 4KHSA 5KTQA 2ZH9A 2VQEF 2YX4A 2OIHA 5A8KB 4OHWA 4CZIA 2HZVA 1Q8KA 3DAWA 3L4IA 2Y3YA 2CPHA 3OXLA 4DV5J 2C28A 3CERA 1RU2A 4GC7A 2VYPA 4CFBA 4K4UA 1WI6A 1F9FA 4CHYA 1PKUA 7FDRA 1U04A 4R8UB 2IBKA 2O4IA 3RRHA 4KH0B 2B3TB 4FP9A 3D66A 1JK9B 1WNEA 3W0LA 2JOQA 2AU0A 1VQMS 3FCVA 4IXCA 2HYIB 2VF3A 4JI5F 3AVMA 2VICA 1BQNB 4JI2K 1YX2A 4Y2MA 2KZZA 2J9CA 2OLWA 5I42B 4NO7A 2PEHA 1LXJA 4CK3A 2XC9A 3L8BA 2G8KA 4F04B 3OL9A 1JLQA 4J9LA 3G82B 4GVBB 4GV6A 3LDPA 2A6AA 1O1WA 4OJRA 2MZRA 2F7TA 1FTCA 2HRYA 4QBUA 2SXLA 4DR3F 4YOTA 4CTAA 2ZUGA 4S0MA 3NGDA 4P7VA 2RU9A 1IKWB 5AQLA 1U49A 4O3RA 5DK5A 4RW7B 3VGMA 1XMQJ 3E1YA 4FLTA 1ZBTA 4C97A 4YQWA 5BR8K 3X1LB 1GOAA 2MJNA 3WXMB 3MCPA 5ITHA 3DYAA 5E3PA 4I6WA 1HNXK 1RT2A 1WEXA 1TKZB 4IYQA 1HQUA 3TJ9A 2O8DA 2H3EB 2IAJB 1TL7A 3GV7B 3VQTA 4Y34A 4BRKA 2EK1A 4CJLA 4CZCA 2ASMA 3F9MA 2DJWA 1BOTO 4OPAA 3HSTB 1Q1KA 1S79A 3KK2A 4LBIA 3JAMO 4MQ3A 5DG9A 2DR8A 4WE1A 3FKBA 1C1CB 4L74A 3BSNA 2DGSA 1J9AA 4BE2A 4I56A 4LF4F 3I0RB 1C0TA 4WFNL 1S1VA 3R8YA 1GLEG 3TUJC 4DX7A 4EO8A 3KZBA 3DMJA 4MH8A 1APSA 2W40A 3DRYA 3VQAA 1EQ0A 1A0OB 2O8EB 4E89A 3FVYA 3KK1B 4LFAJ 3KK3A 1ZOTA 4DV7J 4UY8T 1OKJA 4FWLA 2NQPA 3MR7A 1XNQJ 3C6AA 3I6PA 5ADXH 4M5NA 2UUAF 2BJ8A 4U7BA 2BW7A 2MSSA 4OVLA 4X4QA 4F67A 3B82A 2QWQA 2R3VA 4DR7K 4USWA 4JI8F 3VQ9A 3UDCA 2AP6A 1ZZNA 2YNIB 3U27A 3CPEA 5KPZA 4PZVA 2BANA 3T1YK 1IV0A 1HNWJ 4C23A 3FQLA 3C6TB 1Q4RA 3OHRA 2KHCA 2MYFA 4HI1A 5GAGU 1S1TA 2XI2A 1SL2A 1K0VA 3G9CA 4WKRA 3QETA 4ZMMA 3OW2M 2R7WA 3L9ZA 1QQOA 3DRPB 3JTOA 2V68A 2E7VA 2YWHA 2NPIA 5C2FA 3G6EN 1JX4A 2HF4A 3JYTA 4F8RA 2VQFJ 4EHTA 4FYYB 4OJHA 2YKAA 3L0QA 2F65A 5EUHA 4ISEA 3NHGA 4CHOA 3AVLA 5KRTA 4KHWA 4DWIA 1HD0A 2K1RB 4O4GB 4QYZJ 2F4VK 3SUQA 1CS4A 3KG1A 1C0UA 5HRPA 3Q86A 3P39A 4RKUC 4PG4A 3LA0A 5IOLA 3O1WA 5BPLA 4AXIA 2AGOA 3A12A 1VQ6S 3H3NO 2CKWA 2IC3A 1FRKA 4RL1A 3KNAA 5L1KA 3R7SB 1FI4A 3OUYB 4HTJA 3HT3A 3KMQA 2HW3A 1WSFA 2JZ5A 3H3OB 1NGFA 2XCPA 4WYLA 4Z4CA 2CJYB 2O67A 1U1QA 4ZLPA 2XMJA 1RYSA 3UO0A 3NCPA 5IT0A 3ZSZA 4NLOA 3KLGA 2FYXA 2OO4A 4C2MA 3MN6A 1G4CA 3VA3A 4KFBB 1K9MO 4B1VA 1JLFB 4LF8K 3MCSA 1BY9A 1D3WA 2ALYB 2COLA 1OY6A 1RACB 1ZAWA 4BQLA 1NZAA 1D09B 2Q3SA 1NWKA 1EP4A 2IVYA 2KB2A 1XBWA 3VAMA 4XO0A 4WF9Q 3ONQA 2NYIA 1GFWB 4YY3F 2CNLB 1YTUA 1AT1B 1OJ4A 1KVCA 1KVKA 3AA4A 4K8XA 1XWLA 4BRGA 5IFMA 3QRQA 4M3XA 4E7IA 3D7SB 2CJQA 3G71S 4YB7A 2E7WA 3W5YA 4LR7A 1RTDA 1DEJA 3TW0A 4BY9C 4H0YB 4USHA 4Y2AA 5D6GA 3FSXA 1KWMA 1SUQA 3C66A 3DI6B 2CDRB 2XO6A 3W65A 3BYPA 1HHQA 3MOZA 2MSTA 3M6WA 1HR0J 3FK4A 3VAGA 5A8KA 5AQVA 4BRHA 3RBXA 3QEVA 4NXNK 3R8EA 3AO2A 2RQMA 3MWBA 4LSZB 3TWZA 2E4LA 3MX2A 3H7HB 1KD1O 1RHMB 1T02A 1RHJB 5GMEA 2ZBQA 4HH1A 4J9PA 2G8HA 3T5JA 4R8UA 5GAEU 3CNQP 4PHTX 3PYGA 2AHOB 1NPKA 4RWWA 4KHPK 3TEGA 4EAHD 5AQIA 1BQNA 2Q36A 3OYMA 2B7BB 3J7YP 1N33F 2E5LJ 4JI1K 5B8HA 1EETB 2P9PB 3G82A 4EEYA 4IR1A 2LP4A 4GVBA 4WWSA 2MKJA 4P9SA 1CJVB 4I9QA 1TUVA 1BDGA 2E6LA 4DR1F 1YKWA 2QLXA 4ZPAA 3FQKA 1WOQA 1RTJB 1IKWA 3AXMA 4RW7A 3AAPA 3CD7A 2IRUA 2MLXA 2Q31A 4QW9A 1N8RT 3HHKA 3CT9A 2IRYA 2XZDB 2QW9A 2GJFA 4FSVA 4IFYB 4FLUA 3IAS9 2YKMB 5ETQA 4DX5A 1TKZA 3D0GE 3CD6S 5IM0B 3MUTP 2FGOA 1Y97A 3CFRA 4HH0A 1AFJA 5LY3A 2IAJA 2PO4A 3HVTA 2AT1B 2CQGA 3IM9A 1SQFA 3VAHA 3VQBA 4W5OA 4Y2IA 2A1SA 4KO0A 4K42A 3IGVA 4U67L 1HBMB 5FLXU 5J2QA 1REVB 3MM6B 2BQ3A 3CQXA 1C1CA 1S5ZA 1NO8A 4QS7A 4DTXA 1XC9A 3GSDA 3I0RA 4YS2A 3FZLA 4QPTA 5IV3A 1WEZA 4OX9J 1NKEA 3HVWA 3CJKB 2BGGA 1FT8A 2BE9B 5SWMA 1DQ8A 1KLNA 5KPRA 3AQPA 4FNHA 3W9IA 1ATRA 3TAFA 2O8EA 1AB8A 2GAGC 4X4UA 1DFDA 1H2UX 4F4AA 3HO1A 1R89A 3KK1A 2BTFA 1NK5A 4AQYF 1GLJO 2E8AA 5HSPA 2X3GA 1WG5A 1UCNA 3IC1A 3D5MA 3OSNA 1YJWS 2QLFB 1BIUA 4IKFA 3OTOK 1Y9OA 4K0KJ 4C8MA 2Q0RA 1XIQA 3N5FA 5CZ1A 1U24A 4MK8A 2IY5B 4OZLA 5F0XA 5HVFA 4N8NA 3CW2C 4H54A 3TVKA 4MK9A 2YNIA 1RHKB 1WD6A 2KRRA 4FWKA 4FJMA 2WVEA 3MN5A 2CNNB 2JEJA 1CZ9A 3VCDA 3PZPA 4ZTFA 3CJ7A 4RLEA 4KTQA 4MTPA 3H5UA 3C6TA 2ZH1A 3QT7A 2DCLA 2ACMA 3BS9A 4W5QA 4ECWA 2CPZA 4G1QB 1KONA 4D3GA 1BA1A 1RCXB 4AHVA 3MN9A 3VETA 4JYAF 3SQ2A 1YJVA 1KP6A 2YJEA 3OYNA 3HSJA 3KJNB 3U8XA 4USKA 2IM2A 4CT9A 5CYQB 3L4BC 3U4LA 1MMNA 2X1BA 5C24B 2N82B 1X9WA 3K9KA 1F0XA 2K1RA 3FLCO 3TAEA 4O4GA 1HLWA 2XBPA 4ZLLA 3QPIA 4PPZA 1VHFA 1RISA 1JXVA 2V67A 3J7AN 1RDDA 1FJ7A 4GKKK 2CVEA 1BWVA 1CC7A 2VD3A 2WB1D 3LP0B 4O0NA 5I3PA 2YKPA 2VFSA 3PFEA 4ECTA 3R1LA 3QGGA 1U6BA 4C4WA 2DT9A 3OUYA 4RW6B 4GVMA 3Q2TC 4CJWA 2RT3A 1CEZA 4G1PA 2L9NA 2VC0A 1VSEA 4OPKA 5A2QY 2ZZMA 5GAHU 3ZT1A 2WTUA 2AJ2A 2DIVA 2W25A 2BJ9A 5B0BA 1HKGA 1U1PA 4AH9A 4Z4GA 5CYMB 1NLKL 2QXFA 4KFBA 3Q7BA 1ZAXA 2K3IA 2A1RA 2QEXN 1NDKA 3H8YA 3AD7C 3WNGA 4FZXC 4ZVOB 4HTUA 2YHAA 1HBNB 2R2SA 1D8YA 2XY7A 1WHYA 2DH9A 2MZJA 3IBFB 5KFHA 1I3OB 3PIOQ 4J9OA 2Z58B 4JB8B 3SQ0A 3SBGA 4BC3A 2LYVA 2AJ4A 3L2UA 2XHCA 1KQSR 3QNNA 3E66A 2MKKA 3UN2A 3PYFA 3P96A 2ASDA 1TV6B 2NZ4A 2LU2A 3MHYA 3O3FA 4X66J 3AH6A 4DOZA 3FSYA 2J7WA 5HQMA 5L38A 5DETA 5BYSA 1HNZJ 4DSEA 3IWNC 4FZVA 3CCRN 4O5BA 1YJRA 4BVPA 5D4NA 3UVJB 2BOAA 3M6XA 1JNZB 1RAFB 1OO0B 1FRMA 3DI6A 3AD9C 4ZCMA 4YORA 4OHYA 1T03B 2Z1IA 1QTNB 4C8NA 2FLPA 2Z1HA 4M95A 2HVZA 2IVNA 3CJ4A 4USUA 1XNQK 1ZPWX 1WOPA 3NKYA 5DDRC 5K5MA 1XMOF 3FZFA 2MPUA 2W7OA 4DL3A 3KK7A 2FVSA 1YK9A 2ZM6K 1TKTB 1S4EA 2VWKA 1HNWK 1CXUA 4TYAA 3ZX3A 1RWOB 4DUZK 4YOYA 4WP3A 2AEMA 4JV5J 4HVZA 4YOWA 5AQYA 3EXYA 2K8GA 2EXUA 2WFBA 1WN7A 4DV3J 1EETA 2P9PA 5HJYA 4HDHA 5AQFA 4LT6A 4BREA 4URQU 1CJVA 1HWIA 3EVOA 5KFRA 4I6YA 3HLUA 4GV9A 1ASUA 4A62A 4QR2A 1LNQA 1IO2A 1GLCG 1S77D 3V1OA 1X7VA 5TKYA 4P7TA 2IVPA 4RBVA 3N6NA 4CFAA 3TJ8A 4JI3J 5AQMA 1CBKA 2LEAA 2BXJA 2VA3A 3CMQA 2CUYA 1FEEA 3EGZA 4QYZK 1FK9B 4B3MF 4R0EA 1A5WA 1T9TA 4MIWA 2YKMA 2W9AA 2WW4A 3QMLA 1VQ5S 1CSJA 3FZMA 3R7NB 5IM0A 4M5JA 1YXQA 1YQHA 3QWUA 4F0HA 4RW8A 3S8SA 4CYUA 2W6LA 3GJTB 4UZCA 1HWKA 3KXDA 4PCQA 4O3OA 3W66A 2B9YA 4XH4A 1HBMA 4N56A 2UXBJ 4LVNP 3QFUA 1OIAA 2UVUA 1U0SA 1REVA 2IRXA 2MY7A 3N28A 4FS1A 1RNHA 3C94A 3MM6A 1Z05A 2KXHA 3POTB 2VFUA 3OA9A 1IWGA 2C3PA 3QO9B 2UYTA 1WBBA 4AT1B 3TSPA 4DTNA 1RGVA 3Q8VA 4M3RA 3CJKA 1X4FA 3F44A 3HI0A 3B8HA 1UJ5A 1LW0B 1MN9A 3HP6A 1NNEA 2E5HA 1QS4A 1XQIA 3CC2N 2VDIA 3CCSS 2HAFA 2CNOB 3PY8A 2HFNA 2M70A 5AXKA 1O51A 4E7HA 4ELTA 3ETOA 2E1MC 2QA4S 1VQMN 1KBRA 2EWHA 1OQ3A 3NAHA 1IUJA 5C0YA 4JKFA 2CIMA 2GJ2A 1CJKB 4EUVA 1SXLA 2OH2A 3JS6A 3LP2B 3MMJA 4ZJQA 4OI1A 4CBXA 4RO0A 1OMSA 5GAEI 3QEPA 4JKBA 3SAFA 5AQKA 3H90A 4FWQA 3PACA 4MYTA 1RKIA 2UVVA 4FOEA 3CC7S 3B54A 3CCJS 1VGYA 3HOSA 3KHRA 3THWB 3Q23A 2E1AA 2QSFA 4J2EA 4OPHA 3SK3A 3ZSVA 2WSCC 1VQLS 2A6MA 2MQ8A 4G1QA 3JTPA 1HR0K 5D3GB 3GYXB 3HPGA 3H5SA 3F2KA 3ENQA 2A5XA 3KWMA 1HWJA 4ZJOA 4DCJB 2MQOA 3K57A 3CHWA 4JK8A 2VV5A 2HFVA 1S72S 1Q81O 3WEEA 3HD2A 3CCQS 2FC9A 2QJ3A 4F02A 4QU6A 5CYQA 1GMWD 4FS2A 3OFFA 5C24A 1HUXA 2ZUAA 4USIA 4IOXA 5DG8A 3OD2A 1YLXA 3MMBB 2CG8A 1W97L 4ED7A 4LF5K 1ZZFA 1KFSA 3JSRA 2J76E 5J2NB 2FHMA 2O1PA 4DN0A 2RVJA 2E5LK 3LP0A 4ZHRB 3AA8A 2GVDB 1LXNA 2AX1A 3I5BA 4OYBA 1QY7A 1M1HA 3TSUA 2M52A 1Y7PA 5T14A 4OI2A 3NGZA 2DNRA 4DR6J 3AGKA 3MWPA 2O8BB 1R3NA 3QQCD 3HZEA 2N4CA 2OCEA 1VYAA 4LF6J 1K73O 2WVFA 1B7FA 2UXDK 4L8RB 3SSQA 4U7CA 4A8YA 1UVKA 1IKYB 3OJSA 1N32J 3H0PA 2OUGA 1TMJA 3BGFA 4B1UB 1R27B 4B8AB 4RUBA 3PG9A 1FWLA 3U7JA 3MCMA 1VQ9N 4OI0A 1MLAA 2DNPA 4NXMF 2P5OA 3BSCA 3G2XA 2ZF5O 2BE2B 1E4GT 5D0RA 2AEFA 2QIFA 1BUPA 1TV6A 4IJNA 4IOCL 3HTVA 4MLHA 4XPCA 3C8YA 3IFRA 5LSRA 5ETPA 2WCXA 4N41A 1XEZA 1UVJA 1HNIA 2C1EB 3CYMA 2D1CA 2P6TA 4B3SF 4FNIA 3UVJA 2A3ZA 2YHYA 1CXQA 3OYIA 1FXLA 1CVJA 4OX9K 3QINA 3HOTA 3GFYA 4J9KA 3MXMA 4KHQA 2QLBB 1T03A 1KKHA 2GELA 4AL5A 2N4DA 3G6XA 3GIMA 4DUYJ 3WUHA 3HL8A 3QEIA 4IO8A 2CAJA 1YWXA 4N8OA 3LDOA 3PFOA 2XMKA 1FRJA 3MM5B 3J7AP 3WDOA 1HJOA 1S1UB 2OHDA 3WHIA 3EX7B 1S57A 4Y28C 1ITGA 5ETSA 1BWEA 4P2FA 2HHWA 3OBWA 2B7CB 3HSGA 4IH5A 3AJDA 1TKTA 4OGEA 2R2UA 3ZCMA 3V6HA 5B08A 3TU5A 5IWAF 1MWMA 3IA0A 4K4TA 2M8DB 3EM1A 4NX9A 2EFOA 2DY4A 4OYIA 4DV1J 3CMAS 3PNIA 1LKZA 2X74A 2M7SA 1V3RA 2W6KA 4FXDA 2EFQA 2DFFA 1ZA2B 1R8CA 4BDPA 3O9TA 4DV6K 2DIUA 5K20B 3VTHA 4HDGA 1FD8A 3Q83A 1FRLA 3IMQJ 1TYQB 4BR9A 2KH9A 3BR9A 4IDKA 4CJ5A 3G25A 4GO5X 3TI0A 1NJXA 1BHLA 2P8IA 1KLMB 3ZO7A 4CJ3A 3N79A 4C0BA 4JAXA 2DCUB 1VBZA 4CJUA 4L75A 5GVQA 4TLRA 1YJ9S 2ZH3A 1FK9A 3MF5A 4X4RA 1VBXA 2ZJRL 3PV8A 3JSBA 4M42A 2IFXA 4GNIA 4O5FA 2L08A 2H1YA 1PJ5A 3BGUA 5HMYA 1S97A 2GTDA 2NSBA 4HHUA 2ZBIA 4HHHA 4FO0A 1IBLJ 2DNHA 1HBOB 2F40A 3DLBA 3SQ4A 3WX4A 2NXJA 1NAQA 2EFGA 2VJVA 2HBZB 3FCHA 4KBOA 1SB6A 1KCFA 3H46O 1I94K 1XC3A 4M94A 2CA9A 3RZAA 4ID1A 2HGMA 1WDTA 2G1DA 3QO9A 3ULDA 1NDLA 2ALZA 4CJTA 1P6TA 4GRSA 3SMPA 3D6TB 3OR2B 2P9UB 4EIAA 4NYNA 3RBZA 3N6LA 1FVSA 2FBXA 3ELHA 2CGJA 3UFCX 2XLIA 1RBLA 2DRBA 4PAAA 2E9ZA 1WC4A 4FPAA 1IR1A 4FM0A 5KG0A 1EX4A 1TZ0A 5SZTA 1T6DA 2VFRA 2HHVA 2M9KA 1S9GA 4FJHA 2R4FA 4K41A 3PW7A 1EWQA 3E51A 4BC9A 3TAPA 2I7NA 1U1LA 4F4XA 2C3UA 4CJVA 1CJKA 2EBGA 1S59A 2FC8A 3LP2A 2IBOA 1BG3A 1QSLA 2DNQA 2HURA 1URNA 4CEEA 3AQOA 1Q8IA 4JKHA 4KH6A 1HNZK 2YXLA 1RAIB 1RWPB 3D67A 2E5GA 1UJ6A 4CHZA 3PX4A 3TA1A 3THWA 3T1HF 3CJQA 1WSEA 4W90B 2FBYA 4LR8A 3VQSA 1WSJA 5F9LA 2B56A 1T44A 3FC9A 2GHWA 3V9ZA 3LUYA 2P9GA 2RE1A 5D3GA 2UUTA 4PG6A 4C9DA 2D1KA 1WELA 2FZCB 2XYGB 2Q1NA 5AFUH 4K4WA 4H5VA 3W5ZA 4UOHA 4A8WA 4BR7A 4LF7F 5HRSA 3TUIC 5AR0A 3AXKA 1X4DA 2CQCA 3HULA 1VSMA 2DISA 2UU9F 4KR0B 2ZC4A 1K8AO 3MMBA 3UR0A 4F3OA 1BU6O 3CD6N 2QMUB 2NZCA 2J8SA 3QT8A 5C25A 1X4GA 1XNRF 3L3CA 2D74B 1OQ6A 1B92A 5J2NA 3AVHA 3BO4A 2GUIA 3G8SA 3OTBA 4ZHRA 3K2YA 3J80U 2GVDA 3N4PA 4Z37A 4E1NA 2DTUA 2QTDA 5HOOA 2W2QP 3AJ2A 1NGHA 2ILYA 4J9QA 4IQMA 1SVDA 3QEXA 1D1UA 4OPJA 4F0KA 2YPYA 1S76D 3NH2A 2ZC3A 3DXMB 4X84A 5KFMA 4TVAB 4PYDA 4DMNA 3TVZA 2DEJA 4MO4A 3O6QA 1LAWA 2ITGA 1IKYA 2RB7A 3CCES 4LREA 3SZ2A 2D0CA 4GKJK 2KU7A 2J4RA 2VPYB 2VGMA 1X5SA 3DKDA 1NM1A 4NCBA 3E2EA 4P74A 2HGLA 3CM5A 3S01A 3AOCA 2BE2A 1IBKF 2ZZTA 4OHZA 4P72A 2XWXA 4DSLA 3U1LA 3DOLA 5M1QA 4Z4FA 4M5IA 1EKEA 4KI4A 3PR5B 4EWTA 1YHQN 4DV4K 5KFGA 4MFBB 1QVFR 4CH7A 2AYGA 4YHHF 4FF1A 1NPRA 4YR3A 3NGRA 2FIUA 1QSSA 4I4BA 5BPMA 2CJKA 5T7LB 5DDOC 2P9EA 2Z2MA 3W8GA 1N36K 4DLEA 4RU9A 2NSCA 3EO3A 1JLCB 2OZSA 2I6WA 2YHWA 3BV8A 1HPMA 4X4NA 2W4CA 4KHYA 4BBYA 2IYIA 1ITPA 3H6EA 3GR0A 1SJ1A 1OYEA 4NLGA 3MM5A 4PKIA 3ENWA 2UXCK 1SIZA 3UDEA 3I31A 3EYZA 2QL9B 1OY9A 2Q97A 4HLBA 3OQ2A 3CJ1A 3U3YA 2DFHA 1UW9A 3NNHA 3BQ1A 1NMNA 2HNYB 5KFOA 4TLQA 2HGNA 4FYVB 4HTIA 5AQSA 3D0HE 4FWNA 1J5OB 4UQTA 1R59O 2X7IA 3RMCA 2HWIA 2X1FA 4NE9C 5EXWA 3J81Y 2DGWA 4FK2A 5DQGA 1VRTB 2B5JB 2X6SA 4I0WA 1N8RO 2DGUA 4MKVA 1SC6A 2G2OA 2IS3A 1RFQA 4ILRA 4A2AA 5ETKA 1Q8BA 1VQPN 4RTFD 3PIPQ 2RMLA 2HQGA 1WWHA 4OJGA 2ERRA 3KLIB 3MCAB 6FD1A 1KLMA 3SCLE 3ZFVA 1WLJA 5I4MA 2X1GA 1T9VA 2H4WB 1R8BA 5AZIB 2A2CA 1P90A 4R5PB 3VQDA 4BGBA 4ZJLA 1GX5A 1NGAA 3R5AA 5C10A 4CGHA 4CH0S 5AJ3K 1T9XA 4LRAA 4A8KA 4ZVUB 1JLGB 3C46A 1HBOA 3HVRA 1RDRA 2Z8QA 4DXLA 4DJBA 3L7UA 1VMBA 4B9VA 4RWTA 4PG5A 4PXCA 3PVXA 1QAIA 4V19S 2GIQA 1DKGD 2LXIA 1VLOA 4IEEA 2PI5A 1TL1B 1U0HA 3B6BA 4R0JA 4JS5A 2MJUA 4RCHA 4E19A 4IH6A 2ZJQQ 4MKYA 2JEGA 4FYXB 3CJAA 1LAVA 5LL6d 3HP9A 4GY2B 2O5DA 4QYRA 5JMNA 4LF9J 2W2MP 5AQOA 1K0TA 3HK2A 2JGUA 4CE9A 3IRXA 5B0CA 4JV1A 3OR2A 1MN7A 2P9UA 4DR4J 1XI1A 1H0HB 4NASA 2HG4A 3TVYA 1U25A 2W8LA 4FWRA 2WVDA 2LKZA 3IS9B 2Z1JA 4EFAC 1W25A 2QL7B 3FZBA 1KQKA 2AF6A 3HVAA 1RCHA 3NP5A 4B9TA 1NGEA 3KLHB 5GAGP 4CBUA 3V4MA 5CHIA 2A10A 1GNKA 3UQSA 3EN9A 1KQGB 1ZM4A 1T6CA 2FSKA 4X64J 4XIUA 3J80O 2DNZA 2HSEB 1RWNB 1T11A 2YBVA 4YMEA 1H6KX 3SPYA 3NS7B 4CZJA 3GSIA 2WAQD 3K7RA 5KG5A 2Q0UA 4H4MB 2O01C 1FJGF 1XJWB 5J2MB 3FR0A 1VQNS 1BXNA 4CI6A 2QL5B 3VVTA 1NB7A 3O4QA 1Q9XA 3LGNA 4LSLB 4UTGA 3HYFA 4ED1A 2QX0A 3GWCA 2DXDA 1P8ZA 1F9HA 1N5YB 3TJAA 1V3SA 1SKSA 1WC6A 4XH5A 2VASA 2HS4A 4XDCA 1T8EA 3UN5A 2PFUA 4LBPA 1K6YA 5JMVA 2AYMA 2ZH8A 1WSRA 4PEOA 4LJMA 1VSJA 3Q8QB 2FBTA 4NA2A 4LFCJ 1N56A 1ZBIA 5F8JA 1E3MA 1NEEA 3F73A 4B3OB 1UFWA 1VQKN 4EFHA 2AKWB 1TFYA 3FFIA 4DBQA 1X9JA 3D7EO 3QJJA 5JS2A 5L1LA 2PC6A 5HI7A 2I8EA 2FGCA 2PY5A 2OP5A 4XAKA 1JXBA 3OVAA 3GJRB 4OMFG 4O0IA 4JI6F 5HROB 2F5GA 3W2VA 2FB0A 4XK8C 3QNWB 4ECQA 1KAYA 4BC4A 3L2QA 3CCUN 3DGPB 1UAXA 3DXMA 2X1AA 2VCPA 2CZ9A 4LRCA 2M8HA 5C12A 2D3OR 4IUFA 2PA3A 4KH5A 4DZDA 3W62A 5KFDA 2YQ0A 3U6FA 1KDNA 1MU2B 4CCHA 2VJUA 2D3ZA 1LW2B 3QFHA 2RJZA 1NGJA 2HFSA 4CP5A 1WAJA 1QAYA 2CADA 2P9NB 3MX5A 4JRPA 3ICLA 1S6OA 5KFNA 1JQGA 2Z57B 1S0OA 2X51A 4LVOP 2W9CB 2N3LA 2DNOA 2ZKTA 4USJC 2DPIA 2F9TA 1Y11A 3KG4A 2MZ1A 5EWFA 1VIOA 4ZS6A 4IOAQ 3P5TL 4MFBA 3Q0AA 1XTZA 3VWSA 2XS2A 3VGSA 2JWNA 3M8QB 2UUCF 5GMDA 3IGNA 4JKDA 4RNOA 4ISFA 4ECRA 3CIPA 1JNRB 3H1QA 4F9OA 4DR1J 5KQDA 2V7ZA 3MUVP 3PEHA 3CJCA 3LH2S 3EZ5A 3QBXA 1JLCA 2I38A 4OX7A 2YKOA 2NLWA 4H4KA 2KW4A 1KC8T 4WFNQ 1S72N 1V5IB 3CCQN 3MK6A 3DFEA 2OTJS 4JUZA 3QERA 5HK4A 2EHGA 4DV0K 5BYQA 3SV3A 4NI2B 1CQNA 4A8SA 1SL0A 4M5KA 1YSJA 4LFBK 4ZLJA 1JWWA 3QDKA 2ZGYA 3M05A 2V9KA 3H2LA 4AYBD 2CGLA 3NS6A 1J5EK 3BJYA 2HNZA 2HNYA 2R8KA 4L76A 2F4VF 3G0ZA 1WUAA 4CO2A 2DTJA 4NLVA 2K06A 2VG6B 2FDNA 2KRBA 1J5OA 1NGGA 4YR2A 3V9XA 3E9LA 2VG7A 3R6MA 1WOOA 1NOYA 1U47A 1VRTA 2B5JA 4AXJA 5LOQA 3ISZA 2NRRA 1LOUA 3CQ8A 2IJNA 3D1HA 4JI4J 3BZKA 2Z56B 1ZBHA 2GHPA 4FWMA 4LC9B 3Q7CA 5L9NA 3HFKA 2ZH2A 5BN9A 2I1RA 4WP9A 2J0WA 3KLIA 1G2EA 3I9V9 3T9NA 5GADP 3WNHA 1PG5B 4KV8B 3P1GA 4ECZA 2H9ZA 4JI7F 1UVIA 4KT0C 5AZIA 2K7KA 2Z1GA 1SPBP 1KSPA 4IQXA 3PEJA 4ANEA 4WCEL 4KGZB 3BF4A 1HYZA 1HKAA 3C6UA 1UZDA 3THPA 2CQ0A 3K5PA 1WDDA 3EJMA 4CIGA 2O66A 3EE9A 1HW9A 3Q8SB 1QUPA 2HHTA 1ZBUA 4X62J 3DNCA 1HPZB 5HMZA 3RB4A 2FY1A 1FKPB 2DH7A 5KFYA 1NKCA 1KNZA 1TL1A 1CJUB 5BN8A 5CY4A 4E8UA 1Z26A 2ZGZA 1VQ7S 4YNQA 4CFCA 3S41A 3UD3P 1G3OA 2WSFC 1HYVA 3R5GA 1SIWB 1QQNA 2VQEK 2GW8A 3PW0A 3B4MA 4K7QA 1ATNA 4J2BA 1BMQB 3CCMS 3CMEN 3C19A 5EX0A 4RBTA 3P5BP 3GB0A 3IS9A 5LMUJ 1DLOB 3LQVA 1WHVA 5LMNJ 2JSXA 3KOAA 4JI0F 1L3TA 3Q8UA 4FVCA 2Z2LA 2IM1A 3PW4A 1RE1B 4JI5K 5AQHA 3P3DA 3ZZYA 4NXNF 4WU3A 3T5HA 1Z1ZA 3MTKA 1WBDA 3GE1A 3VQEA 2IVFB 1ELOA 3EXCX 2CQ4A 2EI5A 3AAQA 2HS3A 1SJRA 3M6VA 4N7TA 2GGPA 1P1TA 5M2PA 2UVRA 3CMAN 2GA7A 3A3NB 2W2NP 1NK9A 2QWLA 4H4MA 1KQSM 5J2MA 4AHCA 1OH7A 1N88A 4JI2J 4DR3K 3C15B 4H0PA 3TTFA 2AIRB 2V2KA 4MIBA 4PQUB 2OD6A 1N5YA 5LJWA 4Y1DA 3D1QA 4MIAA 2HHHF 1QVGR 2WHOA 2FTRA 1RTZA 5A6WA 2KN4A 3GG4A 4UY85 1N52B 3Q8PB 3C95A 3FBFA 4FLYA 2DYAA 2MKIA 2V51B 3O5BA 3HXMA 1IN0A 1YJ9N 1PC4A 2B6AA 4TKTA 5KFQA 3RWUA 5IT9U 3CPWR 1ACMB 1QZ6A 4CLPA 5GAHP 4FYWB 3BM7A 4LR9A 4U96A 1XK8A 4PA1A 2GMJA 3P4UB 3J7YI 2F1FA 3AOBA 3LANA 5IQ6A 1N34F 2JLEA 3N01A 2R8HA 3MMVA 3SJJA 1HNXJ 4DN9A 2E2QA 4U8YA 4DQSA 1W26A 4WK1A 2XM3A 5HROA 3AGRA 4LF4K 3ENBA 5E0OA 3VF6A 1QAJA 2E2NA 3UNYA 1U26A 3IFEA 5M1NA 3W2WB 8AT1B 1F21A 1VOMA 1QDUB 4PPDA 3DGPA 4HACB 1TU0B 3EL2A 1NUEA 2RIJA 3RW6A 4TYBA 2GBZA 4FZYA 1S0VA 4CF0A 2BJ7A 3TA0A 2HBJA 4M1KA 4BGAA 3P4IA 3GONA 1MU2A 1LCUA 4M5LA 1XR6A 1Z25A 3MTJA 2UUAK 1LW2A 5FPDA 3LW5C 4BRNA 3IBWA 4DPOA 1SQKA 3TA2A 4CD1A 4I2PA 3TUPA 4JI8K 2P9NA 3EE8A 2GV1A 3JQKA 4DPWA 4JHDA 4CEQA 3OYJA 4DKWA 1KVAA 3T6BA 4WYWA 3CDWA 3MUMP 4AHTA 4K4VA 2OPPB 3I55S 1NK7A 4U7UK 2W4PA 3M2RB 2XTJP 2QA2A 3HD1A 3GCWP 3M8QA 1YITS 5K14A 3MZIA 4DR7J 2BJEA 4XH1A 4U67Q 3T5LA 2HLUA 3CB4A 1GTHA 4Q5VA 3T1YJ 5E84A 2FJXA 2FSJA 4FDFA 2V2ZA 1TAQA 4QIEA 2VFVA 2XB2D 1B0VA 2HMIB 3I8DA 2HQIA 1WI8A 3KKSA 4ECSA 3OPKA 3MXJA 4B3MJ 1F5BA 4NI2A 2F9DA 4DV5F 2XYPB 4C98A 1S7HA 3I82A 4X64K 5E33A 3CJSA 3G6YA 5C5JA 1K1QA 2W9BA 1VC0A 1J2VA 2CJBA 4WQ5A 1GMWA 4H4KC 1RT1B 3ULEB 4IG0B 4M3UA 5KFLA 2VG6A 4RNFA 2FVPA 4CF8A 4I9LA 4UOFA 4H0VB 3BR8A 2ASOA 4DCPB 4YB1P 1L3SA 3EPGA 3M6GA 2WK4A 2BVZA 2BDPA 3HHLB 1BGXT 4ED2A 4BCAA 1R8HA 4J9VA 2R7XA 2GFFA 3CCEN 2ZWHA 4KV8A 3RW7A 3AT1B 3TWHA 4ES2A 4PKHA 1MWZA 1XMQF 4E1JA 3K59A 3V6DB 1M5PC 4Y0WA 1Y4ZB 1NLVA 1YTYA 1YJ7A 1WAFA 3QSIA 3TZZA 4JEPA 4LF8J 1LFPA 3L2RA 1EAYC 1JXEA 3DLLQ 3O6WA 4W5TA 1HPZA 5J1EB 1I6JA 3OV7A 3C6HA 4B08A 3WXLA 3VA0A 4QAGA 5MLCV 2MLZA 5IV4A 2I9SA 1CJUA 1I5OB 1KVBA 3VEZA 3MM9A 4PWDB 1Y10A 3SNNA 3P6YC 1D5AA 3ILOA 2B4PA 4OZ1A 1S0MA 4WZQA 4CZLA 1VISA 2RQKA 5CXTA 2CQ2A 4K4YA 3FZKA 4ID5B 1BLUA 1ZXOA 1V9OA 3B78A 3NCQA 2IPOB 2NUUG 2VONA 1NDPA 1E6VA 4FXVA 3M4XA 1DLOA 5IT9O 4TY9A 3CE8A 4BR0A 5CHCB 3U1NA 4QOZB 2R7QA 1RADB 1LV5A 3M8PB 2DNLA 2HIYA 1GEHA 4B02A 4LFAF 5KFKA 4DFPA 1NBEB 2H5JB 3M7VA 2YV0X 4DV7F 1HNVB 3DJCA 3QGPA 2JLGA 4HWIA 4U7UD 1QD1A 3ZSWA 4C1NK 4OV1A 4KSEB 4MYUA 5EWGA 1ZYQA 1N33K 4DR5F 3A8KA 2VZ9A 2MLYA 1UW4A 2R7VA 4DG1B 2XI3A 4KB0A 1RDWX 4O3PA 3EZUA 2PYLA 3MPWA 2NZTA 2KHOA 1KAXA 4RJVA 2YKNB 4C8ZA 2UVWA 4FLVA 3EWGA 4KHPJ 3ENOA 5FD1A 4LH4A 4DCHA 4I64A 1IJJA 3NS5A 4DR1K 2ABYA 2D9PA 2F8EX 5F8NA 3C15A 2ZITA 2XNRA 1X9SA 1LQ9A 3DRXA 1EIYB 3MM7B 3UKUB 2HS0A 4PQUA 4FCYA 4LMZA 2DVIA 3S6EA 4JV0A 2V5HG 2OPRA 1VK0A 4ALZA 1FF2A 5EY4A 1VLYA 3ZETB 3J8AA 2NRHA 1YGYA 4NA3A 1VQOS 1XHXA 1HX1A 2V8HA 3OTEA 4FN5A 2I0XA 3JAMU 1X60A 3SFUA 3L95X 5K9FA 2PFFB 2P9SB 1YIJS 2VQFF 3M32B 5HVGA 3OY9A 2G8IA 5D4PA 2RDIA 1VIXA 4HR2A 3VZHA 4OQJA 3G86A 3OR1A 4FJ9A 3ZZOA 2DHHA 1J54A 3VMFB 2ZJPL 2BUPA 1FJEB 1Q86O 5FRMA 1WNSA 4DF8A 5G0RB 3CCVS 3I56S 2ILZA 4ITSA 4EMDA 3NLCA 1YJNS 2HVEA 5J2PA 4OYXA 4H0XB 1Q81T 3ZT0A 3BREA 1RAJA 2OPQB 5B0FA 5B7WA 7AT1B 5EX5A