4I2PA

Crystal structure of hiv-1 reverse transcriptase in complex with rilpivirine (tmc278) based analogue
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
554
structure length
554
Chain Sequence
MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A comparison of the ability of rilpivirine (TMC278) and selected analogues to inhibit clinically relevant HIV-1 reverse transcriptase mutants.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Hydrolase, transferase/inhibitor
molecule keywords Gag-Pol polyprotein
total genus 155
structure length 554
sequence length 554
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4i2pA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4i2pA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4i2pA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4i2pA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4i2pA05
1NOZA 4ECVA 1C6VA 1RT4A 4K4ZA 3C6UA 2W9CA 2GIQA 1NK6A 1EXQA 2XY5A 4TN2A 1S9GA 3MXMA 2AJQA 2DFEA 3QIPA 4H4OB 5I42A 1D8YA 4F50A 2ZD1A 2E9TA 1JLQB 2XRIA 1NK0A 3SUNA 2YKMB 3VQ8A 4J2BA 1K6YA 4I7FB 1J5OB 3SUOA 3DLKA 3V81A 3C6TB 4KB0A 3DLEB 4XPCA 4NLVA 3CJ2A 4J9PA 1HMVB 1T3NA 1VSHA 4ZVGA 3T5JA 4ED2A 3P1GA 3ZT0A 1FXXA 1KSPA 5JS1A 4J9LA 2F8TA 3OSNA 1JXLA 4J9MA 2BANA 1YVFA 4NLXA 2XCAA 4GVMA 4URQU 1DTTA 1TVRA 2W42A 4M3RA 4FLUA 3KLVA 3QNOA 4TLRA 1JLCA 2B5JA 1XWLA 3IG1A 2HWHA 3PUFA 3DLRA 3M8PA 2YNGB 1BGXT 1N48A 3ZSRA 3NFAA 1ZBUA 3TQ1A 2D0BA 2J6UA 1L3SA 3SPYA 1KRPA 5FROA 3SI8A 2ASDA 3DMJA 1S6PA 3NF6A 1JLAA 4F4KA 1RDAA 4QCLA 4TQRA 4KHNA 4ECUA 4DEZA 5DGAA 4B9TA 5DGBA 1NK8A 1QQCA 4W5QA 4CJSA 3K5MA 3KLFB 2HHQA 4CHYA 3H5YA 1C1BB 4DQPA 3MTKA 3O4NA 5C24B 4K50A 3KD5E 1HPZB 1RT7B 2BRLA 4ELTA 4FW1A 3SPZA 3KLEB 1YVUA 1QS4A 3ZSXA 1TKXA 4E89A 3FQLA 4DU4A 4FJHA 4KREA 1QSLA 4J9KA 1O1WA 4DFKA 1HQEB 3LANA 2PZSA 2BE2A 4EO8A 3FSIA 4CK3A 4KHWA 4B8CA 3JYTB 3K57A 1Y97A 3TWHA 4I9LA 3OYBA 5EWGA 3NAIA 3S3NA 3EY1A 4O4RA 1IKVA 1NOYA 3GIKA 3TAMA 4IDKB 1X1PA 5KG7A 5KI6A 4TYAA 4KE5A 1FKOB 2AGPA 1MU2B 4ECSA 5KGXA 4NLSA 4TSXA 1TL3A 1U4BA 1GOCA 2HNDB 1T94A 3ZT1A 1FK9A 3H40A 4KHRA 5CZ2A 2KZZA 1TKXB 2IS3A 1B9FA 4RW7B 2Z1IA 1HQUB 1RTJB 2JEJA 3SV4A 3KHGA 3L8BA 3RMBA 2C2DA 4BDYA 4OKEA 3UPFA 5EU7A 5SZTA 3KK1A 4K4SA 2XI3A 3NE6A 4NLRA 3CO9A 1HARA 4RW8A 4DWIA 2HNYA 4QW8A 4RW4A 3DDKA 3SQ0A 1X9SA 3M8RA 1RT4B 4JV2A 4OGEA 4IFVB 4U7CA 3RRGA 1RTIB 2HW3A 4IBNA 5KTQA 3ZSWA 2WONB 3Q8RB 5KFFA 2BANB 4ECWA 2AU0A 5J2MA 1C0MA 3MFHA 1TV6A 2JEFA 4B9NA 2V9WA 4DL4A 4NYNA 1NNDA 3OYFA 4CGJA 3OS2A 3I0RA 4KRFA 3MR2A 3V9ZA 4E3SA 2ATQA 1ASUA 4AHUA 4CJTA 3Q8QB 3ULDA 3HSTB 3TVKA 1LWFB 3NGZA 2VG7A 4Q0BA 2B43A 4CJRA 4UQGA 3V6DA 2A1SA 2G8VA 4HUFA 3F9KA 1RAJA 1OS5A 4O4GB 5KG2A 3AVLA 3KHRA 3CQ8A 4DQRA 4TY8B 4YMEA 1DTQB 4DL7A 1BCOA 4ED7A 1HNIA 3E01B 3QLHB 1NKEA 3HO1A 3M9MB 4ZVEA 1IKYB 3K59A 1EX4A 5KG6A 3RMAA 2D0CA 5CYMA 3H5SA 1TP7A 3BQ2A 4Q44A 2EX3A 1HRHA 3HVTB 4H4OA 4WXWA 4M3ZA 2ZE2A 3IG1B 4ZTFA 4FZYA 4OVLA 4CHOA 4GW6A 4CEBA 3HPHA 4BDPA 4KB1A 1RT5A 3RMDA 1A5VA 3PV8A 2IMWP 4M95A 4DG1B 3LAMA 4M3XA 5F9LA 1RTHB 3CDUA 4RNHA 2FBTA 3AVJA 2ILZA 3AVBA 4EP4A 4CJUA 1TKZA 3SV3A 4BWJA 2IJFA 5DQIA 3OHAA 5F8LA 3NH1A 3HK2A 4TY9A 3EPIA 4BE0A 2XI2A 5KFLA 4AHVA 4E19A 4KHSA 3NGDA 1RT2A 2HB5A 2R2RA 1VSKA 3HVTA 4KO0A 4TYBA 1T8EA 3QNNA 3S3MA 4CEOA 4DTMA 4MKBA 2XGQA 2FJVA 2OPPB 1HNIB 3E01A 4EBCA 3L2VA 1LW2B 3MF5A 3QGGA 3BGRB 4N47A 4RNMA 5KFUA 3KHLA 4Z4EA 4NCBA 1NJYA 2KQ2A 4CJKA 1CXQA 4M3TA 3DLHA 4DTNA 5I3UA 4O0JA 4CJ5A 4BWMA 1ZBHA 2HHTA 3I0RB 4URGA 4JS4A 5C25A 3RBDA 3IRXB 3CYMA 1T05A 2HAIA 4QWEA 1TL1B 3KLGA 1SUQB 5F8JA 2FLPA 5F8GA 2ASJA 3OLBA 1ZBLA 3L2WA 2JC0A 2X6NA 2ZKUA 4ECRA 3LP0B 4Z4FA 4OLBA 1IKWA 2BQ3A 3KLHB 4ZPDA 4CGHA 3V6KA 3PO4A 5KT5A 3KLEA 1S1TB 5DG9A 4K4YA 4K8XA 1RCHA 5CYQA 1J54A 5C25B 5KT7A 1Q8IA 1L3UA 1S0MA 1CSJA 1IKXA 1JXBA 4AHSA 4DLGA 4XIUA 2YHBA 1N5YB 4CEZA 4CF8A 4Y2CA 4DSJA 3DYAB 1VSDA 2FBYA 3NF7A 4CFBA 3RB0A 4LD0A 3OYNA 1RDCA 4W5NA 2KFNA 1S1VB 1K1SA 4WE1A 3AA4A 3GYNA 2IBKA 4ID5A 4IQXA 4FJKA 1TAQA 4MFBA 2JC1A 1LW2A 2ITGA 3RMCA 3NHGA 3RR8A 4KKOB 1RYSA 1KFDA 3DRPA 2G8KA 4NLTA 5JS2A 1U48A 4JUZA 4C8KA 1HYZA 4KV8B 1WSIA 1UOCA 3CFOA 4NYFA 3IN5A 3H4BA 1TK8A 3HVWA 3O3GA 3OY9A 3QETA 2JLEA 5JUMA 4KAIA 4K4VA 3PJWA 3EYZA 3VA3A 1IG9A 3RAXA 1JLFA 3L2QA 1S48A 3SJJA 4Y1DA 4J9RA 3HM9A 2VWJA 4IG3A 4I2QB 1JX4A 2ASLA 3HVRA 4J2EA 4HKQA 4HYKA 4K4TA 3B6PA 3OYCA 1Q9XA 4B3OB 4I2PB 2RF2A 2YNFB 3OSPA 1REVB 1YTAA 4WZMA 3MEDB 4DG1A 3V9WA 3LDSA 3PX4A 1GOBA 4NLGA 5KG4A 1S0OA 4CGIA 4JRPA 4WZQA 2WTFA 1VSLA 1Z4UA 2JEGA 1S1XA 3VN5A 1S9GB 3H4DA 3TI0A 1R0AA 5FDLA 3ZSZA 2UVVA 1EP4A 4G3IA 3QLHA 2Z1JA 1Z26A 3V9SA 1S9EA 3M8PB 4F3OA 5J2NB 5D3GA 1RBRA 5EUHA 1S1UB 4N76A 3CJ4A 5CY4A 1G15A 2VA2A 2AX0A 1UWBA 3I0SA 1SKRA 2XGPA 3L2RA 2F96A 3PR4A 5KFSA 2RF2B 4NLQA 1WSFA 4CJ3A 4ICLA 4Y34A 3FRZA 5E41A 4Y1CA 4FS1A 3NH0A 3CJ5A 2GBZA 4HVJA 3OLAA 4CFCA 4QOZB 3C94A 2I5JB 4IKFA 3ZSQA 3PX6A 4ZHRB 2BGGA 5KG0A 4C8NA 1SH0A 3VQCA 4MIBA 2AWZA 1RTHA 1C0TA 5J2QB 3G6YA 1RT5B 3MXJA 4CIFA 1UWBB 2BRKA 3PO5A 1C1CA 5DLFA 4CJEA 2R2UA 5L1JA 1A5XA 1BQMA 4B9VA 3QGIA 2JEIA 1NKCA 3PZPA 4Z0UA 3HJFA 1RT6B 2VG6A 4EEYA 2C28A 1LWCB 4F4XA 3NF8A 4DFMA 1RT3A 1FKPB 4QWCA 3KOAA 1IO2A 1WSGA 3V6JA 5KFYA 4RU9A 3SNNA 1NHUA 3MEDA 4MK7A 1R0AB 1DTQA 1WAFA 1D9FA 4YR3A 3PJXA 4Z4IA 4ECQA 3ALYA 1D0EA 3N6LA 1EKEA 2R2SA 4KB7A 2NUBA 1TKTB 3VQPA 3AV9A 4ELVA 3NF9A 1JLBB 1N6QA 4RW7A 3OYHA 3RRHA 1IKXB 3S9HA 1BCMA 1FK9B 2W9BA 2HNDA 3T3FA 1TL3B 3T19A 2D5RA 5CYQB 4ZP8A 2UUWA 3AO1A 5KFDA 4DSLA 4CHZA 1RA7A 2VG5B 4FLZA 4NZ0A 2OZSA 3GV5B 3I0SB 4BE1A 4J9QA 5K14A 1IKVB 2D41A 4WFXA 2HHSA 1JLFB 3DRPB 5DLGA 2OH2A 1TGOA 4IG0B 2YKNA 2QE5A 4TQSA 4GMJB 1NK4A 1HJRA 4DTOA 4OJRA 4IFYA 4O3RA 3CVKA 2W9AA 1ZBFA 2KZMA 4O5BA 3AA2A 2IA6A 5F9NA 3WNFA 4B9MA 4Q43A 2FBVA 1BIZA 3H2LA 4FZXC 2DY4A 3CM6A 4ZVHA 2ZQBA 1S10A 3BJYA 4CEDA 4YNQA 1VSMA 1C0UA 4ID5B 3NMAA 1HYVA 2RKIA 3MEGA 5L1IA 2D7SA 4R8UA 2QKBA 4CGFA 2OPSB 3PHEA 4AHCA 3Q8SB 3DYAA 4KFBA 1XC9A 4H4MB 4I2QA 4IG3B 2GC8A 1TK5A 2DFFA 1CLQA 4DSIA 1W25A 5KT6A 3RB4A 2YNIB 4HUGA 4CK1A 3AA5X 2HVHA 3IGNA 3BSOA 4DQIA 2R8IA 4IG0A 4ZTJA 1S9FA 1Z25A 2HVIA 1IM4A 5DQHA 4DTPA 1JL1A 2RDIA 4ZP6A 1RBUA 3KLHA 3KKSA 1GOAA 4DS5A 3M9OB 3ZSYA 4CHQA 4E7LA 2P5GA 3MR3A 3IRXA 3M9NB 4J9SA 4FLXA 3JYTA 4RG8A 5EWFA 3I8DA 4IRCA 3CDEA 1S1VA 4O3OA 4RUAA 1SUQA 4ZPBA 3KNAA 4FVMA 2FVRA 1XHZA 3BDPA 1ZTWA 2FJXA 5F8HA 1WNEA 2EHGA 4NRUA 1BHLA 3AO2A 4DMNA 4CJVA 3DM2A 1VK0A 5C24A 1GX5A 2E6LA 3PW4A 2HHUA 3GIIA 1XI1A 3B6OA 4I7FA 5FRMA 3BQ1A 4YP3A 5F8MA 4KI4A 3MECB 2ZD1B 1QSYA 1KCFA 2Q3SA 5KG1A 1LAWA 3QIPB 1K1QA 1IKYA 4IFYB 3E51A 4F4WA 3OYAA 3DOLB 4WYLA 3HKWA 1U09A 2XCPA 2E9ZA 4DQQA 1QAJA 4C8LA 1XHXA 4GC7A 3LP0A 3N6MA 3DLGA 4PWDA 2HWIA 3UR0A 1JLGB 4KBIA 3QZ8A 3SQ4A 4W5TA 1HYSA 3ZT4A 3HT3A 2KFZA 1C1AA 1DTTB 4FS2A 4ZP7A 3THVA 3AVKA 2VWKA 4FJ8A 4ZMMA 4Y2AA 5KFVA 1TKTA 1QUVA 4LH4A 5KFXA 5D3GB 5KFEA 3FFIB 4QWDA 4ECYA 3I5AA 4ED3A 5CZ1A 3I5BA 4FCYA 1WN7A 1QTMA 1HMVA 1VRTB 3VQSA 1RBTA 3SUQA 1L3TA 4LSNB 5HRRA 1S1XB 3ZCMA 4O4GA 5HROA 1RA6A 4CF1A 3ZT2A 3DRSB 4AHRA 4FJJA 2E4LA 4N41A 1SV5A 1C1CB 4DFJA 5HROB 1UA0A 3NH2A 5KRTA 5KFPA 3T5KA 1ASWA 1C0TB 3O3FA 3OJSA 2HHXA 1REVA 3V9XA 4FJ5A 3KHHA 2ATLA 3OL6A 4G1QA 4RW6B 4LSLA 4ZHRA 4DU1A 3UIQA 1ZTTA 2I5JA 3NCIA 4FJMA 5HLFB 2KW4A 3NDKA 3DOKB 1TV6B 4KHUA 1DLOA 3EPGA 3MR6A 3WNHA 1D9DA 3AVNA 3LP3A 1TKDA 4CFDA 1CXUA 3CJ3A 5L9XA 4C8MA 4URSA 1MU2A 1UA1A 3G10A 5J2PB 4IH7A 4O3NA 1RTIA 4IFVA 2RN2A 1BIUA 2HNYB 5HBMB 4CFAA 3TAGA 3L2UA 2QV6A 4KKOA 3TR8A 1QAIA 1KLMB 2WONA 4ED8A 5KFKA 2JGUA 4XPEA 2V0NA 1I39A 5DMRA 2XY7A 3QZ7A 1KVAA 3ITHA 3KK2A 5FDLB 4ECTA 4KTQA 4O0IA 4XO0A 4CE9A 3HPOA 5F8NA 1RBVA 4B9LA 4M3WA 4OLAA 5HRSA 4RNNA 2AGOA 2HNZB 3WNGA 3OL8A 3N6NA 4I9QA 5J1EB 4AHTA 1HNVB 2R8GA 2VG7B 4Q0BB 1N4LA 4HCBA 1LWFA 4NLWA 3A2FA 1KHWA 4O44A 4O3PA 2DPIA 4N56A 2FVQA 2YNFA 2WOMA 2OPRB 4F4YA 3F73A 1L5UA 2GV9A 2D3UA 2FVPA 3TAMB 2HNZA 3GIMA 4K4UA 3MXIA 4DTRA 3RBEA 2CKWA 4CECA 1KFSA 4CJPA 1W0HA 2IM3A 4CEEA 2YV0X 4ECXA 4EO6A 2FVSA 1ZETA 4CGDA 1RT1A 4DTXA 2UVUA 1KVCA 3OJUA 4M3UA 3AVAA 3SZ2A 1FKOA 4C8OA 1LWEA 4RUCA 3AVIA 3BREA 2HMIA 3SQ1A 2YKNB 5KFGA 3MEEA 3KIOA 3CWJA 3VQQA 4RW9B 4RW4B 4DU3A 3QEWA 2F8EX 1NJXA 3HVAA 1RILA 3V1RA 3WNEA 1X9WA 2G8IA 3ZSVA 3QGHA 2VG5A 3NAEA 1S97A 5L1LA 5KFZA 5KFNA 4YR2A 2BE2B 2FJWA 1IH7A 1DLOB 3HPGA 1HQUA 1RTJA 4AILC 4WXOA 4N5SA 3ICLA 2OPSA 4G1QB 2E9RX 1C1BA 3DLEA 2WK4A 3C6TA 3QEXA 3KK2B 4FZZA 3AA3A 2PYJA 4BDZA 3V1OA 1J9AA 3TABA 4U6PA 1U49A 1LAVA 3JSMA 4CERA 3DMJB 4LSNA 5HBMA 3L3VA 2XY8A 1WAJA 2W9CB 3ITHB 3ZT3A 3LAKA 2I1RA 4FM2A 3T1AA 3S3OA 2IAJB 1RT1B 2YHAA 3TAFA 1XR7A 2R7YA 3QEVA 1NJZA 2PY5A 3LZJA 3PVXA 2Y1JA 3UDLA 1JXEA 5J2PA 3NGIA 2WOMB 3U3YA 4R5PA 3OYIA 3OYEA 2Y1IA 1J5OA 4IKAA 2D3ZA 2G8HA 2W9BB 4OKKA 3NGYA 3VQAA 1JLEA 2BDPA 2D0AA 4ED6A 1SV5B 4MH8A 2QKKA 3HP6A 1WLJA 2P51A 4KHQA 3DLGB 2OZMA 5EDWA 5KGWA 4J9OA 4QPXA 3BQ0A 3SYZA 3DOLA 5KG5A 4O3SA 4M42A 4Q5VA 1VSFA 4OKJA 4CESA 2HHVA 3SUPA 1BQNB 2YKMA 1QHTA 1ASVA 3BSNA 4OGCA 4FLYA 3PW0A 1D5AA 2UUTA 1TQLA 4Z4GA 3FFIA 4KO0B 4IRDA 4YFUA 4PUOA 3D0PA 1RTDA 1JLEB 3GIJA 4NLYA 3OYDA 1S0NA 4CJLA 5KFQA 4NCGB 3BR9A 1VSEA 5EWEA 1B9DA 5KFWA 4DF4A 4JS5A 1RYRA 3VQ9A 1HYSB 4CIGA 1RBSA 2DFHA 1U47A 5KFIA 3K2PA 3D5MA 4DL5A 3CFPA 4FJ7A 1YT3A 4CHNA 1SL0A 2R2TA 3SFUA 2IC3A 2ETJA 4CJ4A 3DOKA 1QSSA 4ECZA 3OS1A 2AGQA 4KI6A 4FK2A 4LSLB 3G86A 3D45A 4ED0A 4QWBA 3KTQA 3SI6A 4IH6A 2FLNA 4NCGA 4WFZA 4KV8A 3NL0A 4F8RA 4NYZA 1JLGA 3QINA 2OPQA 3MECA 3DRSA 5J2NA 4FK4A 1U04A 1I3AA 2W7OA 3HL8A 3OS0A 4FLVA 4BACA 2YNIA 3PW7A 3AVCA 4MFBB 1VRTA 3IS9A 1S6QA 4HUEA 4FBUA 3DM2B 3LP1B 3V6HA 4NRTA 4E1NA 3H59A 5F8IA 4K8ZA 4R8UB 3LZIA 2OA8A 3MEGB 1WSHA 1WSJA 4F4ZA 3LPTA 1S49A 2YNHB 1WNSA 3ASMA 5L1KA 2W8LA 3SCXA 3LWLA 1RDBA 1TAUA 4IDKA 3RB3A 1D1UA 4R0EA 1SKWA 1S1TA 4JV1A 4E0DA 4KPYA 4RW9A 2B6AB 3KLIB 4PY5A 2WRMA 3DI6B 5HP1B 2HMIB 4BE2A 1RDRA 4K4XA 4M3YA 4LQ9A 4PWDB 3G6VA 4ZVFA 3IAYA 2AQ4A 3LALA 5DQGA 3AVHA 1Q9YA 1T03A 4O3QA 2W7PA 1ZYQA 2IOCA 5K14B 3MFIA 1I6JA 3PW5A 3KLGB 4B08A 1QE1B 3V1QA 4YR0A 1S1WB 3V4IB 3AO5A 4GC6A 3AVMA 3IGVA 2RKIB 5KFCA 1UAXA 1SH2A 1LV5A 5KFAA 5J1EA 2ILYA 2R8HA 3AVFA 2IGIA 4PQUB 4FM0A 2WHOA 2XWYA 4CF0A 1S6PB 3QEIA 2C2EA 1S5JA 4DS4A 3G0ZA 1VSIA 3BSCA 4B9SA 4Z4HA 4AH9A 3CM5A 4CHPA 4MK8A 3P5JA 2ALZA 4DSEA 3OYKA 2DTUA 1C2PA 3OVNA 1VSJA 1RT3B 1KLNA 4FJXA 3RAQA 4DSKA 4KTWA 4W5RA 3V4IA 4KHMA 4H8KA 4DL3A 4RNOA 2GUIA 2OYQA 4E7KA 3OYJA 2XO7A 3BSAA 1RT2B 5J2QA 2X74A 5T14A 1BL3A 1LW0B 5KT4A 1IKWB 1TVRB 5C5JA 3CIZA 3KMSA 2F8SA 3H08A 4NLPA 3DRRA 3HHKA 2B4JA 4DL6A 4DQSA 3VQ5A 2X6SA 1EETB 2A1RA 3KJVA 4KFBB 4ID1A 1HPZA 3ZSOA 4RW6A 4FJLA 3OYMA 5FRNA 3KD1E 4KTZA 3V81B 2XHBA 3RWUA 1SL1A 2YNHA 4QW9A 3G6XA 5KRSA 2R8JA 4DTJA 5I3UB 1N6QB 3EZ5A 1S4FA 3U6FA 1NK5A 2IM2A 3T5LA 1RNHA 4IR9A 3UQSA 2IJNA 2ZE2B 4RNFA 1CZ9A 4PUOB 2C2RA 3PR5B 1BQMB 5KT3A 1SH3A 3C6UB 2P5OA 3QO9B 3KK3A 4J2AA 3LP1A 4LQ3A 4CJWA 1EP4B 5KG3A 2Z1GA 4E1MA 1S6QB 2BQRA 1FKPA 2RDJA 3SQ2A 3VQ6A 3OL7A 4WFYA 5DG8A 2UVRA 3HP9A 1TK0A 3NKYA 3GV8B 1JKHB 2B5JB 2OPQB 4DF8A 3RB6A 4LH5A 4OL8A 3K5LA 1VRUB 1B92A 3CJ0A 4J9NA 4MIAA 1KVBA 3DLBA 3M8QB 2BQUA 4ELUA 2DPJA 4H54A 3K5OA 1BI4A 1KHVA 4RZRA 4FLWA 2X78A 3Q8PB 4HCCA 4CIEA 4DTUA 3QIDA 3TAPA 1EETA 3OYLA 4W5OA 3GV7B 1BISA 3H98A 1WSEA 1JLBA 5HLFA 5KFTA 1S1UA 5J2MB 3PX0A 3KMQA 1XR5A 2E6MA 3RR7A 4EYHB 2IM0A 1S9EB 4K4WA 4NLOA 3RTVA 2V4RA 3TAQA 1NK9A 2AX1A 2W8KA 3LPUA 1JLQA 3AVGA 1LWCA 5I42B 1JKHA 2VG6B 4RW8B 4E7IA 3JSMB 3VQBA 1JL2A 3C95A 4CF2A 4FJIA 4NLUA 3TANA 3QO9A 3KK3B 5KFHA 4Q45A 4TY8A 4F2RA 4B3OA 3QERA 4B9UA 4EBEA 4JLHA 2G8UA 4CK2A 4MK9A 3NBPB 3KJVB 4CEQA 3SFGA 3PW2A 3PY8A 2HHWA 2LSNA 4KAZA 4FM1A 4M45A 4ICLB 4EYIB 4R5PB 4F3TA 5KFRA 4I2PA 4B8AB 5KFJA 3M8QA 1U45A 1SKSA 1L3VA 4EP5A 3GQCA 1N56A 4KSEB 4M94A 5JXSA 1XR6A 3VQDA 3HYFA 3DRRB 1NK7A 2UVWA 4L8RB 3TAEA 2FC0A 3MEEB 5SWMA 4CF9A 3QEPA 2IAJA 3CG7A 3EZUA 3K58A 5C42A 4NCAA 3M8SA 4CCHA 4FXDA 4TXSA 3KLIA 2B6AA 2BR0A 4H4MA 4Z4CA 2O4GA 1YTUA 3L3UA 1HQEA 2IDOA 3I5CA 3LP2A 3D28A 2RPIA 1X9MA 4PQUA 5HRNA 1N5YA 3KK1B 2GIRA 3V9UA 5KT2A 2IM1A 3OHBA 1RT7A 3VQEA 1C0UB 3KKRA 4EZ6A 1MMLA 4E7HA 4WE1B 4DFPA 4O55A 1CZBA 2CJQA 2R8KA 4FJGA 1QE1A 1HNVA 4Y3CA 4Q8FA 4ZPAA 3H5XA 1JLAB 2J6TA 3AO3A 2WCXA 3NAHA 3IS9B 2Z1HA 4IRKA 1T03B 2FLLA 1T7PA 2G8FA 3CDWA 1LW0A 4FBTA 4PA1A 4ZPCA 3MAQA 3VA0A 4CEAA 2XY6A 4WYWA 3VQ4A 5T7BA 2YNGA 2J6SA 1SL2A 2QK9A 4EBDA 2P1JA 2XC9A 1TL1A 4FYDA 4CJFA 1JLCB 4YQWA 4E7JA 2O5DA 3ISNC 2V4QA 4Q8EA 3O3HA 1LWEB 4DLEA 4JRQA 1J53A 4EZ9A 4J2DA 3DI6A 5HP1A 3GILA 3CFRA 1NJWA 5KFOA 3NBPA 4FW2A 4OPKA 1T05B 2EC0A 4QAGA 1ZBIA 4FLTA 3QESA 4IH5A 4OPJA 1F21A 4X2BA 3OYGA 3AO4A 2OPRA 1A5WA 4IR1A 3BGRA 4DTSA 3QIOA 3KLFA 3DLKB 1JIHA 2OPPA 1GX6A 4ZP9A 1RT6A 3LP2B 4O44B 2C22A 4FJNA 1S1WA 1KTQA 1W9HA 4CGGA 1NHVA 3MR5A 4HHTA 3O4QA 4FJ9A 5C42B 1BQNA 5DG7A 1NKBA 5DK5A 2KTQA 4M41A 4CEFA 4DL2A 2QXFA 4IOBA 3FQKA 3VQ7A 3LWMA 1ITGA 3T5HA 5KFMA 3V6DB 2PYLA 4NLDA 3K5NA 1KLMA 1TKZB 3FDSA 4JV0A 3H5UA 5HRPA 2FBXA 4MKAA 4F2SA 2O4IA 4QWAA 1BI4B 2WB4A 4DSFA 4KHYA 2VA3A 2FVCA 4LY7A 4HTUA 4CJQA 1VRUA 4FK0A 2IC3B 3OL9A 1RDDA 3QYYA 3P83D 3U3GA 5KFBA 4ED1A 4MQ3A 2G8WA 3ISND 1RTDB 3HXMA 3TARA 5CYMB
chains in the Genus database with same CATH superfamily
3ILJA 4HI1A 3WDOA 4BR5A 2JJ4D 4X4VA 1WEXA 3CJTA 3R1LA 2EWSA 4J9VA 4CO5A 1RT4A 5KAKA 3FC9A 3CSKA 2K3IA 4U8VA 1FDBA 1RAIB 4M5KA 1IBMF 4F50A 2ZD1A 3GOIA 4OX7A 3SUNA 4PG7A 4I7FB 3QMLA 5CE3A 1ZH5A 2C1EB 4FWPA 3B8AX 4LF5K 3R5GA 2WBMA 2ZH9A 1VSHA 2YH1A 1UJ6A 1EQ0A 3IBCB 3T5JA 5K9FA 3ZT0A 2PN6A 4P9SA 4J9LA 5KQDA 9RUBA 3ZTOA 1JXLA 2RD5C 2QWOA 4OYBA 2BANA 5CA5A 3NNHA 3TEHB 1D4XA 5GIOA 2XCAA 4O23A 5K8OA 1CLFA 3KWMA 4IOAQ 2XSJB 3QNOA 3FBBA 1ZBSA 4WTYA 1VDHA 1XWLA 3QT5A 5AFUH 3IG1A 2HWHA 3PUFA 3THXB 4JB8B 2P9LB 1U6FA 4M5GA 3OPKA 3C15A 1IJJA 1N48A 3MM8A 1DGKN 5A0YB 1ZBUA 1QVFM 2VCPA 3TQ1A 2K7KA 5AQTA 1KRPA 2JWKA 5EY4A 4EAHD 3G4SS 4B1ZA 3GSIA 4N8NA 4M7XA 4BC4A 4B9TA 2MKKA 2FHJD 2MSSA 4DQ8A 2NZ4A 4CHYA 4AFFA 3MTKA 5CQGA 5C24B 3IFEA 4K50A 3AGKA 4RTFD 2HOEA 2HS4A 3FQLA 3D1QA 1QSLA 1U0SA 4DFKA 1WWHA 2BE2A 3M2RA 3FSIA 5GAEP 3FCWA 4QYZJ 4B8CA 3SMZA 5BRDA 3OBIA 3BN4A 3TWHA 4I9LA 5CHCB 5EWGA 4NLBA 4PPZA 3S3NA 3EY1A 5IV3A 3KK7A 3HZGA 2I38A 2E1ZA 4LREA 4M5NA 3PRVA 1B0PA 2A10A 1DY3A 5DM7L 4A2BA 3HX9A 3DGVA 2HNDB 1X0FA 2B9WA 3WEEA 4QS8A 5THWA 2Q0RA 1GAOA 1HQUB 3NY0A 4IUFA 2EXUA 2OFGX 1TMJA 1URNA 2LQ8A 3UPFA 5EU7A 4MJKA 3KWIA 1X8DA 4O0NA 5SZTA 4WFNL 3EWGA 4K4SA 4LF6F 4KPCA 4RW8A 4FNHA 4RW4A 3DDKA 2W6KA 3M8RA 1QHAA 2ADBA 4JV2A 1RGVA 4U7CA 3NCQA 5LL6Z 5B0EA 3ZSWA 3MR7A 1NLKL 1V3RA 2HGNA 3Q8RB 4BRHA 3EM1A 3CCTA 4ZDNA 1C0MA 3MFHA 2PO4A 2NNWA 4DL4A 1NNDA 1U1OA 3PIPL 3OYFA 1WF1A 4A8KA 3LQVA 3MR2A 2ZM6K 1ASUA 4CZCA 1WI6A 1IJEB 3HSTB 1OH6A 3BBCA 3OVBA 4Y2MA 1BA0A 4OZLA 4J5OA 4Q0BA 2DNPA 1S12A 4UQGA 5IFMA 5CXTA 2FDNA 2AZ3A 3KHRA 1U8WA 1FD8A 2ROGA 2V2KA 4DL7A 1YJTA 1HNIA 3HO1A 8ATCB 3M9MB 4ZVEA 1HR0K 2NPFA 4DV6F 3RMAA 2D0CA 2FB0A 1ICEB 4J8FA 5BREA 3HVTB 4WXWA 4M3ZA 3BPSP 1N0UA 1SC1B 4KHPF 3BZQA 4DV3F 1LXJA 2N4CA 3HPHA 2HYIB 1CJKB 3RMDA 3PV8A 2IMWP 5IWAF 1NM2A 5RUBA 1VQ6S 2DR7A 4DCJB 4QYZK 4ZVQB 2HGMA 4AT1B 2FBTA 1FWPA 3AVBA 3AQOA 4LF8J 4EP4A 2GO9A 1IM6A 1LWXA 2E5IA 5DQIA 3DAWA 3NH1A 4TY9A 3CCRS 5AZJB 3P45B 4CDIA 3A5MC 2RHKA 1RTZA 1YJNN 3D6MB 2VQFK 2H9ZA 2OIHA 2QZ8A 2X1GA 5A6WA 1YBAA 4HL9A 3BO3A 5BPMA 4DTMA 1Z05A 5ETQA 2E7VA 3RU0A 3SAGA 3I56N 4OYWA 4EBCA 1HPMA 1JCFA 5KFUA 3KHLA 4QIVA 4M3TA 1WEYA 3WXMB 4V1Ak 4CJ5A 1ZBHA 1FVQA 4LR7A 3VAHA 5C25A 1VOMA 3M2VA 2BM0A 2H5JB 4USJC 3G6ES 3KJNB 1XMOJ 2DGQA 2FLPA 5F8JA 2MKIA 3L2WA 1NZAA 2O8BB 2UXDK 1FJEB 2BTFA 2X6NA 2ZKUA 4Z4FA 1VQKS 4OLBA 1IKWA 1HBUA 1VK8A 2BQ3A 5A8KB 2G4BA 2UU9K 5KT5A 2HQGA 1TUGB 2KI2A 3O6QA 3W61A 2ZM6J 4ZA1A 5DG9A 4K4YA 4K8XA 4KT0C 5CYQA 3H1VX 3T9NA 1CSJA 3IR5B 4DLGA 4AHSA 1VC0A 4I68A 3ZEUA 4Y2CA 4CFBA 2EKNA 4BREA 2JWLA 4LD0A 4NXNK 4WE1A 3GYNA 2FXUA 2XB2D 3IBFB 3G4SN 1F0XA 2JC1A 4X4NA 3NHGA 2HHHK 4U7UD 3BR8A 3CUNA 2F5GA 1NSAA 3O1WA 1YJ9S 1WOSA 5JS2A 1AFIA 4JUZA 2DIUA 1HYZA 1FVSA 1HR0F 2VQFJ 1EWQA 1REGX 3QSIA 4DXLA 3IN5A 3H4BA 2ZDPA 3HVWA 3QETA 3JSRA 2JLEA 2CAJA 5AZIB 3L2QA 3TUIC 3SJJA 4Y1DA 2O8BA 4KQZA 2VWJA 4TNOA 3PIPQ 1JX4A 1R8AA 2HG4A 4HYKA 3VPZA 2MZRA 1Q9XA 2FHKA 5IT4A 3ENHA 4I2PB 2KH9A 1S99A 3P31A 3HHNB 2P9KA 4NL5A 2MQMA 3MEDB 4WZMA 3P39A 4DG1A 3CDBA 3QWPA 4NLGA 4LFAJ 2ZVSA 1SJQA 3O6WA 5EGYA 3U27A 3SQGA 2JEGA 1RHQB 1JCGA 1OYEA 1K73O 2UVVA 1PG5B 2P9IA 2E29A 3LPEA 1EP4A 2DH9A 4G3IA 3QLHA 1EQYA 4GNIA 4F3OA 1Q78A 5D3GA 1WB9A 3SQGB 4H0PA 2KHOA 4F0HA 2O8FB 1VQNS 4N76A 3M6UA 1G15A 5FJ4A 1S22A 1UWBA 2KO1A 3I0SA 5ETKA 3DDNA 1X9JA 4BC9A 2BOPA 3PR4A 1Y3JA 2G0JA 2RF2B 4NLQA 2GQQA 3AB4B 4DV1K 3SQOP 3FRZA 3GYXB 3NH0A 2PT0A 5FLXY 4P7TA 2KN4A 1KOOA 4JBCA 3HHLA 4QOZB 1H2TZ 3WUHA 1N54B 2PDAA 3CEDA 3PX6A 1ZM3A 3MMAA 2UV8G 4B3RJ 2GAHC 3VQCA 1RTHA 2F65A 2RB7A 5AXLA 1JXVA 5ADXH 3MMBB 3AOBA 5L1JA 4CLLA 1PAUB 3HD1A 2JEIA 3HJFA 5BJRA 1RWXB 4EEYA 1RT3A 4QWCA 3FNNA 3ILOA 3P49B 3ZO7A 1DTQA 2C2ZB 2OD6A 3EXYA 1D0EA 1NPPA 3CTRA 4QU7A 3VQPA 2GGPB 4H0XB 1N5QA 2VJUA 4OYMA 1IKXB 3S9HA 2B56A 2XSFA 1FK9B 2W9BA 3MDFA 3M32B 3OTOJ 2XLJA 4NB4A 4BC2A 1TL3B 4BC5A 4OQJA 5CYQB 3SLCA 2UUWA 3ZZRA 2R7WA 5KFDA 4DSLA 4BRPA 4IO9Q 2U1AA 3HI0A 3FE1A 2OZSA 4AXJA 4CM2A 3GV5B 3I0SB 5C0YA 4BE1A 2FC9A 2MY8A 4LF6K 1YUWA 1IKVB 4WFXA 2FD2A 2HHSA 1T11A 5DLGA 3ZC4A 3L7OA 1NK4A 1NB7A 4USUA 2YI1A 4OJRA 4AL6A 4YDUA 3CVKA 1SJRA 5FIIA 4DZ6A 4NI2A 3CCRN 3KDNA 4GO7X 2FBVA 2YKQA 2YQ0A 3CM6A 4BVOA 2FZKB 4CEDA 1RZMA 4L3NA 3OTBA 2VWBA 1WOQA 4C0HA 1NGIA 2WVFA 2QKBA 1RWOB 3PHEA 4CBXA 4AHCA 4KFBA 1QQOA 1XC9A 4IG3B 2GC8A 1LKZA 2H54B 4HUGA 4CK1A 2DXDA 1B0VA 3IGNA 3BSOA 4F3QA 3TVZA 4FKXA 2QMUB 1NSKL 3G71S 1UPMB 5DQHA 4AYBD 4DJBA 4CZHA 2DEIA 3QBWA 4CHQA 4CZMA 3AAQA 1ZAWA 1J5EK 1UEVA 2AF6A 5JLFA 3AARA 3TZYA 3M9NB 3JYTA 4FVCA 2QL5B 2GWKA 2DNKA 2LU1A 1SUQA 1YRXA 3KNAA 1PJ6A 1Q0NA 4ZCLA 5F8HA 1CS4A 1R8CA 4B3RK 3THYB 3AO2A 4DMNA 4LF4J 1OKJA 5C24A 1GX5A 4BR4A 1K0TA 3GIIA 1ESVA 3BQ1A 4BC7A 4PHTX 3MECB 2VF3A 3HD2A 5KG1A 1LAWA 3E51A 4F4WA 1LXNA 3DOLB 1HI1A 2HF4A 4WYLA 4DQQA 2MQPA 2JFDA 4GC7A 3WT0A 3DLGA 3OXLA 3IMQJ 3PRBA 1JQGA 4CLSA 1ZA1B 5CD4A 2VKZG 5G4DA 3QZ8A 1N36J 3CMES 3SQ4A 2YY3A 5AE3A 4W5TA 1HYSA 4FOEA 2KFZA 2BJ9A 1C1AA 1S6OA 3GU0A 4DV2F 2NLWA 2CQ2A 1UZDA 1QUVA 5KFXA 5D3GB 4DR7K 4QWDA 4FCYA 1IG8A 1RAHB 4X62J 4FWKA 3CULA 3VQSA 3SAHA 1CG2A 2XMWA 3BY5A 4JI2F 1L3TA 2RRNA 3R7BB 2CPFA 5BR8J 5HRRA 3ZCMA 3OHRA 1SJ1A 4CF1A 3ZT2A 4AHRA 3AHPA 4N41A 1C1CB 1UA0A 5KRTA 2HHXA 2ZBIA 1REVA 5A2QU 4CM0A 2XMUA 5AQIA 4J37A 4ZHRA 1MMNA 5I9EB 1NBEB 3DGPB 4CLTA 3RW6A 2DH8A 4U7BA 1JCEA 3VENA 3R27A 3EPGA 3MX2A 3ENOA 1D9DA 2NRWA 3LP3A 1MWYA 3CJ3A 5L9XA 4E2FB 4DPWA 4Q7AA 1S0VA 3NRBA 2RH3A 1ZXOA 1RFQA 1JJCB 5IWAK 1VQNN 1WTBA 3WC2A 1NU0A 2RN2A 1J27A 3BKTA 1FI4A 2ZZNA 4CFAA 2UU9J 3TAGA 1WKLA 4LF7F 4KKOA 2WONA 3Q0AA 5HATA 2A6MA 2JGUA 4C11B 4ZN3A 3UFCX 1J5EJ 5FDLB 1K8AT 4YHHJ 1AFJA 5F8NA 5ETVA 3D9BA 2ZHAA 4OLAA 2AGOA 3OL8A 2R8GA 2VG7B 2QYCA 3CMAS 1IWAA 4IXCA 4O3PA 2DPIA 4U7UK 1X7VA 3NVKA 1ZM4A 3MPWA 2OPRB 2LQ5A 2D3UA 3GWCA 3UVJB 3TAMB 2G2YA 2HNZA 3GIMA 3V5RA 5GAGP 2VD3A 2CKWA 4CJPA 4CEEA 2MB0B 1U2VB 2HRUA 1ZETA 2UXBJ 4DTXA 4XK8C 1WC1A 4A8XA 1FKOA 1LWEA 3WXLA 1P27B 2HLUA 2YKNB 3MEEA 3DCAA 4JI3K 4RW4B 3NS5A 4X62K 1NJXA 2BA9A 3QWUA 2XSJA 1C0GA 2G8IA 5GADU 1YBUA 1WACA 3D0HE 1SQFA 4FYVB 4DV2K 1S97A 3OD2A 5AQMA 1UETA 3R9PA 5L1LA 2IRUA 5KFNA 3ETMA 4BLGA 4FXWA 3HOTA 4DU8A 5HMYA 2YJEA 3NVMA 4BQLA 4AILC 5ETNA 4N5SA 1OY8A 2OPSA 3WXIA 3QBXA 2CJKA 3MCNA 4UOFA 3QEXA 1S7HA 4DV7J 1ZAVA 1VQ7S 5GAHI 3AA3A 1GXUA 3LDLA 4K43A 3V1OA 4F4AA 1S3XA 4CERA 4NXMJ 3IXQA 4UF4A 2IVYA 2M9KA 3G8TA 3CCWA 2MQNA 2KT3A 3KXDA 3L3VA 4IO9L 2C2NA 1VR6A 3ITHB 3ZT3A 5AZJA 5EOYA 3T1AA 2IAJB 1FNMA 3WQTA 4H0OA 4CD1A 3VF0B 3M8YA 1NGGA 2ZHBA 2XM3A 1HNWK 1EARA 1HR0J 1NJZA 2UYTA 2Q0UA 2DHHA 1Y4ZB 3H42A 4CBWA 1CBKA 4A8OA 2HS0A 3OQ2A 3WXJA 2FHMA 3W8PA 4R5PA 3OYEA 2Y1IA 1Y7PA 3FZFA 2W9BB 4OKKA 1JLEA 1BE4A 3AD9C 4MH8A 1APSA 4BR2A 1R3NA 5HSPA 2P51A 2D0OA 2LU2A 3VF4A 2M5YA 1H3DA 4J9OA 4QPXA 3BQ0A 2QFJA 4CRJA 1VSFA 7FDRA 1PBAA 3DU5A 3SUPA 1YITS 3D54A 3BSNA 4OGCA 1D5AA 4C98A 2UUTA 3TNVA 3FFIA 4KO0B 4WYBA 4A62A 1X5OA 4BR0A 1G3OA 3VEWA 5U47A 3TO8A 1YZ7A 1X5TA 3AAWB 2ZOMA 2OO4A 1MROB 4OV6A 2P9KB 1RYRA 1HYSB 1VQ6N 3G71N 3CFPA 4DL5A 1RAGB 1YT3A 2MDAA 2A5XA 3BH7B 4LR8A 2HGLA 4KI6A 4LSLB 1DEJA 3G86A 4PABA 1RKJA 4F8RA 3DLJA 4ZIVA 4C8ZA 5D4PA 1JLGA 3QINA 4PKHA 3C3LA 3H2VE 3ZETB 3MECA 4MIWA 3D2FA 2ZJQL 3JTNA 3TX0A 2NRXA 3CJ7A 4ENOA 3OS0A 3P5TL 3KNGA 3ID6A 3AVCA 2FJBB 1S6QA 2VFUA 5F8IA 2V8PA 3EUNA 4K8ZA 3L95X 1IV0A 1RAFB 2JX2A 4R8UB 1C0FA 2Q31A 1WSHA 4F4ZA 1S49A 3BDEA 3LM9A 4DV3J 5L1KA 4HACA 1L3KA 3KFWX 4IWVA 3K2YA 1TAUA 2OD4A 1ZC6A 1SKWA 4FDFA 1S1TA 2M88A 3DNCA 4PY5A 5EX5A 2J8AA 5AFUA 3CMEN 1HJOA 1FRLA 2HWTA 1I51B 2AKWB 1WF2A 1FXLA 1D3WA 3I56S 4KGMA 3AVHA 4O3QA 3NWGA 1LEOA 1I6JA 4A8YA 1E4GT 1QE1B 1N5VA 1Q95G 1NMNA 1X4AA 4TVAB 3V4IB 2UU9F 2GJ2A 4X66K 3CJBA 4ZJOA 4CZEA 4MT1A 4YHHK 1QVGM 4LFBF 4A5AA 5J1EA 4OI4A 3DRXA 2WHOA 4GO5X 2XWYA 1S79A 2C2EA 4JI2J 1S5JA 3BSCA 1G7CB 4CHPA 2KM8B 4OI3A 2XS5A 4CW7B 3K7RA 3OVNA 4FYXB 4FJXA 1R6VA 5J1PA 5BN8A 1M1KO 4LF6J 4NYPA 1KVIA 1AROP 1UJ5A 4NX9A 5B09A 5CAAA 4HWIA 1SPBP 2X74A 1LW0B 1SC6A 4QU6A 3IUCA 1R43A 2YWFA 4OI1A 3M1FA 4PQAA 3ZZPA 3NG8A 1A0OB 1N0VC 1ZPWX 4B3SF 2VDIA 2X6SA 4RWXA 8RUCA 3VQ5A 1EETB 3J7AP 4KFBB 3ILLA 4HI2A 2QJ3A 3A8YA 2NYIA 5C10A 2ZHOA 5FRNA 4XH4A 3ULHA 4AQYK 4JHDA 1MROA 2YNHA 2HBYB 3D0GE 3G6XA 5H1SQ 1N6QB 3U6FA 2RMLA 2IM2A 3B4MA 3UQSA 2IJNA 2C2RA 2A2DA 1BQMB 3UWTA 4NMXA 2P5OA 4J2AA 3LP1A 3M8WA 1VAZA 5IC4B 4V19J 3PYFA 2GS8A 2J9EA 1QVFR 3VQ6A 3OL7A 4WFYA 2B4VA 5DG8A 2UVRA 3HP9A 1HNWF 2OSQA 2OPQB 3RB6A 4OL8A 3K5LA 4LFCF 1VRUB 2GEMA 1GK8A 4MIAA 1KVBA 3VTIA 3DLBA 4WKRA 4HDHA 2L9WA 3K5OA 4NA3A 1KHVA 1T9XA 4IO8A 4FLWA 1YJVA 1FRHA 4CIEA 4DTUA 3GE9A 4W5OA 2Z2YB 2F8HA 2DNOA 3G8QA 1XR5A 2E6MA 2VOOA 4JAXA 2RDDA 2MHNA 5GAGU 3VALA 2YXLA 2RRBA 2LEPA 1CC7A 4UOGA 2GX9A 2AX1A 2W8KA 1XNQF 3KVGA 1LWCA 3J81Y 4LF4K 2KJWA 1JKHA 3EGNA 1AXQA 4PWUA 4CVNE 3S01A 4HEA9 3OA9A 4B3MF 4BRNA 3D3BJ 3OUYA 1P8ZA 2X7IA 1VQ7N 2P9SA 2W2OP 4U96A 1U1RA 4H5WA 2XTJP 4LC9B 3T7ZA 4JLHA 3H6EA 2XG8A 5CZVA 2QEXS 2HHWA 1RUSA 2DGWA 3EEQA 3W5YA 3D66A 3O8MA 4F3TA 5KFRA 2V6AA 3M8QA 5K8NA 4MLHA 4C0BA 4EP5A 2CRLA 1CC8A 5M2RA 3HYFA 3WIUA 3PNIA 5SWMA 1KNZA 2FHJA 1R27B 3CG7A 1UFLA 2MJNA 2XMVA 1A7GE 3K58A 1YVNA 2ZBCA 4TXSA 3QAUA 5ADZA 1YTUA 2AJ4A 1HQEA 1VGYA 1GQEA 2ACMA 1MWMA 5HRNA 1E6YA 4HH0A 4PAAA 2GIRA 3RW7A 1FJGF 3V9UA 4QIGA 1IBMJ 1C0UB 2GVZB 2LQBA 2OTJS 2RS8A 2JHEA 5K8MA 1VQSA 3FK4A 4ZVTB 2CJQA 2VQFF 3NGRA 1FHTA 5MLCV 1R0CB 1JLAB 4I6YA 4ATNA 8AT1B 2WCXA 3IS9B 2Z1HA 1VJQA 1T03B 5ETTA 5ETOA 2G8FA 2C2MB 4YOVA 4FBTA 2QYGA 4C11A 4RUHA 1QUPA 4ISFA 4WYWA 3J81O 4NXNF 3W2VB 4LRCA 2QK9A 2P1JA 2XC9A 2AIRB 3HDSA 2R4FA 2WAQD 1YXQA 1XIQA 2VDHA 5DS7A 4YQWA 3ISZA 4E7JA 2O5DA 1FRJA 2CXEA 2QXLA 4NWBA 4F67A 4JRQA 1J53A 1Q53A 4EZ9A 3DI6A 3AAPA 4MO5A 3K0JA 2ZJQQ 1XNRJ 1NJWA 5KFOA 3NBPA 2IBOA 5JICA 1A9NB 3NOCA 1T05B 4FLTA 2E1PA 4C1NK 2HQDA 4IO1A 4OPJA 3UN3A 1A5WA 4IR1A 4GY2B 1EKRA 5GMEA 1TTHB 1JIHA 5LY3A 1T95A 2BXJA 1GX6A 2C22A 4FJNA 1S1WA 2FY8A 2MQLA 1NHVA 2JWNA 2FHOB 4LBHA 1RADB 2FZCB 4XDDA 5C42B 2MZJA 1BQNA 3A3OB 4F9OA 2UXBK 5AQFA 1HI0P 2YWKA 5E3QA 4IOBA 3FQKA 4JI5K 3VQ7A 3ONQA 2PYLA 3V6DB 1H7WA 4JV0A 4FPRA 5HRPA 2FBXA 5ETMA 4MKAA 4F2SA 4DB3A 3IM8A 4OX9F 3T1HF 4HT7A 2HF3A 3TSUA 2Q2RA 4DSFA 2K1RB 2UUCJ 2FVCA 3VV2B 3ILIA 4HTUA 4CJQA 1RAOA 4FK0A 2DRBA 2WSFC 1KC8O 4HTIA 1VBXA 3OL9A 4FYYB 1RDDA 1VBKA 4L3KA 1V6HA 1UVLA 3PJ9A 4MQ3A 3ISND 1RU1A 2OMLA 2VASA 4G1PA 2EC2A 3TARA 1R8HA 5CYMB 2Q79A 5IT9O 3CC2N 2Q3PA 2BJ3A 2E5JA 2B4UA 1NOZA 4ECVA 4ZCMA 4K4ZA 3C6UA 2W9CA 2GIQA 4TN2A 3MXMA 5LMNF 3J7Z5 2O8CA 3CD7A 1KAYA 2XRIA 2QL9B 4DBQA 1NK0A 1HNXF 1K6YA 2IVNA 3JQJA 3DLKA 3LOUA 3C6TB 4KB0A 3DLEB 4NXMK 4NLVA 1HMVB 1GEHA 2WUSA 1V3SA 1HD1A 1U0HB 3P1GA 4ED2A 1TFYA 4H0VB 4C8YA 3OSNA 3ULEA 3ZZYA 1YVFA 3ZX2A 3D1OA 2KLAA 4DR4J 1FT8A 2JFKA 4FLUA 2DHAA 3KWGA 4OJHA 3UDCA 1JLCA 5E7OB 2B5JA 2P8IA 2W6LA 3GFZA 4QOTA 2WVEA 4F25A 4BRGA 1V9OA 2LDYA 3ZSRA 4ZPWR 2D0BA 4IOXA 2J6UA 4QIWD 3SI8A 1FRIA 9ATCB 4K25A 3QAEA 2DGSA 1AW0A 4RX6A 1K47A 1RDAA 4ECUA 1NGFA 1NHKL 5DGBA 1IR2A 1W7WA 1RB0A 2ZVIA 3BBFA 3LDNA 4CJSA 3KLFB 3ENVA 3H5YA 1X3MA 3NOGA 3OVSA 3KD5E 2BRLA 5F0WA 2GVDB 1N36K 2VPZB 3SPZA 1N32F 1TUUA 1TKXA 2PA3A 4DU4A 4KREA 2M8HA 4J9KA 4ZJQA 4EO8A 2YCHA 1TU0B 3CCUN 1LCUA 1RJJA 4Z94A 3K57A 2B4PA 2HFSA 3H90A 2HBLA 1YX2A 2YX7A 3OYBA 4J90A 2KXHA 4GKJK 4O4RA 5HMWA 2UXBF 1IKVA 4ETZA 1NOYA 5DDQC 3TAMA 4IDKB 2FSKA 1YG0A 1FKOB 4EWTA 3CMAN 5L9NA 4JKHA 4TSXA 4WQ5C 4B17A 5DZ6A 3CF5L 2DJWA 1T94A 4AL7A 1ITPA 2M8DB 1FK9A 2IS3A 1B9FA 4RW7B 4CLFA 4DR5K 1H0HB 4DV6J 3SV4A 1BWVA 5A2QY 3L8BA 4M7YA 4BDYA 3H3OB 4F36A 2XMMA 1H72C 4KIAA 3CJCA 2G2OA 3D3CJ 1S72N 4FPBA 3KK1A 1RQ0A 2XI3A 3NE6A 4ITSA 4NLRA 5CABA 2HNYA 1X9SA 2P6SA 1IBKK 2E5LF 4OGEA 4ZPVR 2HW3A 2MLZA 4IBNA 5AQJA 4CLUA 1F9EB 4O8UA 2BANB 4ECWA 3DHWC 4W90B 2IRXA 2QRRA 2CGLA 1NLVA 5GAEU 4DR2J 3VVUA 1HKBA 2VFSA 3OS2A 4WJBA 2A18A 3V9ZA 5M1QA 4R25A 4DV1F 4CJTA 3ULDA 4FO0A 3V6DA 2G8VA 1BQXA 1Q16B 4DHYA 1RAJA 1OS5A 3SSRA 3VVTA 5KG2A 3AVLA 2L08A 4DQRA 1BCOA 4ED7A 3QLHB 1KN6A 4LF8K 4ES1A 2E44A 2QL7B 3VGMA 3THWB 2D69A 3LUYA 3T1HJ 4OX9J 4P2SA 5BPLA 4ILMA 3C65A 3K59A 1EX4A 5D0GA 5BR8F 1NAQA 1FTCA 3BQ2A 4Q44A 2EX3A 4H4OA 2ZE2A 3IG1B 2FPHX 4FZYA 5AJ3J 3MZIA 4CHOA 4GW6A 4CEBA 4BDPA 1RGIA 4M95A 1IBCB 1DAXA 2CPEA 4M3XA 5F9LA 3NGUA 2ASYA 3CDUA 1ZM2A 2J7WA 4RNHA 1KAXA 1HKCA 2O01C 1GLEG 2RQMA 4CI6A 4FKYA 2E66A 4CJUA 2IJFA 4FZVA 5F8LA 4N8OA 2I7PA 2Q36A 3PSIA 3JTOA 3EPIA 4KGZB 1KQSM 4BE0A 5KFLA 2QWMA 3TP2A 4UY85 3PDNA 1R8BA 1ULRA 4DV3K 4Y28C 2HQFA 2VGNA 4I4BA 3RVCA 4ZIWA 1WHWA 4LIRA 2FJVA 1DBDA 2OPPB 3E01A 3W5ZA 5B0AA 2UUBF 3BGRB 3PRDA 4N47A 4RNMA 2I2YA 3WQUA 1B70B 3O5BA 5M1PA 4DR5F 4BRQA 3Q23A 2KQ2A 4CJKA 2M4MA 3CGIA 2E2OA 5DJBA 4L3QA 3DLHA 3KG1A 2MPUA 4BC3A 4DTNA 5I3UA 1CPZA 4JV5F 3FGUA 2B7CB 3I0RB 1Z2LA 4A46A 3RBDA 3IRXB 5CCLA 3G9CA 3E8OA 4PL8A 1BMQB 3CYMA 1T05A 3I55S 3FBCA 3HI9A 4QWEA 3KLGA 2HVZA 3PG9A 4RPFA 2LKZA 1M5PC 2Y8YA 4MYTA 2JC0A 3T1YF 2E7WA 4A59A 3P6YC 1Y11A 4LRAA 2OJ3A 2LP4A 3SCIE 2MSTA 4P52A 4ZPDA 3V6KA 2MGZA 3LTOA 1UW9A 2CNKB 5F3ZA 1RCHA 1RBLA 3FMWA 2DCLA 1HFEL 4OX6A 5C25B 3DXBA 1NDLA 3U7JA 1JXBA 2Z2MA 2BJ8A 2YHBA 3OFEA 1N5YB 3BH6B 4CF8A 5AQGA 3MMCA 1VSDA 2FBYA 3NF7A 3D2EA 1NDPA 5TKYA 4IOCQ 4DPXA 1S1VB 2IBKA 2LEAA 4IQXA 5M1NA 1V4SA 2W7AA 2O1PA 3FZBA 4X4TA 1RYSA 5DM6L 5E26A 4YOXA 2MGZB 3SCLE 1KQSR 4NYFA 3D0IE 2RRAA 4FWOA 1B0TA 1TK8A 2NRHA 3AY9A 2COLA 3OBYA 5JUMA 4K4VA 1IG9A 3EYZA 3VA3A 3T1YK 1S48A 1T9TA 4M5LA 4J9RA 3JB9k 1S7IA 1UEKA 4J2EA 2J0QD 3B6PA 5H9FK 4B3OB 5E0OA 2YNFB 3V9WA 1Z6RA 3GZ7A 1GOBA 3O80A 4JI4J 4RO0A 1JJHA 3P96A 1S0OA 4CGIA 4WZQA 1VSLA 4DR3F 3F9MA 5BYRA 1NO8A 2Y1RI 4MDAA 5LMUK 5HMZA 4JKDA 5FDLA 3ZSZA 4X65K 1Q79A 1X60A 1VS3A 2F9JA 3H1QA 3O44A 2G0IA 2Q66A 1S9EA 1UFKA 4LFCK 5J2NB 2GJIA 1RBRA 3MCOA 5D6GA 4YY3F 2GWJA 4LMZA 2AX0A 1GT8A 3L2RA 4ZLJA 3I4HX 4LBPA 4I6MB 2GHWA 1NSQA 1GXTA 2X1AA 3Q7CA 1WSFA 4CJ3A 5JVHQ 5CD4H 2J8SA 2DNLA 4ICLA 1I3OB 1OJ4A 3HZEA 1ACMB 2AEFA 3OLAA 3W2WA 3C94A 1RHMB 1SAZA 3ZSQA 1WDDA 3US5A 4DMZA 5KG0A 2CDRB 2V8HA 2ROPA 1C0TA 5AJ3F 2R7XA 4CIFA 1UWBB 2BRKA 3AD8C 1C1CA 1K73T 2QT7A 3IMXA 3PZPA 2VG6A 4UY8O 4F4XA 3NF8A 3Q2TC 2DB1A 5EVZA 2EG2A 3GFXA 1IO2A 2RU9A 3N28A 3U9DA 3ZZ0A 4CT8A 1WAFA 1U1PA 3ALYA 4C6AA 1N33J 3N6LA 1EKEA 4PYAA 2R2SA 3E2EA 1UW4A 4ELVA 2DHSA 1N6QA 4LRBA 5ITHA 3RRHA 1WF0A 5IM0A 1VQMN 2JZ5A 4JYAJ 1OQ6A 2XZTB 3VR1A 1SJ4P 3E66A 2M3DA 1YI2N 3NGTA 3P3DA 2D41A 3NS6A 1JLFB 3DRPB 3FZKA 3FZLA 5AZIA 3RZAA 1TGOA 4GMJB 3SCKE 3VGTA 5JMVA 3NS7B 1HJRA 2NUUG 4O3RA 2Y8WA 2IFXA 5IS2A 1AB8A 2KZMA 4O5BA 2IA6A 5F9NA 4B9MA 1T3OA 2V2ZA 3VHQA 3W60A 5LJWA 5HVHA 2XMTA 1SJFA 4YNQA 1VSMA 3MEGA 2OTJN 4R8UA 2CQ0A 2LA4A 4OFZA 2CPDA 3DYAA 4I2QA 5LOQA 3ZFVA 1TK5A 2DFFA 1CLQA 2BABA 4DSIA 2NPIA 5AQVA 4K2JA 1CJVA 3RB4A 2YNIB 4CT9A 3AOAA 2VICA 2XYGB 4DQIA 2ZM6F 4JKGA 2R8IA 2EFPA 3BN7A 3C7NB 1S9FA 2HVIA 1IM4A 3AH6A 3QICA 4DTPA 3TW0A 3VZHA 3KLHA 2O67A 2J0XA 4DS5A 3CJKA 4B1WB 4E7LA 3MR3A 1B99A 1NGAA 2HBKA 3HSGA 4J9SA 4DUYK 4C3MA 2FSJA 4RG8A 5EWFA 3I8DA 3BDPA 1NJIT 5JLHA 5E3PA 4I64A 1WNEA 2FYXA 2K7JA 4NRUA 5FPDA 4E1JA 3UNYA 1EB0A 3DM2A 3ADAC 2E6LA 3R8EA 3PW4A 3H25A 1NCLA 2M70A 1E6YB 3UI3A 2AYBA 4ILGB 1OVQA 4YP3A 2ZD1B 1QSYA 4EHTA 4X4SA 2I6WA 1IKYA 5M1FA 4IFYB 4M5DB 3OYAA 1QAJA 1XHXA 3BYRA 2HWIA 1VQPN 2QA4G 3W2WB 2R7VA 3QATA 2ALYB 1JWWA 5HN0A 1OIAA 3HULA 2B7BB 1I1GA 2H51B 4KBIA 3U02A 3FJ2A 3K17A 3A8JA 3ZT4A 1F3VA 3GJRB 1DTTB 2RE1A 4A5BA 1OSCA 2ZBPA 2HKEA 2D9PA 3A8KA 4JKCA 2JRSA 2BJ7A 1WELA 3BF1A 5EN1A 4FJ8A 3QNWB 5BPNA 2L9DA 2B8PA 4ILRA 4CNYA 1NGBA 3KUEA 1U0HA 2VPYB 4ED3A 5CZ1A 1IBKJ 2WZ1A 1QTMA 1UL3A 3CC2S 3KKFA 1MWKA 2HVEA 3LDQA 2RJZA 3E1YA 3DRSB 1IBLF 4FJJA 3BKFA 4JI7K 5HROB 2LYVA 3NH2A 5AXKA 5LJ5Y 5A6PA 3T5KA 3BO4A 1NDCA 3O3FA 3OJSA 1FRKA 4G1QA 1U2FA 1KQKA 3NCIA 4EUVA 5HLFB 4KRWA 1TV6B 2DITA 4KHUA 2UUAK 6FDRA 3HZ6A 1FESA 4OI2A 3O9QA 3K9JA 3I96A 4CFDA 2PD1A 1CXUA 4C8MA 4URSA 3G10A 1GLFO 4O3NA 2ERRA 1RTIA 4GRSA 3CXCR 4B3TF 1WG5A 2AW0A 1FJGJ 5HBMB 2O8FA 2GELA 1HIYA 2QV6A 2H4WB 2B9XA 1Q81T 4ED8A 2PEHA 3HKZD 3GTYX 2CJXB 2V0NA 2HBZB 4ECTA 4KTQA 4O0IA 1QAYA 2KDOA 1NSPA 3WXKA 4RNNA 3ZX0A 1E4FT 3N6NA 2QSWA 5J1EB 1HNVB 1N4LA 2V63A 2KVQE 3GG4A 2UP1A 2U2FA 1N36F 3D6FB 2XZWA 3MUMP 2ZH7A 4B3MJ 2FVQA 2GQCA 3R5AA 2P9CA 3CQXA 1AUSL 2UUAF 4ID8A 1L5UA 2FVPA 4GKKJ 4DTRA 4CECA 3A5NC 4FWQA 2IM3A 2UXCK 2YV0X 4JP8A 2FVSA 4CGDA 1G99A 3SDEA 2UVUA 3OJUA 3O3LA 4WF9L 4RUCA 3BREA 3TUJC 3CJSA 4OJ3A 5KFGA 2CQHA 3VQQA 4RW9B 4DR3K 1OH5A 3QEWA 3IKMA 1I94F 4CO1A 3HVAA 1RILA 1TYQA 2VGMA 4PL7A 1PCAA 3QGHA 2VG5A 5E2QA 1W7AA 1EKSA 1CJTA 4YR2A 5AQQA 3UN2A 3LPYA 4USTA 1DLOB 2W2NP 3LO3A 2NXUA 4QYRA 4HHUA 1RTJA 5GMDA 5HQ8A 3H7HB 3SK3A 3NMRA 2OI2A 3DLEA 4CLPA 4JD2A 2DH7A 4DUZF 4BDZA 4I69A 3B6BA 3TABA 1KONA 2R42A 1FEHA 4LFCJ 5ADXA 3JSMA 5DDPC 4IEIA 5A8KA 1P1TA 2ZFHA 1U1MA 5T7LA 3KDOA 4C3LA 3S3OA 1SIZA 2QMXA 2PMZD 4B3SJ 4RWWA 2F1FA 3CD6S 1KD1T 1WOOA 5BR9A 3MURP 2VONA 3LZJA 4AF1A 2Y1JA 5J2PA 1NMEB 2WOMB 1OY9A 3EE3A 4I6MA 2Z2ZA 2Z0GA 3TZZA 3N01A 5IM0B 2HVDA 4IKAA 1FJ7A 3NGYA 3ETOA 2BDPA 4ED6A 3DGPA 3P5BP 1WLJA 5H9EJ 4CLZA 1S72S 2QMWA 3DLGB 3DXSX 2OZMA 5KGWA 2XBPA 3S6EA 1RP5A 1ZZFA 3LDOA 3MM6B 4M42A 4IOCL 5B0DA 3OV7A 4CESA 1S4EA 4I6WA 4NE9C 2YKMA 1ASVA 4FLYA 3ZETA 4ZCKA 1WSRA 1YHQN 4IRDA 2C42A 4YFUA 3KG4A 3D0PA 1JLEB 3GIJA 3OYDA 1S0NA 1XNQJ 1EIYB 1WHXA 1ZM9A 5BR8K 1VQ8S 1VHFA 1KD1O 2GAGC 4UOHA 2EG1A 2ZUAA 3VQ9A 4CIGA 3UD4P 1U47A 4Q2LA 3K2PA 3D5MA 5C2CA 1VISA 4FJ7A 1SL0A 2EFGA 5DDRC 2R2TA 3DOKA 2DGXA 3VGLA 4HLBA 4ECZA 3OS1A 2AGQA 4EIAA 2Q1LA 4ALZA 3D45A 4ZOSA 4BRKA 3D2WA 3KTQA 2MEWA 2Y1LB 4YORA 1W97L 1RBAA 3NL0A 1QAXA 2Y9HA 2O8DB 3NXZA 1IBLK 4NYZA 2CNOB 5K20B 2HHHF 4PKGA 4JI6F 4CP5A 3CCES 3MGJA 4UZBA 4DX8H 1KEKA 3DRSA 5J2NA 4FK4A 4LFBK 1X31C 1I3AA 2RSQA 3R5CA 2KRRA 1SB6A 1VRTA 4HUEA 4XEIA 3V6HA 1WC4A 1C4CA 3OTOK 1RDWX 2CQGA 3MCPA 1OWXA 2RQ4A 5A8RA 1QVGR 3IO1A 2OA8A 3M6WA 4W98A 3M1VA 3ZZZA 2LQJA 1KAZA 2QLXA 2XULA 2G13A 2VIHA 4GKKF 2YKAA 1VQPS 1LFWA 4JV1A 2UUAJ 3KLIB 2Y0BB 1P8GA 4F02A 2HMIB 1RDRA 4U95A 2KVIA 1FE0A 3RBZA 4LQ9A 4Y0WA 2QA4N 1Q82T 1NH7A 4JKGB 4ZVFA 3IAYA 4PG4A 3VWSA 2E5HA 3LALA 3QJPA 3UVJA 1TL4A 3F41A 1YI2S 4AQYF 3KLGB 2MZQA 3KHYA 3V1QA 4YR0A 2BJEA 1K9MT 3AO5A 3ENAA 3IGVA 5KFCA 1U1KA 1JK9B 4Z7CA 3S7RA 1LV5A 1LOUA 5KFAA 2ILYA 2EPIA 2IGIA 2NREA 1SJ3P 4PQUB 2HFNA 3D2EB 3QEIA 4HT5A 3G0ZA 3TUPA 3I55N 3EICA 4MK8A 4DSEA 4ILLA 5HQMA 3SMPA 2DGOA 4DSKA 3BP8A 4DV5K 1CJUA 3V4IA 4DL3A 2Z56B 2B3TB 3CJKB 3AODA 1BO5O 4C4WA 3AY0A 2BEFA 3MMBA 2F3JA 1FFGB 3SBGA 2BUNA 1RT2B 1IBLJ 1TVRB 2DHGA 1FX4A 2Y0SD 3H08A 3ENBA 3HHKA 1HHTP 3EZOA 4DQSA 3TWZA 1NEEA 1IBKF 3BO2A 2D1CA 1FA0A 1U24A 3HLUA 3ZSOA 1BXNA 2J0SD 3KD1E 3V81B 3S8SA 2VUGA 4HACB 3N4WA 2CDQA 1ILYA 4OZJA 4DTJA 1FEEA 3EZ5A 1S4FA 1NK5A 4OI0A 2XQCA 3T5LA 1GMVA 1WC3A 1RNHA 2ZE2B 4KR0B 2XHWA 1WHYA 5KT3A 1SH3A 3C6UB 3J80O 3MCAB 4DV5F 1EP4B 2YX4A 3VEXA 3PHTA 2RDJA 4B3SK 2A1BA 3MX5A 2JL9A 3NKYA 4USVA 2QTDA 1QQMA 4DF8A 4NMLA 3EX7B 2EFQA 1B92A 1YWXA 2CQPA 3CJ0A 4J9NA 2RHQB 1V4TA 2BQUA 4ETXA 4ELUA 2UXCF 4OX8A 3RSEA 2DPJA 1WTFA 3A0IX 2Z57B 1FNXH 3MI7X 1H98A 2X78A 4HCCA 1EETA 3OYLA 1BISA 1WSEA 4K7QA 5KFTA 3KMQA 3PIOL 3RUBL 1W26A 5BN9A 2R7QA 2UXDJ 2PAVA 3IA0A 4EYHB 1XQIA 2IM0A 5AQZA 1S9EB 4OYIA 3TTDA 1N34K 4LF1A 2MKHA 3TAQA 2YX1A 3DDIA 3OUYB 5HQLA 1P6TA 2I0XA 3IR6B 4E7IA 1WKKA 3SEOA 3JSMB 2CQBA 2CYYA 4CTAA 1JL2A 4PEOA 1UCNA 1UJ4A 3UDEA 1WBBA 1Y9OA 2LMIA 4CF2A 3TOQA 2VFRA 2PBDA 2VBZA 3GR1A 3QERA 2AJFE 1RHUB 4OHXA 3KJVB 4B3TK 2WVBA 5ETLA 2ZWOA 5IWAJ 3PW2A 1M1GA 3PY8A 3EGWB 2IY5B 2LSNA 3GJTB 4DR6F 4FM1A 4ZVOB 2C3PA 4JKAA 4I2PA 4JKBA 1YHQS 5KFJA 1U45A 1SKSA 4M63A 3W5XA 4Q2MA 1VQ8N 1X0PA 3EGZA 1XR6A 3VQDA 4RR5A 2QWRA 2AJ1A 2UVWA 1WEZA 4X64K 4FWNA 3VETA 4CF9A 2IAJA 5HI7A 4OLOA 3C2PA 1VQLN 3QSYB 2EI5A 4PXBA 3HM8A 4NCAA 3M8SA 2QTWA 4NXMF 4RBUA 2ZH6A 3UCGA 2P9NB 1ZS6A 1N33F 4YOYA 5K8PA 3Q24A 2CJYB 3D28A 4O8KA 4PQUA 2OFHX 4DN0A 3KK1B 1P1LA 4ED4A 3OHBA 3VQEA 4Z2XA 2KB2A 1QZ6A 3K9KA 2OMOA 3AFGA 3DN9A 2AJ0A 3VAMA 1CS4B 1B7FA 1BU6O 2W2PP 1F2GA 4CBUA 2VODA 3ZEUB 4ZPAA 3H5XA 3AO3A 4DCPB 3O08A 2FLOA 2FLLA 4CZLA 4FP9A 2B0GA 2MZSA 4AQYJ 3MPVA 4ZPCA 3MAQA 3VA0A 5BYSA 1R89A 3VQ4A 1WHVA 2ASMA 4BR7A 4YOWA 5I3QA 4FYDA 2BYCA 1NG9A 4Q8EA 1NM1A 1VI7A 3L3CA 3O3HA 3KJQB 5CYJA 5HP1A 1U02A 1EX8A 4WU3A 3T69A 5D4LA 4BRAA 1ZBIA 3QESA 2MYFA 4IH5A 4X84A 4P71A 1F21A 4X2BA 3A3PB 1CJKA 5IZHA 2LXIA 2V4JB 5FPMA 3KLFA 3P4IA 4H4KC 3DLKB 5L8RC 1JNZB 4LF8F 2OPPA 5H9FJ 2Q6BA 3I4PA 4O44B 1KTQA 1MMDA 4CGGA 3MR5A 1DT9A 2P9NA 3N4PA 4ILHA 2QM1A 5AQSA 4FJ9A 1TELA 5DG7A 3J7YU 4G1IA 1CULA 4AD6A 1NKBA 2FF6A 1VQLS 2KTQA 4M41A 1FD2A 2PMHA 4CEFA 5E3CA 2BJ1A 2YBVA 3VAGA 5C2DA 3POTA 1OO0B 3CCVN 1YBTA 4YB1P 4GVLA 5KFMA 3K5NA 2A3JA 3FDSA 1UFWA 3H5UA 3CT9A 3B8HA 2O4IA 4GVEA 4Y65A 2CNNB 4KHYA 3PTWA 2N3OA 2CQ4A 2VA3A 2DGUA 2BE7D 3I82A 2WTUA 1GNKA 2GFFA 5AT1B 2IC3B 4X4RA 3ZYYX 3QYYA 4KH5A 3U3GA 3O9RA 5KFBA 4FN5A 4OO1J 3TUZC 3ENWA 3CD6N 1AT1B 1RTDB 2HIQA 2MKYA 3IWXA 3HXMA 1VQON 1H73A 1P9QC 2GMHA 4ZK7M 1C6VA 1NK6A 3W3DA 2AYEA 2XY5A 1EXQA 2LQ9A 3QIPA 3UD5A 5I42A 4BCAA 1W2BR 1NRKA 2APOA 2A6OA 2E9TA 1JLQB 1FDAA 4OZ3A 2YKMB 1IR1A 3NNCA 4J2BA 1NGCA 1J5OB 2OTLS 1QM9A 4J9PA 3MMAB 1PKUA 2JOQA 4PWWA 3MOZA 4P75A 4ZVGA 1NU4A 1FXXA 3A3NB 5JS1A 4PG8A 3CW2C 5AQRA 1ZZNA 4A61A 2RU3A 4J9MA 5DM6Q 1QDUB 2DTJA 4NLXA 5CCMA 4C1NI 1WUAA 2W42A 3WQPA 2LA6A 4UQTA 1J6ZA 4TLRA 1R31A 2N4DA 3Q8UA 3NMUA 3M8PA 2YNGB 1F9FA 1D8ZA 4EK2A 3NFAA 4KY3A 4FF1A 2AEJA 5BRFA 2N7YA 5FROA 1DQ9A 3NF6A 1JLAA 1JJ2R 2XNRA 3ATUA 4QCLA 4TQRA 3OW2M 4KHNA 4J9UE 4DEZA 5DGAA 5HOOA 4YOUA 1ZBTA 3MD3A 3OTEA 2F63A 4W5QA 4KHPK 1C1BB 4DQPA 4GV9A 2PMWA 3NCRA 3O4NA 2Z4PA 4ELTA 4JI0K 1HWIA 4LT6A 4FW1A 3QT8A 3KLEB 1YVUA 1QS4A 3OTOF 3S41A 3R7SB 1YAGA 1HQEB 3LANA 1VQOS 3JAMY 4TLQA 2MHEA 4Y00A 4F04B 4CK3A 4KHWA 3JYTB 1TUYA 4DR5J 1FX2A 1Y97A 1HW8A 1NPKA 1Q5VA 2EWHA 3ATVA 2ASPA 4X66F 1HBNB 4PZVA 2CA9A 3MAAB 4KBOA 3NAIA 3TZWA 2CVEA 3PM9A 2CPJA 4MMOA 3MAHA 5KG7A 2YWWA 5KI6A 4CZIA 2YPYA 4Y0FA 4TYAA 4KE5A 3CCJN 2GVDA 3E3XA 2OEJA 1MU2B 2OHDA 5JJBA 4NLSA 1M5HA 2GX8A 4KHRA 1RABB 2KZZA 3CI5A 3MN5A 2HZCA 2J9DE 4RWTA 2VOPA 2JEJA 5DETA 5MLCQ 3PYGA 2DXEA 3C8YA 5EXWA 4NOHA 4N7TA 3DLLQ 5T41A 3D2FB 3O8WA 1Y00A 4DR2K 3EKSA 4QIEA 4PG5A 1T9WA 3CO9A 5KOWA 1HARA 4DWIA 3SQ0A 1RT4B 2J0WA 5A0YA 3RRGA 4F0MA 1RTIB 1MSWD 3AJDA 2F9WA 2ZWPA 1U2VA 4CLKA 2AU0A 2CGKA 1Q5YA 4QZVB 3SJHA 1TV6A 4RUBA 4C48A 1HWUA 4B9NA 1NNEA 4LF2A 4NYNA 5IOLA 2OEMA 2V50A 4CGJA 5EX0A 4LF9F 4NEZA 2BE9B 3M1VB 2EFVA 4E3SA 2ATQA 4OZNA 3Q8QB 5A8RB 2Q6CA 3TVKA 4FWRA 1LWFB 3F2KA 2B43A 2VG7A 4CJRA 4BRFA 3AOCA 4O4GB 4DR2F 3VF6A 4TY8B 4YMEA 1DTQB 1XC3A 1CULB 2QFIA 5KG6A 5CYMA 5D4NA 3W1YC 2KRBA 2N82B 4U8YA 3MN7A 1KVJA 4ZTFA 4OVLA 2HFUA 3O9TA 3M8ZA 2BBEA 2MKCA 4USKA 4JI7J 1RTHB 4DV0F 3VAIA 5HVGA 1NMDA 2XHCA 3R7NB 4ES2A 1IVZA 3SSSA 3FZHA 3J7YI 3AVJA 2ILZA 2NSBA 5C15A 1TKZA 4BWJA 1PBUA 3FBFA 3CCVS 5LMNJ 3HK2A 2GIFA 3TU5A 4AHVA 2EFOA 1AA1B 4E19A 2BVZA 4KHSA 3NGDA 2ZF5O 2QA1A 3FFKB 3PKMA 2R2RA 1U1LA 3HVTA 3BYPA 2CJBA 4TYBA 4D3GA 3QNNA 1XTZA 2NUHA 3OXFA 1VQMS 2RS2A 4MKBA 2XGQA 1HNIB 2PI4A 2HLTA 3QGGA 4M1KA 3O2IA 2AEMA 4NCBA 1P90A 4JK8A 2CWKA 2WFBA 3R6MA 2OELA 1SI9A 1XMOF 3UKUB 2V4JA 2HHTA 3A5OC 2KG0A 3KZBA 4JS4A 3JQKA 4ZLNA 2WW8A 2XNQA 2HAIA 4QQBA 3B82A 3NWRA 4CYUA 3OLBA 1ZBLA 2KKHA 4BS2A 2AYMA 5HANA 1U1QA 1WDTA 3CCEN 3MK6A 1PC4A 4MAKA 3AQPA 1F5CA 3KLHB 3Q22A 1PYSB 3PO4A 4B02A 3KLEA 1HKGA 1S1TB 3U8XA 3MPDA 2VB6A 1FFSB 3JS6A 2A0FB 1TZ0A 1L3UA 2QIFA 1S0MA 4DR4F 1IKXA 2QX0A 3D4JA 4XIUA 4CEZA 4OYPA 4DSJA 3DYAB 1RCOB 1G4CA 2MXYA 4Y2KA 3OYNA 4JI1F 1RDCA 1K1SA 1VLYA 1HA1A 4BRMA 4ID5A 4H5RA 3TTCA 4FJKA 4LJMA 1TAQA 4MFBA 4DV6K 1LW2A 1Y64A 1YRUA 3HSCA 4CQ1A 2IDLA 3RR8A 3W65A 1E3MA 4KKOB 3QFUA 1KFDA 1E6VA 5KQ8A 4WIQA 2QA4S 2FC8A 3DRPA 1M5VC 4CLYA 1DRZA 5M1KA 4NLTA 1EHWA 4H5TA 3J7YP 4ZPTR 4YEAA 3J81j 2ZDOA 1D9AA 1WSIA 3CFOA 4OV1A 1RWNB 3O3GA 5DZ7A 5FLXU 4JI6K 3FRYA 1XQSC 2M2BA 4KAIA 2YKPA 3RAXA 1JLFA 4BVPA 5LMNK 4AUKA 4IG3A 2E1RA 3QJJA 1RWVB 4CYUB 1DQ8A 1X4DA 2ASLA 2FJEB 3HVRA 4HKQA 4K4TA 4DV4K 3OYCA 2HK2A 2NRZA 2RF2A 1RK8A 3OSPA 1X5SA 1REVB 4ES3A 1YTAA 2HMPA 3PX4A 4OJGA 5KG4A 3RAMA 3E9OA 4HR2A 4F3MA 3H20A 3D6HB 1M5OC 2YJFA 1R0AA 2MLYA 3ZTSA 2DNZA 4LVOP 3GONA 2BKOA 5AQPA 2Z1JA 1Z26A 5AQHA 3V9SA 2XZDB 3M8PB 2ZOGA 5EUHA 2JSXA 1S1UB 3CJ4A 2EBEA 1FW6A 2VA2A 2ZJPQ 1NDKA 3BS9A 4WP8A 5HJYA 2XGPA 1Q8KA 5KFSA 3ENQA 3R97A 4WTOB 4KJIA 1LFPA 5E41A 3FBEA 2QW9A 3M2UB 4Y1CA 4FS1A 2R3VA 2F4FA 4HVJA 2AT1B 2KXNB 4CFCA 3JXOA 3AXKA 2BH1A 2V7YA 2I5JB 4IKFA 4DX7A 1EO1A 2BGGA 4WFBQ 4A47A 4C8NA 1SH0A 4MIBA 2QC3A 2GA7A 2F9DA 4DUZK 3LA0A 4TU7A 1CZAN 1MNEA 2DR9A 1XK8A 3MXJA 5E5NA 3IWLA 4L74A 4NASA 5DLFA 2R2UA 1A5XA 4A2AA 1BQMA 1NKCA 5FLXO 4IQMA 2DY9A 1BWEA 1BUXA 1RT6B 1XNQK 5ETPA 5IC6B 3CJRA 2HURA 1LWCB 4DFMA 1FKPB 1GTHA 5KFYA 1NHUA 1YF5L 4YR3A 3GMGA 3PJXA 4Z4IA 3VGVA 2J5AA 1KVKA 1TKTB 3VERA 3NF9A 1JLBB 4RW7A 3OYHA 4JI6J 2C2OB 2OKQA 3H46O 1FJCA 1Q18A 3T19A 2D5RA 3FZ2A 3M3ZA 2MTLA 4ZP8A 2KFYA 2NRRA 2X3DA 2V2QA 3DFEA 1Q7YT 1BDGA 4CHZA 1RA7A 1U6ZA 4NZ0A 4LBIA 4CD3A 4DL0C 4ER8A 2Z30B 1KP6A 1DKGD 2OH2A 1HWJA 3BZCA 2YKNA 2QE5A 4TQSA 3OTDA 4IFYA 3BUZB 2H48B 2W9AA 4UY8T 1ZBFA 3WNFA 3CC4N 1NZ8A 4DN9A 3EVWA 4CZGA 2DY4A 4LFAK 2HBJA 3BJYA 3N0VA 1Y10A 3NMAA 3P4UB 1X4GA 1HYVA 2RKIA 1RWMB 5L1IA 2OPSB 3IRWP 2QA2A 3B78A 5LT5A 3Q8SB 4PG6A 2R7OA 2HBMA 3BGUA 3PACA 4UT4A 4EMDA 4K2XA 1SKUB 3BZKA 1W25A 5KT6A 1T9UA 2H3EB 3AA5X 5AQUA 3VEZA 3FMBA 1GLBG 4LIWA 3PYEA 1V5IB 4TKTA 2DBBA 1JL1A 1GOAA 2WC9A 4LRDA 4QBUA 3M9OB 3ZSYA 2P5GA 5HL7L 4LF4F 3IRXA 2D0PA 2GHVC 4ZS6A 4USIA 3AXMA 4DR1F 3CDEA 4C9DA 3M2RB 4O3OA 2GGPA 3ULEB 2FVRA 1HNWJ 1XHZA 3QB0A 5A2QO 1XEZA 2FJXA 3THTA 2EHGA 4WCEQ 1BWFO 4FXVA 4I67A 3MPYA 3QFHA 1VK0A 4QJVA 1A6LA 2H4YB 1HW9A 3ZZOA 3CCJS 2HHUA 4DUZJ 3R5BA 1XI1A 2EK6A 2VFTA 3B6OA 4YB6A 3N5FA 3BEGB 1XMBA 1H7XA 4DR6K 1WD6A 1RI7A 4KI4A 4FSVA 1KCFA 2VC1A 2PGCA 4B1YB 3BB5A 1Q82O 3JQMA 2B9YA 4BG8A 2HPUA 3HKWA 3LM2A 2NZCA 3NGKA 1SQGA 3HSJA 1IR0A 2HSEB 3QRPA 3HFZB 1B4SA 3CXCM 2FIUA 2G9OA 1X4HA 5G0RB 2NSCA 3GYGA 2YWGA 1QTNB 3HT3A 1X3NA 2HQIA 4A57A 5HK4A 5IQ6A 3B4DA 3AVKA 2VWKA 3W7BA 5C2GA 4ZMMA 3BM7A 5KFVA 2VBWA 4K42A 3CF5Q 1N88A 3GFYA 5KFEA 3R2DJ 3FFIB 3Q7BA 5GADP 3I5AA 3ZNUA 1GFWB 1IQTA 4LF9K 4P73A 4RKUC 1YJWN 3G96A 3OTCA 1RA6A 2Z58B 1HUXA 2XMKA 3MN9A 2LLZA 2DRAA 4CZJA 1HQ2A 3C0BA 4DFJA 1FF2A 5KFPA 1C0TB 5F0UA 4DPTA 3KHHA 3OL6A 3K89A 3CIMA 1O13A 4P72A 4DV1J 4RW6B 4LSLA 4K8RA 2XO6A 3UIQA 1ZTTA 5HMXA 4FJMA 3THYA 3VGSA 2KW4A 3NDKA 3MUTP 1DLOA 2E1MC 1VMBA 3MR6A 1SBRA 3EDQB 4X64F 3EXCX 3RSEB 4B3TJ 1MU2A 4OYZA 5J2PB 3ET6B 1RISA 4IFVA 4ANEA 2YPZA 1Q4RA 4DCHA 4K0KF 3D1HA 3GP9A 1TMMA 2ZH1A 2C3UA 2HNYB 3L2UA 3TR8A 1QAIA 3BGFA 4A8WA 5KFKA 1F2HA 2W01A 4XPEA 3A8IA 2E5LJ 3MOJB 1VRQC 3PFOA 2RIJA 1I39A 5DMRA 3QZ7A 3KK2A 1RHRB 4XO0A 1TUVA 3HPOA 2H5EA 3OR1B 3RRKA 3DKDA 4M3WA 2E2QA 2MQOA 3WNGA 2OTLN 2OP5A 4I9QA 4Q0BB 1LWFA 4JI2K 3A2FA 2IRYA 4O44A 3T6JA 3I32A 4N56A 5M1OA 2YNFA 2V69A 4OPAA 2GVZA 3EVOA 3J8AA 2HZAA 2ZH5A 4F4YA 3GCWP 2BM1A 2DNQA 3DOMB 4DR6J 2J4RA 4AXIA 1RLDA 1WSVA 1HBMB 1HD0A 4K4UA 1W0HA 4ECXA 2GV1A 4QS7A 4BRCA 4HHJA 1RT1A 5C2FA 3LF0A 4M3UA 1VQ9S 3BKUA 1HBOB 3SZ2A 4ZVRB 2HMIA 4DR7J 4OHVA 4P6QA 5KPZA 4UW2A 1R8PA 2F8EX 4JOUA 3UO0A 2VJVA 5HL7Q 2CZ4A 4WU2A 3T41A 3R5DA 4ERDA 3V1RA 3WNEA 2VHGA 3DOMA 1X9WA 3AJ1A 5LM7E 3CO0P 1NGJA 3NAEA 2JVOA 4H03B 3PIOQ 1U1NA 1KQFB 3MN6A 1YIJN 4ZKAA 2UV8A 4WCEL 1RWWB 3TX8A 3EMTA 1YTYA 1HQUA 1HL6A 2GCFA 4WXOA 3TJ8A 2VL1A 5LXRA 4G1QB 4ZCIA 2E9RX 4DV5J 2WK4A 5BRHA 3VTHA 3MM7A 2KHCA 3KK2B 1F5AA 3B54A 3TR5A 1BHNA 2E8AA 1IQZA 2CNLB 1J9AA 1YRTA