4I2PB

Crystal structure of hiv-1 reverse transcriptase in complex with rilpivirine (tmc278) based analogue
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
424
structure length
412
Chain Sequence
IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A comparison of the ability of rilpivirine (TMC278) and selected analogues to inhibit clinically relevant HIV-1 reverse transcriptase mutants.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Hydrolase, transferase/inhibitor
molecule keywords Gag-Pol polyprotein
total genus 114
structure length 412
sequence length 424
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4i2pB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4i2pB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4i2pB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4i2pB03
1RT3A 3H5XA 1RA6A 4Q8EA 3M9NB 2CKWA 1FK9B 4O3RA 2UVRA 1MU2A 2E9RX 2R8HA 5J2MB 2UVWA 4ZVEA 4Q8FA 3NGDA 3IGVA 4F4WA 1IKVB 1RT4B 3C6UA 3GIKA 2YKMA 3T5LA 3OL7A 4RNHA 1LWFA 2V4RA 3EPIA 2RDIA 3RBDA 3MEDB 3KLEA 2IM0A 1S6PA 2OPQA 2XCPA 5KFHA 1JXLA 4EBDA 3ISND 1NHVA 4DEZA 4RW4B 4NLQA 1Z4UA 3KJVA 1GX6A 4NLTA 4R8UA 1SV5B 1SUQB 3MF5A 4ED7A 3H98A 4RW9A 4ZPAA 1FKOA 1LWEB 1JLGA 4RUAA 4R8UB 3GV8B 3IG1B 2B43A 4RW4A 2RF2B 5L1IA 1EETB 3E51A 3H40A 2W7OA 5CYMA 3KLVA 4F50A 5HLFB 5KFLA 1RT7A 4NLWA 1N6QA 4NZ0A 4IH6A 4Q0BB 2ILYA 4ZVHA 4RW6B 3KLIA 1S9GA 1CSJA 2AGQA 4IQXA 2WTFA 2VG7A 2W9BB 2RDJA 4I2PB 1MU2B 3MR3A 4ECWA 1VRUA 4MFBB 1ZTTA 3H5SA 3GV7B 3GYNA 5EUHA 4FBTA 5KFSA 4ID5B 1RT3B 1D1UA 5HBMA 5J2QA 2YNIB 3Q8RB 1OS5A 1TKZB 1IKYB 2WONB 3QO9B 4ZHRA 4GC6A 4J9MA 4K4VA 1NHUA 4B3OA 5KG7A 5EDWA 3MR2A 1S1WB 2VG6A 2C2RA 1C2PA 1TVRA 4TY9A 2J6TA 4KKOA 4IFVA 3BQ2A 1KLMA 3DI6B 5C42B 1S1XA 1D0EA 4ZVFA 1FKPB 2R8GA 5HROB 5J2NA 1I6JA 3ITHB 3RB3A 1C1CB 2RKIA 3BSAA 4MFBA 2HNYA 4H54A 4QW9A 3GQCA 5JUMA 1JIHA 1RTHA 3OL6A 1VRTB 4YR0A 1MMLA 3DYAB 2JEFA 3KLIB 2JEIA 1RT6A 1TV6B 2YNFA 4Q0BA 2AX1A 4WFZA 2DPIA 1S4FA 3TAMA 4LQ9A 4IRDA 2HMIB 4URGA 1S9EA 5DGAA 4ECXA 5KFMA 4F4XA 2IC3A 4LSLB 3CJ0A 4NLSA 4K4WA 5KT5A 2VA2A 1TKXB 4TYAA 5KFRA 1RTDB 2ZKUA 4U6PA 1T05A 3RBEA 4K4ZA 1J5OB 3CDEA 3OSPA 3KK3A 2BR0A 3BR9A 3NAHA 2ASJA 4ZPCA 2HWIA 3LP1B 2QV6A 1C1CA 2RKIB 3DLGB 5KFNA 1R0AA 1C0TB 2D41A 3PW5A 4I7FA 2D3UA 4IRKA 1S6PB 3T1AA 4KV8B 5DG8A 1S1WA 2VG6B 4H4OA 4F4YA 3PVXA 1S6QB 4IR9A 2YNHA 2I1RA 1C0UA 3DRSB 5D3GA 1WNEA 1HARA 1RT1B 1T94A 3QO9A 4ZHRB 5KT2A 4EYHB 4DL6A 2V9WA 1HYSB 1TL1A 2YNGB 4J9NA 4ZP8A 1JKHA 1LW0A 4NCGB 5C24A 4WYLA 2C2DA 5J2PB 4ZP6A 3KLHB 3V81A 5J2PA 2AX0A 2JEGA 1LW0B 1JKHB 3LP2B 1TL1B 5CYQA 3G86A 1RTIB 1S1VB 3RB0A 3ICLA 2XGQA 1LWCB 4O44B 1C0UB 3DRSA 1S9FA 4IG3A 4PUOB 4Y34A 3RB6A 4KBIA 1T03B 5I42A 4KFBB 4I7FB 3CJ4A 3CJ2A 1R0AB 2ILZA 3FFIA 4I2QA 3IRXB 1FKOB 4EO8A 3KMSA 5K14A 4DL5A 1SUQA 4WE1A 1T05B 4NLOA 5EWFA 2YKNA 4KO0A 1BQNB 3TQ1A 3CWJA 5KG1A 2OPQB 2BANB 3BGRB 3KLEB 1S0MA 3QYYA 2FVRA 5KG0A 2AQ4A 4LSNA 2V4QA 1LWFB 4RW8A 3BREA 5HP1A 4NLYA 4IG3B 4PUOA 1RYSA 1LWCA 3HHKA 1K1SA 5KFEA 4IR1A 3PHEA 1VRTA 3MEGB 2ZE2A 3MECB 5C25A 2XI3A 2E9ZA 4Y2AA 4EO6A 2BE2A 1N5YB 1KHWA 1JLBB 2HNDB 4U7CA 4DL2A 5KT6A 2BQRA 1S97A 1K1QA 2O5DA 1S49A 1KLMB 4O4GA 3PW0A 2YNGA 3V6DA 4DL4A 3I5CA 4YMEA 1HYSA 3E01A 4K4UA 2B6AB 4G1QA 2IM1A 3T5HA 4IDKA 3SFGA 1JLCB 1S6QA 2WONA 5JXSA 4Q43A 4K4XA 4Y2CA 4ED6A 1TKZA 4R5PB 4JUZA 5KFVA 4GC7A 5F8LA 5HBMB 3LAKA 2GIRA 5KFTA 5F8IA 3JSMA 1N56A 5KFAA 2OPSB 3NKYA 1SH3A 2UUTA 1VRUB 4JV0A 1U09A 1REVA 4NRUA 1RTDA 4RW6A 3BJYA 1TKXA 3QIDA 1HNIA 2WOMB 4TY8A 5F9LA 3KLFB 3I0RA 1JLEB 1QE1B 2I5JB 3DOKA 4H4MA 1RT7B 4IFYB 4XO0A 4KB7A 4FS2A 4LQ3A 4NYZA 2I5JA 3DOKB 2HMIA 5DQGA 5HLFA 3M9MB 3KLFA 5KFIA 5DG7A 4ECVA 2OPRB 3DOLA 2W8KA 1RAJA 3KOAA 3NBPB 1ZTWA 1HMVB 2OPPB 2ASDA 1JX4A 2XWYA 2FLLA 5F9NA 3I5BA 5F8NA 2OPSA 5KFJA 2JEJA 3IS9A 3G6YA 4ED3A 4IFVB 3DLEA 5J1EB 5F8JA 2C22A 1UWBA 5F8GA 1TKTB 2B5JA 3D5MA 1JLCA 3CDUA 3UR0A 3EZUA 1TKTA 1IKVA 1RT4A 1UWBB 3DDKA 3M8PA 4PWDA 4TYBA 2HNZB 3OSNA 3MR5A 4ECUA 1W25A 1JLQA 4ID5A 4WXOA 3BSOA 2UVVA 2IAJA 2BE2B 2R8JA 2W8LA 3MEGA 1DTQA 3KLGA 1HMVA 2OPPA 3DLKA 1SH0A 5F8MA 3RB4A 4FS1A 4RZRA 3GIIA 4ZPBA 2WHOA 2BQ3A 3DRRA 3KHRA 4LSNB 1C1BB 2EC0A 4ICLB 3H5UA 1TQLA 1XR6A 4URSA 1JLEA 1QE1A 5CYMB 3GILA 4YR2A 1QAIA 1HNIB 2WOMA 4TY8B 5KT3A 3CVKA 3T5JA 2WCXA 4J9LA 2GC8A 4IH5A 3IRXA 3Q8QB 1SV5A 1NNDA 2JC1A 1HQUB 3V6HA 3FFIB 4KAIA 4Q45A 5KFGA 3DM2A 3I0SB 1HQEA 4IOBA 4NRTA 2ZD1A 2BRLA 4WZMA 3MEDA 2R2UA 4YR3A 4Y3CA 2UUWA 4QPXA 5KFPA 4MIBA 3T5KA 5DGBA 5L1LA 4G3IA 4ECSA 4EBEA 2R8IA 5C5JA 1S1TB 4ED0A 2R8KA 4ECYA 2WB4A 4MIAA 2AGPA 3LP0B 1S10A 2C2EA 4J9OA 1FK9A 1RTJA 4ZP7A 2VG5B 4OL8A 4ECQA 4ED2A 4NCGA 2ZE2B 3DMJA 3BSNA 3M8PB 4PWDB 4ZPDA 4WZQA 3PW4A 2V0NA 2ASLA 3QGGA 1DLOA 1T3NA 3FRZA 1DTTA 3H4DA 4RW8B 1QAJA 4QWDA 3KNAA 3BQ1A 1S0NA 1QUVA 3G6XA 1JLFA 1IKWA 2VA3A 5I3UA 3JYTA 4NLVA 1SH2A 4DG1B 3I0SA 1BQNA 3GIMA 2UVUA 5KFXA 2YKNB 5KFKA 1IKXA 4QW8A 1EP4B 4TLRA 4ZVGA 4I2QB 5KG6A 3OLBA 2ALZA 3KHHA 2JLEA 2FLPA 4YQWA 4ZP9A 1HNVB 2ATLA 1HPZA 4TQSA 1T03A 4ED1A 4DL3A 3H4BA 1S9EB 4ECTA 1C1BA 4MK7A 4TN2A 4WYWA 2E9TA 1RT6B 1TV6A 3MFHA 1S1VA 3NAIA 3Q8SB 2J6SA 4F4ZA 3EPGA 4K50A 4TQRA 3KLGB 1EP4A 1RTHB 3KK1B 2FLNA 1IKXB 3D28A 1GX5A 4IG0B 3M8QB 2BRKA 1LW2A 5KFFA 1FKPA 5FDLB 4RNOA 4J9PA 3KHGA 3DI6A 1JLQB 4URQU 3JYTB 3HKWA 4KKOB 3FQLA 2HNZA 3QGHA 4O4RA 3DRPA 4J9KA 4PQUB 4NLRA 4EYIB 2YNHB 4QWBA 4PQUA 1RYRA 3V4IB 2BQUA 3E01B 4MK9A 4O3NA 2FVQA 3DMJB 5J2QB 4J9QA 2XCAA 3QZ8A 3CDWA 4EBCA 3M8QA 3MTKA 3DLGA 3HVWA 5KFQA 5KFCA 3OL8A 3G6VA 4KE5A 5KG5A 3MECA 3C6TB 5C25B 3KK1A 5KFWA 4QWCA 4I2PA 3Q8PB 4RU9A 1IM4A 4EEYA 2VG7B 2W9BA 1S9GB 3DOLB 2HAIA 3SFUA 5KFUA 4RNMA 1RT2A 3MR6A 4XPEA 1N6QB 3QLHA 3QIPB 4IKAA 4IFYA 4H4MB 2WRMA 3BGRA 4KSEB 3I0RB 3TAMB 3PJWA 3OHAA 3RAXA 2W9CA 2YNFB 3FDSA 3IG1A 3N6NA 5T14A 3PW7A 3BSCA 2IMWP 5KT4A 2XGPA 1REVB 5K14B 1JLGB 4RW9B 3BQ0A 5KFOA 2AU0A 3JSMB 1S1XB 3MFIA 3OLAA 4MKAA 3N6MA 2IBKA 4KFBA 1IKWB 4R5PA 1TVRB 3QIPA 3OHBA 3LAMA 2R2SA 3DRRB 4O3QA 3MEEA 1DTTB 2HWHA 1RT2B 5EWGA 2YKMB 1DLOB 3LALA 3C6UB 4MK8A 2B6AA 4J9SA 3DLKB 2YNIA 5DLGA 2XI2A 3ISNC 1TL3B 2CJQA 2IAJB 1RTJB 1N5YA 1TL3A 2FJVA 4JV1A 3UDLA 5C24B 5KG4A 1XR7A 3VQSA 3UPFA 3V4IA 2R2RA 4WFYA 5D3GB 2J6UA 3MEEB 3GV5B 2B5JB 4X2BA 4K4TA 3DRPB 4KV8A 4KHMA 2C28A 3PJXA 5J1EA 3FSIA 1C0TA 3DM2B 2RF2A 1LW2B 3IS9B 3T19A 2WK4A 3FQKA 2XC9A 3QGIA 2FJXA 4M94A 4IH7A 4WE1B 4NLUA 3IN5A 4RNNA 1LWEA 3KK3B 3HVTB 3KK2A 3CO9A 4IRCA 4XPCA 1JLAA 2W9CB 3V6JA 5DQHA 4JV2A 1N4LA 3NL0A 4NLXA 4O3OA 4QWEA 4Q44A 4ICLA 4DL7A 1KHVA 3QLHB 5EWEA 3PR5B 5KG2A 1HNVA 3I5AA 3RAQA 2D3ZA 4O44A 4MKBA 2F8EX 4NLDA 4J9RA 2QE5A 2W7PA 4NLPA 1RTIA 5DQIA 5DLFA 1BQMA 1S1UB 1DTQB 3TVKA 3H59A 3C6TA 2HNYB 3V81B 3ITHA 4MH8A 2FVSA 3KLHA 3QZ7A 2AWZA 3UQSA 3GIJA 2IM2A 3IGNA 5I3UB 5KFYA 1YVFA 2R2TA 4O3PA 3NMAA 4B3OB 1RT1A 1RDRA 4KHRA 5KFDA 4G1QB 4RNFA 2IJFA 3V6KA 4M95A 2IJNA 4H4OB 1RT5A 4RW7A 2FVPA 3N6LA 3DLEB 3LANA 4O4GB 5L1JA 2IA6A 5FDLA 2VG5A 1JLBA 2HNDA 4IG0A 1TP7A 4ED8A 1ZETA 4K4SA 3LP1A 3LP0A 5L1KA 3PW2A 5F8HA 1BQMB 1S1UA 1J5OA 1S1TA 5KG3A 4RUCA 4YP3A 3NBPA 4ECZA 1S0OA 3OL9A 2OPRA 4HYKA 5KFZA 5DG9A 5KT7A 3CJ3A 2IC3B 4LSLA 5HP1B 3PR4A 1N48A 1S48A 4O3SA 2JC0A 2W9AA 4K4YA 2BANA 1HPZB 4QWAA 2ZD1B 3CIZA 3HVAA 1HQEB 1EETA 1JLAB 2GIQA 4NLGA 4KO0B 3KMQA 3DYAA 1HQUA 3H5YA 4FBUA 3HVTA 3KK2B 3M9OB 3SI8A 2DPJA 2IM3A 4TXSA 3PZPA 4WXWA 3KJVB 4ECRA 5J2NB 5HROA 4DG1A 5C42A 2FJWA 2FVCA 5I42B 1JLFB 2D7SA 1RT5B 4RW7B 5KFBA 3CJ5A 3H2LA 4HKQA 1RA7A 5L9XA 4IDKB 4ZMMA 1XR5A 4R0EA 1IKYA 4WFXA 2AGOA 5CYQB 5J2MA 3V6DB 3LP2A 2OH2A 3KHLA
chains in the Genus database with same CATH superfamily
3ZO7A 3H5XA 1KD1T 2AD9A 5K8PA 3SQGB 1KLNA 1MN9A 2FYXA 2UVRA 1MU2A 2IVFB 2MKHA 4X4SA 3UCZP 4OMFG 3NGDA 2OLWA 4ZIWA 3R9LA 3BBCA 3H90A 1VJQA 1SQGA 4P2SA 4JI3J 2GV1A 4DQRA 1R0BG 2V4RA 1U1QA 1MWYA 1GK8A 3FBCA 1QAYA 2RDIA 3GR1A 3HD2A 3KLEA 5ETTA 1S6PA 2KG0A 2RRNA 1QAXA 2KU7A 3AD9C 4EBDA 1SL2A 3CULA 4DX8H 3AA9A 4RW4B 5D0HA 4DEZA 1GX6A 5IC4B 3EVWA 4R8UA 5A8KA 2UUBJ 4RW9A 1FKOA 2H4WB 2ZH2A 2ZH7A 2UUCF 1SPBP 2GJ2A 4B9TA 3H40A 4DOZA 4F50A 4FXWA 5U47A 1PYOB 2CNLB 1FTRA 1WC4A 1VHIA 5KFLA 2M2BA 5IV3A 4USMA 1WKJA 2APOA 1YRXA 2FUG9 2XSJB 2YX1A 4IH6A 4Q0BB 3CUNA 2ABYA 3M8ZA 4RW6B 2FJEB 1CSJA 2PSZA 1WEXA 4MJKA 3W62A 1Y5LB 1R8BA 2KH9A 3CW2C 3MGJA 4PWWA 4USHA 3B82A 5F3TA 1WC5A 3GYGA 2EFNA 3QFHA 1FFGB 2CQ3A 5KOXA 2K06A 1JNZB 3CD6S 1YHQS 1NK8A 2XLKA 2AEFA 4ID5B 2CNKB 2XBPA 5HBMA 2UV8A 3RUBL 2E7VA 3PJ9A 3Q8RB 1OS5A 5DS7A 2IY5B 2N7YA 2BKNA 3NGSA 1IKYB 2WONB 4ZHRA 4GC6A 3TA0A 2DR7A 1CJVB 3KKFA 4LIRA 4E0DA 3J7AN 1NHUA 4B3OA 1U02A 1XEZA 1VR6A 4DI6A 5EDWA 3MR2A 2ZH9A 3MMCB 1YDLA 1UVNA 3KDNA 1TVRA 4TY9A 2L3MA 4KKOA 4IFVA 1K47A 1VIXA 3BQ2A 4N76A 2MQMA 1S1XA 3FEZA 5J2NA 2JFKA 1NSQA 5HK4A 4OI1A 2RKIA 3D6MB 3SIPB 1IR0A 4H54A 2CPIA 3PYDA 4CYUA 5JUMA 4QW9A 2XLJA 3GQCA 2N7CA 4YR0A 3JSRA 3KJQB 1IBKJ 4Z7YA 3DYAB 3OTEA 3W9JA 4NA3A 1ULRA 5LSRA 3TAMA 2QYCA 4URGA 1R0CB 3AT1B 3Q8YA 4ECXA 1CJKB 2R9LA 4N7TA 2D1CA 4EEYA 3NNAA 1VYAA 1OPZA 3CJ0A 5IQQA 5KT5A 2CWKA 2ZWPA 1TKXB 3TX0A 3UVJB 1H2VZ 5BR8J 3GSIA 2ZKUA 2OTLS 2LMIA 2M70A 1SIWB 2B7BB 3CDEA 3P5TL 3UCGA 1XN9A 1RU2A 4ZLJA 4ZPCA 3LP1B 4PQAA 1CQMA 2GFFA 4BHQA 2RKIB 5A8KB 2PMWA 3RB3A 2X7IA 4B3RJ 2LECA 2LA4A 5A6PA 2E1PA 3QATA 2D3UA 1ZAXA 2I8EA 3T1AA 2HVZA 2R7RA 1NK4A 4CQ1A 5DG8A 2VG6B 3G87A 4F4YA 3QSYB 1U4BA 2BDPA 2YNHA 3H20A 2ZBQA 3DRSB 2YQ0A 2LP4A 1HARA 1RT1B 2EKYA 1QY7A 3QO9A 4DL6A 1H98A 1HYSB 2I38A 2YNGB 1JKHA 4WYLA 4QZVB 3GPAA 3MM8B 2QRRA 1SJ1A 3T41A 4ZP6A 4DX7A 2ZH4A 1Q8IA 4K0KF 3V81A 2GMHA 1XC9A 2JEGA 1LW0B 2XMUA 3P8BB 2MY7A 3CCRS 1RTIB 2X51A 3G6ES 3ICLA 2B9YA 3OFHA 5H9FK 1APSA 2BKOA 1OY8A 1AZSA 3P5BP 2AYEA 5DETA 5ITHA 3AA8A 2Z2LA 1P9YA 1UPPA 3T6BA 4KBIA 1HNZJ 3MAQA 1GXUA 3CJ2A 1EQMA 3GJRB 4OI6A 4CLYA 4E2FB 3KG1A 1FJCA 4DUZF 2G4BA 4QU6A 5CZVA 3IRXB 2DNKA 3KMSA 4DL5A 4DF8A 3J7ZT 4WE1A 1T05B 1YTYA 4LT6A 5CAAA 2KYXA 2QA2A 1BQNB 1SC1B 1VQSA 5KG1A 3CC4S 1IWGA 4OZLA 2OPQB 2IJRA 3KLEB 2H3EB 3D3CJ 3FBEA 1FJGJ 2KXFA 1KQGB 2V4QA 1IBLJ 3C8YA 2C2ZB 2WVDA 4LVNP 4CLFA 3HHKA 3UDCA 2ATCB 1WHVA 1X4AA 1RI7A 2PT0A 5KFEA 1LV5A 2ZBCA 1MSWD 1UW9A 3BF4A 2OEJA 3OW2R 5EHHA 2R7UA 4Y2AA 2Q1LA 2V9KA 2PIIA 2HNDB 1XMBA 4U7CA 3ONQA 2BQRA 3P3DA 1S49A 1GFWB 4ZVOB 3THPA 1HYSA 3T9NA 4K4UA 3K8WA 3KFWX 3ULHA 2IM1A 2F8HA 4IDKA 4CT8A 4F7VA 3T5HA 1P6TA 2P9GA 4ILRA 1FTCA 2QIFA 1JLCB 1FERA 5GMEA 3N5FA 4MKVA 1OQ6A 4Q43A 4K4XA 4BCAA 4WTOB 1TKZA 4V1Ak 3V5RA 1X4EA 1NHKL 4NL5A 4FYVB 4OLOA 2DGOA 1BHNA 1T0TV 2JLGA 4ENOA 3AOAA 1OWXA 2VPWB 2MEWA 4NRUA 2HGNA 2Z2ZA 2VPZB 3QIDA 1K9MT 4OYZA 3AOBA 5F9LA 2V5HG 4JI0J 3TUJC 1JLEB 3CD0A 2I2YA 4KPCA 1V3SA 4ZLPA 2BKPA 5HLFA 1GMVA 2NR0A 1PO6A 2CJYB 5H9EJ 4V19X 4F0MA 4UUXA 3GG1A 2OPRB 1RAJA 2IRYA 3NBPB 1A0OB 1KOOA 2MQ8A 4DR7F 2BJ1A 4DR6F 5F8NA 2CRLA 2A6MA 3JSBA 4AUKA 3IS9A 2NYIA 5GMDA 4KGXB 1SVDA 4CLLA 5KFJA 3G6YA 1AFJA 5L39A 1FI4A 3NWGA 1BE4A 2QX0A 4MYTA 1TUVA 2YX4A 5F8GA 2CAJA 2W2OP 3UR0A 2VJVA 2MQOA 4X4VA 2B0GA 5ETKA 3EZUA 3CCSS 1RE1B 2K3IA 2IDLA 2HG4A 3IC1A 2HEKA 3Q86A 3DDKA 2WVEA 1VBKA 1PC5A 2HSEB 4WP3A 3LUYA 4ID5A 2E5IA 4LREA 1NPPA 1RWKB 4LRDA 1ZPVA 2POKA 3AD8C 3BH6B 4DPUA 3JAMU 2MB0B 3TARA 1X60A 1EKRA 3W2WA 1DTQA 5AXMA 1FNOA 2ZOGA 4FPRA 4WPAA 2Y0SD 5CYJA 2DR5A 2XY6A 3SSSA 2V2VA 2QA4S 1HHSA 1NLKL 1TZ0A 2OAUA 4OZ1A 2BQ3A 4LSNB 2ZNYA 1C1BB 1JJHA 1V5VA 3EM1A 2MJNA 2XMTA 1H0HB 3G82B 1TQLA 3LW5C 3R5CA 4CTAA 4A8QA 2Y8YA 1S5ZA 5E33A 1J27A 4NOHA 4MKYA 3ZTQA 3PNIA 1K44A 1N5TA 1Z2ZA 2QJ3A 4MYUA 4DQPA 5B09A 1LK5A 2DYAA 2GC8A 4LR8A 3FMWA 3JQJA 1X4HA 4C3LA 3Q8QB 4J9LA 1EIYB 2DY9A 1NNDA 1BY9A 1E6VB 3IWXA 4KAIA 4Q45A 2GNKA 1H38A 1PAEX 2YKPA 3EUNA 3F56A 2CJKA 2G2ZA 5HL7Q 1J5EJ 4YR3A 2CQIA 4Y3CA 4QPXA 2J7UA 4MIBA 5CCLA 1PILA 3DDIA 2HZVA 4HH1A 4YOEA 1IBLF 4L75A 1IR1A 4M5JA 4Y28C 2R8IA 1U25A 3M32A 5E5NA 4C8KA 3LGMA 1S10A 5AE2A 2OTJS 1UWAA 2VG5B 3MUTP 5GMKa 4NE9C 2E7WA 1M5SA 3N4WA 4A8YA 1N5SA 2CZVC 2Y0BB 2FHMA 2PMHA 3MR7A 4F3QA 1HHTP 1T3NA 3TI0A 1HWKA 1Q16B 2HURA 3DGVA 1FRXA 2IPOB 3HZGA 1RHJB 1QAJA 3KNAA 2HQFA 4XIUA 4DV2F 4DSIA 1IVZA 2BE9B 3BKFA 4ZITA 3HVRA 4CLPA 1BLUA 3OV7A 3HSDA 3GIMA 2X1FA 1K0VA 2XTJP 3OTCA 2YQ3A 2ZHOA 4FN5A 4DV5J 4P71A 1EP4B 4TLRA 4ZVGA 4A8MP 4I2QB 4RU2A 5AT1B 3A4TA 1YG0A 1F3FA 5J1PA 2WVFA 3U7JA 4TQSA 3H4BA 4L76A 1YRTA 2HRYA 1TUWA 4QOTA 4ECTA 2G2OA 4IO1A 3FVYA 1N36J 2K1RB 4TN2A 1VS3A 1L3KA 2LCWA 2E9TA 1M1KT 1TV6A 3GTYX 2J6SA 3NAIA 3LWMA 2ZM6J 4TQRA 1HI8A 1RTHB 1ZS6A 5I3PA 4UW2A 1B4SA 4P75A 2GHVC 4IG0B 5KFFA 2MHEA 5JVHQ 1TK8A 1DRZA 4RNOA 4BDPA 4ERDA 1AA1B 3PY8A 1JLQB 3HKWA 3EX7B 4PRFA 2HNZA 3NCRA 3QGHA 3DRPA 4J9KA 4MT1A 4ATNA 4PYAA 3ADAC 4P74A 4EYIB 4QYRA 2QLFB 1VJWA 3TUIC 2UXCF 3AD7C 4C3MA 3BKTA 4F26A 4QWBA 3EJMA 3QT7A 4B9MA 3JTOA 2F9JA 3HHDA 4GKKF 5LSOA 1WOPA 1GNKA 3DKDA 2CQ0A 5IQ6A 2M88A 2DXEA 2OSQA 3HHLC 2BYCA 2NPFA 5B0FA 2OD4A 2EPIA 3M8QA 5KFQA 1YZ7A 2Y9HA 1NJZA 3C6TB 1UPMB 2QA4G 1IBKF 4I2PA 2F4FA 2BOPA 5HI7A 4YN3B 2G0JA 3FK4A 2IMOA 1S9GB 4YDXA 2HAIA 4JI7F 3SFUA 4Z7CA 2J0SD 1FHTA 2HS4A 4RKUC 3EDQB 2NCKL 4CLWA 2E5LF 5DDQC 3QIPB 2OFHX 2BJ3A 2WRMA 3NS5A 5K5MA 3AY0A 4X66F 3OJUA 3PYEA 5E41A 2AJ2A 3VWSA 3R7BB 3RAXA 2RT3A 1FWPA 3FDSA 3HJVA 5T14A 2IMWP 3M8YA 2FJDB 1NH8A 3C66A 2XGPA 4DUZJ 2PA8D 5AE3A 4X4OA 4D3GA 2A3JA 3OT9A 4RW9B 4GVBB 4QIGA 4C98A 4ID8A 1ICEB 3W65A 2XULA 4EGLA 3AB2B 5KFOA 3CXCR 5AE1A 1S1XB 4YHHF 4AL7A 4LFAF 4DR1F 2P2CB 3N6MA 2LLZA 3WDOA 1XJWB 2BXJA 1W2BR 3C2PA 2JNJA 3CEDA 2R2SA 3DRRB 1OY6A 3MEEA 1DTTB 1B70B 4LFAJ 4OHXA 4O3QA 1AT1B 4U95A 2HWHA 5EWGA 4LF7J 4P6QA 4DFPA 4LFBJ 3C6UB 1DBDA 2DKOB 1GMUA 4MK8A 1H7WA 1RHQB 3CCWA 5E7OB 1CJUB 5BYQA 3EZOA 3IFEA 1JJ2R 4LIWA 2RJZA 3W2VA 2ALYB 3HT3A 2OELA 3SQGA 3PRDA 3CCES 2DHSA 4X4UA 3X3UA 1JWWA 4LRBA 4W4MA 2DRDA 2Y1RI 4OJ3A 5AXKA 5KG4A 2ZHBA 1SKSA 4CI0B 2GHPA 4FP9A 8ATCB 3V4IA 1GAOA 2ZC3A 3K89A 4WFYA 4C97A 2E5LJ 1LXJA 1I1GA 3BV8A 2V8PA 1T9VA 5D3GB 4OHYA 3UR3C 2GQCA 2XSJA 5GADU 1H72C 2NXJA 1R6VA 3QAEA 4KHMA 3TEHB 3W8GA 1M5VC 2FZKB 2CZ9A 4ALZA 2YH1A 3W3SA 1UZHA 4OX6A 2G1HA 3NS6A 1URRA 3FQKA 2ZH6A 3IS9B 2KFNA 4M94A 1S59A 1F2HA 3DDNA 1TU0B 1UTAA 2QO3A 4RL1A 2CPHA 3KK3B 3SBMA 2KG1A 2QFJA 2UXDF 1A9NB 2Z30B 1VQ4S 5B0GA 4XPCA 1L3SA 2E1RA 1HR0J 4S0MA 1JLAA 2JSXA 1A7GE 1X5OA 3BGUA 4YB7A 3SSRA 1T95A 1N4LA 1OSCA 2COLA 3B8HA 2X1GA 4DL7A 1DQ9A 1IBCB 4DFMA 3PR5B 2C22A 2AZ3A 2Z8QA 2CJ9A 5KG2A 3AB4B 4DHVA 3RAQA 4O44A 1FFWB 5A6WA 2CDRB 2BUNA 3O2IA 3CCQS 1VQ5S 5DQIA 3MI7X 2V8HA 3UWTA 1WI6A 2HBZB 1BQMA 5B0EA 1DTQB 5DLFA 3FRYA 3M4XA 3MM5A 3V81B 1DQAA 3THTA 3ITHA 2FVSA 3OUYB 3KLHA 3ISZA 3TYTA 4DV3J 3SZ2A 2OMLA 3UQSA 3GIJA 3R7NB 4PPZA 2XS2A 1HD1A 1GMWD 3U02A 2G0IA 1WD6A 3LTOA 3M30B 2V8GA 4PXCA 1TELA 1T8EA 1RJJA 4WKYA 2LYVA 4AFFA 5KFDA 4RNFA 2AZ1A 4NEZA 5D4LA 1RT5A 3N6LA 3LANA 3NMRA 3Q8PB 3W1YC 2DTJA 4A47A 1ZETA 1RAIB 1TP7A 2WAQD 3SCIE 1G2EA 1N33J 3LP1A 2J5AA 1Z1ZA 3CCZA 3NGRA 3OQ2A 5KAKA 4YP3A 1J5OA 3BN7A 4DR4J 2H4YB 4ECZA 3NBPA 2MQLA 1VLYA 3HI9A 5E2QA 4CO0A 4DUYJ 2LXUA 1SJFA 3OL9A 5KFZA 4QYZK 5KT7A 1KQKA 2IC3B 1N48A 2MKSA 4ZVQB 2W2QP 4WK1A 1KFDA 4C11B 5A2QU 2PFFB 2PE8A 4QWAA 2GIQA 1JLAB 2FJAB 3S6EA 3NEKA 3DYAA 1FDAA 2O66A 1NEEA 2AHOB 3HVTA 4ZN3A 1SJ3P 3C3LA 3M8WA 1URNA 3M9OB 2NLWA 2IM3A 3D6HB 2E5HA 4PXEA 1X4FA 2KT3A 2NSCA 4WXWA 5E3RA 2ERRA 4X4TA 1P1LA 4ZPTR 5IWAF 1YITS 5C42A 3AH6A 1HI1A 3EMTA 2F63A 2MYFA 4RW7B 4JV5F 2HHQA 1CPZA 3J81j 1NZAA 2NXEA 4YY3F 3H2LA 3PO5A 2WVCA 5HJXA 3ENAA 5L9XA 4X84A 2C3PA 2CIMA 3QGPA 2ZKTA 5CH7B 5D78A 3HM9A 1SC6A 2R42A 3BYRA 4OYWA 2R4FA 4R0EA 3ZZTA 5C2CA 1NB7A 1VK3A 2B9WA 2KJVA 4I56A 3Q24A 2NS1B 3FBBA 4J9UE 1N32J 2MPUA 4NMLA 2VUGA 3W2VB 2PO4A 3MM5B 2A2DA 3MPDA 3IAM9 4Q8FA 2PA3A 2CPXA 2W2NP 1FE4A 3IGVA 1KVJA 2KTQA 5B0DA 3TOQA 2VIHA 4Y0FA 3OTDA 3TAQA 2C2OB 1OYEA 2BJ7A 2M52A 2W2PP 2Z58B 4PG8A 3OL7A 4ER8A 1NKBA 1CC7A 2LXIA 3RRKA 5EN1A 1Y0HA 3MM9A 3D4JA 3RBDA 3C46A 2M4MA 3ILOA 2XCPA 3A12A 1N5QA 2Z56B 3ISND 1XERA 5T7LA 1NHVA 2EK1A 3T1YF 4A8SA 1FX4A 3CNQP 3T1HF 3UD4P 1SV5B 1SUQB 1W7WA 1EZZB 4ZOSA 2PC6A 1OYDA 4Y00A 4R8UB 3FC9A 4QR2A 3E8OA 4FYXB 1M5HA 2RF2B 5IOLA 5L9NA 3HP6A 2MLYA 3E51A 3CC2S 5CYMA 3C15B 3POTA 3LO3A 1N34F 1QSSA 3C16B 2LA6A 5RUBA 4P7TA 4GKJF 1TL4A 2KDOA 4NLWA 1N6QA 3IBWA 2Q3PA 3OXFA 2YXLA 4YB1P 1D9FA 4NZ0A 4DV3F 2DNMA 3KDOA 4LFCJ 4C4WA 2CVEA 4AE5A 3VAIA 1U26A 1SB6A 2O01C 2VC0A 2Z57B 2DEIA 2FPHX 3MURP 2RDJA 2RHQB 4FNIA 4I2PB 4X4QA 4ECWA 3DRYA 2VDHA 1NU4A 2QC3A 1F5AA 4ANCA 3I56S 5DRKA 5EUHA 1EJ7L 2MXYA 1FCAA 1S4EA 1D1UA 2DIVA 3GV7B 1VQLS 1N52B 2R7SA 1BWEA 1CJTA 1TKZB 3PG9A 4GKJJ 1P27B 3RRHA 3OBIA 4J9MA 4OYMA 1SL0A 1SKWA 1R6YA 1HR0F 2JVRA 2F1FA 4K5RA 3VAMA 2KVIA 3OVBA 2VG6A 9ATCB 3AJ1A 2C2RA 2W2MP 1REGX 3PKMA 2IA0A 2EEYA 2MLXA 3KWMA 3L09A 3OD2A 1C1CB 3OR1B 2CPDA 4MFBA 3MTJA 4KGVB 4P9SA 5E0OA 5GVQA 4EI2A 5GAHU 2FHOB 4WK3A 1DQ8A 2YH0A 3OL6A 1MMLA 4L6V3 3GJTB 4OYBA 1XNQJ 4X65J 3MM7B 4FYYB 1OMSA 4WFZA 1T9XA 1J2VA 3M1VB 4KGZB 4P2XA 1TL7B 2RD5C 3TW0A 4X4PA 3R2DJ 2PN6A 4DV1F 5DGAA 4MTPA 4DPXA 1FDNA 2AJ0A 3Q89A 4FXVA 4X64J 4K4WA 3EGNA 1MW7A 4TYAA 1RBLA 3I4HX 3MWBA 1YJVA 4ITSA 1GEHA 1X7VA 2DEJA 1FXDA 1J5OB 3PDNA 4HT5A 4U6PA 2BR0A 2GVDB 1FD8A 3NAHA 3O1LA 2HWIA 3IRWP 2QV6A 4DU7A 1C1CA 3DLGB 1ZPWX 2DIUA 2HQIA 3OR1A 3MPVA 2ZH8A 3CCTA 2D41A 5CD4H 5IFMA 4IRKA 2LDYA 3H0PA 3CJRA 5K8OA 1CC8A 3MM9B 4QIVA 5L46A 2HFVA 1NXIA 2RAQA 1XMQJ 1S6QB 1VFJA 1F60B 2O67A 3N79A 4IR9A 2XS7A 2W1BA 1C0UA 1ACMB 5HQLA 5KTQA 4ZHRB 1U0HB 5AXNA 3M2VB 3TVZA 5M2UA 3UFCX 2V9WA 1QJHA 4KPYA 1GT8A 2AF6A 3OFEA 2BM0A 3I96A 3BGFA 2HBQB 2MKKA 4J9NA 2J8AA 3BO2A 3SV4A 1RWUA 3D0IE 1Q8BA 4DU8A 2E1AA 3TZZA 3DGPA 3GYXB 4M5KA 1GMWA 2AX0A 3IBCB 1JKHB 3LP2B 2NXUA 3FJ2A 3G86A 5IT9Y 4KRWA 2QTWA 1UJ4A 2EBEA 7FD1A 2RE1A 3WBZA 1I94F 4O44B 3DRSA 1W2IA 1U2RA 4IG3A 1U8SA 3CE8A 2OP5A 3IM9A 3TA2A 5CXTA 1FRMA 1N54B 1PIEA 2NYHA 3J81Y 3QT8A 2N82B 2P6SA 4ES1A 1T03B 5I42A 3OVSA 1R0AB 1Q5VA 4HEA9 4OFZA 1B0VA 4PYDA 4C8YA 2YWGA 5FLXU 2VQEF 3U1MA 2HIQA 5K14A 1HWLA 1SUQA 2CQBA 3JXOA 4KT0C 1JXVA 4NLOA 3TRGA 4NEYA 4X64F 5EWFA 5HAOA 2AP6A 4B17A 3M2UB 3W64A 4CCHA 5DM6Q 1XMQF 2ZEJA 3BGRB 4ZVRB 1ZM2A 2EC2A 4DQSA 2FVRA 2QSWA 5KG0A 4JI2F 4FF1A 1LWFB 3CCJS 1TL7A 4OHVA 5E3PA 4IG3B 4B3RF 3HX9A 3RW7A 2VFTA 1K1SA 3H2UB 4FYWB 2RRAA 3MMBB 5HO4A 3PYGA 3PHTA 3MEGB 4WBFA 4U96A 3L3CA 2ZDOA 5C25A 4UT4A 2N4CA 4TU7A 4EO6A 2BE2A 2DR8A 5BR8F 1JLBB 3GFHA 3I82A 3I6PA 4DL2A 5DDPC 2O5DA 1GTEA 3PW0A 3V6DA 4DL4A 2RRBA 3I5CA 4DV1J 1RAHB 1WELA 5DJBA 4PR6A 1TFWA 1RHRB 4G1QA 5LMNF 2GHWA 2ZUAA 4DCOB 2KXNB 1S6QA 4U7UK 1X4BA 5JXSA 3VAHA 3QWPA 1X9SA 4JUZA 5F8LA 3G96A 5KFTA 3LAKA 2GIRA 2H48B 3K17A 2UUAJ 1MMDA 3O6QA 1WEYA 1NDKA 2HQGA 3NKYA 4HT7A 2UUTA 3D6FB 5KFAA 1XIQA 2GAHC 4FDFA 2BBEA 2JH3A 5HMYA 4NWBA 1U09A 3WIVA 1RTDA 4RW6A 3BJYA 2QLXA 1TKXA 2LU2A 2WOMB 3UVJA 2R7TA 1VDHA 2W25A 3ILLA 4U67Q 3I0RA 1QE1B 1VQMS 4XO0A 4H4MA 1RT7B 4IFYB 4KB7A 4OZNA 1XWLA 1D9DA 4JI1J 3ET6B 4LQ3A 3NOGA 5DQGA 3M9MB 2AW0A 2PGCA 5GAEI 3UCUP 5A2QY 2A2CA 1WC1A 2BA9A 3DOLA 3UNYA 3BPDA 3KOAA 2YWEA 4Q2LA 1WTFA 4N47A 2ZH3A 4DLGA 1RWNB 2L9DA 1RAFB 2FLLA 5F9NA 4N5SA 1FVSA 3DHXA 3A3PB 4USIA 1Q82T 2JRSA 2AJQA 1LFPA 5IWAJ 1VQ6S 2DGSA 4IFVB 1XBWA 1ZZFA 4O23A 3PIOQ 3B78A 1TKTB 2B5JA 4WFNQ 1JLCA 1M90T 1JMTA 4DQQA 4QIWD 2W7AA 4GRSA 4DSLA 4PZVA 5ETVA 1MG7A 3DNCA 1CS4B 1Y5NB 1UWBB 4CIOA 3M8PA 4PWDA 4TYBA 3OSNA 1VBYA 5B0BA 2DH7A 1JLQA 2AT1B 1S0VA 4OJGA 5GAEU 2UVVA 3TJ8A 4WU3A 2R8JA 1ZOTA 2H5JB 3C19A 5AJ3J 4LF4F 3HULA 4ZCIA 3HHLB 1QD1A 1DURA 3DRRA 2C3OA 3B6BA 3HO1A 4A46A 2C1EB 3VAJA 1VBZA 1UETA 5EX3A 1JLEA 5CYMB 2V2KA 2ROGA 3C15A 3IR6B 4OYOA 1RB0A 2WOMA 2E44A 4CO2A 4Y65A 3GFYA 3T5JA 5HANA 2LQJA 1SKUB 4UY85 3G71S 3ETOA 4LF8J 3FFIB 2E5JA 5IZHA 4X62F 3NCPA 3DM2A 3I0SB 1SXLA 2GVZA 2VPYB 4LF5F 4NRTA 2XYHB 4V19J 1RHUB 4UOGA 1XNRF 5HQMA 1PJ7A 4YY3J 4WZMA 2M8DB 3TZWA 2UUWA 4Q7AA 2DHHA 2PMZD 4KGMA 5DGBA 1QTMA 1A6LA 1FRHA 3G8SA 4G3IA 2JX2A 3FZ2A 1XQIA 5A76A 2XO6A 4EBEA 2LXFA 3CMQA 4ED0A 1S1TB 2KRBA 2WB4A 4LBHA 4CLTA 1P9QC 3W5ZA 2NZ4A 3PCOB 3D6TB 4OL8A 4NCGA 2ZE2B 2V50A 2VPXB 3G2XA 1WEZA 3M8PB 4PWDB 1HBMB 4O0NA 2JLFA 2V0NA 4AQYJ 4OX9J 3D66A 2ASLA 1RHMB 1UVJA 3Q2TC 2J7WA 2B8PA 3QJPA 2DNZA 3C14A 4QWDA 2YKQA 2XQCA 2EFPA 1S0NA 5K8NA 2VF3A 1V9OA 3K5OA 3KUEA 3N01A 5B0AA 1RBOB 1FX2A 3GG0A 5KFKA 3MAAB 3SXLA 1IKXA 1KR4A 4FKXA 1Y9OA 1T9TA 4LSZB 3OLBA 4PG7A 3CSKA 4OZ3A 3KHHA 1R31A 3F44A 2XHCA 5ETNA 2QFIA 2MZQA 1FNXH 5I4MA 1HNVB 2ATLA 1T03A 2MGZA 5ETRA 4ZVTB 3AQPA 1S9EB 4ZLLA 3LPYA 1ZA2B 3L4BC 4WYWA 2ZH5A 1RT6B 1PYSB 3GJSB 1UAWA 3Q2SC 3Q8SB 3QT6A 2CPJA 3EPGA 2ZITA 4F4ZA 2D3OR 4U8VA 1EP4A 3D0HE 4RR5A 3KK1B 1F5BA 2CA9A 3CO0P 1IR2A 3A8IA 3GR0A 3PEHA 4KTQA 5HVGA 1OY9A 1VHFA 1LW2A 2HRUA 1FKPA 2K7KA 4N77A 1K8AT 4J9PA 1FEEA 4URQU 3OTBA 4KKOB 3FQLA 4DV4J 1HBOB 2NUHA 1I51B 4PQUB 4B08A 1AROP 3HHLD 2DHGA 2P9EA 1H6KX 2YNHB 2ACMA 3E01B 1RLDA 3DOMA 4O3NA 1WHWA 2A6OA 2FVQA 3DMJB 2GGPB 4CDIA 2K7JA 3CDWA 2KFZA 3GU0A 4I0WA 2JL9A 1UA1A 4LR9A 5KFCA 5DDOC 5C25B 3KK1A 3QRPA 1XNQF 2BZ2A 1IM4A 4RU9A 2DO0A 2ZUGA 1Y5IB 4JI8F 4DSKA 2HLTA 5KFUA 1I94J 1FFSB 1N0VC 5CCMA 3MR6A 3QRQA 1DFDA 1TMMA 2DXDA 3K59A 1YJNS 4BWJA 1NSAA 1N6QB 3QLHA 1AUSL 4OI3A 4IUFA 1PJ5A 2YPZA 1X0FA 2FZGB 1FE0A 4KSEB 3PJWA 4LJMA 1BWVA 2LU1A 4JI2J 4FF2A 2W9CA 2YNFB 4EMDA 4M8LA 3WHIA 3PW7A 3PYFA 4ANEA 4BBYA 1JLGB 4JI5J 1TFYA 3BBFA 5A8RA 4DV4F 3PM9A 3E2EA 2ZWOA 1X4GA 1NK7A 5K9FA 3FKBA 4X66J 4NI2A 5B7WA 2HIYA 2FC9A 2AU0A 1ZBTA 1NDPA 1NPRA 1UFWA 4LF2A 2X1AA 4KFBA 1M5OC 1IKWB 4R5PA 4QPTA 4G1IA 3N9UC 4G1PA 3QIPA 1UEUA 2DO4A 5DZ7A 1RAGB 4L72B 3MPYA 5FIIA 3S1TA 1DLOB 3HHNB 3HHEA 3TZYA 1F2GA 2MTLA 2HK3A 1P1TA 2HWTA 3DLKB 4UOHA 1CJTB 1WG5A 4A8OA 3JQMA 1Y7PA 1TL3B 1LFWA 1WWHA 2XSFA 3S01A 4ZJQA 2VICA 1S76D 2IVMA 1TL3A 2FJVA 2A18A 2CNOB 3UDLA 5C24B 3G4SS 2DNOA 3UDVA 3GE9A 2DGQA 1MROA 5LSLA 1EAYC 2Q66A 3ENQA 3VGUA 3CB4A 4I6AA 2AV5A 3GV5B 2B5JB 3JB9k 2F4VF 4X2BA 1RGVA 3DRPB 4KV8A 4OYIA 4I6WA 5D8HB 3F0NA 2XEXA 5BXIA 1BXNA 2XMWA 2E66A 3RRGA 2RF2A 1LW2B 2W01A 2XC9A 2HFOA 4F0HA 1F1BB 3QGIA 3TWZA 4IH7A 1Y3JA 2BJ9A 4QYZJ 1KVIA 1X5PA 1ELOA 1X31C 4IRCA 3OJSA 2L48A 1Q95G 2VJUA 1N32F 2HS0A 5DZ6A 2W9CB 2JOQA 4B3MF 2VOOA 2RB7A 4JV2A 2RUSA 5LM7E 4ICLA 2XYPB 3DCAA 3OXGA 3CJQA 2MGZB 2B4PA 1VMBA 2DGTA 4X65F 2D3ZA 4M5HA 3JTNA 3K58A 2F8EX 4NLDA 1M5PC 1T11A 2BM1A 5ETQA 4NLPA 2W7PA 2XZTB 2N4DA 5ETSA 4RLEA 1VK8A 2OMOA 1S1UB 4HI2A 4OX8A 3QFWA 1TKDA 4OYAA 5BJRA 3C6TA 1X4DA 2ZZTA 1G3OA 1YJTA 3DLHA 3Q8UA 2HRTA 3TX8A 3Q22A 4C8LA 3QZ7A 2QN6B 4X62J 3FUYA 2VBZA 5KFYA 2FY8A 2R2TA 2JVOA 2Q79A 4NPOA 3TA1A 4KH0B 1YI2S 1L3UA 3VCDA 1V5IB 3V6KA 2IJFA 4M95A 3M30A 2IJNA 1Q53A 1AFIA 5A8WB 2CPYA 1FF2A 2QMWA 2Y1LB 2RILA 3CJKA 3DLEB 1F3VA 5IM0A 1HWJA 1YZ6A 1CEZA 2IA6A 4UQGA 3CF5Q 1UFKA 2F3JA 2HHPA 1FO1A 2NPIA 4IG0A 4W98A 4GMKA 1T9YA 4K4SA 8RUCA 3PKYA 2C42A 3MD3A 1JB0C 4RUCA 1BQMB 2CQGA 1WF2A 1S1TA 3M8RA 3PW2A 1TAUA 2OPRA 3DN9A 4RJVA 4DJBA 1C4CA 3SQOP 5DG9A 1NJIT 4NXMJ 4QR0A 4DV7J 1R27B 2XY5A 5HP1B 3LH2S 4M1KA 4ZVSB 4QQBA 1VRQC 2RDDA 1SCJB 1YWXA 4H4KA 2W9AA 2D3O1 1VC6A 2ZBPA 1X5TA 4M5MA 2BANA 1HPZB 1D8YA 4WIQA 1HW9A 1EETA 2XLIA 1Q1KA 2FD2A 2C3MA 3MM7A 1UZDA 2QA1A 4JB8B 4ANDA 4FBUA 4H4KC 2CQ4A 1T02A 3FMBA 4TXSA 3PZPA 3MAAA 2PEHA 3UD3P 2EI5A 4LUBA 4ECRA 2CJXB 4CO3A 3NOCA 2CFXA 1WOSA 2XZDB 2ZHAA 2FVCA 5I42B 1NAQA 1S6OA 3IMQJ 2MSTA 4J91A 2MKCA 4RPFA 4HKQA 3GCXP 2F8MA 4JOUA 1Y4ZB 4HDGA 4ZK7M 4IDKB 2VKRA 4ZMMA 4CNYA 1NK9A 1CVJA 1IKYA 2ZNZA 4PG4A 3NG8A 2AGOA 5CQGA 3V6DB 3D1OA 1XMOJ 1BGXT 1PG5B 1RHKB 1RT3A 1JXEA 2O3DA 3I32A 4F3MA 2ASJA 3Q83A 3W5XA 4Q8EA 3QAUA 4O3RA 3WIUA 3CCUS 2ZJPQ 2YX7A 2KYZA 4HI1A 4L74A 3K5LA 4R0JA 2KL8A 3QNWB 5ETMA 3W5YA 4ZVEA 2UVWA 3M8SA 1XK8A 3MHYA 3CMAS 4F4WA 1IKVB 3GMGA 3M2VA 3NP5A 4Z2XA 5JJBA 4C2MA 1D09B 1HL6A 1U1LA 4BC9A 4RNHA 2Y1JA 1LWFA 3EPIA 2BX6A 4DR4F 3MEDB 2IM0A 4P2MA 2OPQA 2GO8A 1JXLA 2AEJA 4ILMA 1U7LA 1TTHB 3AOCA 1E6YA 1HFEL 3E3XA 4NI2B 2MZTA 4NLQA 4NLTA 4RBVA 4WP8A 3MM6A 2HLUA 2QT7A 1F9HA 1RTZA 3H98A 4YB6A 4ZPAA 1LWEB 4EFAC 4ED7A 4DFJA 1S7HA 1WJ9A 1R8HA 1EETB 1UL3A 1WACA 5D15A 3BO4A 2H9ZA 4BWMA 1R8CA 2DCLA 2YWKA 5HLFB 4XAKA 3FNNA 1PKUA 2BOAA 3KJNB 2OHDA 2Q6BA 3H7HB 4C11A 4CTAB 5HMZA 1RT7A 5JMNA 1S7IA 2J9CA 3J80Y 2DH9A 3OFGA 4DUYF 2YPYA 4EZ6A 2ILYA 4LF7F 4ZVHA 1SJQA 1S9GA 3N28A 2E1CA 2WTFA 2VG7A 4IO9Q 3KYLA 2IFXA 2QZ8A 1IQTA 3MR3A 2NZCA 2EVZA 1SJ4P 4OZJA 1WG1A 4TKTA 1WF1A 3H5SA 2OKQA 4LF9F 4FBTA 2AYMA 5KFSA 1F9FA 1M1GA 4CH1A 1H7XA 1U49A 1EQ0A 4IOAQ 1Z2LA 4YB5A 2QL7B 1T7PA 3QJJA 4P10A 3DXSX 3ENVA 2WBRA 4FF4A 4JI0F 1NKEA 1PYTA 1YGYA 2FLOA 1GTHA 4YUDA 2LQBA 2M3DA 2PD1A 3TP2A 2J6TA 2UXBF 3DI6B 4F67A 2R8GA 1D0EA 1N0UA 4ZVFA 1FKPB 3OTOF 2EC0A 4UUWA 1S12A 3ITHB 3OUYA 2HHXA 2H51B 3BSAA 2HNYA 4DPYA 3W61A 1RTHA 5D4OA 1KN6A 3AXMA 1DZ5A 2QLJB 2DK2A 1U48A 2JEFA 2JEIA 1TV6B 2IBKA 2MMYA 1VQNS 4Q0BA 1RSCA 2AX1A 1R8AA 3QPIA 2DPIA 3LWLA 3CD5A 4C6AA 4IRDA 2HMIB 5LMUF 4JP8A 3VALA 1S9EA 4WCEQ 1G4CA 4FKYA 4F4XA 2GZOA 3JSYA 4LSLB 5G0RA 4AL5A 2UU9J 2VA2A 2A0FB 1RTDB 4EZ9A 4LMZA 2ZBRA 4K4ZA 3OSPA 3BR9A 1RWOB 3FBFA 3T9ZA 4JI8J 2RQCA 2HHWA 1GH8A 2IDEA 3FCHA 2KKHA 4A8FA 1S6PB 1Q0NA 1B99A 4OV6A 2KB2A 4KV8B 2BACA 1S1WA 4PKDB 2XY7A 2HVDA 4N56A 4QU7A 1MMNA 3OXLA 3PEJA 1WNEA 5D3GA 5E3QA 3L95X 4OI0A 2WW4A 5JVGQ 2DXFA 5KT2A 4UY8T 4EYHB 2P9CA 3MPWA 4XDDA 3MZIA 4NCAA 1H74A 3A8KA 3PTWA 2Q43A 1RBAA 2C2DA 5C24A 1O8BA 3DRXA 4K7QA 3W63A 5J2PB 4J7CA 2KM8C 1YSJA 2PI5A 4A8XA 3MOZA 2B3TB 5J2PA 1UEKA 2V8VA 1R89A 3ZFVA 1YJ9S 5M2RA 2AEMA 4GKKJ 1TL1B 5CYQA 1YKWA 2IRUA 1FWLA 4NMXA 4DV6F 1S1VB 2J8SA 5IC6B 2XGQA 3TUPA 4E98A 4ZA1A 1LWCB 2WW8A 1C0UB 4Y34A 3VAGA 4DV6J 4YHHJ 5FJ4A 1U2FA 4ZLNA 3L7UA 2V69A 4CO4A 4KFBB 2V4JA 2FQQB 3B4DA 3ZC4A 4WF9Q 3BBBA 3UO0A 1P8GA 2KT2A 3NCQA 1E6VA 2ZH1A 4KH1B 4ETZA 4KYZA 1NK6A 1JJCB 1BD6A 4RX6A 4KO0A 1KONA 1Q8KA 3CWJA 3UDEA 3I55S 3QWUA 4ED5A 1FD2A 3P45B 4DV5F 2BANB 1QM9A 1JK9B 3LA0A 3ZZZA 1PJ6A 2RMLA 4LSNA 3QQCD 3BREA 1M0SA 4J37A 5HP1A 4NLYA 4UOFA 3R97A 3VR1A 5LXRA 3BKUA 2CPZA 4J9VA 1ZYQA 3DLBA 4IOCQ 3UNGC 3PHEA 3VGTA 5IS2A 2J0XA 4NYPA 3IM8A 1NPKA 3MECB 2XI3A 2HQCA 1LOUA 2E9ZA 2OEKA 4LVOP 5D4PA 1KHWA 2XMVA 3H2VE 3W60A 3LPEA 1K1QA 3BN4A 1KLMB 2DH8A 4PEOA 2YBVA 3CIMA 3PACA 2EKNA 3E01A 4D3HA 2ROEA 2B6AB 5J1NA 3Q23A 1S77D 4GO5X 4P52A 3UW1A 1KBRA 2Q6CA 1Q86T 1HIYA 2WONA 5CZXA 4DL0C 4QR1A 5H9EK 2HQDA 1R8PA 4R5PB 2U2FA 4IQMA 1VBXA 2PEBA 2B7CB 5HBMB 1U8WA 5F8IA 2GCFA 2HFNA 3R5BA 2VFUA 1L3VA 1SH3A 1VRUB 1AW0A 2UXBJ 2DCUB 1GXTA 3AHPA 1VI7A 2B4UA 1H2UX 3M6VA 3NLCA 1HNIA 2J0QD 2JJ4D 3KUGA 1ZAVA 4DS5A 3EXYA 3KLFB 1SI9A 1RISA 2L9WA 2R7OA 3DOKA 2CPEA 3BGLA 3GP9A 4AQYF 4I64A 3C16A 3CDBA 3DOKB 2HMIA 4NYZA 2NXCA 2WZ1A 4WTYA 1AXQA 1KQFB 4A48A 5KFIA 3B54A 5DG7A 2K3KA 3HZEA 3P6YC 4ECVA 2W8KA 1NDLA 2UUBF 3T1HJ 5LJ3Y 4F8RA 1HMVB 2OPPB 4LF1A 2ASDA 2ZFHA 2OJ3A 3A3NB 3VGSA 4LF6J 2JEJA 2HHSA 1T9UA 3I9ZA 1YRUA 4CLUA 4F2RA 1T3OA 2J0WA 2MSSA 2DNPA 1NJWA 4ELTA 5J1EB 5F8JA 2N3LA 1UWBA 2NXNA 2HFZA 2YKOA 2RIJA 1D9AA 3L9ZA 4TU8A 3D5MA 2EFVA 1B7FA 4HLBA 3ELHA 1YQHA 3BH7B 2GMLA 4ZJOA 3VF0B 2HYIB 3KXDA 2R7XA 3Q0AA 1TKTA 1IKVA 2HAFA 3MMAB 2CQHA 2DHXA 3MR5A 2MDAA 4NXNJ 3L7PA 1W25A 1UCNA 4USUA 4UOCA 1BMQB 2JFDA 1WDDA 1HBUB 4WXOA 3BSOA 1WORA 4BS2A 2X3GA 1VQ9S 1BC6A 3K8VA 7AT1B 5F0WA 3BR8A 1U47A 3TZXA 3MEGA 1SH0A 3KLGA 1SIZA 2XZWA 1PSDA 1NZ8A 2HS3A 4C8MA 3RGIA 3RB4A 2B4OA 4F3OA 2LQ9A 4RZRA 2XNRA 2NQPA 4M5DA 4ZPBA 1Y11A 4DR7J 3KHRA 4DWIA 2KHDA 4URSA 1QE1A 3GILA 4OI2A 5SZTA 1QAIA 1HNIB 2NUUG 3WQPA 3US5A 2DVIA 3CJ8A 5HJYA 3CVKA 1VC5A 4CO1A 2WCXA 3THVA 1WF0A 1G6BA 3FCVA 2C2KB 3SV3A 3WC2A 1SV5A 2JC1A 3V6HA 1VCTA 4N41A 5DO2A 4TU9A 5KFGA 1HQEA 4IOBA 4OHWA 1EARA 2BRLA 3MEDA 3R2CJ 3J7YU 1PCAA 4CLKA 5I3QA 4NXNF 1CQNA 1IBMF 1FRKA 2KN4A 2SXLA 4USKA 1RKIA 2F4VJ 3W7BA 2FTRA 1MROB 3HCXA 1FT8A 4YDDB 5EGYA 4ECYA 2AGPA 3LP0B 2I6WA 3CCVS 1OQ3A 4DSEA 2P6TA 2M7SA 3TJAA 3DU5A 4ZP7A 2C2EA 1DJ0A 1IQZA 1HQ2A 4ECQA 1C4AA 4ED2A 1HWIA 1I5OB 1S79A 2QL9B 5DDRC 1D3WA 2V2QA 4RBTA 1CULA 5THWA 1RWVB 4O0IA 2AKWB 4FVCA 3BSNA 2AYGA 1YLXA 3D1HA 3FRZA 1R43A 2LEPA 3GB0A 1DTTA 3H4DA 4RW8B 3AAWB 1QUVA 3G6XA 4CH7A 3QBCA 5D77A 1Q7YT 5I3UA 1IBMJ 1KDNA 4NLVA 2DGUA 1BQNA 2R3VA 2UVUA 3RTVA 4MMOA 2XWXA 2YTCA 2HZAA 4GVBA 4QW8A 1KRPA 2CXEA 2PI4A 5KG6A 4OV1A 3VGVA 3W9IA 4OJ1A 2JLEA 3B4MA 1XNRJ 1QVGR 4YQWA 3MAHA 5LMNJ 4JI4F 2P5VA 4RWXA 1TUGB 5G0RB 1Y3KA 2VBWA 2Y3YA 4LBIA 2VOPA 4CZCA 2VONA 1C1BA 1FNMA 2J7KA 3FCWA 3NGTA 4MK7A 3TEGA 5FD1A 3HFKA 4XDCA 4U9RA 3SSQA 3ZXWA 3CCLS 1RU1A 3KLGB 5B08A 2QEXS 2E5GA 4TLQA 1GX5A 2BRKA 5BYSA 5FDLB 1SKRA 2J9EA 2C3UA 3DI6A 2MLZA 3BZQA 3FSXA 3S7RA 4E8UA 2HGLA 2VQFJ 1L3TA 3JTPA 4C0HA 1FJGF 3BO3A 4FZVA 4IYQA 3IWLA 3I31A 3C14B 3ZZRA 4KHPJ 1S6UA 2DNHA 2IRXA 2DD8S 2HHUA 2OSRA 1N8RT 3BEGB 2MZRA 4B9NA 4PQUA 3V4IB 3FEXB 5D0GA 3VHQA 1L5UA 5MAOA 5J2QB 4J9QA 2XCAA 3QZ8A 4EBCA 2CDQA 4FNHA 7FDRA 1FDBA 3HVWA 3G6VA 2CQDA 4TVAB 4WP9A 3MECA 1OJ4A 1LWXA 1T9WA 2E1MC 1KEKA 5KG5A 4QWCA 1ZM3A 4BC7A 1CJUA 2VQFF 2VG7B 4Y2MA 5SUHA 3BYPA 5HVFA 4HHHA 4L3KA 3DOLB 1FEHA 3OFFA 4OI4A 3V4MA 4OIXA 4RNMA 1RT2A 4DPOA 2FGOA 2ZM6F 6AT1B 1UVLA 4M5NA 5L8RC 2LQ8A 5MLCV 4IFYA 4H4MB 2VBYA 5IV4A 4F4KA 4U8YA 2ZDPA 4Y2KA 1VOMA 1NUEA 3U1LA 3FGVA 2GVZB 4F25A 3A3OB 3PFEA 3J80U 3T1YJ 4C9DA 5ETLA 2VQEJ 3BSCA 5KT4A 1M5KC 2BW2A 1CBKA 1VLOA 1LXNA 2V94A 2OI2A 3DXBA 3EXCX 4GO7X 2P8IA 1D8ZA 2QG9B 1HNZF 2F7VA 3BQ0A 3RW6A 2YWWA 2CVIA 1YBTA 3OLAA 2OH2A 3HT0A 2ZJQQ 1MWZA 1ITPA 1RAAB 4ELVA 4CRJA 2DRAA 3LF0A 1F6TA 3N5BA 3OTOJ 3OHBA 5A0YB 1HNWJ 3P96A 1HNXJ 4OJHA 2YKMB 2M0GB 1NM2A 2B6AA 9RUBA 3HHLA 3M6WA 1W26A 1UW4A 5DLGA 3CTRA 1V6HA 4CNZA 2DNQA 3ISNC 2CJQA 2VB6A 1PBAA 2IAJB 1JQGA 3M2RA 1RTJB 1N5YA 3T6JA 2DY1A 2WBMA 3VVTA 1U1OA 4PAAA 1ZZNA 3HD1A 3UPFA 1XR7A 4UF4A 1QSLA 1UEVA 3J7A1 2BABA 2R2RA 4KHPF 1OO0B 4C8NA 4JI6J 1QLNA 1KTQA 2J6UA 3MEEB 2BJ8A 4JI7J 1RP5A 2ASYA 2D9PA 3D9BA 3G8QA 3OR2A 5E3AA 3PJXA 5J1EA 4HR2A 2C28A 1NB2A 1CLFA 1PGZA 3FSIA 3R6LB 1X9WA 1C0TA 5L1KA 1G1XA 2FY1A 2WK4A 2DNRA 2RU3A 2UZAA 2FJXA 4NLUA 3IN5A 4WE1B 2CWXA 2X1BA 4DXLA 2H5IB 1LWEA 1HHQA 4Y6IA 3KK2A 1RCXB 4DMZA 1FRIA 4A8KA 4LF8F 3WX4A 3HXMA 2YQ1A 3FEYB 4PABA 4B3TF 1YBAA 4NLXA 4QWEA 1FXRA 1CJKA 4Q44A 1SQEA 3G82A 1YJUA 4OHZA 1VQOS 4ILLA 3R5AA 4LFCF 4F4AA 4MKBA 1WDTA 4J9RA 4B02A 1RTIA 3MCSA 4NYOA 3SDEA 1RWWB 1UJ5A 2EFGA 3BDEA 5GADI 3PV8A 2B8QA 2I9SA 1NJXA 2HVIA 3H59A 5LJ5Y 2HNYB 2DR6A 4MH8A 4RWWA 5DM7Q 3IGNA 1YVFA 2G13A 4O3PA 5A8WA 4HDHA 5L38A 1VQYA 1U0HA 3DLJA 2EBGA 4ETXA 1RT1A 3EGWB 1RDRA 3PRVA 4KHRA 2QL5B 2XO7A 1O0PA 4G1QB 4KR0B 1NBEB 2EWHA 4H4OB 3VAKA 4RW7A 3AJDA 3CT9A 4O4GB 1WOOA 2YVSA 2W4PA 5FDLA 2GJFA 2MHNA 2VG5A 2HNDA 4YFUA 4ED8A 4NXMF 2FDNA 1B64A 3H42A 4USJC 3MCOA 3LP0A 4HHJA 3K57A 4QCLA 2LKZA 3UI3A 4CWBA 1S1UA 1Q4RA 3KG0A 3VAFA 1JJ4A 3UE2A 2C2MB 1RCOB 4HYKA 4M5GA 3PR4A 4DV0F 1YBUA 4AD6A 3F41A 2FHKA 4K4YA 3GWCA 3AQOA 3MUMP 4CO5A 3HVAA 2ZC4A 1KVKA 4NLGA 3RU0A 2AMCB 4KO0B 2LQ5A 2J9DE 3AXKA 4ZN1A 2FB0A 2BEFA 3KMQA 2EW9A 5H9FJ 2DPJA 2DGXA 4KGKA 4CYUB 3ZTPA 2QYGA 5HROA 2XMJA 4UZCA 5T7LB 1DHMA 2WVBA 1IWAA 1JLFB 3R5GA 1RT5B 1RWXB 3G8TA 2W24A 3QSIA 3CJ5A 1K0TA 1RA7A 2LVWA 3T3FA 2Z2YB 3OVAA 4QIEA 1FRLA 1MNEA 1XR5A 5AJ3F 2CJBA 2CJAA 4ED4A 3PIPQ 3P4UB 1HBMA 5CYQB 4P72A 5KT6A 2OGUA 3LP2A 2DNNA 3RJMB 5HMWA 1V3RA 3TAPA 2ADCA 1RA6A 3M9NB 1YJ7A 1FK9B 1NSPA 2CKWA 3K5PA 2CZ4A 3M2RB 3V2UC 4DBQA 2E9RX 4RUHA 5J2MB 2R8HA 2DJWA 1WHYA 2FJBB 2OD6A 2BVZA 5F3ZA 1RT4B 2Z0GA 3C6UA 3K5NA 4DV0J 3GIKA 2M9KA 4HTJA 2YKMA 2IVYA 2YWFA 4ZPWR 3T5LA 1WTBA 4W92B 2VFSA 2A1BA 4JYAJ 3D2WA 4WKRA 3CDAA 5LL6d 2B9EA 3M6UA 4DZ6A 5KFHA 4UQTA 1X4CA 2HBYB 1GXLA 3KJVA 1Z4UA 3HSJA 4QIFA 5HATA 3MF5A 3CJSA 4WJBA 1JLGA 2DB1A 3IR5B 1UJ6A 1Q78A 4OYPA 3GFZA 1U6ZA 4DDFA 3IG1B 2B43A 4RW4A 4RUAA 1DAXA 2AJ1A 5L1IA 2VASA 1KQSR 2BV3A 3KLVA 2V4JB 2W7OA 3MUVP 3D67A 2XG8A 2YKAA 1AUDA 2LFVA 3GV8B 2HHHJ 4NX9A 2GIFA 2A10A 4QJVA 5HN0A 4DR5J 2AGQA 3KLIA 2BE7D 1M1HA 1ROFA 3HPOA 4IQXA 4JI6F 2MKJA 2W9BB 1U6FA 4FF3A 1MU2B 1EHWA 3HSGA 3ZZ0A 1VRUA 4MFBB 1ZTTA 1N88A 3DGPB 3ZTOA 6FDRA 5K20B 1IJFB 1FA0A 1MN7A 3GYNA 4PPDA 2ZOFA 3EICA 1RT3B 3MEKA 5J2QA 2YNIB 1VIOA 3IR7B 4I6YA 4J90A 4PXBA 1RK8A 2V63A 3CJKB 3TO8A 5GAHI 1KFSA 3QO9B 3ZZPA 4K4VA 2KHCA 5KG7A 2LDIA 3BB5A 5A0YA 3ZZUA 1S1WB 4DN0A 1C2PA 4DQIA 3IWNC 2UXCJ 3AFGA 3PFOA 4WFBQ 4ELUA 1KLMA 3FSYA 5C42B 2QGFB 3AODA 5HROB 1I6JA 3TNVA 4B9SA 4L3NA 5G4DA 1JIHA 1YX2A 5A8RB 1VRTB 1SQFA 2VKZG 3HK2A 3KLIB 2B4VA 1RT6A 1WC3A 2VFRA 2YNFA 3LGHA 4HVZA 4PWUA 5CD4A 4K0KJ 5CHCB 1UVKA 1S4FA 4LQ9A 4DPTA 3NY0A 4AXIA 3VZIA 4Q5VA 2DRBA 2UU9F 2I0XA 5EX0A 5KFMA 1TK5A 2IC3A 1VQ7S 2W4CA 1VQPS 4NLSA 5HQ8A 5CABA 2KT5A 4KQZA 5KOWA 1T05A 3NWRA 4LRCA 5F0UA 3RBEA 3F73A 3KK3A 3WC0A 2DT9A 4I4BA 2V8DA 2XB2D 4DCJB 2BMBA 3A8EA 4K8RA 5KFNA 1R0AA 1C0TB 3PW5A 2V2ZA 1H73A 4I7FA 3LQVA 4K5SA 2VH7A 2HFSA 2CYYA 2G1DA 3DC2A 3JQKA 4GVLA 3TJ9A 2VV5A 5HMXA 3OR2B 3MMCA 4H4OA 4USVA 3PVXA 2VODA 1HBNB 1RAEB 2EG1A 3MDFA 3HJFA 2I1RA 1AZSB 4WIIA 1U1MA 1SC4B 1T94A 1TR0A 2DNYA 1X0PA 2GMJA 3O3LA 4DFKA 4X4NA 4DR2F 5ETOA 1TL1A 3NNCA 4ZP8A 1LW0A 4F04B 4NCGB 2L41A 3HKZD 3BGOP 3DFEA 3K7RA 4JI4J 5IXUA 3KLHB 4NCBA 5E3CA 4DR2J 1S72S 4EWTA 5LT5A 1TL5A 4LFBF 1FKAF 4K59A 3O5TB 2JDJA 2C2NA 2DITA 3QJLA 2M8HA 3RB0A 1HNWF 4ES2A 6FD1A 2Y1IA 3S8SA 3CJTA 2H54B 4DZDA 1S9FA 1ZM4A 4PUOB 1H2TZ 1TAQA 1HW8A 1KS2A 1WUUA 2AIRB 3RG6A 2AJFE 4N8NA 3RB6A 2RQKA 1KP6A 4FYDA 2QLBB 4I7FB 2CPFA 4ZPVR 3CJ4A 3IAS9 2ILZA 3FFIA 1TMJA 1UMJA 2K2PA 3KG4A 3MCMA 4I2QA 1VISA 4J5OA 4RBUA 1FKOB 3EVOA 4EO8A 4B3SJ 1QVFR 2GA7A 2UUCJ 2YKNA 1I3OB 2IYGA 2VD3A 2MKIA 3TANA 1YK9A 4EK2A 1WSVA 1OIAA 1AB8A 1O5JA 1S0MA 1VQKS 4M5IA 2NREA 2CQ1A 3QYYA 2AQ4A 1NMEB 3UN3A 2ADBA 4RW8A 2AJ4A 4PUOA 1RXOB 1RYSA 2MKYA 1LWCA 4DX5A 2G9OA 3NGKA 4K2XA 2B9XA 4NZ7A 4IR1A 2HHHF 4OLPA 1CULB 1VRTA 3MPUB 3W2WB 1VGYA 2BJDA 2ZE2A 3TR5A 2CG4A 5HSPA 1J5EF 2MQQA 4PG6A 2O1PA 4USWA 1N5YB 3MOJB 2IHR1 1S97A 1R3NA 4O4GA 2YNGA 1IUJA 3SCLE 5IT0A 4YMEA 1RACB 2YY3A 3MMAA 4MAKA 3RR8A 3PX4A 2KRRA 3DU6A 3UD5A 1CJVA 3SFGA 3WX8A 1HBNA 3W66A 1WSRA 2EXUA 2RHSB 4Y2CA 5LXYA 3ZZOA 1HBOA 4ED6A 1N5VA 3CC7S 1B0TA 5KFVA 1KTVA 4GC7A 1VC0A 4DSJA 2HHTA 3GZ7A 2WB1D 5M2PA 3JSMA 4KY3A 2ACYA 2RQMA 3U27A 4L73A 1N56A 2HHVA 2OPSB 1CG2A 2KXHA 3R6GB 4JV0A 4A4JA 4EUVA 2WSEC 4I68A 1F5CA 4DR5F 1X5SA 2M5YA 4N8OA 4EU0A 4DV2J 1REVA 3SDEB 4DR3F 3K5MA 4ZDNA 1LNQA 1GQEA 4TY8A 3EZ5A 3QT5A 3QRRA 2XYGB 1N34J 4HTIA 4F2SA 1KOHA 2I5JB 2FHJD 4FPIA 3K2YA 4OX9F 1EX8A 4FS2A 2I5JA 5T41A 3POTB 3KLFA 1JNRB 3ILJA 2DNLA 3M1VA 2HGMA 2VL1A 2PDAA 2CADA 2F65A 2MZ1A 4B9LA 1U0SA 3ILIA 2V6AA 1ZTWA 2CQCA 3KTQA 3Q8VA 3VQTA 4DF4A 1SJRA 2X3DA 2XWYA 1JX4A 2DNGA 3I5BA 2OPSA 2K8GA 4BLGA 2H1YA 2RUGA 4DN9A 4ED3A 3PX0A 4M63A 2W4DA 3CPWR 5C2GA 2FC8A 3DLEA 1QUPA 1OPIA 2RQ4A 4DR6J 2QMXA 1TK0A 3LOUA 3CDUA 4OZ2A 3H25A 1B3TA 1IXKA 1YJRA 4LBPA 2NSBA 2XMKA 3GFXA 3KNGA 2JWNA 3D1QA 1F9EB 4HACA 1RT4A 2R7QA 1G7CB 5C7PA 1RZMA 4HHUA 1S57A 3GSDA 2HNZB 1NH7A 3ZTRA 4ECUA 3SCJE 2V68A 4DV7F 3D54A 4DX6A 2BW7A 2IAJA 2BE2B 1RWMB 2OEMA 3M32B 2G0CA 4YEAA 2L9NA 2W8LA 3HFZB 2IBOA 1HMVA 2OPPA 3DLKA 1ZM9A 2OUGA 3CCMS 5F8MA 1Y00A 4C0OC 2KO1A 4FS1A 2DISA 3GIIA 2D69A 2K1RA 4ZKAA 2WHOA 2ZBIA 4HH0A 2RVJA 1BUXA 3ZTSA 2V67A 4ICLB 3EVMA 3H5UA 1XR6A 3NGUA 4C3KA 3EDRB 2R7WA 3R1LA 3CMES 3NRBA 3D3BJ 3A13A 1UFLA 4HL9A 4YR2A 1WC6A 4TY8B 4C8ZA 1U45A 5KT3A 1YJWS 4B3TJ 2U1AA 4IH5A 3IRXA 4FVMA 5GAGI 3MM6B 2DR9A 1HQUB 4USTA 3RZAA 3A1YG 1FXLA 2R7VA 1WKKA 3R8YA 2ZD1A 2JHEA 2UP1A 4P7VA 2V34A 4RO0A 5FLXY 1UVIA 3EGZA 1WKLA 2R2UA 4JV5J 5KFPA 3TQEA 3T5KA 1NRKA 5L1LA 3PXGa 1LKZA 1QSYA 4M5DB 2XMMA 2MY8A 2DHAA 4ECSA 2LEBA 4KJIA 2XHWA 3H8YA 1O51A 5C5JA 2R8KA 4UTGA 1X8DA 4MIAA 4ZS6A 1UP1A 2C3YA 3PO4A 4J9OA 1FK9A 1RTJA 4KIAA 3R1HA 1ZA1B 1U24A 2VC1A 1NO8A 4G65A 1U1NA 4U7UD 2ZVSA 2BJEA 3DMJA 1HA1A 2F9DA 2GGPA 2F40A 4I69A 3TUZC 4ZPDA 2UXDJ 4WZQA 3BPSP 3O44A 2J76E 1CS4A 2VBXA 2H65B 4B3SF 3QGGA 1DLOA 3M6XA 4YS2A 3HSZA 1UKUA 4DUTA 4ES3A 3BQ1A 3IBFB 1JLFA 1IKWA 3R27A 3R5DA 3JYTA 1HNXF 2PFDA 1NK5A 2VA3A 4LF6F 1SH2A 4DG1B 3I0SA 3M2UA 1N33F 1RLCL 3D0GE 1V3ZA 3ENWA 2YKNB 2MQNA 5KFXA 2UUAF 4DR1J 3SYZA 4TNOA 4CP5A 3IA0A 2VFVA 5H1SV 2FIUA 1UVMA 2WSCC 1RAOA 2ALZA 4LF4J 3ZNJ1 1F0XA 2WSFC 2RS2A 2FLPA 2HW3A 5D0EA 2MZSA 2Z4PA 3HLUA 2EG2A 4ZP9A 1HPZA 1HKAA 4CM2A 1SC3B 1FDDA 2FGCA 5ADZA 4ED1A 1Q7LB 1FESA 1Y10A 2RU9A 4Q2MA 3ZZYA 4DL3A 4DR3J 2F5GA 2ZZNA 1KNZA 2IYIA 5D0RA 2IIHA 1S1VA 3RBZA 3MFHA 4DCPB 4K50A 2XNQA 5BYRA 1WI8A 1U1PA 3FZBA 1IKXB 2KFYA 4DS4A 3D28A 2FLNA 3M8QB 2B56A 2KVQE 4ZCLA 3KHGA 2HBRB 2L08A 3JYTB 4Z37A 2CQPA 1K73T 4O4RA 4JI5F 4NLRA 4NASA 2LEAA 2B51A 3HDSA 3IO1A 2VU5A 3IXQA 1HD0A 1RWPB 2FZCB 2YWHA 3LGNA 1ZH5A 1ZAWA 1RYRA 2BQUA 4B3MJ 4MK9A 4I1TA 1KSPA 1HI0P 4X4RA 3KJFB 5D6GA 5LMUJ 1OSDA 1U2CA 3BS9A 1IJEB 2UV8G 1PBUA 4NZ6A 2CQ2A 3MTKA 3DLGA 3NS7B 2Z2MA 3R7SB 3OL8A 3TQ1A 4KE5A 5KFWA 3PW4A 4PG5A 2D74B 2VDIA 5F41A 2N3OA 2W9BA 1LQ9A 4C0BA 4CT9A 5GAGU 3ZNUA 1IN0A 1NCLA 2DGWA 5B0CA 4UZBA 4XPEA 4RUBA 3SCKE 1FVQA 2CNNB 4IKAA 4CM0A 5K8MA 3JS9A 3BGRA 3I0RB 3TAMB 3PRBA 3OHAA 3P49B 2H5EA 3SEOA 4DLEA 3IG1A 3N6NA 1EB0A 3ETMA 1REVB 3N0VA 4Y2IA 5K14B 2GQQA 3R3TA 1X9MA 1IM6A 1Q8LA 3W8PA 2OFGX 3O8WA 2KZZA 1LEOA 2GW8A 4DPWA 2E7XA 4NA1A 4OX7A 3X1LB 3M05A 3M7VA 2FHJA 4LF9J 3JSMB 3J7Z5 3MFIA 4MKAA 3EWGA 1DY3A 3VTIA 1TVRB 3WZ0A 3D7SB 1BQXA 3LAMA 4OQJA 5HVHA 1U1RA 1RT2B 3LALA 4ZJLA 2GAGC 2EK6A 3EYZA 4JI3F 4JBCA 4J9SA 3JAMY 1U6BA 2YNIA 3HF5A 2Y8WA 2XI2A 1NSKL 1RUSA 1WHXA 3TVYA 1NKCA 1KC8T 3NNHA 3I87A 1RABB 2ZJRQ 1HBUA 4JV1A 2HVEA 1Q81T 5ETPA 3VQSA 1VQ8S 3MMBA 2KZMA 1KKHA 3AJ2A 4HACB 2KI2A 3EE3A 3IP0A 2J9DA 3UN5A 4NA2A 4WWSA 1YIJS 2HK2A 4QBUA 4K4TA 3R5JB 2HFUA 4OYXA 4DSFA 5IT4A 3J7YI 3MD1A 2OIHA 1B0PA 5AXLA 1Q5YA 1KWMA 2GQ2A 4CLZA 2ZZMA 3DM2B 3T19A 1PC4A 2HPUA 2VHGA 1XTZA 1B7YB 2VZ9A 3BDPA 4ZVUB 4PCQA 2ZOMA 4RNNA 3HVTB 3CO9A 3VV2B 1DARA 3VVUA 4ZIVA 1N36F 1HWUA 5CA5A 4MIWA 1E6YB 2KJWA 3EGVA 4WFAQ 3V6JA 5DQHA 2GS8A 3NL0A 4O3OA 3ET6A 2KM8B 4B9UA 1KHVA 4W90B 3QLHB 5EWEA 2GO9A 3MXHP 5D4NA 1HNVA 3I5AA 4F36A 3HMJG 4P2FA 2HVHA 3J81U 2QE5A 4JYAF 2MZJA 3UN2A 2XM3A 3TVKA 3I9V9 4A8WA 1FJ7A 2RSQA 3GIRA 1AYEA 4LF5J 5IT9U 2HZCA 1PAUB 2QLWA 3A8JA 2AWZA 3MM8A 4LRFA 2IM2A 4KC5A 4CH0S 5I3UB 5LOQA 1QTNB 3GONA 2OO4A 3DOMB 1UA0A 3NMAA 3KUHA 4AT1B 4B3OB 4K2JA 3RAMA 1XMOF 2G2YA 3CD7A 1MWQA 1RKJA 1WG4A 4CLSA 1NDCA 1RQ0A 2FVPA 1EKSA 3I4PA 2GX8A 3QMQA 1MLAA 4ZCKA 3RYLA 4ZCMA 2XMAA 4XTTA 5L1JA 4F02A 4AL6A 1HLWA 1JLBA 3MCNA 3OPKA 2EFQA 4AXJA 4C8OA 4M5LA 2ROPA 2AYBA 4XK8C 2DBBA 2GVDA 1NJYA 1RADB 3BM7A 5KG3A 4C48A 5KFRA 5F8HA 1S0OA 3K0JA 4AYBD 4FXDA 2CUYA 2MJUA 3CGIA 4F0KA 1SBRA 1H3DA 3CJ3A 4LSLA 3GJQB 1S48A 3G9CA 2DGVA 2GJIA 2JC0A 3RR7A 2MQPA 4WU2A 4OZ0A 3W9HA 4O3SA 3RBXA 1QDUB 4C7QA 3MMJA 4PXDA 2ZD1B 2QMUB 2D9OA 3CIZA 2RS8A 4OZ5A 1HQEB 3VZHA 1FWKA 2ZVIA 1HQUA 2JZ5A 3L7OA 3GLJA 1Q79A 2CG8A 4P73A 3H5YA 3KK2B 4I67A 2RH3A 3SMZA 1O6XA 3SI8A 2HQ3A 1S99A 2XS5A 2RNEA 3KJVB 5J2NB 4DG1A 3HFVA 2FJWA 1WC0A 1U1KA 3NXZA 3DLLQ 4B9VA 1LK7A 2D7SA 3D68A 5IM0B 5KFBA 2HKEA 1NK0A 1R7IA 8AT1B 3DHWC 1FRJA 2EFOA 4LRAA 2E29A 1SL1A 4G6VB 3U1NA 3PX6A 2QSFA 4WFXA 1FJEB 4JI1F 5J2MA 4LR7A 4ZVPB 4R25A 3GCWP 3KHLA
chains in the Genus database with same CATH topology
3H5XA 1KD1T 2AD9A 5K8PA 3SQGB 1KLNA 2UVRA 1MU2A 2IVFB 2MKHA 4X4SA 3UCZP 4OMFG 3NGDA 2OLWA 4P2SA 2GV1A 4DQRA 1U1QA 2V4RA 1MWYA 3GR1A 1QAYA 2RDIA 3KLEA 1S6PA 2KG0A 2RRNA 1QAXA 2KU7A 4EBDA 1SL2A 3CULA 4DX8H 3AA9A 4RW4B 4DEZA 1GX6A 4R8UA 5A8KA 4RW9A 1FKOA 2ZH2A 2ZH7A 2UUCF 2GJ2A 4B9TA 3H40A 4DOZA 4F50A 4FXWA 5U47A 1FTRA 5KFLA 2M2BA 2APOA 1YRXA 2FUG9 2XSJB 2YX1A 4IH6A 4Q0BB 3CUNA 2ABYA 4RW6B 2FJEB 1CSJA 2PSZA 1WEXA 4MJKA 3F73A 1Y5LB 1R8BA 2KH9A 3MGJA 4USHA 3B82A 5F3TA 2EFNA 5KOXA 2CQ3A 1JNZB 3CD6S 1YHQS 1NK8A 2XLKA 2XBPA 4ID5B 2UV8A 5HBMA 3Q8RB 1OS5A 5DS7A 2N7YA 1IKYB 2WONB 4ZHRA 4GC6A 3TA0A 2DR7A 3KKFA 4LIRA 4E0DA 1NHUA 4B3OA 1XEZA 5EDWA 3MR2A 2ZH9A 3MMCB 1UVNA 1TVRA 4TY9A 2L3MA 4KKOA 4IFVA 3BQ2A 1VIXA 4N76A 2MQMA 1S1XA 3FEZA 5J2NA 2JFKA 3RB3A 4OI1A 2RKIA 4QW9A 2XLJA 1IR0A 4H54A 2CPIA 3GQCA 5JUMA 2N7CA 4YR0A 3JSRA 3DYAB 3OTEA 4NA3A 1ULRA 5LSRA 3TAMA 2QYCA 4URGA 4ECXA 2R9LA 2D1CA 3NNAA 1OPZA 3CJ0A 5IQQA 5KT5A 1TKXB 2OTLS 1H2VZ 2ZKUA 2LMIA 2M70A 1SIWB 2B7BB 3CDEA 3P5TL 3UCGA 1XN9A 4ZPCA 3LP1B 4PQAA 1CQMA 2GFFA 4BHQA 2RKIB 5A8KB 2LECA 2LA4A 5A6PA 2D3UA 1ZAXA 2I8EA 3T1AA 2HVZA 2R7RA 1NK4A 4CQ1A 5DG8A 2VG6B 4F4YA 1U4BA 2BDPA 2YNHA 3H20A 3DRSB 1HARA 1RT1B 2EKYA 1QY7A 3QO9A 4DL6A 1H98A 1HYSB 2I38A 2YNGB 1JKHA 4WYLA 4QZVB 3MM8B 2QRRA 1SJ1A 2ZH4A 4ZP6A 1Q8IA 4K0KF 3V81A 2GMHA 1XC9A 2JEGA 1LW0B 2XMUA 2MY7A 3CCRS 1RTIB 2X51A 3G6ES 3ICLA 2B9YA 3OFHA 1APSA 5DETA 5ITHA 2AYEA 3AA8A 2Z2LA 3T6BA 4KBIA 3MAQA 1GXUA 3CJ2A 4OI6A 1FJCA 3KG1A 4DUZF 2G4BA 4QU6A 5CZVA 3IRXB 2DNKA 3KMSA 4DL5A 4DF8A 3J7ZT 4WE1A 1T05B 1YTYA 4LT6A 2KYXA 2QA2A 1BQNB 1VQSA 5KG1A 3CC4S 4OZLA 2OPQB 3KLEB 2KXFA 1KQGB 2V4QA 3C8YA 4LVNP 3HHKA 3UDCA 1WHVA 1X4AA 1RI7A 2PT0A 5KFEA 1LV5A 2ZBCA 1MSWD 3BF4A 3OW2R 2R7UA 5EHHA 4Y2AA 2Q1LA 2V9KA 2PIIA 2HNDB 1XMBA 4U7CA 3ONQA 2BQRA 3P3DA 1S49A 3THPA 1HYSA 3T9NA