4I2PB

Crystal structure of hiv-1 reverse transcriptase in complex with rilpivirine (tmc278) based analogue
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
424
structure length
412
Chain Sequence
IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gag-Pol polyprotein
publication title A comparison of the ability of rilpivirine (TMC278) and selected analogues to inhibit clinically relevant HIV-1 reverse transcriptase mutants.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Hydrolase, transferase/inhibitor
total genus 114
structure length 412
sequence length 424
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4i2pB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4i2pB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4i2pB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4i2pB03
3G6YA 1S1TB 3VQSA 1TKZA 4Y2CA 1CSJA 4J9PA 4WYLA 3QGHA 2UVUA 2OPQA 4U6PA 2B5JB 1BQMB 3DLGB 3DM2A 2IM2A 3CDWA 4MK7A 1QAJA 4NLOA 1HMVA 5KFGA 2XCAA 4J9RA 2I5JA 3IRXB 2IC3A 3QO9A 3UR0A 5C42A 4ECZA 4RW6B 3RBDA 4HYKA 1RT2A 2IJNA 4TYBA 1QAIA 2FJXA 4ID5A 4YR2A 3M8PB 5J2MA 3MEDB 4MFBB 1IKYA 4NCGB 5C24B 4B3OB 1GX6A 3BREA 4ZP9A 4ZP7A 1S9EB 4LSLB 2AU0A 3NBPB 2BQRA 2C2EA 3LAKA 4EO8A 2R2TA 4WZMA 3V4IA 4MK8A 2E9TA 4PQUB 4NLRA 3JYTA 2WRMA 1LW2A 1R0AB 1S4FA 3NMAA 1TVRA 4ZVHA 5KFSA 4ZP6A 1RTDA 5J1EB 1IKXB 3BQ2A 4LQ3A 2FVSA 3C6TA 5KFFA 4JV2A 3HVWA 1C0UB 3BJYA 2ZD1B 4JV0A 3OL9A 5F9NA 4RZRA 1QE1B 4O4GB 4RW8A 4YP3A 2HWIA 1VRUB 2IJFA 2WHOA 2J6SA 1TP7A 4O3RA 1TV6B 3LANA 3KLEA 4TLRA 5C5JA 2JLEA 1TKXA 3GILA 2W9AA 1RAJA 1FKPB 3KLFB 3QIDA 4IFVA 4RW4B 3QGGA 3MEEB 4F50A 3ICLA 1C0TA 1RT3B 1HQUB 5EWGA 4G3IA 3DDKA 4Y3CA 4QW8A 4J9KA 4F4ZA 4Q8EA 4TY9A 3QZ7A 1C1CB 1IKWA 1D1UA 3BSNA 3ITHB 4K4TA 4TYAA 1S1UB 2OPPB 3DOLA 4ZPDA 4YR3A 5KT3A 4NLTA 3CJ2A 1JKHB 4Q0BB 3KLVA 2BE2B 3MEGA 4NLGA 1FK9B 3I5BA 4MIAA 5KG4A 1NHUA 3LALA 4H54A 2V4RA 4EYIB 4ECYA 3DOKA 5J2PB 1T03B 4NLDA 4MH8A 4K4VA 3N6LA 4K4XA 5KFYA 1N48A 2C22A 4QWCA 1TL1A 2AX0A 3PJWA 4I2PA 1LWFB 1JLCA 1DLOA 3M9MB 1S1WB 2WOMB 2YNIA 4IFYB 4URQU 3CIZA 2V0NA 2W7PA 3BSOA 4J9MA 2BRLA 3SFUA 4MK9A 5J2NB 2FVPA 2W9BB 1S10A 3KK3B 5HLFA 4Q8FA 2ILYA 4MIBA 5KFUA 4QWBA 4RUAA 1JLEB 2ZE2A 4PWDA 3HHKA 1TL3A 4RUCA 1UWBA 4TQSA 1RTIB 5C25A 2IA6A 2IAJB 3BQ0A 3HVTB 2W8LA 5KT2A 3C6UB 1LWCA 4FBTA 1RTJB 1RT7A 4RW9A 3V6KA 4H4MB 2CJQA 2QE5A 1ZETA 5KFVA 3OSNA 2W9CB 2RDJA 1RT6A 3FSIA 1HYSA 3QYYA 2WONA 3KLGA 4PUOA 1D0EA 3PW2A 3KLHB 3LP1A 2R2SA 4KFBB 4Q44A 4WXOA 1HNVA 5HP1B 2R8HA 2XGQA 4I2QA 4KB7A 2B43A 3I5CA 4K4WA 4ED7A 3V6DA 1T05B 2ASLA 3N6MA 2HWHA 5F8JA 4OL8A 1RT1A 4YR0A 2FLNA 5J2QB 2YNFB 4WZQA 2E9RX 5KFMA 3BSAA 1EP4B 3UDLA 1HQEA 4XPEA 1REVA 4ZVEA 2YKMA 4RNOA 3KMQA 5KFNA 1IKVA 1FKOB 3DRSB 3BGRA 2AWZA 4ICLA 5KFHA 3DI6A 4ECXA 5CYMB 1RYSA 1BQNA 3DRPB 5HBMB 3LP0B 4TY8B 4WE1B 4ECQA 4KO0A 4DL2A 5DLGA 4ZVGA 3KK1A 2O5DA 1HPZA 4IR9A 1HNIB 5I42A 1S6PA 2VG6B 4R5PA 4RNNA 4J9OA 3IS9B 3T5JA 2RF2A 3QLHB 1RT5B 5JXSA 1JLQA 1EETA 4DG1A 1RA6A 2GIRA 2JEGA 5KFZA 5KFKA 4EEYA 3BSCA 3M8QB 1JLFB 2ASJA 1JLGA 2JEJA 4DL4A 3DM2B 3GIJA 1JLAB 4EYHB 1HMVB 3V81B 3CDEA 2HMIA 1U09A 1RYRA 2HNYA 4ZP8A 4ZHRB 3H5XA 4HKQA 4NLXA 3KHLA 1J5OB 4IH6A 3PR4A 1SUQA 4H4OA 2QV6A 1XR5A 4Y34A 3MR3A 3GIMA 3TQ1A 3MFHA 2OPRB 2B6AA 4NYZA 2RKIA 4QPXA 4GC6A 2BQ3A 1KLMB 3DRRA 2FVQA 2CKWA 2R2RA 4KAIA 4J9QA 4ECTA 3IG1B 5L9XA 3H98A 5F8IA 1S0MA 1TQLA 1S1TA 3KK2A 4YMEA 5DG7A 1RTHA 3EPIA 3PW7A 3KOAA 1TVRB 3D5MA 5EWEA 1BQMA 3DLGA 1Z4UA 3ISNC 3IRXA 4XPCA 1SH2A 3FQLA 4EBEA 2IM3A 4Q45A 3E51A 4RW6A 5KFAA 4DL7A 4O3SA 4KV8B 5CYQB 2XCPA 4RW8B 3OL8A 1K1QA 3RBEA 3IGNA 1WNEA 1JIHA 4IG3B 3LP2B 4KBIA 3M8PA 3MEDA 4MFBA 5FDLB 4NCGA 5C24A 1N5YB 1DTTB 3JSMB 1N6QB 4B3OA 1S9EA 4LSLA 5HROB 3NBPA 3FRZA 3GYNA 3QIPB 5EUHA 3M9OB 3CVKA 4RW7A 1DTQA 5KFDA 1NHVA 5KFLA 4NRUA 3E01B 3IN5A 1TKTB 4PQUA 4NLSA 3GV7B 3CWJA 1RDRA 2FJWA 3TVKA 2R2UA 1S48A 1R0AA 3CO9A 4DL6A 3NL0A 5K14B 4F4XA 1VRTB 1T3NA 2WCXA 3NAHA 3I5AA 1IKXA 2YKNB 3DMJB 3D28A 3RAXA 2YNHB 1C1BA 3MTKA 5KFXA 2FLLA 3T5KA 3OLAA 5DQGA 3MEGB 3OHAA 4IDKA 1QE1A 3I0RB 4O4GA 5F8LA 5KG2A 1VRUA 4NLYA 4K4UA 3UPFA 4NLQA 4WXWA 2HNDB 4EBCA 4LSNA 1S6QA 3I0SB 1FKPA 1TL1B 3KLFA 5KFRA 1RT4B 3LAMA 4RW4A 3CJ4A 3MEEA 2WTFA 3RAQA 2YNIB 1HARA 3MR2A 1HQUA 4MKAA 1SV5A 5KG5A 4K50A 4K4YA 4IRDA 4O3OA 5F9LA 3OLBA 3QGIA 2W8KA 2HAIA 4K4ZA 5KFIA 3ITHA 1S1UA 2OPPA 1I6JA 3KHHA 1C2PA 1TL3B 2YNGB 5D3GB 3Q8QB 3PVXA 1S1XB 3FFIB 4Q0BA 3PHEA 4ZPCA 2JEIA 3H5UA 4ECRA 4RNHA 3H40A 3T1AA 4X2BA 3PJXA 4URGA 2BR0A 1S9GB 3G6XA 4IG0B 5KG0A 3NKYA 5J2PA 1T03A 3KJVA 1ZTTA 3GV5B 5F8HA 2JC0A 4Q43A 2XWYA 4O4RA 2V9WA 4WFYA 4JV1A 4WYWA 4KE5A 4O44A 2XGPA 3CJ3A 1LWFA 3TAMA 1S1WA 2WOMA 4IFYA 3V6DB 3NAIA 5KG7A 3MF5A 4ED8A 2W7OA 4J9LA 1W25A 4O3NA 5J2NA 2W9BA 3KK3A 2C2RA 5L1LA 5I3UB 4KSEB 1RT1B 2R8KA 1JLEA 1LW0B 2OPSA 3PW0A 4NRTA 4XO0A 1JLBA 3DYAA 1RTIA 4I7FB 3H4BA 2R8IA 1S0NA 1LWEA 2IAJA 5DQIA 1N56A 2RDIA 4ED3A 3Q8RB 5F8GA 4H4MA 2BANB 4R8UB 1OS5A 1S1VB 3DLKB 3DLEB 4KKOB 4KO0B 2FJVA 2UVWA 3MECB 2D3ZA 2JEFA 1MU2A 5I42B 3OL7A 4R5PB 3KLHA 3RB4A 4KFBA 3OHBA 3MR6A 2ASDA 2RF2B 5HP1A 1RA7A 5KT5A 3SFGA 4G1QB 2DPIA 3KLIB 2UUWA 2VG5B 1T05A 4M94A 3V6JA 2D41A 2I1RA 1TKZB 4NZ0A 1JLGB 5KFQA 3UQSA 1YVFA 3OL6A 2OPQB 5DGAA 5J2QA 2YNFA 4QWDA 4FBUA 5KG3A 3EZUA 4IH7A 4QWAA 2I5JB 4ECSA 2IC3B 3QO9B 5C42B 1SUQB 3DRSA 4ZVFA 1SH0A 5DLFA 3T19A 3Q8PB 1RT2B 5CYMA 2HNZA 3DRPA 5HBMA 3LP0A 4TY8A 4ID5B 4WE1A 5J2MB 1IKYB 3DRRB 2AGOA 2IMWP 4RU9A 2VG6A 1T94A 3ISND 3IS9A 2FVRA 3QLHA 3CJ5A 3V4IB 1RT5A 2OH2A 4KHRA 5KT6A 2BRKA 5DG9A 2VG7A 3KK2B 2AGPA 1RTHB 2FVCA 3JYTB 4QW9A 3GQCA 2XC9A 3M8QA 1LW2B 5KFOA 3KHRA 1JLFA 1SH3A 4TN2A 2AQ4A 2D7SA 3G86A 1XR7A 4FS1A 4EO6A 2AGQA 1JLAA 2XI2A 3V81A 2B5JA 1RTDB 4KHMA 3C6TB 4ZHRA 3T5LA 3PW4A 1J5OA 4J9NA 3GIKA 2C2DA 3PW5A 3HVAA 2OPRA 2WK4A 4LQ9A 4IKAA 4ECWA 1S97A 5KFEA 3GIIA 3KLEB 4FS2A 1KLMA 4YQWA 3QZ8A 1TKXB 1IM4A 3IG1A 3BR9A 4DEZA 2UUTA 4IFVB 4RW7B 1DTQB 4DL5A 2C28A 3CDUA 1C0TB 3N6NA 4ECUA 3RB3A 1JXLA 5EDWA 3CJ0A 5EWFA 1IKWB 3DOLB 4DL3A 1C1BB 5DGBA 5J1EA 4NLPA 3HKWA 2DPJA 4ED6A 4ZPAA 1C0UA 3FQKA 4IDKB 3M9NB 2ZD1A 4KV8A 5CYQA 3KHGA 5KG6A 1K1SA 2V4QA 4IG3A 3LP2A 3GV8B 2GC8A 3H5YA 3T5HA 5FDLA 2ALZA 1N5YA 3DOKB 1DTTA 3JSMA 1N6QA 4F4WA 1TV6A 4LSNB 5HROA 3H2LA 1S6QB 3QIPA 1ZTWA 4I2PB 1SV5B 1JLCB 1DLOB 3E01A 1TKTA 2XI3A 5F8MA 1RT3A 2VA2A 4IQXA 5KFCA 2IBKA 3OSPA 5K14A 5HLFB 1VRTA 4URSA 4WFXA 1C1CA 1NNDA 1S0OA 2YKNA 2BQUA 3DMJA 2ZE2B 2YNHA 4PWDB 5L1IA 4J9SA 1UWBB 3NGDA 5C25B 4IRCA 5KFPA 1JKHA 2ZKUA 4O3QA 2R8GA 2BE2A 4EBDA 3I0RA 1LWCB 1RT7B 1FK9A 4RW9B 3PR5B 4IOBA 3H5SA 3Q8SB 3KJVB 2ATLA 2HNDA 1RT6B 1HYSB 3FDSA 2WONB 3KLGB 4PUOB 2UVVA 3IGVA 4ED0A 2J6TA 3I0SA 4IH5A 5KT7A 3LP1B 1RT4A 4O44B 4RNMA 1HNVB 3TAMB 4ZPBA 4I2QB 1N4LA 2IM0A 5KG1A 2E9ZA 1GX5A 5KFTA 3H59A 2OPSB 4M95A 2YNGA 1JLBB 3DYAB 5D3GA 5DQHA 1S1XA 3FFIA 4K4SA 5DG8A 3EPGA 1LWEB 1S9FA 4ECVA 1HQEB 1REVB 2ILZA 2YKMB 2AX1A 4TXSA 2IM1A 5L1JA 1KHVA 3HVTA 1IKVB 3C6UA 1RTJA 3BGRB 1S9GA 4ICLB 3DI6B 4IG0A 2D3UA 3BQ1A 1BQNB 1S49A 2W9CA 2J6UA 3PZPA 4GC7A 1MU2B 3KK1B 1HPZB 4RNFA 1S6PB 2WB4A 2EC0A 2JC1A 4ED2A 1JLQB 4ZMMA 4TQRA 1EETB 4DG1B 5KFBA 4R0EA 4IR1A 1MMLA 5JUMA 4QWEA 3SI8A 3KMSA 1XR6A 3MFIA 2R8JA 5I3UA 4F4YA 4ED1A 3KNAA 5KT4A 1LW0A 4I7FA 2VA3A 2HMIB 2HNYB 3V6HA 5F8NA 1EP4A 1QUVA 3MR5A 3H4DA 4IRKA 4H4OB 5KFWA 2BANA 1FKOA 4R8UA 1JX4A 2FLPA 4NLVA 2HNZB 4NLUA 1S1VA 2B6AB 1KHWA 2RKIB 3DLEA 3DLKA 4KKOA 2F8EX 2GIQA 3MECA 4MKBA 4NLWA 4O3PA 5KFJA 3G6VA 4WFZA 5T14A 4U7CA 3RB6A 1HNIA 2UVRA 5L1KA 4Y2AA 4G1QA 3KLIA 2VG7B 2VG5A 3RB0A 4JUZA
chains in the Genus database with same CATH superfamily
3HM9A 3HSZA 3W9JA 4CIOA 1NLKL 1QAJA 1HMVA 2IC3A 4ECZA 3CD6S 3VCDA 1X4CA 1GNKA 3H90A 3PTWA 1I51B 1Q16B 1V6HA 2CJYB 2QMWA 4ZVHA 5EN1A 4DX5A 3C6TA 2MEWA 2N3OA 4JV0A 5F9NA 4AUKA 1TP7A 3D6FB 4F0KA 3LANA 1OY6A 4M5GA 1BXNA 1CQNA 4OZ1A 1PC5A 3QIDA 4OX6A 5G0RB 3FSYA 4WCEQ 3HSDA 4ZN1A 1U2CA 3CCWA 3GCWP 3GR1A 2OD6A 2V4RA 2V4JA 2PGCA 4DV3J 5KFYA 2K2PA 4J37A 1DLOA 3M9MB 3R5JB 1UVLA 4ZK7M 2JRSA 4Q8FA 1F0XA 1UJ4A 2NXNA 3HHKA 1UWBA 4QR2A 3OVSA 4A8OA 2F3JA 3EVMA 1O6XA 1BUXA 2P6TA 2JJ4D 4WXOA 1S12A 2VODA 4M8LA 4DF4A 2CNLB 5H9EJ 4XPEA 2V9KA 2ZDPA 1T7PA 2AWZA 3DI6A 4ECXA 1RYSA 2EKYA 1RJJA 1XN9A 2O5DA 3MAHA 5I42A 1BE4A 3D0IE 2KTQA 4B08A 3X3UA 5BJRA 3UVJA 3EE3A 3TANA 2N7YA 2VB6A 1J5EF 3KKFA 3LW5C 1CJKB 2E1RA 4ZVRB 2BQ3A 1WDTA 1EZZB 3IG1B 1OMSA 4CTAB 2K3KA 2CQCA 3CCRS 1TVRB 3CCLS 3DLGA 2NXEA 1Z4UA 1UZHA 3RYLA 2XMJA 3LP2B 3GLJA 3ULHA 4FXVA 2W4DA 2X3DA 4N41A 2NUHA 2EKNA 2KVIA 4F4XA 1JK9B 4AYBD 1HQ2A 4LFAF 3OLAA 1M1KT 1HWJA 2ZH8A 4O4GA 1HWLA 2F4VF 2P9EA 5CHCB 2GJFA 3TA1A 4LR7A 2DNPA 4DF8A 3TUIC 5GAEU 3R5AA 1QUPA 4ZIVA 4URGA 3O2IA 4I69A 1VISA 5F8HA 4QR0A 2WOMA 3M32B 4NA3A 4I7FB 2A2CA 4PPDA 2IAJA 4N8OA 3BH7B 3RW7A 3DLEB 4KO0B 5EGYA 2FZGB 2XHCA 4BWMA 5HP1A 1X5SA 3IWLA 1SJFA 3MMAA 2Z56B 1HWKA 4LUBA 1IQZA 1BMQB 1SH0A 4I56A 2M9KA 1NSKL 2DISA 4NMLA 1M5OC 4AT1B 3RGIA 4K7QA 3QLHA 3V4IB 2OH2A 5GADU 1LW2B 1HIYA 4F0HA 1PIEA 1LK7A 3MPWA 2ZZTA 4OQJA 2I8EA 2K8GA 4YB1P 3EJMA 3DCAA 4GRSA 4C6AA 4LFBF 4IKAA 5KFEA 4CO3A 1JJ2R 1PBUA 4IFVB 4DV4J 3CDUA 5HK4A 3N6NA 1YBUA 3MM8B 3SZ2A 2X7IA 1H3DA 2L3MA 1HNXJ 3SXLA 3Q24A 2VC0A 1A0OB 3FZBA 2K7JA 1X9WA 1RBLA 1I5OB 1PJ7A 5KFPA 4P75A 3U1NA 5IC4B 3H5SA 4JOUA 1GQEA 4B9LA 1F3VA 1M1HA 4RNMA 4PAAA 2VPYB 3DYAB 1RWUA 5I3QA 2LU1A 5HO4A 2AX1A 1KEKA 3TZYA 4IG0A 4NPOA 4YB5A 5HATA 5L39A 4WKYA 3VF0B 3N4WA 4CZCA 4DG1B 4DPXA 4ED1A 2XB2D 5ETVA 2OD4A 3TEGA 4WP3A 3H4DA 2BANA 2MQ8A 5D77A 2RQMA 1CULB 2F1FA 2F4FA 4KKOA 3G6VA 4PRFA 2FUG9 3QT7A 3N01A 2ZDOA 2JX2A 3J81U 3F0NA 2GQQA 3UR0A 4UTGA 4FXWA 3LPYA 4LF2A 2BKPA 4CYUA 4YR2A 3NLCA 5IM0A 1CC8A 4CM0A 3PIPQ 1FTRA 2MQNA 2QLBB 2HS4A 1F5BA 4P72A 4FP9A 4N56A 1QSYA 1K0VA 4F4AA 4O3RA 2VBWA 1WC6A 4C0BA 5SZTA 3QGGA 2EFGA 4QW8A 1EHWA 3CCTA 4LRAA 3LALA 5J2PB 4M5NA 1ACMB 2P6SA 2C2ZB 3D9BA 5GAHU 2W2PP 2FVPA 3UD5A 3LH2S 4OZJA 3O1LA 1YG0A 2JOQA 2LEPA 1LWCA 1SIWB 4KGVB 2B4UA 1NEEA 3M8YA 4DUTA 3ET6A 1NSQA 1FRJA 4FF2A 2IDLA 4MJKA 1WEYA 1M5SA 1X9SA 1UEVA 3KJFB 2V8PA 2FGOA 4I4BA 2QLWA 1U1MA 3M8QB 2JHEA 3L7OA 3V81B 2MGZA 1VQNS 3MR3A 2AHOB 4OYAA 2KJVA 1Q4RA 1UW9A 5L9XA 4JB8B 3MM6A 3KK2A 2PMHA 1KWMA 2ROEA 1QSLA 4MTPA 2XMMA 1F9FA 1AYEA 3OL8A 3IGNA 3CCJS 4PXCA 4A46A 2ALYB 2HHVA 5ETTA 1Y7PA 3TO8A 4CH0S 2R2UA 4C11B 3BN4A 3C2PA 2YKNB 3DMJB 2FZCB 1R31A 4JYAF 2GAGC 2X1GA 1QE1A 2IPOB 4DX6A 1EIYB 4WXWA 2MY8A 4DCOB 3UI3A 4N47A 5ADZA 3LAMA 1JNZB 1XBWA 3O6QA 4Q0BA 2JEIA 3H5UA 3PJ9A 3OFFA 4X2BA 4CLLA 1S59A 2Q6CA 2K06A 5KTQA 3KJVA 5CYJA 2XZTB 2G1DA 2W4CA 4E8UA 4OYPA 3M4XA 2C2RA 4V19J 3BBFA 4M5JA 4ETZA 5HJYA 4X4OA 1K0TA 3QJPA 4F2SA 4DV7F 1RGVA 3DLKB 4NASA 3DGVA 3MECB 4KFBA 3SFGA 1NPKA 2D41A 1FRKA 3RG6A 4DN9A 3V5RA 1HR0F 2KFNA 2H4WB 2DNMA 4DPUA 3DOMB 3CCQS 1RT5A 2VQFJ 2VG7A 2I6WA 2FVCA 1SC4B 4ZLNA 2GW8A 3ZTQA 2D7SA 2AGQA 4PG6A 5DDQC 1JLAA 4HI2A 1YJUA 4DFJA 5HN0A 2C2DA 3HVAA 1JNRB 4ZVQB 2L9DA 2ZH6A 3KLEB 1UFWA 2MZRA 3BR9A 1K9MT 3D4JA 4EI2A 1IKWB 1R89A 3G6ES 1C0UA 1B7FA 3NS6A 3VAFA 1SBRA 2IVYA 4IG3A 3HHDA 3ZZTA 1N0UA 1N6QA 2HVIA 1TV6A 2NS1B 2YNHA 5L1IA 4JI5J 3NGDA 4KTQA 3I0RA 3SV4A 4RW9B 3QRQA 3OTEA 5HAOA 2ZOFA 2HVEA 3K8WA 5KT7A 3I87A 1QJHA 3H59A 2DH7A 2ZH3A 1IKVB 3CE8A 5GVQA 1M5VC 2CJKA 1DARA 2KRBA 1MROB 2R7SA 2WB4A 9ATCB 2QYGA 4FKYA 3TUZC 2DHXA 3KMSA 3MFIA 3R9LA 4U95A 1R8HA 3BGOP 4R8UA 3WQPA 4LRDA 5G4DA 2F8EX 1IM6A 4O3PA 4A47A 5T14A 4ZJOA 1R8AA 2FHOB 4UUXA 1NK5A 1FRMA 3CDWA 3MUMP 3CMES 3C15A 4XDDA 4ID8A 3SCIE 4A8KA 4ID5A 2FLNA 4DL3A 4ED6A 4FYYB 4OHWA 3LAKA 2J5AA 1MMNA 3BB5A 2M0GB 4OHZA 2XG8A 1V5VA 2FVSA 5KFFA 3U27A 3P49B 2G0IA 2HYIB 4UOHA 1MN7A 3AAWB 1HQUB 2LFVA 3P6YC 2DNGA 4QU7A 3TX0A 3QT8A 4OHXA 3HHLC 2Q66A 4NLTA 1JKHB 3FK4A 4FXDA 1YJNS 5M2RA 3DN9A 2NSBA 4PQAA 2VQEJ 1NU4A 3F73A 1MWYA 1F1BB 1OWXA 4I2PA 1CS4B 5IT9U 1IUJA 4JI3F 3KUHA 4IO1A 4RUCA 2RSQA 4DUZJ 2EVZA 4FPRA 1DQ9A 4P52A 4TU8A 1TTHB 1OPIA 3CEDA 3GB0A 1RABB 2V8GA 2B0GA 3BGRA 1Q8BA 2HHWA 2G9OA 5HBMB 5SUHA 1VQ4S 3OR2A 1U48A 3PIOQ 2GIRA 1VRQC 2KDOA 4MKVA 2JEJA 3ZZUA 4EYHB 1HMVB 4ZHRB 2HBRB 3C8YA 1J5OB 1SUQA 3QNWB 3RUBL 1SIZA 1FFGB 2CQGA 5CD4H 4CWBA 1VC5A 1RHJB 2MZQA 2DRAA 3G2XA 4ZJQA 2HIYA 1VMBA 1EARA 5E3RA 2IM3A 2AP6A 2E5IA 2V8VA 3B54A 5CYQB 2PE8A 4JI4F 3M8PA 1DTTB 5HROB 4J7CA 4F0MA 2Y9HA 1Q7YT 5KFLA 4EK2A 4W98A 3AH6A 2XSJB 2A18A 2EC2A 4N77A 3W5YA 5F8LA 3L95X 1UMJA 1HD0A 1NK4A 3N79A 2RHSB 4GO7X 3OTCA 1TELA 1FKPA 1YJTA 3W5XA 3OUYB 1RT4B 3DHWC 4C3KA 1SL0A 3RAQA 3PFOA 4UW2A 2YKAA 1UPMB 1SKRA 1VR6A 3SIPB 3D1QA 1RWWB 1RWOB 1U25A 1UKUA 3HLUA 3BYRA 1U6BA 2B9EA 3IC1A 3OXGA 4LJMA 3BBCA 2JC0A 4N7TA 1UJ5A 3KUEA 1IBMJ 1U24A 1RQ0A 1IWGA 2AYMA 4KYZA 3H7HB 2RUGA 1PAUB 5I42B 2CJAA 2VG5B 4M94A 1UTAA 2LA4A 3G96A 2ROGA 2RQKA 4KQZA 1TUGB 3TVYA 2GV1A 1GTHA 5GAGI 3LP0A 1F2GA 1BC6A 2VG6A 3UN2A 1O5JA 2V9WA 3PRVA 1CG2A 1PC4A 3TYTA 3L3CA 4KJIA 1S97A 1AZSA 1SI9A 1DQAA 4DPOA 1N32F 1W2BR 2GGPA 5HVFA 2UXDJ 4HTJA 5J1EA 3HKWA 1YK9A 4KV8A 3OVAA 1F5AA 4C8KA 2R9LA 4F4WA 1HHQA 2HK3A 2BJ7A 4E2FB 1V3RA 4QQBA 4URSA 1T3OA 2RRBA 4I0WA 1DRZA 4PG4A 3D3CJ 4J90A 2VH7A 4QU6A 2WSCC 4NYOA 3IGVA 2BXJA 3LP1B 4U7UK 3ZNUA 2LEBA 3UE2A 3TUPA 4NZ6A 4M95A 2CNOB 2YWFA 5D3GA 1P9YA 3MHYA 3T1YF 1KFSA 1REVB 1N34J 4KGMA 4OJHA 3TOQA 3ETMA 3ZZRA 3AJ2A 4XAKA 1HPZB 2PMWA 1WC3A 3LWMA 4TQRA 1Y3JA 1HBMB 3WX8A 3B78A 5KT4A 4QYRA 1EP4A 2V2KA 5ETKA 4GMKA 2CNKB 2X51A 4YN3B 5KFJA 4A8QA 5CA5A 3MUTP 2DGVA 1WEXA 4DPYA 1U2RA 3VZIA 2MHEA 4AFFA 2GMJA 5A8KA 3HKZD 1G3OA 1LFWA 4OZ2A 2QEXS 4P71A 4MAKA 2ZH5A 2MZJA 3G82B 3M1VA 2B9YA 4B3OB 3EGVA 2C2EA 1VBKA 1UA0A 4LT6A 3BO2A 3R2DJ 2LQJA 1TUVA 1RAGB 4PABA 1RTDA 4MMOA 3J81Y 4IOAQ 3OL9A 3A8JA 4R25A 5CAAA 1YZ7A 5D4NA 1KR4A 1ZM2A 4B3MJ 1VHIA 2XLIA 3JSBA 2CPDA 1TKXA 1RAJA 1PSDA 1VGYA 2DH9A 4Q8EA 1KQGB 4KPCA 2OPPB 5B0DA 4DSIA 5BYSA 3CJ2A 1W2IA 2XYGB 1YI2S 4K4XA 2PI5A 1OJ4A 2C22A 2AX0A 4OYIA 3HZEA 4IFYB 4DX7A 3SV3A 4DS5A 3AOCA 1JLEB 2ZE2A 3GPAA 1X4HA 3K17A 4JYAJ 3CC4S 5CZVA 2HZAA 2JFDA 2RILA 3QYYA 2YWGA 3PYEA 1X4DA 3PX0A 1Y00A 3GCXP 5CH7B 5KOWA 4DDFA 1Y5IB 3VVTA 2B4VA 3KMQA 3V4MA 2PEBA 3NNCA 2GVZB 3AT1B 1BQNA 3DRPB 1CVJA 2J9EA 3JTOA 4ECQA 2C3PA 3MM7A 4HL9A 3F56A 3VR1A 1MMDA 4UOFA 5KFKA 4EEYA 3BSCA 1GXLA 2EW9A 1RHMB 3TNVA 1WACA 3KHLA 4ELVA 1FT8A 2WSFC 4OI1A 5DRKA 3MM9A 3SQGB 3IR6B 4X62J 3PW7A 3KOAA 2DNRA 4DV1J 3D5MA 4JI6J 3MMCA 1WI8A 4DSEA 2QFIA 1NXIA 3QIPB 1X0FA 3IAS9 1LOUA 3TJAA 1UJ6A 2V5HG 2VOOA 2GJ2A 3S1TA 2OMOA 5F3ZA 3T5KA 3IWNC 3OHAA 5CD4A 2WVFA 1VRUA 5E41A 2XYHB 3I0SB 3KLFA 1TR0A 2UUBF 3C14B 1C2PA 4JI1F 2UV8A 1FJGF 3IXQA 1S9GB 3G6XA 4NE9C 1JJHA 2EK1A 2DNYA 1FWPA 3VQTA 2A6OA 3WIVA 4K8RA 2GAHC 4JP8A 5H9FK 4WFBQ 2M88A 4XO0A 1RTIA 1S0VA 5F8GA 1AUSL 2LQ9A 5D6GA 5KT5A 4HACA 1KVKA 4ZCMA 1L3SA 2WB1D 4EU0A 1Q78A 2UU9F 4LMZA 2C2MB 1YRXA 1HKAA 4LFCF 3ILOA 3ZZPA 2BRKA 3MURP 3KK2B 1U1RA 3R7BB 5DM6Q 4WK3A 2FGCA 4USIA 2R7XA 3O5TB 4OZNA 1CJUB 4V1Ak 2LDYA 1UFLA 5E3QA 2VU5A 2QL5B 5L46A 3M30B 4F25A 4KT0C 2WVDA 1VCTA 1H74A 4M5LA 1RT3A 3PXGa 3M2UA 3EVOA 3PNIA 2HKEA 3PR5B 5HJXA 2V50A 3HT3A 2QMUB 2G2ZA 3KJVB 1KQKA 2KXFA 2J6TA 2XNQA 2DR5A 4KPYA 4NYPA 1VHFA 1GX5A 1RAHB 4DCPB 3BPDA 1N8RT 2Q6BA 3C6UA 2CZ4A 2XWXA 3W9IA 1EJ7L 1E6YB 2IVMA 1OY8A 2DNZA 2HURA 5KFBA 4QWEA 3AD8C 4LVNP 3B4MA 2VA3A 2HNYB 3B6BA 4DOZA 4WU2A 2B6AB 3A12A 4G1QA 3W3SA 2VG7B 1FD2A 1S1TB 4Y2CA 1GMUA 4DV2F 4AD6A 3ZTSA 3JQMA 4YY3F 1B4SA 4DR7F 5J2MA 4LSLB 3DKDA 2KN4A 1QDUB 5B0CA 4RX6A 2DGSA 3EGNA 2ZVIA 1AA1B 1ULRA 2B4PA 2EFNA 1KS2A 1IKXB 4ERDA 4H4KA 4JV2A 1C0UB 4QIGA 2J9CA 3TZXA 2GJIA 2YBVA 4RW8A 2AZ3A 4JI0F 3NY0A 4KGKA 1TV6B 3HMJG 4HTIA 3GILA 2V94A 3PV8A 2PMZD 1X9MA 4Y3CA 3ZTOA 4KH0B 4ITSA 3NCQA 1FNMA 4DV0J 4JI4J 5HMYA 2OSQA 3DOKA 4MH8A 3N6LA 1VBZA 3M8RA 3BN7A 4FYDA 1LKZA 2NSCA 2YNIA 3HPOA 5HVHA 3KK3B 3CCZA 5BR8F 3UWTA 4DJBA 1ZETA 4H4MB 2ZJQQ 5ETSA 2RDJA 1HYSA 4PUOA 2QGFB 2B7CB 2MPUA 1T05B 3ILLA 1I1GA 2HBQB 1VQYA 5J2QB 3TW0A 5KFMA 5IT9Y 2GS8A 1JB0C 3HX9A 4CLSA 4FNHA 1YJWS 3CJRA 1Q82T 4FF3A 2MKKA 3LQVA 4R5PA 2BJ3A 2PN6A 1NB7A 3KWMA 4E0DA 3R5CA 3GIJA 4OLPA 2HMIA 5E2QA 4Y34A 4CDIA 4WFNQ 4GC6A 4M1KA 4DV5F 1V9OA 1NK6A 5AJ3J 2BABA 1WELA 2CPHA 2V2ZA 1X4FA 2JZ5A 2OLWA 2M5YA 1WNEA 2RS8A 2J9DE 1N5YB 1ZAWA 3M9OB 2VONA 2YXLA 1FRIA 3IN5A 4F7VA 1L3VA 3NAHA 4P6QA 3GZ7A 3E8OA 2DCLA 1Q1KA 3FUYA 1VQPS 2HNDB 1IBKJ 4DMZA 5G0RA 1HARA 3MR2A 5KG5A 2VZ9A 3QGIA 4BC9A 1AW0A 4DBQA 3PHEA 3H40A 2AEJA 1X4AA 1F3FA 1NK7A 4Q43A 1S6UA 4O44A 2ZBRA 3RRGA 2BV3A 2R8KA 1URRA 2AEMA 3HJVA 2J7UA 4ED3A 3CB4A 4WBFA 2NZ4A 5B7WA 3OR2B 1RA7A 4JI7F 3P5TL 4QZVB 1G6BA 1Y4ZB 3OL6A 3T1YJ 4ZCIA 1SUQB 3HJFA 4TU7A 3PRDA 2W2OP 2V68A 3JS9A 4USMA 1X31C 3CMAS 2GO8A 2OEJA 3GQCA 3PDNA 1SH3A 2DPIA 2B56A 3NCRA 3UDEA 1IQTA 1OQ6A 4NWBA 4LQ9A 3W63A 4AL6A 2YTCA 2CQPA 3IG1A 1WHYA 2C28A 3N0VA 4FVCA 5EDWA 3AY0A 4ELUA 3TA2A 4CT9A 1LWXA 3LP2A 5K8NA 3T5HA 3OR1B 3H2LA 4LIWA 4EUVA 3MCOA 4LSZB 2XI3A 1PYOB 2HRYA 2BQUA 1XTZA 1FKAF 2R8GA 2XHWA 3GYXB 2WONB 2UVVA 2HPUA 2Y1LB 1YJVA 5LMNJ 3I4HX 3TZZA 2MQMA 1NJIT 2O67A 2E29A 2A10A 4ICLB 3RRHA 4YDDB 2D3UA 4RBUA 3KK1B 4Q5VA 1S6PB 5GMEA 2G0JA 3GU0A 3VZHA 1WHVA 2VFUA 2BA9A 2ZEJA 2CUYA 4I7FA 4B3SJ 2Y1RI 4OZ5A 2KT2A 3DLEA 1WC1A 3C16A 2WVCA 2I38A 2JWNA 3WIUA 4DSFA 2RUSA 2DB1A 2QA2A 2HLUA 4OX9J 1Y5LB 5KFGA 2FQQB 4J9RA 1NK8A 1QAIA 1AZSB 2OJ3A 1OYDA 3MEDB 3V4IA 3RR8A 1LW2A 2JLFA 5J1EB 3BM7A 4QIFA 1PKUA 2HWIA 2MQLA 3K0JA 2W9AA 4IFVA 3DRYA 1G4CA 4PG8A 2D3O1 5GMKa 2VPWB 4YR3A 4ZPDA 1DY3A 3GG1A 4X65F 4KIAA 2JSXA 4V19X 3NRBA 2ZH7A 5ETLA 4QWCA 1SJ3P 2NLWA 3P4UB 4OJGA 3W9HA 2VF3A 4OX7A 4DV6J 3FMWA 4CI0B 3PW2A 2F8MA 1NMEB 3I5CA 3V6DA 4U7UD 4JI8J 2RQCA 3N6MA 2CYYA 3K8VA 4JI1J 2YNFB 2YKQA 2C2KB 1EP4B 1FJGJ 3OPKA 3QWPA 4DR4F 2EK6A 4IR9A 3PO4A 4RNNA 4DG1A 2HRTA 2HFVA 3G71S 1JLGA 1CQMA 4K0KF 3R6LB 4JV5J 5AE3A 2KJWA 3GIMA 3CCES 1NKCA 3CT9A 2IFXA 4UOGA 2LQ5A 1NUEA 3MTJA 5B0EA 3PYFA 4RR5A 2CA9A 2DHGA 2NPFA 1YJ9S 2NXUA 2OMLA 2F9JA 2EFQA 4EBEA 2H48B 1LFPA 4X66F 3NWGA 4N5SA 2E1CA 3TQEA 3C66A 1YX2A 3AD7C 1DTQA 3MDFA 2FJDB 4U9RA 3CWJA 3ETOA 5KFXA 2OHDA 4CNYA 4XDCA 5DQGA 3W2WB 2XS7A 2KU7A 2EXUA 3UPFA 4EBCA 2AD9A 1U1KA 3O3LA 5KFRA 3I4PA 1FESA 3HXMA 2PT0A 5AXLA 4K50A 4IRDA 1Z2ZA 3KJQB 1TK5A 1WDDA 3KHHA 1I6JA 3FFIB 3A13A 3RW6A 5AE1A 2F63A 2BR0A 2ZOMA 5J2PA 6AT1B 4IOCQ 4O4RA 4JV1A 4ZLLA 2C2OB 4ED8A 1OSCA 4PG5A 1W25A 1LW0B 4NRTA 4A8WA 1VI7A 1LWEA 1IWAA 2DNNA 1S1VB 2Q43A 4MT1A 1IR1A 1KQSR 1BHNA 2H4YB 2IRXA 2OPQB 1HBUA 3TAPA 4CRJA 4ZPTR 3AHPA 5L9NA 1RT2B 1O8BA 1T94A 2ZFHA 5M2PA 1RAEB 2X1BA 2HGLA 5DG9A 3NGSA 1D8YA 2AGPA 2EPIA 1IBLF 2XC9A 3M8QA 4W92B 2ZBPA 3G86A 3V81A 1IXKA 2ADBA 1G1XA 2XLKA 3HFKA 1YBAA 4AE5A 4RBTA 2VHGA 1C0TB 3HHNB 4GKJJ 4DV2J 4I1TA 3OQ2A 1K44A 2F8HA 3OFEA 4NLPA 4LF6F 1XIQA 2V4QA 5KG6A 3R1LA 4DR7J 2KM8C 3FGVA 2PD1A 5LXRA 2FTRA 2IBKA 2HHUA 4C11A 1Q53A 3A8IA 2YKNA 3DMJA 4UF4A 3TWZA 4NXNJ 3VAIA 4O3QA 2BJ9A 1RT7B 4JI0J 4L75A 1R6VA 3KLGB 1AT1B 5K5MA 4PCQA 1I3OB 1HLWA 2QLFB 3QT6A 5KG1A 3Q8VA 3R97A 4USHA 1SKSA 2YWHA 2KYZA 1UW4A 4RU2A 1UVKA 4GC7A 5A8WB 2H54B 4CLTA 4C8YA 4ZMMA 5LMUJ 3RBZA 5E3CA 1UVJA 4UQTA 2GQ2A 4NL5A 3PYDA 4HI1A 1QUVA 3W62A 3T9ZA 3THTA 3DLKA 3MECA 3FEXB 1CLFA 1HHSA 5IZHA 2HS3A 5L1KA 4AQYF 2HHSA 1DZ5A 3VQSA 3AQOA 1DJ0A 2HIQA 3Q89A 4WJBA 2XMWA 4DQIA 1U8WA 4CLZA 2AU0A 4ZPVR 2ROPA 5LJ3Y 1R8PA 3MAAA 3NMAA 2MQPA 4ZP6A 2W24A 2O66A 4D3GA 4MIWA 1FDBA 1PILA 1D09B 1FXRA 4C0HA 3W8GA 5HL7Q 1CJTB 4FDFA 2D69A 1NPRA 3KLEA 3HHLD 4KGXB 5HSPA 3H2UB 1RT3B 4CH1A 1H2TZ 3JXOA 2ZH4A 1IKWA 1NAQA 3I82A 2N4CA 2EBEA 2Q1LA 3PX6A 2C3UA 1XMBA 2MQOA 1VJQA 3ENVA 2W1BA 3JSYA 1C4CA 3CIZA 2V0NA 5E33A 5J1PA 3IA0A 2XZWA 2FHKA 3SMZA 1ZOTA 4ZPWR 3C6UB 2VUGA 4X64F 4RW9A 2QE5A 5KFVA 4OHYA 3FSIA 4DX8H 1I94F 2DITA 3DU6A 3CJKB 1HNWF 4X4UA 4RKUC 2E9RX 3UDLA 4ED5A 4CO4A 3JQJA 1IKVA 1HNZF 4LIRA 3OTOF 1Q5YA 2HHHF 1OIAA 3FBCA 5BXIA 1TL7B 2O01C 2L9WA 1MROA 1F60B 2VDIA 2RF2A 2UXBJ 2I9SA 3J7ZT 3M2RA 2PI4A 2ASJA 2HQFA 1XMQJ 4ZP8A 2RRAA 2RU3A 2ZNZA 3R5GA 2EG2A 1U8SA 4ECTA 1TQLA 2UXCJ 1UVNA 1MWQA 4YMEA 2QMXA 5HVGA 3FMBA 1FRLA 1N36J 3E51A 5LJ5Y 2R7QA 3RBEA 4RW8B 4B9NA 5AXNA 4OJ3A 3OBIA 1XEZA 1IN0A 4OYOA 1PO6A 5KFDA 1TKTB 4PG7A 4A4JA 2IA0A 5DETA 2XSFA 3U7JA 2MKSA 1SC3B 2AKWB 1NDCA 4NLQA 3OT9A 2Y1JA 2YNIB 3F44A 1HQUA 4MKAA 2AMCB 3TAQA 3NGTA 4QYZJ 2AW0A 2BE9B 1RWMB 4C3MA 3CJTA 1WUUA 2DGUA 1GEHA 1M90T 3T1AA 3MUVP 2J7WA 3PJXA 3Q2TC 1QVFR 4KE5A 3CJ3A 1CS4A 3MF5A 2BW7A 4O3NA 4TNOA 3CULA 1N56A 3UO0A 2DIVA 1R8CA 2X1AA 1D9AA 1LEOA 4DI6A 1QM9A 3OL7A 4R5PB 2RIJA 3HT0A 3KLIB 4KY3A 2XNRA 3U1LA 2V2QA 4FBUA 2I5JB 4RL1A 4F4KA 3GJQB 1Y3KA 1PYSB 5HBMA 5C2CA 5HI7A 1FNXH 4U67Q 3CTRA 1U1NA 3JYTB 3I56S 1U1OA 4NZ7A 4PKDB 2VICA 1WTBA 1UEUA 2KT5A 4KHMA 2B5JA 4L73A 4ZHRA 3HK2A 1J5OA 4P2FA 1U0HB 5A8RB 3T6BA 4G6VB 2UUTA 5GAEI 4ECUA 3JSRA 3DOLB 1KKHA 1QTMA 3M9NB 4CO0A 3O8WA 1NHKL 5CYQA 1FVQA 1DTTA 5HROA 4GVBA 1GAOA 2VIHA 1JLCB 4USWA 1Y11A 2KT3A 2XSJA 4BCAA 3R2CJ 1LXJA 1WC4A 2NXJA 1E6VB 3K59A 3Q8SB 2ATLA 4UT4A 4I6YA 3OUYA 1RT4A 2IRUA 4O44B 4AXJA 4I2QB 3ZZOA 2U1AA 1SCJB 1WI6A 4DSLA 4X65J 1HQEB 4TXSA 3MGJA 3HVTA 3QSIA 3WBZA 3QMQA 3J7YU 1S49A 1H2UX 5GADI 5KAKA 2AZ1A 2C1EB 4ED2A 4EZ9A 4EMDA 3IAM9 4UY8T 2QN6B 1H2VZ 2QL9B 4ZCLA 1KHWA 2GIQA 3KG1A 4Y6IA 2E1MC 3JAMU 2VG5A 4F3OA 1U7LA 2JH3A 3M8SA 2KKHA 2GMHA 1YRTA 4RW6B 3RBDA 4MFBB 4L74A 1TMJA 2LXIA 3SSSA 2M8HA 2DTJA 4HH1A 4K0KJ 3FCVA 4YOEA 2KZMA 2HFUA 3BJYA 3TARA 4ZDNA 2V63A 5T7LA 2H3EB 4IYQA 4YP3A 5C5JA 5T41A 1X5OA 4F50A 4LF5F 2RDDA 2BKOA 4OV6A 4OYZA 4A8SA 2OFGX 1YLXA 5KT3A 3EDQB 2XEXA 2Z57B 1JWWA 2EG1A 5D0RA 4MIAA 2PFDA 3KJNB 4F36A 1O51A 2IY5B 4NLDA 3CXCR 5LXYA 3BKUA 1VOMA 1FCAA 2DHAA 4J9MA 4NXMJ 4MIBA 2JL9A 1KQFB 1FJEB 2CWKA 2EFVA 4KRWA 4DR5F 2CADA 2CG4A 2Z30B 3L4BC 3LP1A 1TMMA 3LPEA 2XGQA 1K47A 2E5JA 2DRBA 4OYWA 5CXTA 4YR0A 1PYTA 3T1HF 4ZVEA 2AJ4A 1REVA 4O0IA 5KFNA 5IQ6A 3QWUA 4B3TF 1RWVB 3I6PA 4C8ZA 1AROP 3C16B 1HPZA 3T5JA 3IS9B 4LF8J 4OZ3A 1H72C 1HBMA 1QAXA 2L41A 3A4TA 4I68A 1IJFB 2VPZB 2HFZA 2YPZA 3S7RA 1SKWA 2HBZB 2WVBA 4P9SA 1KLMB 1KRPA 5U47A 2W25A 3KTQA 3CUNA 2VOPA 3CD0A 1TKDA 1Q8IA 1ZPVA 3TR5A 2V6AA 4X4SA 2H5IB 1EQMA 3G82A 3KNGA 1EQ0A 4KBIA 1WOPA 4B3OA 2HVDA 5GAHI 3CJSA 3GJTB 5EUHA 1GT8A 4BHQA 4RW7A 3E01B 2XS2A 3TVKA 4C97A 2WCXA 4DUYF 1B0PA 3D28A 2Y0SD 3K5MA 5I4MA 2ZBIA 1SJRA 5F0WA 1D3WA 2MYFA 2MDAA 4LSNA 3UR3C 3A3NB 3IR7B 1Q86T 3N9UC 5GMDA 1SV5A 3QFWA 4O3OA 1GXTA 3W64A 2OPPA 4OMFG 4LF6J 3RBXA 3CCSS 2ACYA 3P8BB 2ZC3A 4LF9F 6FDRA 1R7IA 1RBOB 1Y5NB 3I55S 3G8TA 3TAMA 2JNJA 4IFYA 3V6DB 3O44A 4DR1J 3W61A 3I96A 1JLEA 2G2OA 3BZQA 3PW0A 2E44A 2R8IA 2YX1A 5AE2A 2DCUB 3BDPA 1U6ZA 2HQ3A 2P2CB 4USTA 2YWKA 3V6JA 1T0TV 1JLGB 3UQSA 3MPUB 1RP5A 1S4EA 2GVZA 3U1MA 3DRPA 1Y10A 4CO2A 2FDNA 2POKA 1RBAA 2B8QA 2J0XA 3VAMA 2WK4A 3GIIA 1NPPA 4FS2A 4PXEA 4F02A 3W8PA 4DV3F 4DEZA 1DTQB 3SQGA 2KG0A 2DNKA 3RAMA 3B82A 4C8OA 4F67A 1AB8A 2WSEC 1ZM4A 7FD1A 3QIPA 3KFWX 1VQ5S 1NJWA 4A8XA 1S0OA 2MLXA 2CDQA 3DXBA 1L3UA 4GKKJ 4EBDA 2NUUG 3EYZA 3PG9A 3I0SA 3RJMB 4IH5A 1TK0A 4ZPBA 3D0GE 5KFTA 3C14A 1OPZA 3EPGA 1LWEB 4ECVA 1FXLA 2ILZA 3EGWB 5FLXY 1KHVA 1S9GA 3EX7B 2CQ3A 2HFOA 3DU5A 1JLQB 1FJ7A 3K2YA 5JUMA 4BWJA 1HBUB 1NKEA 1VQKS 1HWUA 2X3GA 4C9DA 3MR5A 1FRHA 2DYAA 1FFSB 5BYQA 2CJBA 4DR6J 3RB6A 3DGPA 2N82B 3T6JA 3ZZ0A 3VGSA 1HNWJ 4J9PA 4WYLA 3D1HA 5A2QU 4ETXA 1UZDA 1RCXB 1AXQA 3TP2A 3UNYA 3OTOJ 2HHHJ 2HHXA 4RPFA 5C24B 4I6AA 2YX7A 1S9EB 4EO8A 2ACMA 4DQPA 5HQ8A 2V8HA 4PQUB 3A3PB 3LA0A 2CQ1A 4D3HA 1TU0B 1VQ6S 4RZRA 3A1YG 2WHOA 2J6SA 1CJUA 1RCOB 1Z2LA 2C3OA 4TLRA 3PKMA 3NOGA 2JVRA 3ICLA 5K8PA 4G3IA 1Y0HA 3ITHB 2VDHA 2Z2YB 2HS0A 1RHQB 3TVZA 3M30A 5KG4A 3PY8A 2OTLS 1P6TA 4P74A 4LF4F 3DLJA 2E1AA 2DY9A 3PJWA 3W1YC 5D4LA 1NKBA 3F41A 1ROFA 3DC2A 4TQSA 3ZNJ1 1HD1A 1UETA 3MM5B 1T9YA 2R2SA 5D4OA 4LF7J 4G65A 2IHR1 2RAQA 1TUWA 2ABYA 4H4KC 1Y9OA 1VQOS 3FVYA 1NM2A 1FERA 3NGKA 2HQDA 3THPA 1E6YA 4TKTA 5JXSA 1JLFB 3MOZA 4DL4A 2FD2A 2HNYA 2W2NP 3PR4A 1NDPA 2VL1A 2ZHOA 3MFHA 2OPRB 5L38A 2B6AA 4NYZA 4QPXA 4FN5A 2H5JB 1HNXF 2R2RA 1ZS6A 3R27A 3MAAB 1S1TA 5HQLA 1XNRJ 2EEYA 4L3NA 1WEZA 5AT1B 2UUAF 5HMZA 4LSLA 2EWHA 2K1RB 3C3LA 2YQ0A 2QLXA 3CVKA 1RKJA 3NL0A 1T9XA 1VRTB 1IKXA 1FNOA 1SQGA 2QX0A 3JQKA 1N0VC 1WWHA 2YKOA 4X4PA 1X7VA 3CJ4A 2CFXA 5KOXA 2DRDA 3P45B 5F9LA 1RAIB 4K4ZA 5KFIA 3HSGA 3T3FA 5BYRA 1S1XB 3SDEB 4OI4A 1T8EA 5JMNA 1X5PA 1ZAXA 1RXOB 5FJ4A 3HI9A 2WBRA 4GVLA 4WFAQ 3Q23A 2FJBB 4DSKA 3BO3A 2W7OA 1XJWB 3AA8A 3KK3A 1JLBA 3BBBA 1SL2A 5JVGQ 1RSCA 3WDOA 4H4MA 4ZJLA 3NEKA 3S01A 3AD9C 1HW8A 2RF2B 5ETPA 1R27B 3M2RB 1T05A 5JVHQ 4ATNA 1A9NB 3NWRA 5J2QA 3EZUA 2KI2A 4IH7A 1U1LA 3PYGA 4ZVFA 1EB0A 1FJCA 4C4WA 3T19A 3QFHA 4ZVTB 3Q8PB 1NSPA 1IKYB 2DNOA 2LEAA 2BYCA 4OI2A 5K8MA 4DU7A 3JTNA 1AFJA 3D1OA 2AQ4A 4PEOA 2XI2A 4ZCKA 4K5RA 4J9NA 2MKCA 1WTFA 2UV8G 1WOOA 1J5EJ 4Y28C 4M5DB 2VJUA 3GV8B 3HDSA 1R0CB 1N5YA 5LSOA 2XM3A 4P73A 3FZ2A 2QT7A 3PO5A 4F04B 3OW2R 1EX8A 2GVDB 3Q86A 4A8FA 2BJDA 2HNDA 1R8BA 4I67A 1H7XA 1ZZNA 3LGMA 2OTJS 2DGWA 1VK3A 2RH3A 2K7KA 4LFAJ 2J0QD 4X4RA 3VWSA 5DG8A 4C0OC 4CLYA 1SXLA 2YKMB 2F4VJ 2CPFA 4WKRA 4PPZA 2J6UA 4CO1A 1N88A 3KDOA 3TRGA 1M1GA 1JJCB 2NPIA 1P9QC 5DZ6A 3HP6A 3TZWA 1N5VA 4LBPA 2LU2A 1VQMS 2RMLA 4FZVA 2GFFA 2GQCA 2HGMA 3VGTA 3H20A 4FPIA 1QTNB 3HULA 1ZA2B 2DGTA 2MZSA 2CWXA 2F40A 3DLLQ 1J2VA 2B5JB 1L5UA 1BQMB 2OAUA 4B3TJ 2R42A 4B3RF 4BBYA 3BREA 1GX6A 5CCMA 3NBPB 4WZMA 4P10A 2KO1A 1YQHA 2AYGA 2CVIA 1U6FA 2WRMA 3BO4A 1R0AB 1FX2A 3E3XA 3JAMY 3R8YA 1Q8KA 4PXBA 2E7VA 4GVBB 5CABA 1Q7LB 2I2YA 2MJNA 2ZJRQ 1ZA1B 3DDKA 3FRYA 3C46A 1S1UB 3VAJA 3SYZA 5A6WA 1M5KC 2OP5A 4LFBJ 1S5ZA 2VD3A 3OR1A 2ZUGA 1T03B 1T02A 5IT0A 2YQ3A 3CC7S 5IXUA 2QZ8A 4URQU 2XMAA 1S10A 4MK9A 2W9BB 4DR3F 1FVSA 1S76D 2A6MA 2XMKA 1KOHA 3HVTB 5KT2A 2ERRA 4CQ1A 8ATCB 3V6KA 2H65B 1H0HB 3OSNA 4N76A 1RLCL 2OO4A 4RO0A 2WONA 3HD1A 2DHHA 3KLHB 1R3NA 2L48A 3D3BJ 3FCHA 3K5OA 3CPWR 3W2VB 4DS4A 2IMOA 3K89A 4PXDA 4ICLA 4LF9J 4F3MA 5CYMB 4WE1B 5DLGA 3KK1A 3BF4A 2YH1A 1S6PA 2RS2A 2FPHX 4USVA 3S8SA 4ES3A 1YTYA 1V3ZA 3S6EA 4LRBA 3I9ZA 5ETQA 1U1PA 2LDIA 2BJ1A 2QFJA 3M7VA 4CLKA 2CKWA 3AA9A 1SQEA 1W7WA 3M8WA 3QATA 5EWEA 2CXEA 3IFEA 4JI5F 2DNLA 4GO5X 5T7LB 5I3PA 2XCPA 5ETMA 1JIHA 3MEDA 5FDLB 2N4DA 2R7OA 1ZPWX 1BWEA 3I31A 3GV7B 2Z2LA 1CC7A 4OZ0A 3W66A 2ZUAA 1M0SA 2AJFE 1CPZA 4F3QA 3R7NB 4CM2A 2CVEA 1Q5VA 2G13A 2ADCA 1S6QA 2Z2MA 1REGX 4K4YA 4KR0B 4JBCA 3H25A 1WG5A 3HSJA 4ZPCA 3AB2B 5E3AA 4RUBA 2HFSA 2XY6A 1LK5A 2M3DA 4C98A 3NAIA 1FE4A 2FY8A 3HHLB 3US5A 3CMQA 1NH8A 1H6KX 1VS3A 3M6XA 4CLPA 2KFZA 3W65A 1MU2A 4WIQA 3RB4A 5DDPC 4ZOSA 2PO4A 3GSIA 5CCLA 2UUWA 4RUHA 1MG7A 1TKZB 1M5HA 3EXYA 2YNFA 3RRKA 2HBYB 3BGFA 3DDNA 2QRRA 1IBCB 2AGOA 4OI3A 2IMWP 4RU9A 2HZCA 3J80U 1F5CA 2FHJA 4LREA 4DQQA 3NMRA 4XK8C 3KHRA 1LV5A 5DDRC 2W01A 2CQHA 2QA1A 2XS5A 4DZ6A 1ICEB 1F6TA 7FDRA 2LYVA 2OKQA 3D6HB 4PYAA 2VQEF 4RW7B 3VALA 4QJVA 3CCUS 3CJ0A 3ENQA 3IRWP 3PCOB 2DPJA 4DL0C 1RISA 1SL1A 4DUZF 5MAOA 1P8GA 5LT5A 4LSNB 2ZZNA 1ZTWA 2KYXA 1SV5B 3ZZYA 4IQXA 1YGYA 3OSPA 5HLFB 3W2WA 2XMTA 1QY7A 2BE2A 2FJAB 3NNAA 2OGUA 1KLNA 3GTYX 2AF6A 1RT6B 3FDSA 1NZAA 1GTEA 3TAMB 2U2FA 2IM0A 4NI2A 3X1LB 4UUWA 4DR2F 4OYBA 3FFIA 1NZ8A 2IM1A 5IQQA 4LF4J 2W9CA 3PZPA 3SCLE 3K58A 5RUBA 1DQ8A 4LR8A 3GWCA 2CPJA 1LW0A 2N3LA 2XTJP 5KFWA 4F8RA 3ELHA 2FLPA 1S1VA 2IJRA 4Y00A 3LWLA 3M8ZA 1HNIA 1WD6A 2VFRA 2RHQB 2DEIA 4F26A 4OLOA 2N7CA 2OPQA 3M2VA 2DXFA 3IRXB 4ILRA 3DLHA 4DV7J 1WORA 1RT2A 4TYBA 3RU0A 2QSWA 2KL8A 3DXSX 2R7RA 4LBHA 3ILIA 3BS9A 1SQFA 4NLRA 3KDNA 2WW4A 1HR0J 4I6WA 2GHVC 1VQ7S 1OY9A 1KNZA 1W26A 5A2QY 2AT1B 2HG4A 3R6GB 3VV2B 3PFEA 2JLEA 3QRRA 2FYXA 2MKHA 2MSSA 4RW4B 5IV4A 1HBOB 1IBMF 1C0TA 2HQIA 3GP9A 2VFVA 1H98A 4ALZA 3W5ZA 2UUAJ 3MEGA 4NLGA 2ZHAA 1YJ7A 1D9FA 4CO5A 5K9FA 3UD4P 3CNQP 1T9UA 4MYUA 1TL1A 4B02A 1LWFB 8RUCA 3IP0A 1S1WB 2QYCA 1KN6A 1R0BG 1PCAA 4OFZA 4B9SA 4QR1A 2APOA 4S0MA 1RT7A 2GCFA 2KB2A 1F9EB 3CDBA 1FE0A 1UA1A 3KLGA 3EDRB 2J8AA 2HQCA 1X60A 1RU2A 2VBYA 3R7SB 1U2FA 2XMVA 5F8JA 4OL8A 2BKNA 4OIXA 5F0UA 2KZZA 3VAHA 3DRSB 1U26A 5KFHA 3IO1A 4TY8B 5A8WA 3DGPB 3ZZZA 2ZZMA 1CJVB 2HQGA 2JEGA 5B0GA 2Z58B 4WK1A 2ZBQA 2LKZA 2UXDF 1U09A 2QTWA 3BKTA 3H5XA 4C48A 3GMGA 5ITHA 2E7XA 1F9HA 2VASA 4ZS6A 3EICA 3KG0A 5F8IA 3EZOA 3EPIA 3BGLA 3AB4B 1PAEX 3TX8A 5LM7E 2C3MA 4ZKAA 5H1SV 1U0SA 3JSMB 3FRZA 1YRUA 3ENWA 2ZM6F 1FWKA 3HF5A 1FD8A 4YHHF 2B7BB 1NSAA 3D6TB 2FJWA 4DL6A 1QSSA 1C1BA 3MTKA 2J0WA 2V8DA 3MD3A 1CJTA 1N34F 2IDEA 2FHMA 2KH9A 2ZHBA 3OLBA 1WKKA 2HAIA 1NDKA 3PVXA 1CEZA 1C4AA 1ZTTA 2CJ9A 1VQLS 4WYWA 4QYZK 2P5VA 4C3LA 3SSQA 4HHJA 4OZLA 4RBVA 5I3UB 1U1QA 2OPSA 1V3SA 1S0NA 4MKYA 4NX9A 2DD8S 1O0PA 1WG4A 4UOCA 4ZLPA 4K59A 3ZTRA 2FJVA 4ES2A 4OI0A 2MB0B 2KVQE 3D6MB 3OFHA 2JDJA 4C7QA 4AL5A 3CJKA 3L9ZA 2VBZA 4JI3J 3EM1A 1YVFA 4KHPF 3OXFA 5DGAA 1LXNA 5KG3A 3QO9B 5C42B 2KG1A 5DLFA 2H1YA 2A0FB 1TL7A 3LTOA 4QBUA 4B3MF 2UZAA 4M5KA 3ZFVA 4KHRA 1LQ9A 4EO6A 2PA3A 4B17A 1SJQA 1UFKA 2W2MP 4DPWA 4ECWA 2ZC4A 4B9MA 2FC9A 4O23A 3MEKA 3AXMA 4USUA 3OTBA 2DJWA 1TFYA 4LRFA 1HFEL 4FF1A 2FZKB 1NB2A 1NK9A 5EHHA 3FQKA 2RQ4A 4B3RJ 4P7VA 3IWXA 4DU8A 3GG0A 3A3OB 1FEEA 2C42A 1TKTA 4OI6A 3NGRA 2BM1A 3TJ8A 4PWDB 2KRRA 3DFEA 1Q95G 5C25B 2FIUA 1DFDA 2MJUA 1QVGR 1VIOA 2IVFB 1OQ3A 1RUSA 4YB7A 2BW2A 3TUJC 3C19A 1HNVB 1K8AT 4Y0FA 4DFPA 1JLBB 3NGUA 2PA8D 1EKRA 1KFDA 6FD1A 2CQ2A 1GMVA 4RNFA 1NJXA 1EETB 2DIUA 5IFMA 2Z4PA 4X62F 4DR3J 3J7A1 4DV1F 4WWSA 1NDLA 4IRKA 4JI6F 4H4OB 1FTCA 2P9CA 2RKIB 4QIVA 4NLWA 3ENAA 5B09A 1M5PC 2UVRA 2DNHA 3FEYB 3KLIA 1U49A 2RU9A 1NCLA 2PIIA 1B0VA 1CSJA 4HT7A 1ZZFA 3QGHA 5H9EK 3DM2A 2XCAA 2I5JA 2HVZA 1YKWA 1CBKA 4NCGB 2LLZA 3RTVA 3SCKE 2LXUA 3CSKA 4PR6A 2R2TA 2E9TA 3M6VA 3DLBA 3JYTA 4ER8A 1S4FA 3IBWA 2IYGA 3BQ2A 4ZA1A 5LL6d 1U0HA 1FF2A 1B0TA 3R5DA 5A8RA 4FNIA 3MEEB 2XBPA 4J9KA 2MMYA 2OI2A 1A6LA 1X5TA 3QGPA 3DOLA 3EVWA 3KLVA 4A48A 1ZAVA 1KP6A 2FHJD 5D15A 3NS7B 1LNQA 1VIXA 5D0GA 1N32J 1VDHA 1N48A 1KONA 3OJUA 4X4TA 2OEKA 1JLCA 1TZ0A 3T41A 2BRLA 5J2NB 3BKFA 1HL6A 4NCAA 4QWBA 5AXMA 1A7GE 1YIJS 2IA6A 4DWIA 1E6VA 4OX8A 4N8NA 3LF0A 1V5IB 3M6WA 4Q44A 2Z8QA 2OELA 4I2QA 4K4WA 3QPIA 3LGHA 3R5BA 2NXCA 1VJWA 1MSWD 3K7RA 1YWXA 1HQEA 1HBNB 3Q8UA 2OFHX 1YJRA 4QIEA 1T11A 1NO8A 1OYEA 2C2NA 1FI4A 1WJ9A 3MZIA 3FBBA 1GXUA 1UPPA 2MZ1A 1FXDA 1XR5A 3TQ1A 3GIRA 2LECA 4PWWA 4C8LA 3AJ1A 1VYAA 4QOTA 2GZOA 3IM8A 3DDIA 4QPTA 3LGNA 4W90B 3LO3A 2QC3A 1RWNB 3U02A 4RW6A 2VBXA 4O3SA 1FX4A 4MFBA 3EGZA 5IT4A 1RE1B 3PM9A 3G4SS 3L09A 4NLSA 2KFYA 2R4FA 1XMOF 3AQPA 5K14B 1T3NA 1TFWA 4TVAB 3Q2SC 3WC0A 4X4NA 2J0SD 5FD1A 1MWZA 3CF5Q 2W8KA 1MN9A 2LA6A 3FCWA 2YNGB 1AUDA 2J7KA 2ATCB 2KHCA 4DLGA 1KVIA 3GV5B 1IJEB 4ANDA 3FSXA 3PEHA 2CIMA 3ONQA 3UDCA 5L1LA 4KSEB 5AXKA 3H4BA 5DQIA 1OS5A 4OYMA 2G4BA 3OHBA 1VQ9S 1T9VA 5LSLA 4K5SA 4DR2J 4LVOP 3BYPA 2LXFA 1XNQF 2V34A 2AEFA 2IC3B 1UP1A 4FYXB 1HW9A 1TK8A 3BH6B 3FBEA 3ISND 3IS9A 3HCXA 4BS2A 1FRXA 5HANA 4FS1A 4OHVA 2Y3YA 1HWIA 4UZBA 3C6TB 2M52A 4DV0F 3TEHB 1KLMA 1IM4A 5D0HA 4ZVPB 4ED4A 3EUNA 1HI0P 3SBMA 5EWFA 3J80Y 1Z1ZA 3MPDA 4ZPAA 2V4JB 4J9VA 1S6QB 1H73A 1FEHA 1F2HA 3UCUP 1DLOB 3E01A 2VA2A 3L7UA 5KFCA 4WFXA 1C1CA 4J9SA 3GONA 3BGUA 1UWBB 7AT1B 1KVJA 1VC0A 1N4LA 2E9ZA 3J81j 2A3JA 5B0BA 5DQHA 3CJQA 3TI0A 3PKYA 1APSA 2XY5A 3DI6B 5C2GA 2DHSA 3BQ1A 1MU2B 4NOHA 5E0OA 3J7Z5 2JC1A 2UUBJ 1S99A 5AJ3F 3SI8A 5J1NA 3CJ8A 2R8JA 4FVMA 3UVJB 2MHNA 5IWAF 3V6HA 3DHXA 1JX4A 2CAJA 3UN5A 4DCJB 1JXLA 2OIHA 4IUFA 2ASYA 3MCSA 3HO1A 4JUZA 2UVUA 5A0YA 3DLGB 2IM2A 3MMBA 1X8DA 3P3DA 2E1PA 2FJXA 2QL7B 4ZP9A 2ZJPQ 4JI2F 2B3TB 5F41A 1IBKF 4MK8A 5LSRA 4A8MP 3D67A 2UU9J 4YEAA 4J5OA 4UZCA 4CH7A 5KFSA 4LQ3A 2CJXB 2FLOA 4LFCJ 1Q8LA 1B99A 4O4GB 3I32A 2BM0A 2ZITA 1J27A 4DHVA 5EWGA 3QZ7A 4K4TA 2GNKA 2BE2B 2R7UA 4H54A 4ECYA 1WSVA 2R7WA 2E5LF 3CIMA 2ZM6J 3MCNA 3B4DA 1P1LA 4YHHJ 2WOMB 4NI2B 4OJ1A 1WKJA 5KFUA 1KC8T 3V2UC 1TL3A 2LP4A 2IAJB 2CJQA 2W9CB 2KHDA 4O0NA 3HHEA 5B08A 1FWLA 5HP1B 2W4PA 2R8HA 3BPSP 3Q0AA 2ASLA 3MMAB 2YX4A 4G1PA 1ZM3A 1RT1A 3UCZP 3BSAA 1T9WA 4ANEA 1UL3A 4RNOA 3EZ5A 2H9ZA 1JQGA 2DR9A 1HNIB 2QO3A 4J9OA 1X4GA 3QLHB 4AXIA 1JLQA 1RA6A 5KFZA 2E66A 3M2VB 2GMLA 1RYRA 3IBFB 2Y0BB 4IH6A 2QV6A 3ADAC 4TU9A 2ZBCA 2VFSA 3DRRA 4Q2MA 5HMXA 5M2UA 4KAIA 4BLGA 1PJ6A 2AYBA 4KH1B 4Z2XA 1PBAA 1KOOA 1RTHA 4KHPJ 1ZH5A 1TL5A 4DL7A 2EFOA 5C24A 3MXHP 1S9EA 3AOAA 3MR7A 5GAGU 1NHVA 3CDAA 4PQUA 1S48A 5LMNF 1NRKA 2B8PA 2IYIA 2R7TA 4YY3J 2JFKA 3MEGB 4IDKA 4HT5A 4FF4A 3POTA 2CNNB 1TL1B 2SXLA 4DLEA 2WTFA 5FIIA 2IRYA 3ITHA 2WAQD 1JXVA 3Q8QB 4ECRA 4RNHA 4B3SF 1Q0NA 4C8MA 4IG0B 4P2MA 3NKYA 3Q83A 4UY85 4IO9Q 4OX9F 2RDIA 2BANB 2HSEB 5LOQA 3MM5A 4B9UA 2E7WA 4KKOB 3K57A 2D3ZA 3GE9A 2PEHA 2CQIA 2I1RA 1NK0A 3D7SB 3FEZA 3DRXA 5KFQA 2BX6A 2ZH9A 5BR8J 1WF0A 1TAQA 4HDHA 4WU3A 2YH0A 1KTQA 2ZOGA 2HNZA 1JJ4A 4CYUB 4U8YA 2DNQA 4CLUA 5IM0B 4P7TA 1GFWB 2ZWPA 4Y2IA 2M7SA 1JLFA 2MZTA 4Y2MA 3N5FA 1ITPA 3GIKA 1KTVA 2OPRA 2XMUA 1MLAA 3CO0P 3QQCD 2XO6A 1MW7A 2COLA 2OEMA 4DL5A 3MD1A 3M05A 3VAGA 3GFHA 1FA0A 2RB7A 1C1BB 2BE7D 2PDAA 1VLYA 2ZD1A 1ELOA 3KHGA 4DV5J 2ZKTA 3OD2A 5A76A 1WC0A 2NQPA 2RRNA 2K1RA 4DV6F 2F7VA 2QLJB 3SSRA 3UD3P 3QJLA 4YS2A 1VRTA 4JI8F 2DT9A 4CLFA 4CLWA 3R3TA 1LWCB 2C3YA 1FK9A 4IOBA 1T95A 3ET6B 2HVHA 3E2EA 3H0PA 4ZITA 2OPSB 3Q22A 1S1XA 3SDEA 1L3KA 4JV5F 1RTJA 2NCKL 4IR1A 1XR6A 2D3OR 3W60A 2MGZB 1SC6A 1FKOA 4NLVA 4NLUA 1XWLA 2M2BA 3MM6B 2HLTA 1U45A 4WF9Q 2DKOB 4LR9A 2F9DA 1SVDA 2CPZA 2JVOA 5IV3A 5EX0A 2B51A 4KC5A 5ETNA 4HYKA 2IJNA 1TAUA 3OJSA 3N5BA 3CW2C 1IKYA 4ZP7A 1XK8A 5B0FA 3VGUA 4JI7J 2RD5C 1YITS 4C2MA 4HEA9 1PJ5A 1QE1B 4RLEA 5JJBA 3AFGA 2JLGA 3WHIA 2M70A 2WVEA 1RADB 3GJRB 4ZVOB 3LUYA 3UFCX 3HFZB 3TA0A 1D1UA 2CZ9A 2LQ8A 4TYAA 1WKLA 3MI7X 3J7YI 4Q0BB 3UDVA 5DDOC 2BUNA 3I5BA 2D9OA 4M5DA 1DURA 4PWUA 4K4VA 2G1HA 4P2SA 2CQ0A 3QAUA 1X4BA 1XMOJ 3KXDA 2ILYA 1GK8A 1RB0A 4RUAA 3MMJA 1N33F 4PYDA 4FBTA 2GVDA 4MYTA 2W7AA 2HHTA 2KM8B 2AIRB 1SPBP 1BQXA 4KFBB 2Q3PA 2E5HA 4DQRA 3FBFA 3NCPA 2QA4G 4E98A 2HWHA 1WG1A 5MLCV 2XYPB 2YKMA 3BR8A 3CGIA 4DL2A 4ZVGA 1RT5B 2IIHA 1UVMA 4GKJF 3DM2B 1JLAB 2UP1A 3CDEA 2VJVA 1PGZA 4NLXA 1B64A 1VBYA 2CQ4A 2BJEA 4NMXA 5IC6B 1XNQJ 1BQMA 3FQLA 4Q45A 4NEYA 4NXNF 4IG3B 4DFKA 4ILMA 2AJQA 1N6QB 3NBPA 3FNNA 4K2XA 1WC5A 1RHRB 2J76E 1R0AA 1N52B 2GX8A 2XULA 3I5AA 5THWA 2YNHB 2FLLA 4FYVB 3H42A 2HW3A 3I0RB 2MTLA 3VGVA 4K4UA 3NXZA 4Z7CA 3FKBA 1BD6A 4IQMA 3CC2S 2Q79A 1VBXA 3GYGA 5LMUF 1S1UA 2MLYA 4Z37A 1RWPB 4ZN3A 2ZNYA 2DBBA 1S7HA 2BDPA 3T9NA 5KG0A 1T03A 3QRPA 1QD1A 2DR8A 3Q8YA 2XGPA 3PX4A 2UUCF 3UW1A 4J9LA 1YBTA 2W9BA 2VKRA 2MKYA 2HWTA 2CQBA 3OTDA 3H8YA 5D4PA 3Q8RB 5K8OA 4R8UB 2JEFA 3KLHA 2FY1A 4ES1A 3W2VA 4CNZA 3C15B 1H38A 5CYMA 4ID5B 4WE1A 4RJVA 2FVRA 3MWBA 2G2YA 5DM7Q 2DR7A 5IWAJ 3IR5B 3T5LA 4DR4J 1BGXT 2RT3A 1EAYC 2G0CA 3PW5A 2NZCA 4CP5A 3CD5A 3NG8A 3HFVA 4HR2A 1UEKA 1WF1A 4YB6A 2VPXB 1YZ6A 1K1SA 2GC8A 2ALZA 5E5NA 5FDLA 2D74B 2EFPA 2FB0A 3PACA 4JI2J 3QSYB 2MKIA 4I2PB 1ZYQA 1RWXB 4UQGA 1RACB 2DH8A 1QAYA 4X66J 2ZKUA 4L72B 1YHQS 2XY7A 2J8SA 2UXBF 2BMBA 2DO0A 3P5BP 1S9FA 1XMQF 3OFGA 3G8SA 5L1JA 3G9CA 3BGRB 3EXCX 2E5LJ 3PEJA 1L3TA 2CPXA 1D9DA 3R1HA 3MCMA 4R0EA 3HHLA 4F4YA 2UXCF 4HVZA 3JTPA 5CQGA 1N36F 2XO7A 2HHPA 2HK2A 1EKSA 4F2RA 4MKBA 4U7CA 3FC9A 4C8NA 2BVZA 2Y8WA 3A8EA 2HAFA 1TKZA 4FKXA 1KD1T 1G7CB 1UCNA 2RNEA 3M8PB 2PFFB 1CJKA 4Q2LA 2BQRA 4CTAA 1ZBTA 1TVRA 4X4QA 3MOJB 3D66A 2HHQA 2LMIA 4DFMA 3GSDA 2NYIA 3ISZA 1S7IA 4U96A 1FKPB 1IBLJ 2CQDA 5ETRA 4TY9A 1C1CB 3BSNA 4NEZA 3D54A 1NHUA 4EYIB 1S72S 3UN3A 1GMWA 1U4BA 5HLFA 1X4EA 3M6UA 1OO0B 2KXHA 4WTOB 4ZIWA 3LOUA 1VFJA 2KXNB 4WTYA 2YY3A 2K3IA 4CCHA 2J9DA 1RT6A 2WZ1A 3K5LA 4KB7A 4ED7A 4ANCA 2DR6A 2I0XA 3NNHA 3M32A 4WZQA 5C7PA 1B3TA 2V69A 2QA4S 4YFUA 2CG8A 4DSJA 2CPYA 2D9PA 3LP0B 1MNEA 4DQSA 4KO0A 4ZVSB 2VG6B 2DEJA 2V67A 5L8RC 5A0YB 3MMBB 2DK2A 1RKIA 5DS7A 4LRCA 4J9QA 1GH8A 3NS5A 2MXYA 3BDEA 3GJSB 3RZAA 2GGPB 1S0MA 2OUGA 1BLUA 4ENOA 1B70B 1S77D 3N28A 3WZ0A 2GA7A 3ISNC 2YKPA 3IRXA 1SH2A 1FO1A 3HZGA 2CZVC 5KFAA 2Y8YA 4KV8B 1K1QA 2YVSA 1VK8A 3IMQJ 3G8QA 2VFTA 3GYNA 4J9UE 1YSJA 4AQYJ 3UNGC 4XTTA 1N5SA 4NRUA 3WC2A 4KGZB 1WHWA 1RDRA 2MQQA 3MM8A 1UWAA 3CO9A 3UCGA 2BBEA 5KG2A 4NLYA 5K20B 4WP8A 3W7BA 4RW4A 1HBOA 2A2DA 3HD2A 1TL4A 4L6V3 2ZVSA 3QBCA 2BJ8A 4QIWD 1TL3B 5D3GB 2CRLA 2V2VA 2Z0GA 4Y2KA 1NBEB 4Z7YA 2D1CA 3OXLA 2R3VA 3CCMS 1RU1A 3ILJA 1LWFA 1S1WA 5B0AA 1RT1B 1Q79A 3DYAA 2FC8A 2VKZG 2AJ0A 2DXEA 4DN0A 1BY9A 2QJ3A 2HEKA 2UVWA 2XZDB 4HDGA 2LVWA 3MR6A 3QT5A 2VV5A 1FHTA 1P1TA 3KUGA 4NZ0A 3MPVA 2ZWOA 5A8KB 1WHXA 4ECSA 4X64J 3H2VE 3DRSA 1U02A 4J91A 1CULA 2HGNA 3M1VB 4TY8A 1I94J 1JMTA 3DRRB 8AT1B 2DGOA 4QCLA 3ZTPA 1CJVA 2AV5A 5KT6A 1RTHB 4QW9A 2AJ2A 5KFOA 3SEOA 4TN2A 1XR7A 5D78A 1RTDB 1OSDA 3HVRA 3PW4A 2BOAA 1HNZJ 5IOLA 2X1FA 2LQBA 4YQWA 1TKXB 1WOSA 3KG4A 2BACA 1R6YA 2M4MA 4Q7AA 2RJZA 4NXMF 4IDKB 1UVIA 3POTB 3H5YA 4EZ6A 1VQSA 2EBGA 3JSMA 2BZ2A 2A1BA 4X84A 4R0JA 3ZC4A 3JB9k 2NYHA 5F3TA 1NNDA 2B4OA 2ZE2B 5E3PA 1DAXA 1N54B 3K5NA 2O1PA 4XIUA 4LF8F 3IBCB 1D8ZA 5DZ7A 2GO9A 1KBRA 4M63A 4USKA 2QG9B 3CCVS 1BQNB 3MM7B 1MMLA 9RUBA 2RE1A 1KDNA 1DBDA 5I3UA 3KNAA 1N33J 1HHTP 1VLOA 1U47A 1NJZA 2HNZB 2DGQA 3MM9B 4Y2AA 5E7OB 4DV4F 3RB0A 3G6YA 4X4VA 3D0HE 4U6PA 1RHKB 4I64A 2WBMA 4MK7A 4NLOA 3QO9A 3MMCB 3TJ9A 5C42A 3AODA 3OV7A 4PZVA 5HMWA 1IR2A 2B9WA 1NJYA 2Z2ZA 3GFYA 3SCJE 3HVWA 4DPTA 2ZD1B 1H7WA 1T9TA 1VRUB 2IJFA 2M8DB 4DXLA 4ELTA 4DZDA 1P27B 2Y1IA 3KLFB 1FDAA 4Y65A 2YQ1A 4F4ZA 3GR0A 4DR1F 1VQ8S 5FLXU 1SJ4P 1S6OA 2IBOA 1Q81T 1FK9B 3PHTA 3NOCA 4BDPA 3GFXA 2HRUA 5D8HB 4AL7A 1RAFB 3DNCA 4M5HA 2W7PA 3BSOA 3SFUA 3VVUA 1S79A 2QSFA 4PWDA 3AJDA 1RTIB 5C25A 5ETOA 1G2EA 2F5GA 2DGXA 3BQ0A 2W8LA 1RTJB 4HHHA 5DO2A 4RWXA 1HI1A 1D0EA 4A8YA 5EX3A 4LF1A 1HNVA 4HACB 1XC9A 2B43A 1WF2A 2HFNA 1URNA 1WSRA 2PC6A 4U8VA 2AYEA 2W2QP 3QJJA 4P2XA 2GIFA 1FKOB 4EWTA 2DXDA 1XERA 2UUCJ 4OYXA 1FDNA 3D68A 1HA1A 1EETA 3I9V9 3GFZA 2BOPA 1R43A 4HKQA 1DHMA 4H4OA 4OV1A 4W4MA 2FJEB 2MLZA 1RWKB 3DOMA 2RKIA 1BWVA 4FYWB 3A8KA 2FVQA 3AXKA 3H98A 4HH0A 3WX4A 5DG7A 1RLDA 2EI5A 4XPCA 3D2WA 2B9XA 3CD7A 4GKKF 2F65A 4NCGA 3B8HA 4BC7A 4ZLJA 2CPIA 2XQCA 1QLNA 3VAKA 3M2UB 2GHWA 2DY1A 4NCBA 3RAXA 3SQOP 4CT8A 2GHPA 3PRBA 5HQMA 3K5PA 4RWWA 3VHQA 1AFIA 1N5QA 3EMTA 2H51B 3MEEA 2NR0A 3P96A 1ZM9A 2MY7A 2L9NA 2E5GA 5H9FJ 2DO4A 1SKUB 4TLQA 1FFWB 5IS2A 2XWYA 4WFYA 4L76A 2L08A 4DR6F 4LF5J 2LCWA 1B7YB 5KG7A 1NH7A 5J2NA 2O3DA 1UAWA 1HI8A 4EFAC 4YDXA 2ZH2A 5A6PA 1FDDA 4HLBA 1IR0A 1RK8A 5CZXA 2ASDA 1IVZA 4G1QB 2AJ1A 4QWDA 2CPEA 4NA2A 4QWAA 1RTZA 1HBNA 4DR5J 3OVBA 1GMWD 2P9GA 1RHUB 1JXEA 5J2MB 3BV8A 3MAQA 3CJ5A 2P8IA 1SC1B 4ZVUB 1SB6A 3T1HJ 2XLJA 4M5MA 1KSPA 1PG5B 5DJBA 3G87A 1RZMA 1RAAB 3QZ8A 3L7PA 4LBIA 4NA1A 3RB3A 2CDRB 3BEGB 5DGBA 4WPAA 2RVJA 1VC6A 1S57A 3J7AN 4WP9A 2R7VA 3DOKB 4K2JA 2ZH1A 3RR7A 1RI7A 2YPYA 1XQIA 4M5IA 5F8MA 3THVA 4LF7F 2YWWA 3KYLA 5K14A 2QIFA 4WIIA 4HHUA 2OSRA 4IRCA 1YDLA 3ZO7A 1JKHA 3FJ2A 2NREA 2MSTA 5D0EA 3MPYA 1HYSB 4PUOB 4ED0A 3ZXWA 2H5EA 2DVIA 3QAEA 1N5TA 4DUYJ 1RAOA 2YNGA 4K4SA 3AOBA 2MKJA 4L3KA 4USJC 3VTIA 4B9VA 1K73T 2VC1A 4ILLA 2EC0A 1X0PA 4G1IA 2VQFF 1SJ1A 2BEFA 1XNRF 3EWGA 2HZVA 2HMIB 5F8NA 4YUDA 2PSZA 3NP5A 4WFZA 3IM9A 2WW8A 4EGLA 2YWEA 4B9TA
chains in the Genus database with same CATH topology
3HM9A 1S1TB 4Y2CA 4J9PA 4CIOA 4WYLA 4DV2F 2UVUA 3D1HA 5A0YA 3DLGB 2IM2A 3MMBA 1QAJA 4ETXA 1HMVA 1X8DA 2IC3A 3P3DA 4ECZA 4YY3F 3CD6S 1AXQA 3VCDA 3TP2A 1X4CA 1GNKA 4DR7F 2HHXA 2FJXA 5J2MA 4ZP9A 5C24B 4I6AA 2YX7A 1S9EB 4LSLB 2ZJPQ 1Q16B 4JI2F 4EO8A 2KN4A 2B3TB 5F41A 5B0CA 1IBKF 4MK8A 5HQ8A 5LSRA 4DQPA 4RX6A 2DGSA 1V6HA 2V8HA 4PQUB 4A8MP 3EGNA 4YEAA 1ULRA 2B4PA 4J5OA 2EFNA 2CQ1A 1KS2A 2QMWA 4ZVHA 5KFSA 4CH7A 4LQ3A 1IKXB 5EN1A 3C6TA 4ERDA 4H4KA 4D3HA 4JV2A 2FLOA 1C0UB 4QIGA 2J9CA 2N3OA 4JV0A 1VQ6S 5F9NA 1Q8LA 2GJIA 4RZRA 4AUKA 3I32A 4O4GB 3A1YG 4RW8A 4JI0F 2WHOA 2J6SA 1TP7A 2BM0A 1Z2LA 4KGKA 1TV6B 3LANA 2C3OA 4TLRA 2ZITA 2VG7B 4HTIA 3HMJG 1CQNA 3GILA 4OZ1A 1PC5A 3QIDA 3PKMA 2V94A 4OX6A 3PV8A 5G0RB 2JVRA 4DHVA 2PMZD 3ICLA 5K8PA 3FSYA 4WCEQ 5EWGA 1VQMS 1X9MA 1Y0HA 4Y3CA 4G3IA 3QZ7A 4K4TA 3ITHB 3CCWA 4ITSA 2GNKA 2HS0A 3TVZA 3NCQA 2BE2B 1FNMA 2R7UA 3M30A 3GR1A 5KG4A 2OD6A 4H54A 5HMYA 2V4RA 1P6TA 4ECYA 2V4JA 2OTLS 3PY8A 4LF4F 2R7WA 2PGCA 2OSQA 3DOKA 2E5LF 3CIMA 4MH8A 3DLJA 3N6LA 1VBZA 5KFYA 2E1AA 3B4DA 2K2PA 3PJWA 3M8RA 3BN7A 4FYDA 1LKZA 1P1LA 4J37A 1DLOA 3M9MB 2WOMB 2YNIA 2NSCA 4OJ1A 3HPOA 1UVLA 4ZK7M 2JRSA 4Q8FA 5D4LA 3KK3B 1NKBA 1F0XA 5KFUA 1UJ4A 3F41A 1ROFA 1KC8T 3CCZA 3DC2A 1TL3A 3HHKA 1UWBA 3V2UC 4QR2A 4TQSA 5BR8F 3OVSA 1HD1A 4A8OA 3UWTA 2F3JA 2IAJB 4DJBA 1UETA 1ZETA 4H4MB 2CJQA 2ZJQQ 3MM5B 2W9CB 2KHDA 2RDJA 1HYSA 2P6TA 4PUOA 3HHEA 2JJ4D 5B08A 2R2SA 2B7CB 4WXOA 5HP1B 2W4PA 2MPUA 5D4OA 2R8HA 2VODA 4M8LA 3Q0AA 1T05B 2IHR1 2ASLA 3MMAB 1I1GA 2YX4A 4G1PA 4DF4A 1ZM3A 1RT1A 1VQYA 3UCZP 5J2QB 3TW0A 5KFMA 3BSAA 2ABYA 5IT9Y 1UL3A 5H9EJ 4XPEA 2V9KA 2ZDPA 4H4KC 4RNOA 1Y9OA 3EZ5A 1VQOS 1JB0C 3FVYA 3HX9A 4FNHA 1T7PA 2AWZA 2H9ZA 3DI6A 4ECXA 1FERA 1YJWS 1RYSA 3NGKA 1Q82T 4FF3A 2EKYA 2DR9A 1RJJA 1XN9A 2O5DA 2MKKA 3MAHA 1HNIB 5I42A 1E6YA 4R5PA 2QO3A 3LQVA 4TKTA 1X4GA