4I2QB

Crystal structure of k103n/y181c mutant of hiv-1 reverse transcriptase in complex with rilpivirine (tmc278) analogue
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
424
structure length
416
Chain Sequence
IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gag-Pol polyprotein
publication title A comparison of the ability of rilpivirine (TMC278) and selected analogues to inhibit clinically relevant HIV-1 reverse transcriptase mutants.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Hydrolase, transferase/inhibitor
total genus 112
structure length 416
sequence length 424
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4i2qB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4i2qB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4i2qB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4i2qB03
3ISND 4RW6A 4EO8A 3DLEB 2FVCA 1RTDA 4IR1A 4ECQA 4WXWA 1HMVB 3DYAA 3H5XA 2HMIB 3TQ1A 2UVUA 5KFXA 1RT2B 4JV2A 3KLHA 1J5OB 1ZTWA 1DLOB 5JUMA 3OL7A 4XO0A 2C2EA 3V4IA 4J9KA 4LQ9A 2ALZA 2OH2A 4K4TA 4DL7A 1VRUA 1WNEA 5J2QA 3IG1B 4LSNB 4MFBB 4ZVEA 3ITHB 2OPRB 1VRTA 3QO9B 3QIPB 5KFYA 1QE1A 3MEGA 1R0AA 3CJ4A 5KFIA 4WFXA 5C5JA 1S1VB 1S48A 4KO0A 5K14B 4NLDA 3M9NB 4NYZA 4K4WA 4PWDB 1SV5B 4ZP9A 3N6NA 5EWEA 2V4RA 3PW4A 2ASLA 3OSNA 1FKPB 5DG7A 4O3RA 3QLHA 2WB4A 1S0NA 5HBMB 3I0RA 1JLAA 3H5UA 3GV8B 3KLVA 4IG3A 2XWYA 4QWCA 3MEEA 3DRSA 1Z4UA 5KT7A 2R8HA 3GIIA 2DPJA 1JLCA 1LWFA 1HYSA 5DGAA 2BANB 4EBCA 4ID5B 5HROB 1TP7A 4LSLB 4EBEA 4XPEA 4OL8A 2IC3B 3NAIA 3MFHA 4ECXA 1RYRA 3KK2A 4ZPDA 1T94A 3GV5B 4ED2A 2ZD1B 3KLGB 2JEGA 4RW4A 1N6QA 4GC6A 5DGBA 4DEZA 3DLGB 2IM2A 4FBTA 2UVWA 1C1CB 2GIRA 4Y2AA 5KG6A 3GILA 2VA3A 1U09A 3IGVA 3H5SA 5KFDA 5J2MA 4Q0BB 1RTHB 2YNHA 4Y2CA 4FS2A 3LP0B 5KFUA 3FFIB 5KFWA 3OLBA 4J9RA 4ED7A 3H2LA 1RT3A 5C25B 1T3NA 4KHRA 4NCGA 5KFEA 2ZE2B 2W7OA 3NMAA 2OPQB 5KFHA 3RB6A 4DL3A 4ZVFA 4WE1A 1C1BB 4MK8A 3RB3A 2YKNB 3QGGA 1C0UB 2CKWA 3SFGA 3H4DA 1QAIA 4O4RA 2FLLA 1S1TA 3UDLA 1DTTA 1JLBB 4J9QA 3KLEA 5JXSA 1YVFA 2D3UA 3NGDA 1RT7B 2W7PA 3NBPA 3V6DA 2HAIA 4RW7A 4KKOA 4TLRA 3T5JA 3DOLA 3BGRB 3MR3A 2IMWP 1NNDA 3OHBA 4H4MA 4RW8B 4Q43A 4RW9B 2JEIA 3DOKA 2J6TA 3M8QB 4B3OB 4QW8A 5CYQB 1N5YB 3CDEA 4ED3A 3V6KA 4ZHRA 3KK3A 5L9XA 1JXLA 4IQXA 1HNVA 1FKOA 2HNZA 1JX4A 4NLOA 2C2RA 4WXOA 1T05A 2RF2A 1EP4B 3EZUA 5KFBA 5DG8A 1S1XA 3GQCA 4QWAA 4IG0B 3C6TA 4KFBA 3KJVB 2AX0A 2VG6A 4ECSA 4MIAA 3DI6A 3FRZA 3OL6A 3FSIA 4O3OA 2B6AB 4IH5A 4RUCA 2W9CA 3GIJA 2JEJA 1HQEA 2JC1A 2XI2A 4Q8FA 3BJYA 3V4IB 1SH2A 3PW5A 3RB4A 5KG1A 2ZKUA 5I42A 4URGA 3D5MA 3E01B 4R5PB 1UWBB 5C24B 2C28A 3MEGB 4RZRA 2WRMA 5J1EA 1W25A 4J9OA 3IRXA 4O44B 2OPPB 3MR2A 4I7FB 1TL1A 3QIDA 4O4GA 3V81B 4PQUA 3PR4A 3LANA 3H59A 3Q8PB 3QLHB 5HP1B 2FVPA 3BR9A 4ZPCA 1DTQB 3TVKA 1S1UA 1S0OA 4O3QA 4IG3B 4K50A 3MECB 1RT1B 3IS9A 2W8KA 4MH8A 4O3NA 3KLFA 2WK4A 1K1SA 1RT6A 3PW7A 1LWFB 3LP2A 2IJFA 3FQKA 1D1UA 2W8LA 4ZVHA 1S6QB 1S1WA 4ICLB 4TQSA 4EBDA 4KSEB 3NAHA 3I0SB 3EPGA 3DLKB 4YP3A 5HLFA 3KK2B 2YKMB 5KFPA 2IAJB 1REVB 2AX1A 2JC0A 5KFMA 1C2PA 4K4YA 1RDRA 4NLTA 3GIKA 3KMQA 1C0TA 4J9LA 2BE2A 2VG7A 1HNIA 4KV8A 5J2PA 4M94A 3LALA 1TKTB 1KHVA 3KLIA 4H4OB 2WTFA 2ASJA 4FBUA 1JKHA 5KG4A 4ECWA 4LQ3A 3MFIA 4I2QA 3Q8QB 4YR3A 5I3UA 1TL3B 5J2MB 3PW0A 4IFYB 1LW2B 2IM1A 3CJ3A 3G6XA 4YR2A 1SUQA 1TKZA 3MF5A 2VG5B 4Q45A 2YNGB 2R8KA 1TKXB 3I5CA 1GX5A 4URQU 5KFAA 2BQUA 2B5JB 4YR0A 2HWIA 3PW2A 4J9MA 2WONB 3BREA 5KFGA 1IKWB 2AWZA 4U6PA 4JV1A 4O3SA 5KFRA 1S9FA 4NLGA 4G1QB 1N4LA 3CIZA 1KHWA 3JYTB 4KE5A 3OL8A 4HYKA 1DTTB 2HNDB 3UPFA 5C42B 5KFQA 1BQNA 3DMJA 3LP1B 4WYWA 4QWBA 1TV6A 1CSJA 1EETA 3MEDA 4TQRA 2W9BB 1T03A 4MK9A 3T5KA 1S6PB 2IM0A 4ZMMA 1LWCB 4NLPA 1LWEB 2ILZA 3GYNA 2HNYB 2WOMA 1RT4B 3RAQA 1QAJA 1SH3A 3QZ7A 1XR5A 3BQ2A 1IKVA 3KK3B 3RBEA 2C22A 4WZQA 3CVKA 1HNVB 4F4ZA 3KK1B 5KG5A 2FJWA 1KLMA 1S9EB 1T05B 2RF2B 2I5JB 2D3ZA 4I2PB 4ED8A 1S0MA 4J9PA 1JLGA 3C6TB 2FVRA 2D41A 4RNFA 1MU2A 2AGQA 2R2TA 3KHHA 1LW0A 1IKYA 2WCXA 5J2NB 4GC7A 1RTJA 3H5YA 1TVRA 3NL0A 3H98A 2ATLA 4URSA 5EDWA 2BRLA 2YNFB 4RNHA 2R2RA 2E9RX 4R8UB 2XCPA 4ECTA 2F8EX 4ECUA 2GC8A 3DM2B 3CWJA 4F4YA 5I42B 3DLEA 4DG1B 2AU0A 4TY9A 1HMVA 4EO6A 4RU9A 1RTIB 4RNMA 2HMIA 3G86A 5F8NA 3MTKA 3DRPB 5KT2A 4H54A 3G6VA 4EEYA 4J9SA 5KG0A 4PUOB 3RB0A 1RT2A 2ILYA 4WYLA 1J5OA 1RT5B 1S9GB 3VQSA 2OPSB 2EC0A 2C2DA 3OHAA 1JLQB 3HHKA 5L1IA 1RYSA 4RNNA 5KFKA 2R8IA 3IG1A 3ITHA 1FK9B 3ICLA 2OPRA 3QIPA 4WZMA 4KHMA 2BR0A 4WFZA 2AGOA 1N56A 3KLFB 5KFTA 4Q8EA 1S1VA 1S49A 5K14A 5CYMA 5D3GB 4ECVA 4PWDA 1SV5A 1JLEA 1IKXB 2I1RA 4TY8B 5KT3A 3HVWA 5KG2A 5L1JA 2FLNA 4QWDA 5HBMA 4RW6B 2W9AA 1GX6A 3RAXA 4NLUA 5HLFB 1RTDB 4NLWA 4DL5A 3DYAB 4ZP8A 4ECYA 3HVTA 2QV6A 2BE2B 2VG7B 1HNIB 4F4XA 3KLHB 3KLIB 1XR7A 4IH6A 5KG3A 1JKHB 3FDSA 3BQ0A 4LSLA 4R0EA 5L1KA 3Q8SB 2J6UA 1VRUB 2IC3A 2RKIA 2XGQA 5J2QB 3T1AA 2QE5A 1VRTB 3CO9A 2GIQA 3T5HA 1QE1B 3KLGA 1R0AB 2V0NA 4MKBA 4NRUA 5F8GA 2UVVA 5F8HA 4KO0B 1BQMA 3M8PA 3DLGA 4NRTA 1C1CA 4F50A 3PR5B 4IRCA 2IJNA 3C6UA 5KFFA 3CDWA 4Q0BA 3I0RB 1JLAB 1JLFA 1NHUA 3FFIA 4KBIA 5DQHA 1HQUA 3HVAA 3MEEB 3DRRA 5C25A 3DRSB 4ECZA 2ZE2A 3QZ8A 1JLCB 2OPQA 4IDKA 1HYSB 5F8JA 2FVQA 4TYAA 3MEDB 3BSAA 1C1BA 2ASDA 1ZTTA 1C0UA 4ZPAA 1T03B 3N6LA 3NKYA 5KT5A 3RBDA 3OSPA 4IRDA 4TXSA 1JLBA 2UVRA 3FQLA 2IA6A 4G3IA 1N48A 2V9WA 1RA6A 4NLRA 4RW4B 1N6QB 2BQRA 2O5DA 3BGRA 3DDKA 1TQLA 4Q44A 1IM4A 4ED6A 4DL4A 4RW8A 4HKQA 4TYBA 4RW9A 3BQ1A 2YNHB 3M8QA 5KFNA 5CYQA 1N5YA 3I5AA 4M95A 3PZPA 1XR6A 4JV0A 1RT3B 4JUZA 5DLGA 4NCGB 1NHVA 2J6SA 3HKWA 1EP4A 4WE1B 3IN5A 3V6JA 4IG0A 3CJ2A 3KJVA 5FDLA 3CDUA 3CJ0A 1S1TB 4FS1A 4WFYA 4K4VA 5DQIA 3MR5A 3JSMA 3V6HA 2B6AA 3KLEB 4NLVA 3NBPB 3V6DB 3QYYA 3MR6A 3LAKA 4KKOB 4RW7B 2R2SA 3BSCA 4NZ0A 3KHLA 3DOLB 2YNIA 3E01A 4R5PA 1UWBA 5C24A 4F4WA 4H4MB 3M9OB 3N6MA 5CYMB 3DOKB 5KFLA 4IFVA 4O44A 1JLEB 2OPPA 4ECRA 4I7FA 2RDIA 4ZHRB 5F9LA 3V81A 3I5BA 2HNZB 1FKOB 2FVSA 2XCAA 5HP1A 1DTQA 4ZPBA 3T5LA 2FLPA 1S1XB 4YMEA 3MECA 1HPZA 1RT1A 1RAJA 5EWGA 4IKAA 4KFBB 3TAMA 1MMLA 2VG6B 3HVTB 3DI6B 3UR0A 5F9NA 2XGPA 2W9CB 3GIMA 1HQEB 5KG7A 1S6QA 2VA2A 4ICLA 3KOAA 4YQWA 5KFCA 3I0SA 3DLKA 2RKIB 5KFVA 2YKMA 2D7SA 2IAJA 4NLSA 2AGPA 1REVA 3ISNC 3H40A 4IOBA 4ZVGA 2WHOA 4DL6A 4K4UA 5KFJA 1BQMB 3M8PB 5J1EB 3IRXB 1TKTA 5F8LA 4H4OA 1TL1B 4RNOA 1DLOA 4O4GB 4TN2A 4PQUB 5DLFA 1D0EA 4K4XA 2E9TA 3C6UB 1TL3A 3QGHA 5KFSA 4IFYA 1LW2A 5F8IA 4Y34A 1S1UB 1I6JA 3PHEA 1JLFB 4LSNA 4MFBA 2UUTA 3QO9A 1HQUB 3IS9B 3OLAA 2VG5A 3DRRB 4MKAA 2YNGA 2RDJA 3BSOA 1RT6B 1TKXA 1QUVA 1OS5A 2FJXA 2IBKA 2B5JA 5F8MA 4IH7A 4IDKB 3LP2B 2V4QA 1FKPA 2WONA 1IKWA 4XPCA 2HWHA 4KAIA 2BRKA 4KB7A 4U7CA 5L1LA 4EYHB 4IR9A 1S1WB 4G1QA 3JYTA 5KFZA 3PVXA 2HNDA 2R2UA 3CJ5A 5C42A 5DQGA 1S10A 3LAMA 3LP1A 2R8GA 1C0TB 1JIHA 5J2PB 3EPIA 3PJXA 4KV8B 3H4BA 2BANA 4IRKA 4ID5A 5HROA 2XI3A 2W9BA 3SFUA 4K4ZA 3IGNA 4QPXA 1S6PA 4I2QB 1S4FA 1LWCA 5I3UB 1LWEA 3BSNA 2HNYA 1RT4A 3KHGA 1SUQB 1TKZB 3SI8A 2ZD1A 5T14A 4RUAA 3KK1A 5KFOA 1S9EA 2I5JA 4QWEA 4J9NA 4ZP7A 4I2PA 3Q8RB 2DPIA 1ZETA 4ZP6A 4MK7A 5FDLB 3KNAA 3PJWA 4DL2A 1RTHA 3LP0A 5J2NA 2IM3A 3JSMB 1SH0A 1HARA 4NLQA 3D28A 3QGIA 2YNFA 1BQNB 3DMJB 4R8UA 3UQSA 2XC9A 2UUWA 4EYIB 1TV6B 3DM2A 1EETB 5DG9A 3GV7B 4DG1A 2YNIB 2YKNA 1S97A 2JEFA 1RTIA 4ED1A 2FJVA 3DRPA 4PUOA 4IFVB 2WOMB 4MIBA 2R8JA 1RT7A 1IKVB 1RT5A 1S9GA 2OPSA 3KHRA 4NLXA 1JLQA 3M9MB 3OL9A 3T19A 4K4SA 4X2BA 2E9ZA 1KLMB 3KMSA 4Y3CA 4ED0A 2JLEA 2CJQA 1FK9A 5EUHA 2B43A 5KT6A 1HPZB 1RA7A 1JLGB 2BQ3A 1MU2B 3TAMB 5D3GA 1LW0B 4B3OA 1IKYB 1K1QA 5KT4A 1IKXA 4NLYA 1RTJB 4TY8A 1TVRB 3E51A 3G6YA 5EWFA 2AQ4A 4QW9A 4O3PA
chains in the Genus database with same CATH superfamily
5BYRA 1MNEA 3AAWB 1QD1A 4ZVQB 1ZTWA 1YJUA 2VJVA 3W66A 3S01A 3ENWA 4P6QA 4XAKA 3QFHA 3K17A 2WB4A 1S0NA 5HBMB 4LFCF 2MTLA 3MEEA 5K5MA 4CO5A 5B0BA 1VQ4S 3AA8A 2YQ1A 5M2RA 2ZH4A 3LF0A 4TU9A 5G0RA 1FVQA 3ZO7A 2ZD1B 3M2UA 2APOA 1BLUA 2VFSA 2HAFA 5C25B 3I82A 3JQJA 1IBKJ 7FDRA 4CO2A 2E5HA 2BKPA 2PE8A 3RB6A 2V50A 3ENVA 4E98A 1CULB 4OI2A 1HWUA 3B4MA 5A8WA 1DTTA 4WIQA 4EU0A 1JLBB 3KLEA 1IBMJ 1HWLA 2IMWP 3VAMA 4H4MA 2FYXA 3UWTA 2YX7A 4ED3A 4ZHRA 2VOPA 2CYYA 1NH7A 1KN6A 5T7LA 2AKWB 1HNXF 1CJTB 1WHXA 3V5RA 2H5EA 5HQ8A 2D9PA 3AD9C 2F63A 3QIDA 4PQUA 4MJKA 2DNHA 4UOGA 3CT9A 1B0PA 4EBDA 1WOSA 5IV4A 1AT1B 4ER8A 4WFBQ 4KV8A 5GAGU 2F9JA 3BKFA 4RWXA 2LECA 4CRJA 2Y1LB 2GS8A 4OJ3A 3W64A 1DTTB 2HZVA 5IT4A 2VQEJ 4QWBA 3PX4A 2AW0A 3KWMA 4U67Q 4C0BA 3GYNA 3WIVA 1HIYA 4B02A 4I2PB 4GC7A 3TWZA 3NL0A 5T7LB 3GCWP 1S4EA 3VGVA 2YH1A 3DM2B 2JHEA 3G86A 2CJKA 3DRPB 5KT2A 2QGFB 2GMLA 4J9SA 1YHQS 3VQSA 3QNWB 2DR6A 3MHYA 5KT3A 1PC4A 4RW6B 2CDQA 1FFWB 2XO7A 3DYAB 4ZP8A 2O1PA 2ZBQA 4PXCA 2RIJA 3R5GA 3BYRA 2C1EB 2QE5A 3VZIA 4ELVA 3K5LA 2OP5A 5F8HA 4B3MJ 1ZH5A 1SPBP 2AIRB 4OZ3A 4F2RA 2Y8WA 4R25A 3DDNA 5DQHA 3OW2R 2OKQA 2UXDF 1C1BA 4EK2A 5BXIA 1ZBTA 3GLJA 1OIAA 8AT1B 1V3SA 4F3MA 4JI2J 1MMNA 3DDKA 1IM4A 3KXDA 1N5YA 4LF7J 5CYJA 2XMUA 1YJTA 2KT3A 1AZSA 1Y5IB 1PJ6A 4WFYA 5C2GA 3PEJA 2BJ9A 2FHMA 2DH9A 1KOOA 2IDEA 2C2OB 3ENQA 2EG1A 4B9NA 3UN2A 4G6VB 2AZ3A 4ZCLA 3A3PB 3T5LA 2V2ZA 3MUMP 3QT5A 4HACA 2MKYA 3CC7S 2I2YA 3MOZA 2DJWA 4OI0A 2QMUB 3O5TB 4HHJA 2JNJA 1WC3A 2J8SA 4QYRA 5M2PA 2ZVSA 5GMKa 4O4GB 3KKFA 4IFYA 5E0OA 4ILRA 1MMDA 1IKWA 2M8HA 1HHSA 3SV4A 3LAMA 1R8AA 1B4SA 4FP9A 2ZC4A 5A6PA 3H90A 3CCUS 4QR2A 2I5JA 1U25A 3DKDA 4RR5A 1VI7A 1TL5A 1TU0B 3ZZRA 1FE4A 1IR0A 4A8OA 2CNKB 1UP1A 4LRDA 2JH3A 1VHFA 3UR3C 1DQ9A 1VR6A 5LOQA 1D9DA 2XWXA 1FK9A 1PBAA 4HACB 2ZH9A 3K8VA 1HNZF 3IP0A 1KEKA 2UP1A 3BR8A 3G87A 2QLBB 2RUGA 3KNGA 4N8OA 1VFJA 1M0SA 4OZNA 2XMAA 2FJEB 3T41A 5LM7E 4K8RA 5E41A 1PG5B 4PXEA 5K14B 2LQ5A 1VQKS 2G4BA 3I0RA 3THPA 4XTTA 3DDIA 2HHPA 1LWFA 1WHYA 4DDFA 3TVYA 2DIVA 3ZFVA 1X0FA 4EWTA 3LH2S 1NK8A 3MFHA 2K06A 1RYRA 2GHVC 2DY1A 2CNOB 1UEVA 4FBTA 2DIUA 3K0JA 3TA1A 3H5SA 3TAQA 3QATA 4DCJB 2MGZA 4ZVFA 3RB3A 1CS4B 1Y7PA 2ERRA 2DITA 4RW7A 5GAEU 5CCMA 1H2TZ 4XDDA 5HO4A 3OHBA 4JV5J 3KDNA 4NA2A 2ZEJA 3PRDA 2XS7A 1FWPA 1OY6A 3P5BP 2RF2A 2GA7A 2CPEA 2QSWA 2ZM6J 2B6AB 1F60B 2VQFF 3WX4A 3I9ZA 3FNNA 1NPKA 4CLPA 5A8KB 4MYUA 2HHSA 5SZTA 1NM2A 2DNQA 2JFKA 4P10A 3BR9A 1RGVA 2R7XA 2GVZA 4JI6J 1RT6A 1LWFB 2VH7A 1S1WA 3PDNA 2J9DE 2YKMB 1SVDA 2AX1A 3GIKA 4I4BA 2E1PA 4JBCA 2G13A 3N5FA 1W2BR 2CG4A 2HFOA 3JYTB 5I3PA 4E2FB 4OZ2A 2M2BA 4NEYA 2RB7A 1S6PB 1LWCB 1FEHA 3QT7A 1DRZA 4ELTA 2RMLA 4WIIA 2RF2B 4JYAJ 2BKNA 1IKYA 1TVRA 2V2KA 2BRLA 2R2RA 2GJIA 2GC8A 4BC9A 1HMVA 2KL8A 5F8NA 2XYHB 4ATNA 2ILYA 4RNNA 2DXDA 2AGOA 1MW7A 3OVAA 4CT8A 1SCJB 2YWGA 4EFAC 4NXMJ 2I6WA 4OJGA 2B9WA 3ZTSA 2QA4S 1M5KC 1IWAA 4F0HA 3EGNA 4DBQA 4ZK7M 5IT9Y 3KLHB 2HIYA 2HVEA 3W2VB 3BQ0A 3W8GA 1Q8IA 2XGQA 2HLUA 3CO9A 3KLGA 1EB0A 5LJ5Y 2A6MA 1FEEA 1TFYA 1NHUA 4KBIA 3HVAA 1HI0P 4TYAA 1U1LA 3MAAB 2LXFA 2E44A 2AEMA 4Q44A 2RSQA 1UVJA 3NNHA 3FBBA 5AXMA 4X4OA 3V6JA 1IJFB 5BYSA 3CD5A 4NZ0A 4W92B 2CJ9A 3UCGA 3GFYA 5KFLA 4IFVA 1NZ8A 3B8HA 2HGNA 3MECA 5CH7B 4KFBB 1GT8A 4PG4A 2NPFA 3PYFA 1CLFA 2HHHF 3FCVA 4C0HA 1U0HA 2IYIA 1IM6A 4DJBA 4GKKF 2MKCA 4USJC 5EHHA 4U7CA 4IR9A 1VS3A 4K2XA 1G1XA 3OFGA 3D0IE 3EJMA 2DNZA 4OX9F 2MQ8A 1VYAA 2KZMA 2HNYA 1X7VA 2WVDA 1S9EA 1TUGB 4CO1A 2ATCB 3P45B 2ZOGA 4DR6J 1I5OB 2IM3A 1SH0A 1JJCB 2VBWA 2D1CA 2J0QD 1RWKB 2YKNA 2AEJA 1FF2A 3HSZA 4IQMA 4IFVB 1G2EA 4PG5A 2HURA 2MPUA 3T19A 1WC1A 4K4SA 4X4QA 3JAMU 1MU2B 1NH8A 2V63A 4B3OA 3NCQA 2CQHA 4DN0A 3LO3A 1URNA 3J81Y 2KHDA 1U0HB 1WTFA 4CLYA 4WXWA 4I1TA 3V4IA 2ALZA 4FKXA 1GH8A 1QSYA 4ALZA 5KFYA 2PA8D 4UT4A 2V4RA 3POTA 3G71S 3H5UA 3C15A 1T0TV 1U2RA 4Z37A 1LQ9A 3KK2A 4NYPA 2BABA 4IUFA 2ZBRA 1WI6A 4LRCA 4Y2AA 4I68A 1U09A 4OYMA 3P4UB 5D8HB 3OLBA 4OZLA 2QL7B 1X9MA 4JI7F 2W7OA 4X62J 2YKNB 3QGGA 1C0UB 7AT1B 2HFSA 2FLLA 2JVOA 3QAUA 3NGDA 4H4KA 3NBPA 3WBZA 3T5JA 1WI8A 1GXTA 3CCSS 4B3OB 2MY7A 3VAHA 4ZVSB 3NWGA 3HT3A 3KJVB 4MIAA 3DI6A 3PX6A 3GIJA 4Q8FA 2XG8A 4TU7A 3V4IB 3I4HX 2PEBA 2J7KA 2XS5A 4AFFA 5IWAJ 1TR0A 1S12A 3PM9A 3HI9A 4KGXB 3Q8PB 4DF4A 3PEHA 4L72B 2WW4A 4DUZF 3UN5A 3W60A 2FHJA 3I0SB 4OZ5A 3KK2B 3LA0A 4JP8A 2IMOA 4PAAA 4LF4F 4M94A 2BM0A 2ASJA 1HBOA 4KGMA 1TAUA 2CQBA 3CJ3A 2QIFA 2ZH5A 3SBMA 3SQOP 1HR0F 2YNGB 4OX6A 1TKXB 1GX5A 4URQU 4OI3A 1T9UA 2C2NA 4G1QB 3ZZUA 2V4JA 3NGRA 1OO0B 4C8LA 4ZVOB 4ZLLA 4F4ZA 3MM8A 3OFFA 2DY9A 1NCLA 4RNFA 3M2VA 4USHA 5EDWA 2Z0GA 2YNFB 3G2XA 5D15A 3TA0A 1JNZB 2F8EX 4EGLA 2AU0A 2OLWA 4RUHA 3CXCR 4GMKA 3T9ZA 2OPSB 2PN6A 3PRVA 3G4SS 3HFZB 3IG1A 3ICLA 3QIPA 5BR8F 4NCAA 5D3GB 3DHWC 1M5SA 1FCAA 1HNXJ 2G2OA 4DX7A 3MM6A 1ZZFA 1FJ7A 1VQ9S 3P96A 1XNRF 3SEOA 4JI1F 1X8DA 2G0JA 2HHTA 2BYCA 3T1AA 3ELHA 2POKA 1XN9A 2VFVA 3MI7X 3IBFB 3CDWA 1JLAB 3GJRB 5CZVA 1CPZA 4B3SF 5DZ6A 2V4JB 1H6KX 2GAHC 1YJNS 4RU2A 5GMDA 4DV7F 3VQTA 5HATA 4QIFA 8ATCB 3D7SB 5CD4H 2BQRA 4ED6A 3TUZC 3M8QA 4CI0B 5CYQA 4M5JA 4M95A 1RT3B 4JUZA 1NHVA 4G65A 1RWUA 2W01A 4IOAQ 1GTHA 5DQIA 3V6HA 4QU6A 3KJQB 3HXMA 1CJVA 5IS2A 3M8ZA 2YNIA 4B17A 1QLNA 2G0IA 3CCWA 2QX0A 2HNZB 2MZ1A 3SV3A 3BS9A 3CNQP 5EWGA 1BMQB 1K0VA 2XB2D 3A12A 2W7AA 1CJUA 1KDNA 2KG1A 4FNHA 4KH1B 2Z8QA 4RNOA 2D69A 2E9TA 1AB8A 1AROP 4NYOA 4MKAA 1D8YA 3TW0A 2VDHA 1YJ9S 3ZNUA 4ZLJA 2N4DA 2PO4A 1HD1A 2HBZB 4USKA 2RQKA 2HS0A 3IA0A 3S1TA 3PJXA 3H4BA 4WU3A 2CQ4A 2JSXA 1OJ4A 4C8MA 1Q7YT 2R4FA 1FX2A 4Z2XA 2UV8G 3VAGA 5GAEI 5KFOA 2HEKA 1N5VA 4GRSA 5JJBA 4OZJA 3LP0A 2PT0A 4HT7A 4U96A 2YNIB 2E1MC 3VHQA 2GAGC 4PUOA 2R8JA 1IKVB 1S9GA 1SB6A 4X4RA 2ZFHA 2B43A 4LRBA 4HEA9 3PYDA 3GB0A 3E51A 4LRFA 2EFVA 3UD5A 3FKBA 3ISND 4N8NA 3HX9A 2OMOA 1HKAA 2NXNA 3H5XA 4C3MA 3TQ1A 1DHMA 3PYEA 1XMOJ 4M5KA 3FMBA 3BEGB 4WFXA 1S1VB 4NYZA 1RHRB 4M63A 1Q16B 3PKYA 1U24A 3R27A 4FN5A 1JLCA 1U48A 1FNMA 4OL8A 5ETLA 3GV5B 1M90T 2XMMA 1N6QA 3DLGB 2W4PA 3GYXB 4ES1A 3L7UA 3LP0B 2M9KA 4KIAA 1YBAA 2XZWA 1GMVA 2HAIA 3CJRA 4YB6A 3G8SA 2FY8A 4M5GA 1N33J 3CCTA 2XMVA 4DR4F 3KK3A 1X4DA 4DU7A 4FZVA 1JX4A 2R7RA 4X4VA 1FRIA 3OXLA 1T9VA 3W62A 5A8RA 4UOHA 4G1PA 1WKLA 2ZBPA 2LMIA 3QJPA 3GZ7A 1HNZJ 2H5JB 2HHXA 1Q95G 3LANA 2FHJD 1V3RA 1WEYA 3PX0A 1K1SA 1N32F 1EAYC 2IJFA 2NLWA 1S6QB 3W9HA 1CEZA 2IAJB 1REVB 4OYXA 4LR9A 3MWBA 4LIRA 3RRKA 1TKTB 3C46A 3KLIA 3Q8QB 3D6MB 1SKSA 4Q5VA 2B5JB 4DV6J 1YG0A 3RZAA 5KFGA 4J37A 1VK8A 4HYKA 1N4LA 3SDEA 1Q8BA 1VBKA 3UPFA 2NSBA 3C66A 3S6EA 5L38A 2W9BB 5C2CA 3V2UC 3NLCA 1ULRA 2NZCA 3KK3B 3J7A1 3CVKA 3FEZA 3PV8A 4F8RA 1LXJA 2HHVA 4J5OA 1F6TA 1AXQA 1VBZA 1LW0A 1F5BA 4URSA 2WB1D 2KM8B 2H1YA 3HHEA 4B9UA 4ECUA 1NJWA 4FF3A 1LOUA 1FDAA 1J5OA 5B7WA 4L76A 2A10A 1WG4A 2UUAF 2VQFJ 1SV5A 2Z30B 2EK6A 5KG2A 5HVFA 2AJ1A 3RAXA 2WZ1A 1RTDB 3FGVA 4LF6F 4X4TA 3IBWA 3EICA 3KLIB 4IH6A 4LF1A 1FHTA 2BE9B 2QRRA 1UFWA 1WOPA 3VAJA 3AOBA 1RP5A 1UA0A 3KFWX 2DGTA 2FGCA 1HHQA 1NK6A 2FGOA 1D9AA 4LF8F 4EMDA 3MM5B 4XK8C 4WP8A 4RW9A 4CZCA 1XQIA 1XTZA 3GU0A 4WE1B 2ALYB 3MMAA 1U7LA 1QSLA 4DS5A 3A1YG 1SJ1A 3ZC4A 1UWBA 3M9OB 2IVMA 3QRRA 3V81A 2OO4A 3I5BA 4PABA 1DTQA 1WC4A 3J80U 1ZA1B 2GMJA 1HQEB 5ETPA 1WORA 1FJEB 1E6VA 1T7PA 1HWJA 5LSLA 1XNQF 1LW2A 1WD6A 1S1UB 5E3RA 1U1PA 3HSDA 3NXZA 3FEYB 2E1RA 5MAOA 2OMLA 1LFWA 2HNDA 3CJ5A 1IR1A 1Q4RA 3KUHA 3AQPA 4QPXA 3TZYA 1ZM3A 3EX7B 3BSNA 3SI8A 3KK1A 1B64A 4LSZB 4DSKA 2WSEC 3IR5B 3PJWA 3OTBA 3Q0AA 3HT0A 3DMJB 4I6YA 3K5MA 2KI2A 3LGMA 2WOMB 2LQBA 2H9ZA 4OX7A 2PEHA 1KLMB 3A4TA 4USUA 4A8FA 3X3UA 2H51B 4CLFA 4KTQA 4IO9Q 3HLUA 1UVMA 1V9OA 4XO0A 4CT9A 2DGWA 5J2QA 5ETRA 4AL7A 1FXLA 1PIEA 1PGZA 3BGLA 1UZHA 4RBUA 2NXJA 4ZP9A 2HHHJ 1YJWS 3VGSA 2QYGA 2B4OA 4QR0A 4DR7F 1R6YA 4GKKJ 1B0VA 2XMTA 3EVOA 3ISZA 3NAIA 5GAHI 4ED2A 4DEZA 2P5VA 4AXJA 5K20B 1C1CB 5KG6A 5IM0B 1H74A 4J9RA 5KFEA 4OX9J 1YZ6A 4CH1A 3HM9A 2J8AA 3CCRS 3BN4A 2VBZA 3TR5A 4RW8B 1X4AA 3EE3A 3DOKA 1GAOA 5D4PA 1RWNB 1Y4ZB 3RG6A 4IQXA 2V67A 2WW8A 4ECSA 3RW6A 2GQQA 5A2QY 1UPMB 4NI2A 2VODA 3BJYA 1SH2A 2ZKUA 2IJRA 3TQEA 3TVZA 1TZ0A 5IT9U 3BDEA 1RWWB 3R5DA 4QU7A 1P1LA 2LU1A 1RT1B 4O3NA 1BWEA 2B7BB 3TJ8A 3IMQJ 1TAQA 4Y2MA 4V19X 4TQSA 3NAHA 4YN3B 3EPGA 3GTYX 1C2PA 1H7XA 4K4YA 2VG7A 2HK2A 2WTFA 1MWQA 2G2ZA 3I96A 4PCQA 1TKZA 3MF5A 3LWLA 4ZS6A 3AXMA 3AH6A 1FJCA 1W26A 3MPVA 1ROFA 5M2UA 3NOGA 4OI1A 4ZVUB 4L74A 2R2TA 2F9DA 4NI2B 1H73A 2OEJA 4RNMA 5KOWA 4H54A 3RB0A 2BA9A 1LEOA 3Q89A 2AHOB 3HHKA 5L1IA 4LFBJ 3BGFA 3NGTA 2OPRA 4YB5A 4ECVA 1IN0A 2GJ2A 5JMNA 3EXCX 2I1RA 4KGKA 1A7GE 4M5NA 4RJVA 4DR5F 1PBUA 2VG7B 2KRRA 3DXBA 2XSFA 4YDXA 1YDLA 4DFMA 3DOMA 1T95A 3GJSB 1RE1B 3T5HA 4DQQA 4ZPWR 1N34J 1JLFA 2Y1RI 3A8IA 3DRRA 2HFNA 3I56S 3OR2B 2ASDA 3UI3A 2BE7D 1O8BA 1S5ZA 2RVJA 3OUYA 1HR0J 4C3LA 3ETOA 2LQ9A 4ANCA 1KQGB 2Z2YB 2HZCA 4FKYA 2FHKA 4DUYF 4DLEA 2C3UA 3QPIA 2ZZMA 2J9CA 3S8SA 1V6HA 1FJGF 4DS4A 1WTBA 4F3QA 2L41A 3H42A 3ZZTA 4AXIA 3ZTRA 2F4FA 3K59A 4N5SA 3R97A 4IG0A 2ROEA 4NMLA 2QT7A 3ILOA 3U7JA 2CZ4A 4JI0J 3GJTB 4CH0S 3DGPB 3J81U 2WBRA 2M70A 5AE2A 2X3GA 3N6MA 1YK9A 5F9LA 3EVMA 2RT3A 3Q22A 4OLPA 1FT8A 1SXLA 3PFEA 4OZ1A 1YRUA 5KG7A 1Y00A 4YQWA 5LXYA 2Q6BA 4I0WA 4NE9C 4ZVGA 2NZ4A 4CO4A 2OFGX 4MMOA 5F8IA 1AUDA 1JLFB 2UUTA 4U9RA 3DRRB 2WVEA 2RD5C 2ZVIA 4GVBA 4EYHB 1U1OA 2EC2A 3PVXA 2VU5A 3LP1A 1JIHA 2V8VA 1F9FA 1S4FA 4USTA 4B3SJ 2WBMA 1HQ2A 2D3OR 1FD8A 3R5JB 2HHUA 4I69A 1OY9A 3DXSX 3GYGA 2YY3A 4QWEA 2XMJA 1DARA 4HHHA 2YX1A 3DRYA 1AFJA 2UUCJ 3GV7B 4DG1A 3HHLA 1WHVA 2B9XA 3KHRA 3THVA 4X64F 3KMSA 2BQ3A 1NKEA 4A4JA 2VICA 5AE1A 4TNOA 4TY8A 1WACA 3WC0A 3U1NA 4DI6A 2R7OA 3QWUA 3I9V9 1WC0A 2BXJA 3M8WA 2H65B 5ETKA 2J9DA 5IQ6A 4A8QA 2C2EA 2OH2A 4K4TA 4C48A 3TA2A 3GFZA 3LW5C 3ET6B 4NLDA 2MKSA 2HHQA 4ZLPA 3N6NA 3OQ2A 3OSNA 4MYTA 1Y5LB 2XWYA 3VTIA 4EBCA 4Y0FA 4C4WA 4XPEA 3IBCB 3C3LA 5DGBA 3MMBA 4F02A 3OTOF 3L7OA 1YWXA 1S7IA 1BY9A 2ZE2B 4U8YA 3DU5A 1HW9A 4PXBA 4EI2A 5ETVA 2DHSA 4KKOA 2W2PP 3MR3A 1SQFA 4OHWA 5L9XA 2QL5B 4NXNJ 4WKYA 1KTQA 4LR7A 1ZA2B 3FRZA 2HS3A 1QTMA 3RR7A 1LV5A 2W9CA 1X4GA 2E5GA 5DM7Q 4Q2LA 3E01B 4R5PB 1NJZA 2WRMA 2OPPB 4I7FB 3MMCA 3JB9k 5HP1B 1VQMS 5K9FA 4O3QA 4LIWA 3TNVA 1GMWA 1UJ6A 1D1UA 5EN1A 4LBPA 2FC9A 2KXNB 3MMBB 4I2QA 2V2VA 3T3FA 2P9GA 2YVSA 3HSJA 4P2FA 4EZ9A 4WP3A 5A6WA 3C14B 4U6PA 4O3SA 3M4XA 2GX8A 3MEDA 4Y2KA 5ETQA 4NLPA 1UEUA 3CCMS 2C22A 4ETZA 1SJ4P 3CB4A 2EW9A 5KG5A 5HQMA 4F67A 1JLGA 4J9PA 3SCIE 5D4LA 4PPDA 5HI7A 3A8EA 5FIIA 3LGHA 4ERDA 3DLEA 3HPOA 4TY9A 3LUYA 3FMWA 1KC8T 3GIRA 4NASA 2C2DA 1WUUA 4KT0C 4DPUA 1M5PC 5K8OA 2FLNA 1T9XA 2G1DA 1P9YA 4FYWB 2QV6A 3HJVA 2I38A 2B9YA 3EZOA 4OFZA 2J6UA 1HBNB 1DZ5A 1N32J 2GIQA 4X65J 1UW4A 4NRTA 2NSCA 1RAIB 1VQ8S 2IJNA 2AT1B 4Q0BA 2Z4PA 2FPHX 3MEDB 3GFHA 1QVFR 5F0WA 3NY0A 3VCDA 3BPSP 4CTAA 2DXEA 4CH7A 1RAEB 1NRKA 4XDCA 2DCLA 2YNHB 3BQ1A 2HQDA 3DGVA 1AW0A 4NCGB 2QC3A 1RAOA 5LMUF 2AJ4A 2BJEA 2CPFA 1PSDA 3V6DB 3MR6A 4A46A 3QAEA 4DZ6A 5FJ4A 3DOLB 1Q78A 4F4WA 3K5PA 1LXNA 2EI5A 2E5LF 2RS8A 3L7PA 2OEMA 4B08A 1OYEA 4KHPF 4DX6A 3CDBA 4KYZA 2YPZA 4ICLA 1R0BG 3KOAA 4YS2A 2UUAJ 2UZAA 3ZNJ1 4ZN1A 1TL1B 4LF6J 2NUUG 3IS9B 2VG5A 4CLTA 3G82B 4IH7A 2R9LA 5AXLA 4DZDA 1KR4A 3TJAA 3VAIA 4NPOA 1XK8A 1U1MA 3W63A 5J2PB 3IGNA 2GMHA 5I3UB 1RT4A 1SUQB 1VISA 1UFLA 3HHLD 1NJXA 4DQSA 4LF8J 3F0NA 1DQAA 3BO4A 3FK4A 3VF0B 3HSGA 3SCKE 2HZAA 1R8CA 2QA1A 1EETB 3IWXA 3VAFA 4C8KA 2YXLA 5DM6Q 2J7WA 3IAM9 1HBMB 1QJHA 1UW9A 3KUEA 2VD3A 3SXLA 2VPXB 2G9OA 2DCUB 3SYZA 2DNNA 4O3PA 5FLXY 4K5SA 4IR1A 2HFVA 3N01A 2IY5B 2DT9A 1FWLA 1NSPA 2F8HA 2HLTA 4U7UK 2MQMA 4NZ6A 1VRTA 1SL0A 1NB2A 1QE1A 5C5JA 3PW4A 5D4NA 3M1VB 1UL3A 2LQ8A 2HQIA 5ADZA 3Q8VA 3BBFA 2WSFC 2PIIA 3ZZYA 4X84A 1Z4UA 5KT7A 2R8HA 2Q79A 1XNQJ 3M8YA 2VB6A 3GR0A 4WKRA 2PMWA 4QZVB 1T94A 2JEGA 4N76A 2V34A 3I55S 3H2LA 2XNQA 4KHRA 2OPQB 2HFUA 3MM7B 4IOCQ 4FXWA 1J27A 3UDLA 1U6ZA 1QAYA 3BGRB 1B7FA 1FO1A 3M8SA 2DGOA 3MGJA 2J7UA 3U02A 4RUBA 4WXOA 2PMZD 1EP4B 4KJIA 5CCLA 4QWAA 4PYAA 3MDFA 3FSIA 2YWHA 2FTRA 3RBXA 4Z7CA 1S72S 3TANA 1CQMA 3EYZA 4URGA 2BM1A 1GMWD 3CIMA 5J1EA 2HHWA 2CQIA 5IOLA 3EDRB 4P73A 4KQZA 3LP2A 4ID8A 2PSZA 1PYOB 2K1RA 4HTJA 2YH0A 2XLJA 3DLKB 4YP3A 3GFXA 4MKVA 1TUWA 2BE2A 2HK3A 5LXRA 3B78A 3QMQA 2XO6A 4ECWA 1NLKL 4K0KJ 2R8KA 1NK0A 3CD7A 1SL2A 4DR7J 1YGYA 4F26A 3BO2A 2WONB 2AWZA 2R7WA 2RAQA 3UNYA 4WYWA 2ZJPQ 4O23A 4M8LA 3O3LA 2W4CA 4I56A 3BQ2A 1NHKL 4WZQA 3VR1A 2COLA 2AGQA 1RTJA 2GGPA 4LFAF 4R8UB 2CFXA 1J5EF 3JTOA 4EO6A 4MKYA 1X9WA 1SC3B 4EEYA 3UCZP 1JLQB 2VKZG 1FX4A 3MR7A 3C16B 2W2OP 2BJ3A 2JX2A 4UZBA 2K1RB 5HBMA 4HDHA 4XIUA 2Y0BB 5A0YB 3MOJB 4HVZA 2BE2B 2VOOA 5KG3A 2VC0A 3V4MA 1VRUB 5B0EA 1R0AB 3H2VE 4F50A 2MDAA 3KG4A 3I87A 5C25A 3ILLA 3GONA 1UA1A 1HYSB 4C3KA 3MD1A 1CULA 1H2UX 4IRDA 1JLBA 2RRAA 2V9WA 2CQ0A 3CC4S 2F40A 3AJ1A 5D0RA 4L3KA 2P8IA 3PG9A 3CDUA 1DY3A 2DGVA 3CGIA 1MLAA 2EFPA 2A2DA 3P6YC 1CJTA 4OYPA 3DHXA 2H54B 1KD1T 2BX6A 3K2YA 4RPFA 3LGNA 4M5MA 3SSSA 1S1XB 4C7QA 2XQCA 5F9NA 2CADA 2RS2A 3GG0A 2D7SA 3PYGA 1V3ZA 4DL6A 4UY85 4PPZA 2Z2LA 1XMQF 4O0NA 2HRYA 1JMTA 1MN9A 2J9EA 4DR5J 3HVRA 1BE4A 3L9ZA 4KB7A 5L1LA 2GO8A 5DDQC 5DDOC 4OYBA 4BBYA 4D3GA 1FFGB 3TEHB 1SKWA 5T14A 1V5VA 1MSWD 3JQMA 4I2PA 3UFCX 4C2MA 1B7YB 1JJ4A 4DUYJ 3DM2A 3UO0A 1I94F 1QUPA 1FJGJ 3DRPA 1YX2A 5A2QU 3RTVA 3D1OA 3MMJA 3D3CJ 4X2BA 4Y3CA 2CJQA 2ABYA 1BC6A 3EGVA 2W1BA 3TUJC 3BPDA 2LQJA 3M05A 1FFSB 1EJ7L 1N36J 3TYTA 4RW6A 3OV7A 3DYAA 1NBEB 4ED5A 3A8JA 5LT5A 4PXDA 4LQ9A 3D4JA 1WNEA 3ITHB 2CPYA 2F4VJ 2QSFA 2IHR1 4X4PA 4OYOA 2Y8YA 3QLHA 1JB0C 4ETXA 4DPTA 3RRHA 3KLVA 4IG3A 2KH9A 2O67A 4RWWA 1TP7A 5AXKA 2M88A 2IVYA 4ECXA 1U45A 1PILA 3FJ2A 1UEKA 2IM2A 3HKZD 1TK8A 4RKUC 4NCBA 4FS2A 1HLWA 2O66A 3R1LA 2YKQA 4YUDA 4ZA1A 2XBPA 1QM9A 4QW8A 2BEFA 3M32B 3NEKA 2F7VA 3B6BA 4V1Ak 2C3PA 1FDBA 3Q83A 2AZ1A 3TX0A 4O3OA 2JEJA 2E7VA 2M5YA 4X64J 4DSFA 4A48A 4U95A 3QJLA 3I4PA 2XZDB 4CNZA 4O44B 4O4GA 3HZGA 4J90A 3QLHB 1S0OA 4IG3B 3P3DA 1HI1A 5F0UA 2W8LA 5K8PA 1GXLA 4CYUB 1Q86T 1KTVA 2DNPA 5KFPA 2GIFA 5KFMA 2RDDA 1RDRA 1B99A 4H4OB 1P9QC 3T6JA 3UD4P 3VALA 1TL3B 4DFKA 3UVJB 2OJ3A 5SUHA 1WKKA 2KM8C 1S6OA 4WFNQ 2AMCB 1U1RA 2BW7A 4LJMA 2RE1A 1BGXT 2DR5A 3OTOJ 2K7KA 4MK9A 1NB7A 2OSRA 3ILIA 3MEKA 1AA1B 4OLOA 1PYTA 1S0MA 2MQOA 4ED8A 3RW7A 1UZDA 5D4OA 2QLXA 3QGPA 4AL6A 1RT5B 1Q8KA 2P6TA 5L9NA 2QA2A 4U8VA 4V19J 3QT8A 4DV4J 2DHHA 2G0CA 3VGUA 2CQ1A 5K14A 5CYMA 1JLEA 1S57A 1BHNA 2C3YA 1BQXA 3L3CA 1Z2LA 4GO5X 3SMZA 1Q79A 4CM0A 1WF2A 4GVLA 4LF2A 2VHGA 4MIWA 2K3IA 2U2FA 1JNRB 4BDPA 3F44A 1HQUA 1SC1B 3DRSB 2ZNZA 3CCLS 4PEOA 4B3MF 3CCJS 4TVAB 1CS4A 3IFEA 5I4MA 2HRTA 4NLRA 1OMSA 4RW4B 3E8OA 1T9TA 1RTZA 1SQGA 5GMEA 1U49A 3CF5Q 4TYBA 4DV3J 3WC2A 3PNIA 3H8YA 2PGCA 4X66J 3EMTA 5DRKA 4RBTA 3D6HB 3HKWA 3BB5A 5FDLA 2E5IA 1S1TB 2B6AA 2XYPB 4OI6A 4F04B 4JI8F 2P2CB 4OZ0A 5A8KA 3GPAA 4ZPVR 5CYMB 1JLEB 3J80Y 1FKOB 2YPYA 2ZOFA 3RJMB 2FLPA 3NGSA 1RAJA 2RUSA 3AB4B 3TAMA 4B3RF 2QFIA 4YB1P 4L6V3 3W1YC 2IFXA 1YJVA 5KFVA 2YKMA 4IOBA 1LK5A 5JVHQ 4K4UA 1HNWJ 1TTHB 1HQUB 1QUVA 4Y65A 2NYIA 2HWHA 4XPCA 4B9LA 2MLXA 4M5DB 3JYTA 4JI5F 4ZJOA 4OQJA 5DO2A 1T9WA 1C0TB 3HO1A 1SI9A 3M30B 4K4ZA 3R9LA 4OYWA 1S6PA 1LWCA 4YOEA 1NO8A 1UJ4A 2CAJA 4RBVA 1KS2A 2LA4A 5CA5A 2BVZA 2KFNA 2FD2A 5FDLB 4MK7A 1RTHA 2DKOB 3GCXP 4NLQA 1UETA 1BQNB 5LSRA 1DJ0A 1TV6B 2B9EA 5BYQA 3ZZ0A 4F4AA 3OTCA 5LMUJ 2E9ZA 1EKSA 1X31C 3TAMB 4NLYA 5H9FK 4AQYF 2KZZA 1ZS6A 3SSRA 1SJFA 2HMIB 1IXKA 8RUCA 1KNZA 5KFXA 1RT2B 3KLHA 5G4DA 5L8RC 3W2VA 4KHPJ 1IWGA 4KPCA 1L3KA 4ZLNA 4PWDB 2XZTB 4KR0B 2I0XA 3PIOQ 1RBOB 4C8ZA 5LMNF 3TZXA 3ULHA 1U2CA 1X4EA 2HKEA 3OXFA 3MAAA 3NS6A 1RAHB 1RTHB 5KFWA 3LPYA 1ELOA 2IRUA 1MROB 2QO3A 4ZCKA 5IXUA 3HK2A 5KFHA 1XIQA 2FJDB 4K59A 1QAIA 1WF1A 4DMZA 4Q43A 2KN4A 1T02A 3CDEA 3FC9A 2OTJS 1HNVA 4DLGA 1O5JA 4QPTA 4KFBA 3OBIA 2UU9F 4RUCA 2Y0SD 3JS9A 4BWJA 2NUHA 2DVIA 1H98A 2RJZA 2EVZA 3L4BC 4P7TA 1NJIT 3G6ES 3MR2A 5CHCB 3T6BA 3TVKA 4FDFA 3PO5A 1FXRA 3KLFA 1KP6A 2L48A 4HHUA 1RXOB 5IT0A 2NXUA 4ZVHA 1GNKA 4JI6F 1XJWB 1JKHA 1UWAA 1WSVA 3GR1A 2IM1A 1Z2ZA 2VJUA 3Q23A 4J9MA 2QL9B 2ZC3A 4JV1A 3QBCA 4CO3A 2J0SD 4NLGA 1YLXA 4KE5A 3OL8A 4Q7AA 5C42B 4KC5A 1LWEB 2AJ0A 1SH3A 4OI4A 1HNVB 2FC8A 2ZH8A 1N5SA 2EEYA 2D41A 1MU2A 1Q0NA 1FD2A 1X4CA 4RNHA 5HVGA 3IR7B 1RTIB 3A8KA 2LXIA 1E6YB 4N47A 1Q5YA 1FDNA 3WQPA 4UY8T 4UOCA 4BS2A 2KXHA 3KLFB 3AJDA 4OYIA 3CCQS 5ITHA 4DOZA 3CMAS 3TP2A 2V5HG 2W9AA 5H9FJ 1GX6A 2M7SA 1VHIA 4ECYA 3HVTA 3CCES 1VK3A 1JKHB 4R0EA 5L1KA 4KGVB 1D9FA 5LL6d 1X5OA 5IFMA 3HCXA 1KFDA 4KO0B 1TELA 5KFFA 2OFHX 2HVHA 3NNAA 1R7IA 3RRGA 4J9UE 2CG8A 2DEIA 1ZTTA 1C0UA 5AJ3F 2KG0A 3NKYA 3RBDA 2OTLS 2MQLA 2BACA 2RILA 2RRNA 2LEAA 3MUTP 2OELA 4DL4A 2N4CA 2CJXB 2MLZA 4QIWD 1FVSA 1XR6A 2VPYB 4JV0A 1AYEA 1M5VC 4FYXB 5KOXA 4LBIA 3KJVA 3MR5A 5E5NA 3W5ZA 5FLXU 3KHLA 4AYBD 4NOHA 2CRLA 5E3AA 2M8DB 4LFAJ 5D78A 2RDIA 5BJRA 2FVSA 1Y3KA 1J5EJ 4NWBA 2D3O1 4YMEA 4P74A 2LA6A 4C8OA 3NS7B 2VG6B 3HVTB 1X5PA 3UR0A 2XGPA 1SJQA 2P9CA 2HBYB 5B0CA 2A2CA 4DCPB 2MQQA 3I0SA 4ZCMA 1VQ7S 3ISNC 1ZAWA 1RKJA 5KFJA 2NXEA 3IRXB 4YEAA 5DLFA 1F1BB 4K4XA 3NP5A 3QGHA 3UDEA 4Y34A 3PHEA 4MFBA 2NREA 1EZZB 1CC7A 2YNGA 1TKXA 3ZZOA 2GZOA 1ZM9A 4G1QA 2G2YA 2B4PA 2U1AA 3HMJG 1RISA 2D9OA 2UXBJ 2XSJB 1QDUB 5ETOA 1J2VA 4DL2A 2JJ4D 2KU7A 2YNFA 5C7PA 1RJJA 1UTAA 2XTJP 1DFDA 2O3DA 2JEFA 2M3DA 4DR6F 2OPSA 5GADI 4DV0F 4ELUA 5D3GA 2ZITA 1R8HA 4UUWA 2AQ4A 4HR2A 4C11B 2B8QA 2JZ5A 5LJ3Y 3W5YA 4JV2A 4LFCJ 4DSJA 4MFBB 2L9WA 5DJBA 3CJ4A 2VC1A 1S48A 4WF9Q 2ADCA 2CQ3A 2KT5A 4LR8A 2DNYA 3HFKA 1NZAA 1JLAA 2XEXA 4QIEA 1I3OB 5GAHU 3F56A 1M1HA 2CPZA 1XMQJ 4LSLB 1FRLA 4EBEA 2CQPA 1RBLA 1N5TA 1YRTA 1DBDA 2IC3B 1WOOA 2P6SA 1GMUA 4DPWA 4JOUA 4IO1A 4NA3A 2A18A 2CQCA 3IGVA 1F2HA 3FFIB 1RT3A 1T3NA 4I6WA 2E1AA 2AYEA 2HBRB 3A3NB 2A6OA 2LP4A 5CZXA 4C98A 4Y28C 4TLRA 1U47A 3IC1A 4X62F 1NNDA 2OUGA 2LEPA 2NXCA 1BXNA 4AUKA 2VZ9A 2NQPA 3V6KA 1L5UA 2HNZA 5KFBA 3KUGA 5DS7A 4PYDA 2AX0A 2QA4G 3OL6A 2MZQA 4IH5A 1ZZNA 2DO4A 3PW5A 1F0XA 5I42A 3D5MA 4HL9A 5C24B 2C28A 3RR8A 4A8YA 4P71A 2CQ2A 1Y11A 1R27B 2R3VA 2XHWA 4LUBA 2B4UA 3FQKA 2MHEA 2Y1IA 2RQMA 1VJQA 2C2ZB 2MJNA 1CG2A 4P2XA 5HQLA 3KMQA 3EVWA 2R7UA 4QBUA 1F3VA 3MFIA 3G6XA 2V2QA 1ZPVA 2VPZB 5FD1A 2H48B 2ZH1A 3BREA 5AE3A 1GTEA 1RU1A 1K47A 3MZIA 4PKDB 2MYFA 2O01C 1S9FA 3CIZA 1KSPA 2R42A 2E29A 4FPIA 3R6LB 1T03A 2CXEA 2ILZA 2UV8A 4PR6A 2QG9B 1IKVA 1LFPA 1SKUB 2FJWA 1RKIA 2D3ZA 3QJJA 2VL1A 4CLUA 5J2NB 3H98A 3CD6S 4F4YA 5I42B 4C97A 1SIZA 2HFZA 5D6GA 5KFTA 3ENAA 1S1VA 1S49A 1IKXB 4N41A 2L08A 1WEXA 1S79A 2E66A 4DL5A 1KRPA 4CWBA 3KJFB 4LT6A 5KTQA 4HLBA 1RHUB 2LDYA 2UXDJ 1BWVA 2IIHA 1DQ8A 3DLGA 2FZGB 2XULA 3Q86A 2X1BA 3MEEB 4IDKA 1C4AA 2V8HA 2FVQA 3OVBA 3AOCA 1T03B 3FCWA 5G0RB 3CO0P 1N48A 5EGYA 3M2UB 2DH8A 5D0GA 1IBCB 4X4NA 4M5LA 5HMXA 2KKHA 2Z56B 2JFDA 3D68A 4DWIA 5E3PA 1F9HA 2FY1A 2QEXS 1F9EB 5A8WB 3JSMA 3KLEB 3WDOA 2CUYA 2C2MB 2ASYA 5I3QA 3CDAA 3RGIA 2BW2A 4H4MB 1X0PA 3G8TA 4ECRA 4ZHRB 1YKWA 1KQSR 1B3TA 1RUSA 1VDHA 5E3QA 1RHKB 1VQOS 1S6QA 4ENOA 3G8QA 2IAJA 1REVA 3CCVS 1JJHA 4OX8A 5CD4A 4W90B 2RU9A 3NRBA 1HI8A 1TKTA 1DLOA 2ZH2A 1N8RT 4PQUB 3QWPA 2XMWA 2HQCA 1ICEB 2HQFA 1LWXA 1RZMA 1U8WA 3OLAA 3IO1A 2RDJA 5AT1B 5D0HA 5B0AA 2B5JA 3OXGA 4IDKB 3G96A 4KAIA 2BRKA 3D0HE 5KFZA 4CCHA 4UW2A 2P9EA 2R8GA 3HP6A 3HZEA 4KV8B 1HBUA 1L3TA 2W9BA 1X5TA 2LFVA 1ZPWX 2AP6A 4RUAA 3Q8RB 2QYCA 2ROGA 5ETMA 2EBEA 3JSMB 2V94A 3QGIA 1U0SA 4OMFG 2E7WA 5HL7Q 1S97A 2EPIA 1RT7A 4DN9A 3MXHP 5DETA 2ZKTA 3LOUA 2KHCA 2CA9A 4FXVA 5KAKA 4JI4F 3PY8A 5D77A 4PWWA 1YRXA 4JI8J 3PW7A 3M6UA 1RTDA 4NA1A 4DHVA 2BV3A 1DLOB 1Y3JA 4J9KA 1PYSB 3H2UB 4ZVEA 3T1YF 4B3RJ 1VQ5S 3HJFA 3RU0A 4P52A 5EWEA 2ZUAA 1Y9OA 1XMOF 4Z7YA 3J7YU 1U1KA 1RWMB 2HWTA 5DGAA 1HBUB 5THWA 2HVIA 5CAAA 1S6UA 4PG6A 3MM5A 4WFAQ 4ZPDA 3T9NA 4FYDA 1ACMB 2Q6CA 3BYPA 1IQZA 3GILA 2VA3A 4JI5J 1RHQB 4BHQA 4FPRA 4Y2CA 2VKRA 3CTRA 1WDDA 3NMAA 4WE1A 1C1BB 4MK8A 1CBKA 2K7JA 3BDPA 4DV2F 1YVFA 1RT7B 3M6VA 4L3NA 1AUSL 2Z57B 3GMGA 1CVJA 2HRUA 1NXIA 2D74B 4YDDB 4HH0A 1N5YB 1MN7A 1N0UA 1H7WA 1HHTP 3GQCA 1AZSB 1CJKA 1D8ZA 3JSBA 1NUEA 1N33F 3MPWA 1HQEA 1PAEX 3BV8A 2PA3A 4P9SA 1SKRA 2DRDA 3R7BB 2DH7A 4AQYJ 1W25A 3MAHA 2CVEA 5T41A 3OJUA 1S59A 3H59A 2FVPA 2BJDA 2KB2A 4C8YA 1S1UA 2H5IB 3N28A 3O44A 1XERA 3CJTA 2CNLB 3PCOB 3D6FB 3RAMA 4CLZA 2MKHA 2FB0A 5A76A 2JC0A 3ZXWA 1RACB 3LALA 2JOQA 1AFIA 3J7AN 1T3OA 3NS5A 2X7IA 3AXKA 4YR3A 4IFYB 3FCHA 2V8PA 2DGXA 4USWA 1VLYA 5LMNJ 2BQUA 1YQHA 4YR0A 2LCWA 3PRBA 2Q43A 3J81j 1IKWB 3R6GB 1NSKL 2W25A 3DMJA 3OD2A 2L3MA 2AYGA 3EGZA 1CSJA 4DV6F 2IYGA 4AL5A 4F36A 2WOMA 3RAQA 4CLWA 4N7TA 1QVGR 1KLMA 1PKUA 2I5JB 2IDLA 1CJKB 3CCZA 2XMKA 2BJ7A 2ZBIA 3BM7A 3HDSA 3EDQB 1XWLA 3AOAA 2GQ2A 4WYLA 1RYSA 2UUBF 4ZJLA 2R8IA 4NEZA 1FK9B 3DCAA 2UU9J 2DHAA 5HMZA 1RLCL 4E8UA 2OAUA 2YKAA 4DUTA 3PO4A 2FUG9 1TL7A 3MPUB 2VFTA 3MM9A 3FZ2A 2GVDA 2ZJQQ 1RAFB 4F4XA 1YIJS 3TEGA 1RWXB 2V0NA 1G7CB 2X51A 5F8GA 2DR8A 1BQMA 1C1CA 3PR5B 5IM0A 4ZN3A 3I0RB 2XHCA 3NNCA 3KG1A 1FRHA 2HG4A 2XM3A 4ZVRB 4A8SA 1VQYA 3RYLA 2EBGA 2KT2A 5KT5A 4TXSA 1HL6A 1RA6A 1FTCA 1H3DA 4RW8A 4EZ6A 3PHTA 4AT1B 1SQEA 1YBUA 1OYDA 1WDTA 3U1MA 4AE5A 2FLOA 4USVA 2KFZA 4HTIA 4PZVA 9ATCB 3PJ9A 2MGZB 3W3SA 5CQGA 2SXLA 3GWCA 2MY8A 5JVGQ 3LAKA 4RW7B 3BSCA 1NPRA 4WP9A 3K58A 4DCOB 4WPAA 4K7QA 1TL7B 4DR2F 1R6VA 3MM9B 4AD6A 1RK8A 2XY5A 4DR1F 1RT1A 4IKAA 2GVDB 2H3EB 5CABA 4FVCA 5KFCA 4OJ1A 4NLSA 2WHOA 2JRSA 1BQMB 1IR2A 3N4WA 1I6JA 2F65A 2GVZB 3DRXA 1RT6B 1FNOA 2FJXA 3QT6A 1UVKA 3E3XA 4F4KA 1S1WB 5DQGA 4ID5A 2XI3A 2CQGA 1FE0A 2RHSB 2MQNA 4P2SA 1L3VA 5AJ3J 3DNCA 2HPUA 1ZETA 2LKZA 4DPXA 2V8GA 1FXDA 1X4HA 2IPOB 2OD6A 1R89A 2DHXA 4ED1A 2FJVA 3B54A 1O0PA 2E1CA 1Q82T 1YZ7A 2FJAB 4N56A 2JLEA 1IKYB 1TVRB 4PG8A 1PO6A 1O6XA 5EWFA 6FD1A 2QJ3A 2FVCA 2V9KA 1HMVB 2UVUA 3CMES 2RRBA 5H1SV 4B9MA 4HH1A 1QSSA 3MEGA 3M9NB 3AD7C 2LXUA 4QR1A 3I32A 3CC2S 4O3RA 2R7VA 4QWCA 1WSRA 2CPXA 3OR2A 4I6AA 4Y2IA 2MKKA 4ID5B 2FZCB 4JI7J 3KLGB 4GC6A 3HD1A 2GIRA 3QRPA 4NL5A 1KVIA 5KFUA 4LVOP 4LF9F 2YQ0A 2DGSA 2JWNA 4U7UD 5EX3A 4DR3F 4DL3A 2CDRB 3W2WA 2VBXA 1K73T 2DNLA 5JXSA 1SJ3P 4DSLA 2WVCA 3W5XA 3RUBL 3DGPA 4ILMA 1FA0A 1JQGA 4OYAA 1JXLA 4OYZA 2GHWA 3JQKA 2ZDOA 4DV0J 4F7VA 3W61A 3RB4A 5KG1A 1JXVA 4ZKAA 4DUZJ 3MEGB 2PC6A 3N79A 1VLOA 3CULA 2C42A 1EQ0A 3ZZZA 1Q5VA 4K50A 3MECB 4LF4J 2DBBA 2B3TB 3MCNA 1RB0A 1F3FA 2MKJA 1NKBA 3UD3P 4HDGA 3CD0A 2QFJA 5E3CA 2DNRA 1TMJA 5J1NA 1PJ5A 4FBUA 3D67A 3K89A 1NSQA 3HULA 4UQGA 3EGWB 2KRBA 3SSQA 3PW2A 3ETMA 5GAGI 3W2WB 1VQNS 1VQSA 4K2JA 1TMMA 3AY0A 2JLFA 2W2QP 1HWKA 2ROPA 1NDPA 3VVUA 4ZMMA 3I31A 2HNYB 4LREA 3H7HB 1WF0A 1GEHA 2ACMA 1S9EB 1UAWA 1UVIA 2DO0A 3R5CA 1JWWA 2WSCC 2OGUA 5BR8J 4ZIVA 3KG0A 4YHHF 4B9SA 3K8WA 3D9BA 2BR0A 1EQMA 3ET6A 4Q8EA 1XNRJ 1NK5A 4JI1J 2KYZA 4DV5F 4LFBF 5B09A 2JLGA 2VFUA 1VRQC 2GO9A 2H4WB 2AV5A 1Y0HA 1G6BA 3Q8SB 2DEJA 1ZM4A 2QN6B 2RH3A 4MKBA 1YJRA 2IRXA 2MZTA 5HAOA 3POTB 4DV7J 4OJHA 1L3SA 3C15B 4CP5A 2ZE2A 3DU6A 4USMA 1N34F 3QRQA 1U8SA 3ADAC 3BBBA 4ZDNA 1RAGB 2V8DA 3TUIC 2GW8A 3OFEA 1P8GA 3R7NB 3US5A 4HKQA 4C9DA 1ZM2A 2CIMA 1U1NA 1SIWB 2HGLA 4KGZB 2HQ3A 1PAUB 1VGYA 3HHLC 4OV6A 3KJNB 3NBPB 3QYYA 1X4FA 2ZZNA 3E01A 4R5PA 2L9DA 1YBTA 2OPPA 4I7FA 3TZZA 4BCAA 5HP1A 4JI0F 2PDAA 2M52A 3DI6B 2EFGA 5HVHA 3H25A 3TJ9A 4F0MA 1RSCA 1SC4B 3J7YI 3D6TB 4P7VA 2C3OA 2E7XA 1RU2A 5F8LA 2CPHA 3A13A 5KFSA 1KOHA 3T1HF 4RO0A 3QO9A 1S7HA 4WTYA 4S0MA 3DLLQ 7FD1A 3C14A 1FKPA 2KJWA 1UMJA 1HD0A 3BH6B 2NR0A 2R2UA 1PC5A 1S10A 2YX4A 1WHWA 2Y1JA 1LKZA 2N3OA 4FYVB 4IRKA 1HBOB 5U47A 2Q66A 1N5QA 1P27B 3P5TL 5AXNA 1EIYB 4LVNP 4DU8A 1FESA 3D28A 1XMBA 2N82B 2KO1A 4LBHA 2ZHBA 2KVIA 2FZKB 3IWNC 2JL9A 3MM8B 2UUCF 4ANDA 4UUXA 2CWKA 4BC7A 3JTPA 3M2VB 4OHYA 3G6YA 4QW9A 4ECQA 1HW8A 2XS2A 3TRGA 2KFYA 1RWOB 1SJRA 4CM2A 1HBNA 3IG1B 3QIPB 3QO9B 4F3OA 2ZH6A 4KRWA 2ASLA 1FKPB 3U27A 1LK7A 3MM6B 3NGUA 4I64A 2XNRA 1A9NB 3MCOA 3R2CJ 3J7Z5 3KTQA 1F5CA 1XC9A 1GFWB 3H20A 4ILLA 5KFDA 1N52B 2YNHA 4ED7A 4ES3A 4NCGA 2BMBA 3HHDA 3SFGA 4DR4J 3D2WA 4O4RA 4J9QA 2ZH7A 3V6DA 3DOLA 5ETSA 4ZIWA 3M8QB 5CYQB 2C2RA 1T05A 1OQ6A 1W2IA 5ETNA 2MJUA 2DNGA 4DPYA 1CJVB 4A47A 4CNYA 1VBYA 2PFFB 4NXNF 4JI4J 2B0GA 1ZYQA 2GNKA 1TUVA 4J9OA 2LEBA 1TL1A 1Y5NB 4ZPCA 5L39A 3IS9A 2W8KA 3G82A 2M0GB 1CJUB 4KSEB 3T1YJ 4MTPA 4GO7X 1D09B 4KY3A 3AD8C 5J2PA 1HNIA 1KHVA 1KVJA 3WZ0A 5DDRC 2ADBA 4LQ3A 5I3UA 1SUQA 2EKNA 3FEXB 2YWWA 5KFAA 4UOFA 3O2IA 3BO3A 5KFQA 3IM8A 2B56A 1EETA 2MZJA 3X1LB 3ILJA 3LQVA 1URRA 4PQAA 4M1KA 2E5JA 4B9TA 1QAJA 3N0VA 3QZ7A 1HBMA 4DQIA 1T05B 4DV2J 1NJYA 3ONQA 3HHNB 4P2MA 2E9RX 2EK1A 2XCPA 4ECTA 3W65A 3LWMA 4WTOB 3G6VA 5KG0A 4PUOB 1S9GB 2EC0A 5KFKA 4NX9A 4C6AA 1N56A 3C8YA 1RI7A 3UDCA 3M1VA 1KWMA 2YKPA 4QWDA 1U4BA 3L95X 4ITSA 1HNIB 2ZWOA 1R8BA 3BZQA 4UTGA 1OWXA 3OR1A 4I67A 3M8PA 1ZOTA 3K5NA 3VV2B 1RHMB 2GHPA 4O0IA 2PMHA 3Q8UA 3QZ8A 1JLCB 2OPQA 4X65F 5F8JA 3W9JA 4YY3F 3MM7A 1QY7A 2DISA 2UVRA 2DYAA 3OTDA 1N6QB 1B70B 3BGRA 1TQLA 2Y9HA 1JXEA 2V6AA 5J1PA 2R7SA 3NGKA 3GSDA 1S0VA 2VIHA 1IQTA 2GFFA 2J6SA 1EP4A 5K8MA 1FRXA 1O51A 2H4YB 4WWSA 4N77A 3D1HA 4NLVA 1FRKA 3Q8YA 3KDOA 1U1QA 1NMEB 3VAKA 2W24A 2XCAA 3THTA 3DLBA 3IM9A 5A8RB 3W8PA 2UUBJ 2VA2A 3FRYA 3DLKA 3BN7A 3OR1B 3H40A 3OFHA 3R5AA 3M8PB 5HN0A 4HT5A 5IC4B 1D0EA 2RQCA 3CPWR 4F2SA 1FRJA 1IBLF 1VC5A 2YWFA 2MB0B 2WONA 3CSKA 1IUJA 4L73A 4X4UA 1F5AA 1KQKA 3SFUA 1NPPA 1VIOA 2YBVA 2CJAA 4KH0B 2MSTA 4J9NA 3AJ2A 4D3HA 4ZP6A 4B9VA 3SDEB 3CJKA 1I1GA 3AQOA 4R8UA 3UQSA 2UUWA 4EYIB 3OTEA 4DF8A 3W9IA 1M5HA 4MIBA 4DQRA 2XLIA 2J0WA 1JLQA 2PI4A 4DX8H 2F8MA 4MT1A 4QCLA 1LW0B 3C16A 2KDOA 1NKCA 2WVBA 1PJ7A 3NWRA 1H2VZ 5A0YA 3TOQA 2CZVC 1U02A 5EX0A 1J5OB 1WKJA 4DR2J 1VBXA 3OL7A 4DR1J 1VRUA 1R0AA 5KFIA 1SV5B 3UCUP 5DG7A 3DN9A 1ITPA 2RHQB 2Q1LA 2QLJB 2DPJA 1HYSA 1RBAA 1RAAB 2I9SA 1ZAVA 2HGMA 2HW3A 4EUVA 3FBEA 6AT1B 4P72A 5J2MA 3CJKB 4TLQA 2WVFA 4C8NA 1R3NA 2CQDA 1K9MT 2DK2A 2VF3A 4GKJF 2CKWA 2LLZA 2K8GA 1K8AT 1PCAA 4ZPTR 2HS4A 1GK8A 3P8BB 4RW9B 2CNNB 3DFEA 2MLYA 2VBYA 2N3LA 1VC0A 1S1XA 1ZAXA 1FI4A 3C6TA 2XLKA 3MMAB 1OPZA 2JC1A 1TFWA 2HQGA 1W7WA 1EKRA 1UWBB 1SC6A 4RZRA 2NPIA 3V81B 1DTQB 3IR6B 4QOTA 1YTYA 4LF5F 5E33A 1SBRA 2CJBA 2CPDA 4YB7A 4DFJA 1E6VB 5KG4A 5J2MB 3PW0A 1LW2B 1L3UA 3SIPB 4YR2A 2AYMA 2VPWB 5HJXA 3TX8A 2R7QA 4W98A 5F41A 2HNDB 3EZ5A 4K0KF 3EWGA 4CIOA 3Q2SC 4TQRA 5DDPC 1CC8A 4LF9J 4QJVA 4HI1A 3RBEA 4DR3J 3KK1B 2J0XA 2CPJA 3C6TB 4UZCA 1EX8A 3MCSA 3MPYA 3M7VA 1REGX 2ATLA 3CJQA 2GQCA 3SZ2A 1NU4A 2M4MA 4WK1A 2JVRA 4JI3F 1APSA 2DD8S 3OHAA 6FDRA 3ITHA 4KHMA 4WFZA 5HANA 2KJVA 4ZOSA 4ES2A 2X3DA 4USIA 5L1JA 3N5BA 4Q2MA 3D1QA 4NLWA 3UDVA 2YTCA 2HYIB 4ZVPB 2RKIA 5J2QB 2UXCF 1VQPS 1N0VC 4FF1A 3VGTA 2XY7A 4IRCA 2DRAA 2MSSA 4DX5A 3TUPA 5F3ZA 1NSAA 1NDLA 3GE9A 1YJ7A 4J91A 1BUXA 1X5SA 4DL0C 1DURA 5HSPA 4PRFA 2BOAA 2BKOA 2O5DA 4B3TF 2KXFA 2HVDA 3EM1A 4J9VA 1U2FA 1KBRA 4NZ7A 3PZPA 3M32A 3NCPA 2A0FB 4PWUA 3ZZPA 4DV1F 3IN5A 3CJ2A 2RNEA 3LTOA 4FS1A 4ZCIA 4ZJQA 5B0FA 2DGUA 3PFOA 5IC6B 3BKTA 3DOKB 4O44A 1JK9B 4IYQA 5E7OB 2C2KB 3AFGA 1MMLA 4YHHJ 1K44A 4DSIA 3NG8A 3GIMA 1YI2S 3ZTPA 4CYUA 2RKIB 3J7ZT 4ZVTB 3R1HA 3TZWA 2FDNA 3FUYA 3BBCA 2ZHOA 4CQ1A 4H4OA 4QQBA 4TN2A 4CLKA 4DV5J 1TL3A 1VOMA 4CLLA 4LSNA 3OT9A 3TI0A 3BSOA 3UVJA 5RUBA 1MWYA 1T9YA 2NCKL 3UW1A 4F0KA 1KFSA 1XEZA 1RQ0A 1IBKF 5HROA 2EFQA 2X1GA 1RHJB 2RQ4A 3KHGA 1TKZB 2EKYA 1M1KT 2ZJRQ 1WG1A 4G1IA 1IBMF 2DPIA 4ZP7A 3C19A 3BKUA 2YKOA 4BWMA 5GADU 3F73A 5DG9A 1BD6A 2NYHA 1U6FA 3TAPA 5LSOA 1RT5A 3M9MB 2OD4A 2W2NP 1Q53A 2XY6A 1K1QA 4QIVA 5KT4A 3ZTOA 1H0HB 2AD9A 4PG7A 1WC5A 1P1TA 3DLHA 3GJQB 2Y3YA 5JUMA 1N88A 2L9NA 1N36F 1TK5A 1RLDA 4DL7A 1KQFB 4LSNB 2OPRB 2DXFA 4K4WA 4L75A 2QLWA 3R8YA 2Z58B 1VC6A 3GV8B 4WCEQ 4QIGA 3DRSA 3GIIA 2F4VF 5HROB 1X60A 3T1HJ 2Z2ZA 3DOMB 2IBOA 2B4VA 1KKHA 5F3TA 4RW4A 2UVWA 2CWXA 2VQEF 3BGUA 1OY8A 2QMWA 4TU8A 2JDJA 3D54A 3OUYB 1S1TA 2A3JA 5HK4A 2AJFE 2OEKA 3R3TA 1D3WA 3PTWA 2W7PA 3U1LA 3CJ8A 4J7CA 1NK7A 2LYVA 2JEIA 5H9EK 2J6TA 1FKOA 1S99A 1G4CA 1NK9A 5DG8A 4IG0B 1WELA 2F5GA 3M6WA 1Z1ZA 3OPKA 1S76D 1GQEA 2EFOA 3M8RA 2B51A 2CVIA 1QAXA 1WC6A 3W7BA 3FBCA 4C0OC 3PR4A 4HI2A 4MH8A 2OSQA 2WK4A 3NMRA 1IVZA 1WWHA 3B82A 3PKMA 4M5DA 5HLFA 4NLTA 1C0TA 4J9LA 4A8KA 3PXGa 3M30A 4DSEA 4UF4A 2YWKA 3AODA 4Q45A 2B7CB 3I5CA 2ZZTA 4JI2F 4GVBB 5KFRA 1OPIA 1KHWA 5DZ7A 1BQNA 4LF7F 3LP1B 2LU2A 1TV6A 1A6LA 3T5KA 3R2DJ 4ANEA 3AA9A 2QMXA 3HF5A 1XR5A 2QZ8A 3JXOA 2W4DA 4A8MP 1JJ2R 2FVRA 2QTWA 3KHHA 2CJYB 1U26A 3CWJA 3OJSA 3D66A 4DG1B 3HHLB 4DFPA 4RU9A 2N7YA 2HMIA 3WIUA 1RT2A 1EHWA 3DC2A 3PACA 2C3MA 3P49B 3D0GE 4WZMA 4PWDA 4TY8B 2ZDPA 3HD2A 3HVWA 3L09A 5HLFB 3K5OA 2QLFB 4DV4F 1RADB 1M1GA 3AHPA 3DLJA 3UNGC 1Q8LA 1R8PA 1X4BA 1XR7A 4CDIA 3FDSA 1U6BA 1R43A 1UKUA 4LRAA 1CQNA 4OIXA 1MWZA 2B8PA 3C6UA 1WJ9A 1FERA 3FBFA 1MROA 4ECZA 3GG1A 3F41A 1Q7LB 4W4MA 3WX8A 2Z2MA 1X9SA 3OSPA 3FQLA 4FYYB 1NDCA 2VV5A 2NS1B 4TKTA 2MZRA 4K5RA 3I5AA 5DLGA 4CLSA 2E5LJ 1I51B 4K4VA 4DV3F 3O6QA 4X66F 4KKOB 2R2SA 2MZSA 4OHXA 2AJQA 2PI5A 1TKDA 2K2PA 2BBEA 1WG5A 2FHOB 2J76E 5H9EJ 2HVZA 2MXYA 2ZH3A 4M5IA 1UPPA 3RBZA 2W9CB 4LMZA 2HSEB 3B4DA 3TARA 1VJWA 2BUNA 4QYZK 3MPDA 1H72C 3MMCB 2VASA 3C6UB 2IBKA 1OS5A 1T11A 2V4QA 4RLEA 1HNWF 4M5HA 2VDIA 5C42A 3VWSA 4DPOA 2ZWPA 3UN3A 1Y10A 3G9CA 3EPIA 2BANA 1MG7A 4Y6IA 1VQLS 4DQPA 1DAXA 4I2QB 1P6TA 1LWEA 2LVWA 2ACYA 4YY3J 1FRMA 2OI2A 3KNAA 3EUNA 4KPYA 2DGQA 4JV5F 2BJ1A 4ED4A 2FJBB 2WAQD 1RTIA 3JSYA 1VMBA 5GVQA 1E6YA 4A8WA 2N7CA 2ZM6F 2KVQE 4NLXA 3PIPQ 4ZITA 5EUHA 1RA7A 1JLGB 3CUNA 3QSYB 1R0CB 1TL4A 4EO8A 1T8EA 3DLEB 2PFDA 3E2EA 4UQTA 2DNMA 3NCRA 3Q2TC 3I6PA 3UE2A 1NK4A 4KO0A 1FKAF 4BLGA 3M6XA 1UCNA 2DB1A 2F1FA 4FVMA 3HFVA 2EWHA 3H0PA 2W2MP 3CEDA 3FVYA 2BANB 1LNQA 1NDKA 3QQCD 3IXQA 3MURP 4Y00A 1IBLJ 3CW2C 5IV3A 3BH7B 4Q0BB 3FSXA 2VFRA 4DXLA 3MAQA 1G3OA 1R31A 2DNOA 2DNKA 4JYAF 2IVFB 4A8XA 9RUBA 3H4DA 4WJBA 5HMYA 1KONA 3LPEA 2D3UA 2MQPA 4CTAB 2OIHA 1UVNA 2MHNA 3WHIA 2EFNA 3GP9A 2G1HA 4NLOA 2MKIA 4X4SA 2A1BA 3EZUA 2V69A 2X1FA 2VG6A 4E0DA 1UFKA 2MEWA 5MLCV 2XI2A 5E2QA 1KLNA 4NXMF 3OVSA 3JAMY 3IRXA 1B0TA 1C4CA 2DRBA 1OSCA 4FF2A 1Q1KA 3R5BA 2GJFA 2OHDA 3D3BJ 3MTJA 4ICLB 1RWVB 2F3JA 4R0JA 3NOCA 4QYZJ 5L46A 3SCJE 4RX6A 2X1AA 1NEEA 2MMYA 2J5AA 3CMQA 2ZNYA 3JSRA 2VG5B 2XSJA 4F25A 1WEZA 3QSIA 5IZHA 3R7SB 2BJ8A 2HWIA 5B08A 1HWIA 1SL1A 3VZHA 4FF4A 3KYLA 3BF4A 2IM0A 3IWLA 3C2PA 1RT4B 1RWPB 2I8EA 3AT1B 2V68A 4GKJJ 2K3KA 3CJSA 3AB2B 1FDDA 2WCXA 3H5YA 1KVKA 2ZBCA 3IAS9 2VUGA 3N9UC 5ETTA 4C11A 1H38A 1VCTA 3MTKA 2YQ3A 3SQGA 2VONA 1FNXH 1XBWA 3Q24A 3M2RA 4FNIA 3FZBA 2KTQA 2DHGA 4NLUA 1K0TA 2YWEA 3MD3A 2DR9A 2DTJA 3K57A 4LSLA 2IC3A 1VRTB 1QE1B 4NRUA 2UVVA 4LF5J 2IRYA 1YSJA 2BDPA 1IJEB 2AJ2A 3ZTQA 1UJ5A 3S7RA 3FFIA 4WK3A 2LDIA 4OV1A 4H4KC 3BSAA 3K7RA 4ZPAA 1HFEL 3N6LA 4NMXA 2IA6A 4G3IA 3MUVP 4OHVA 2EG2A 5B0GA 1YITS 4WBFA 5B0DA 5KFNA 1OQ3A 4CO0A 1S77D 4MAKA 1M5OC 2BOPA 5K8NA 4YFUA 1FTRA 3CJ0A 3SCLE 3SQGB 2HBQB 3O1LA 1VIXA 4JB8B 3QFWA 2ZHAA 5C24A 3M2RB 1N54B 2PD1A 4ZPBA 3BGOP 1HPZA 1RCXB 1F2GA 2ZOMA 4JI3J 3EXYA 5CXTA 1V5IB 2CZ9A 2HIQA 2KYXA 2AGPA 2BZ2A 5J1EB 2FQQB 2AYBA 2GV1A 3JTNA 2RU3A 1OSDA 5F8MA 5D0EA 3LP2B 2CPIA 3FSYA 1HA1A 2UXCJ 1NAQA 2GCFA 1TK0A 1A0OB 5IQQA 1UVLA 2R7TA 2ZD1A 1I94J 3MCMA 2DR7A 4P75A 3A3OB 1VQ6S 5J2NA 2AF6A 1HARA 1FWKA 4B3TJ 2ZUGA 2XC9A 2UXBF 1RCOB 2EXUA 1GXUA 4FXDA 3O8WA 1QTNB 3CE8A 4WU2A 5HMWA 3IRWP 3VVTA 4DV1J 3OL9A 4OHZA 4RL1A 4ED0A 5KT6A 1HPZB 2XYGB 2FIUA 1IKXA 1RTJB 1EARA 1RABB 5IWAF 2GGPB 3GSIA 3TO8A 1Q81T 5HJYA 2AEFA 2Q3PA 2IA0A
chains in the Genus database with same CATH topology
4KTQA 4IO9Q 5BYRA 3SSRA 4ECQA 1MNEA 1SJFA 3HLUA 1HW8A 3AAWB 2HMIB 2XS2A 1IXKA 3TRGA 1UVMA 2KFYA 1KNZA 1V9OA 1RT2B 1SJRA 5KFXA 3KLHA 5G4DA 1ZTWA 1YJUA 5L8RC 3W2VA 4XO0A 4CT9A 3S01A 2DGWA 5J2QA 1HBNA 3ENWA 3IG1B 4AL7A 1FXLA 3QIPB 4P6QA 3QO9B 4F3OA 1PGZA 4XAKA 3BGLA 2ZH6A 1L3KA 4KRWA 4RBUA 4PWDB 4ZP9A 2ASLA 1YJWS 1FKPB 3U27A 1LK7A 2WB4A 1S0NA 5HBMB 4KR0B 2I0XA 4LFCF 3MM6B 2B4OA 3MEEA 4I64A 5K5MA 3PIOQ 4CO5A 2XNRA 5B0BA 1VQ4S 3AA8A 1A9NB 4C8ZA 5LMNF 4QR0A 3ULHA 1X4EA 5M2RA 2ZH4A 3LF0A 4DR7F 3J7Z5 3KTQA 4TU9A 3OXFA 1R6YA 5G0RA 1B0VA 2XMTA 1FVQA 3ISZA 3NAIA 5GAHI 1F5CA 1XC9A 4ED2A 2ZD1B 3NS6A 4DEZA 2P5VA 3H20A 3M2UA 4AXJA 1C1CB 2APOA 1BLUA 2VFSA 5KG6A 5IM0B 4ILLA 5KFDA 1N52B 1RTHB 2YNHA 5KFWA 4J9RA 3LPYA 4ED7A 4ES3A 1ELOA 5C25B 3I82A 2IRUA 4NCGA 1MROB 2QO3A 4ZCKA 7FDRA 5IXUA 4CO2A 5KFHA 5KFEA 3HK2A 2E5HA 2PE8A 3RB6A 3HHDA 3ENVA 4E98A 3SFGA 4OI2A 2FJDB 1HWUA 4K59A 1QAIA 3D2WA 3B4MA 4O4RA 5A8WA 1DTTA 4CH1A 4EU0A 1JLBB 4J9QA 3KLEA 3HM9A 2ZH7A 3V6DA 1WF1A 4DMZA 3DOLA 2J8AA 3CCRS 1HWLA 3BN4A 2IMWP 2VBZA 3TR5A 3VAMA 4H4MA 4RW8B 3UWTA 4Q43A 2KN4A 1X4AA 3DOKA 1T02A 1GAOA 3M8QB 2YX7A 4ED3A 5CYQB 3CDEA 5D4PA 4ZHRA 1Y4ZB 2OTJS 4IQXA 1HNVA 4DLGA 2C2RA 1T05A 1O5JA 1OQ6A 4QPTA 2WW8A 2VOPA 1W2IA 2MJUA 4KFBA 2CYYA 4ECSA 1NH7A 2DNGA 3OBIA 3RW6A 2UU9F 4RUCA 2GQQA 2Y0SD 5A2QY 1KN6A 5T7LA 4BWJA 2VODA 2NUHA 4A47A 4CNYA 2DVIA 3BJYA 1SH2A 1HNXF 1WHXA 1VBYA 1H98A 2ZKUA 3V5RA 2RJZA 2PFFB 4NXNF 2H5EA 5HQ8A 2EVZA 2B0GA 4P7TA 2D9PA 2GNKA 1ZYQA 1TUVA 3TVZA 1NJIT 1TZ0A 4J9OA 3BDEA 2LEBA 3G6ES 3MR2A 1TL1A 3QIDA 4PQUA 1Y5NB 3R5DA 4QU7A 4MJKA 4ZPCA 5CHCB 3T6BA 3TVKA 3PO5A 5L39A 1P1LA 1FXRA 2LU1A 1RT1B 3IS9A 2W8KA 2DNHA 4O3NA 3KLFA 3CT9A 2L48A 1BWEA 2B7BB 1TAQA 2M0GB 5IT0A 2NXUA 4ZVHA 1B0PA 4Y2MA 4V19X 4TQSA 4EBDA 4KSEB 3NAHA 4MTPA 4GO7X 3EPGA 1GNKA 1C2PA 1H7XA 4K4YA 2VG7A 5J2PA 1HNI