4I2QB

Crystal structure of k103n/y181c mutant of hiv-1 reverse transcriptase in complex with rilpivirine (tmc278) analogue
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
424
structure length
416
Chain Sequence
IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A comparison of the ability of rilpivirine (TMC278) and selected analogues to inhibit clinically relevant HIV-1 reverse transcriptase mutants.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Hydrolase, transferase/inhibitor
molecule keywords Gag-Pol polyprotein
total genus 112
structure length 416
sequence length 424
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4i2qB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4i2qB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4i2qB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4i2qB03
2AWZA 4NLOA 1VRTB 4H54A 4H4MB 1JLAB 1S1WB 5L1LA 2HNZA 1YVFA 5KFFA 2HNYB 4K4YA 1IKWB 1FKPB 1RT6B 3BREA 1S1VA 2I5JA 4MIBA 3RBEA 1WNEA 4NCGB 4NLYA 3GIJA 4PUOB 5C25A 1S6QB 3DLGA 2QV6A 3BSAA 3H2LA 3IGVA 3Q8RB 5KT3A 2ZD1B 4IRCA 1JLGB 3KHLA 2RF2B 3H5UA 2HNDA 4KFBB 1RT1B 3G6XA 5C42A 2W7PA 2IC3A 2R2UA 1SH2A 4OL8A 3T19A 2XWYA 4O3OA 1HNVB 4ECZA 3KK3A 3CWJA 3ITHB 1TL3A 2AU0A 5KFIA 2BE2B 4Y3CA 3MR3A 1HYSB 1HPZA 2AQ4A 4WE1A 4WYWA 3LP2A 4DL6A 5DG7A 1ZTWA 2HAIA 4QW8A 5J2QB 1SUQB 2OPSB 1RT2A 4K4XA 5KT5A 4WFZA 4RW6B 4ID5B 3MEDB 4M94A 4YP3A 4EYHB 3PW0A 3LP1B 4R0EA 1JLQB 3PW7A 2W7OA 2YNFA 5HLFA 1J5OA 1BQMA 4ECXA 2GIRA 3CDEA 3MTKA 4MKBA 3KHGA 1TQLA 3QGHA 1RT2B 4NLUA 1I6JA 1RTJA 4ZP6A 4URGA 4IFYB 1ZETA 2JLEA 1DLOB 4ZVGA 3QIDA 3FFIA 4QW9A 3BQ2A 1HNIA 3KLGA 2FVQA 2OH2A 1C2PA 4ZHRA 5DG8A 1MU2A 1IKYB 3QIPA 5EWGA 3RB6A 1VRUA 4B3OB 4O3PA 3DI6B 3PR4A 4LSLB 5J2MB 3KHRA 1S6QA 1HNVA 3DLGB 1LW2B 2RDJA 2AGOA 5DG9A 2BRKA 3I5CA 2IM3A 1IKXA 2IAJB 1DLOA 2CJQA 3DRRA 3UQSA 4Q44A 1RT1A 2BQUA 5JXSA 4MFBA 2ATLA 3H5XA 4ECWA 2ZD1A 5KFKA 4U7CA 2YKNA 4EO6A 2VG5B 3QLHB 2IM0A 4YR2A 4ZPDA 4NCGA 1FKOA 2I5JB 1IKXB 5CYQA 3T5KA 2V4RA 1N56A 3DRSA 1RAJA 2WB4A 1N48A 5KFHA 2DPJA 2F8EX 4PQUA 4TY8A 2W8LA 5FDLA 5HP1B 3G6YA 3DI6A 4TQSA 1HARA 4MFBB 2VA2A 1S9EA 1QE1A 2FJVA 5L1KA 4K4WA 4RW9A 1HNIB 5J1EB 3RAQA 4ECQA 1DTTB 3D28A 2FJWA 2IAJA 3KK3B 2I1RA 3M9NB 1TL1B 1TKXB 4IRDA 4U6PA 4RNNA 5KT2A 1S1XB 3E51A 5KFZA 1S1TA 5DGAA 3V6HA 5EDWA 3DLKA 3LP0A 3QO9B 4ECUA 1T05B 3IRXA 1T3NA 1RYSA 2DPIA 5T14A 2IM2A 4RW6A 1N5YB 4I2QB 4RNMA 4Y34A 2V9WA 3E01B 3TAMA 1XR5A 5D3GB 3DYAA 4IH5A 3MR2A 4IH7A 1N5YA 2OPQB 4WE1B 4Q0BA 3CVKA 3PVXA 5HROA 1JKHA 1LWCB 4H4MA 5F9LA 5KFJA 3QO9A 4FS2A 4KSEB 1JXLA 1TP7A 3ITHA 2ASJA 3NAIA 4H4OA 1KLMB 3IGNA 4Q43A 2AGQA 1T94A 4LQ3A 1S0NA 1HQEB 1REVB 4RUAA 3MFIA 2EC0A 3DDKA 5J1EA 3OHBA 1S9EB 3CO9A 1LW2A 4KBIA 3H5YA 3UR0A 2W9CB 4R8UA 2JC0A 4DL3A 1QAJA 5C25B 3FQLA 3HHKA 3KLGB 3V4IA 3HVAA 2R8IA 1EETB 1HMVB 3KLFB 2R2RA 2BQ3A 2OPPA 5CYQB 2HMIB 1GX6A 3MF5A 3SFGA 5KFOA 1IKWA 1FKPA 5F8HA 1RTJB 1XR6A 5DLGA 3GILA 4J9PA 4F4ZA 4RU9A 2FLNA 1LW0A 1VRTA 3CDUA 3FDSA 2C2EA 1LWEA 4J9NA 3PJXA 3PR5B 5HROB 4NZ0A 4DL2A 3KLIB 4ECVA 2WK4A 5KFGA 3BQ1A 4J9RA 4IR9A 3CJ0A 5KFBA 5KFXA 2XGPA 2J6TA 3RB0A 4K4ZA 4Y2AA 2W8KA 3OHAA 3IG1A 1T05A 5KG7A 3KLEB 2BE2A 3T5LA 1TKTA 4RW8A 4ED7A 4ZMMA 3DRPB 4WYLA 1BQNA 2WONA 2D3ZA 2WOMA 2V4QA 1D0EA 4ZPCA 3T5HA 3RAXA 5KFAA 5KFCA 4TLRA 4GC7A 4IG3A 4QWEA 3FSIA 3KK1B 2D41A 4Q8FA 3CDWA 3NBPA 3JSMA 4RZRA 3MFHA 4I2PB 4FBTA 2GIQA 4QWCA 5HP1A 1FK9A 4ICLB 4ZPAA 3KLVA 2JC1A 1RT7A 1UWBB 5J2QA 2AX1A 1JLEB 3GIKA 2YNGA 2JEFA 1JLBB 1QAIA 2HWIA 3EPIA 4JV1A 1RT7B 1UWBA 1HYSA 4X2BA 4O3NA 2ASDA 3M8QB 1JLAA 1S1WA 1RTDB 2ZE2B 2W9BA 1TVRB 3C6TB 4I2PA 1T03B 1TL3B 3JYTA 4J9KA 4J9OA 5KFTA 4IFVB 5I3UA 1RTIA 3C6UB 1N6QB 2WRMA 4TYBA 5EWFA 2AGPA 1RT4B 4Q45A 1S1UA 4KO0A 3I5BA 4ZP8A 3IS9A 3DRPA 3BR9A 1JLGA 3BSCA 1GX5A 4LSLA 2ILZA 1DTTA 4RW8B 1S0OA 2J6UA 3FQKA 4NLRA 3N6NA 4ECTA 3MEEA 2R8KA 5KFLA 4J9LA 3SFUA 4IKAA 2XGQA 3FFIB 1S0MA 2UVWA 1C1CA 5CYMB 3V6DB 4ZPBA 4O4RA 4URQU 3QYYA 4MKAA 4RNFA 3OSNA 4G1QB 4MK9A 3Q8QB 3TQ1A 2YKMA 1JLCA 4K4UA 1C0TB 1S9FA 2UVRA 4NLXA 2YKNB 1CSJA 4O3QA 4IOBA 2WTFA 2YKMB 1JIHA 3KNAA 3QGGA 1LW0B 3CIZA 4KKOA 2YNIB 3KMSA 4DL7A 2UUWA 5KG6A 1RA6A 2W9AA 2R8GA 4NLDA 5EWEA 2VG7B 3MEEB 3KLHB 1RT5A 3M8PA 3FRZA 4I7FB 4KAIA 5KFEA 1IM4A 1Z4UA 1S1TB 1RDRA 4IG3B 1TKXA 1TKZB 4EBCA 3GIMA 3V6JA 2V0NA 1SH3A 3D5MA 3I0SA 3BGRB 3OL9A 5I3UB 1N6QA 2QE5A 4K50A 5KT6A 1KLMA 3LANA 1HQUA 2IMWP 4MK7A 1T03A 3DMJA 4RW4A 2FJXA 4IDKB 5DLFA 2UVUA 1RT5B 3LP1A 1R0AA 3NKYA 4Y2CA 4MH8A 3KOAA 3NMAA 5C5JA 2OPQA 1JLBA 1RTHA 4Q0BB 3PJWA 2UVVA 2WCXA 4YMEA 3LAMA 1KHWA 3V6DA 5KFRA 3V6KA 4WZMA 3I0RA 4HKQA 4ED6A 5KFPA 3DMJB 4RW4B 4MIAA 5KG3A 3DLEB 1LWEB 3TVKA 4ZVFA 3ICLA 3DOKA 4TQRA 3VQSA 5KFYA 4J9QA 5KFDA 5F8LA 2FLPA 4IG0A 3C6UA 4EEYA 1VRUB 4B3OA 4RW9B 4MK8A 4ZHRB 2RF2A 2OPRB 3IG1B 4DG1A 3JYTB 3EPGA 2IBKA 3OL6A 5KFQA 4ED2A 3H4DA 3BSOA 2RDIA 4JV0A 1TV6B 4LSNA 4ZP9A 4TXSA 4TY9A 3PW4A 4ZP7A 1RT4A 2D7SA 3MEGA 4R5PA 3NL0A 4FBUA 1DTQB 3KK2A 1N4LA 1XR7A 3DOLB 2E9TA 3UDLA 1DTQA 2BANB 3KK2B 5F8NA 1NHVA 5C24A 5DQGA 4IRKA 2OPPB 2HMIA 4NLQA 4ECSA 3RB3A 3V4IB 3NAHA 3TAMB 4KHRA 5J2NA 3V81A 3LALA 2BRLA 2WHOA 1LWFB 4I2QA 2VG6B 2B6AA 2RKIA 4NRTA 4I7FA 2XI3A 3M9OB 3H40A 4WFXA 3NBPB 3JSMB 3LAKA 3HVTA 1MU2B 1OS5A 1JLFA 4QWAA 4KV8B 4XPCA 2BQRA 3KJVB 2IC3B 4O3RA 1RTIB 2GC8A 3KJVA 1S1XA 2XCPA 2J6SA 4K4SA 4KKOB 4F4WA 3DOKB 1BQMB 4HYKA 3NGDA 2R8HA 1RTDA 4YR0A 1LWFA 2VG6A 4RW7B 4IH6A 4JUZA 2ASLA 3MEGB 4KE5A 4NLGA 3MECB 5L9XA 5KFVA 3KMQA 2C2RA 5D3GA 1RT3B 5DQHA 3QZ7A 3BJYA 4ZVHA 3DOLA 4ED0A 3H4BA 1IKVB 4NRUA 4EBDA 2VG5A 3QLHA 4RW7A 3DM2B 1C0TA 4XPEA 3CJ2A 3DLKB 3LP0B 4KHMA 5KG0A 4G1QA 1U09A 4PWDB 4EYIB 4NLSA 1C1BB 2YNHA 2E9ZA 4IR1A 3IN5A 1S1UB 3SI8A 3BGRA 4PWDA 1REVA 4LQ9A 5EUHA 5DGBA 1S6PA 4O44B 2UUTA 5KT7A 3GV5B 2IA6A 3G86A 4F4XA 1NNDA 1JX4A 4DL5A 2FVPA 4KV8A 2JEIA 1S97A 4Q8EA 1EP4A 2JEJA 1IKVA 1RA7A 3PHEA 4KB7A 3HKWA 4R8UB 2ZE2A 3I0RB 2B6AB 2RKIB 5FDLB 3H5SA 5JUMA 4PUOA 3MR6A 1SV5B 4F4YA 1S4FA 5KG2A 1JLEA 2FVRA 1FKOB 3H98A 2ALZA 2CKWA 1R0AB 3UPFA 4YR3A 2BANA 3M9MB 3T5JA 1S9GB 1FK9B 4IDKA 1SH0A 2W9BB 3RB4A 2B5JA 4NLVA 1JLQA 4RNHA 5J2PB 4WXWA 1K1QA 4QWDA 4R5PB 3OLAA 2R8JA 1ZTTA 1MMLA 2AX0A 3DRRB 4O3SA 1S10A 2FVCA 2XI2A 1TKZA 2C2DA 3ISNC 1BQNB 2WONB 5KFNA 1TV6A 4LSNB 1JLFB 2R2SA 4WXOA 4ICLA 5DQIA 1C1CB 4F50A 4FS1A 3PW5A 3LP2B 2JEGA 4K4VA 3CJ4A 2BR0A 3M8PB 1HPZB 2OPRA 1IKYA 3QIPB 1QE1B 4DG1B 4NLPA 1C0UB 5HBMA 3PZPA 5F8MA 4ZVEA 5K14A 3H59A 3I0SB 5KG1A 4IG0B 3Q8PB 1HQEA 5KFWA 1RYRA 3GIIA 3IS9B 5C24B 4NLTA 4ED3A 5I42A 2YNIA 4EBEA 1K1SA 3GYNA 4IFVA 3I5AA 5J2PA 3GV7B 3T1AA 3C6TA 5F8IA 3OSPA 1S9GA 3PW2A 1RT3A 3ISND 3OL7A 4K4TA 1NHUA 1RT6A 4TYAA 3MECA 4URSA 5KFSA 1EETA 5KG5A 3BSNA 4J9MA 3IRXB 3QZ8A 3QGIA 2C22A 2ILYA 4DL4A 3KK1A 1HQUB 5KFMA 3BQ0A 2XC9A 4O44A 1S6PB 1S48A 5L1JA 3RBDA 5F8GA 4IFYA 4EO8A 1HMVA 3KLFA 2WOMB 3OLBA 4WZQA 3DLEA 3OL8A 1C0UA 5HBMB 4XO0A 4ECRA 2YNFB 5HLFB 1J5OB 1TKTB 3DM2A 3KHHA 3M8QA 5KFUA 2VG7A 5J2NB 3V81B 4DEZA 2ZKUA 4KO0B 3CJ3A 4WFYA 3DRSB 4ID5A 4QWBA 4GC6A 2IM1A 2VA3A 1RTHB 1W25A 4JV2A 3MR5A 4G3IA 3DYAB 2HNYA 1SUQA 2OPSA 3E01A 4NLWA 1QUVA 2O5DA 2D3UA 1TVRA 3HVWA 4ED8A 1JKHB 1LWCA 4M95A 1S49A 4RNOA 2IJNA 4RUCA 3GQCA 3G6VA 1KHVA 3MEDA 2FVSA 2B43A 3GV8B 4ED1A 2YNGB 4O4GB 5F8JA 1SV5A 5I42B 2HWHA 5F9NA 5CYMA 5J2MA 1D1UA 5K14B 2HNDB 4KFBA 3N6LA 1EP4B 4TN2A 4ECYA 3KLEA 3KLHA 4NYZA 2IJFA 3HVTB 4QPXA 2FLLA 2E9RX 2XCAA 3Q8SB 4YQWA 2W9CA 4J9SA 5KG4A 4PQUB 3EZUA 4TY8B 1TL1A 1C1BA 2YNHB 2C28A 4O4GA 1S1VB 5C42B 3KLIA 5KT4A 3N6MA 3CJ5A 4H4OB 2R2TA 5L1IA 2HNZB 2B5JB 4IQXA 1JLCB
chains in the Genus database with same CATH superfamily
2VC1A 2EXUA 1VRTB 2QX0A 1JLAB 1S1WB 3A1YG 2HNZA 4M5LA 4ES3A 1NPPA 2CQIA 1OIAA 4DN9A 7AT1B 2H4WB 4B9LA 5C2GA 3KG1A 2DH9A 4M5JA 3TZXA 1H38A 3CD6S 3SDEA 3R6GB 4DR6F 1U1PA 4NLYA 4RU2A 2V94A 3EXYA 5C25A 1K44A 1YGYA 1S6QB 5HK4A 3BSAA 4DV4J 4P6QA 3AODA 3EVMA 3VGVA 2VODA 4NXNF 2HQFA 4YHHF 3I87A 2MKHA 2W2MP 3G6XA 4HT5A 2CDQA 2W7PA 3ZTQA 4OYAA 3WDOA 1WKJA 2M7SA 3RBXA 2ZM6J 2B3TB 1WC6A 3I6PA 5DO2A 3CWJA 3ITHB 1TL3A 2XMTA 2F5GA 3DHWC 3DHXA 3R97A 3N28A 5IT9U 4WK3A 3TX0A 1JK9B 3MR3A 1VQ5S 5KAKA 2Z8QA 2HQCA 1HYSB 3MM5B 9RUBA 1ZH5A 2AQ4A 2ZBPA 4WE1A 2EBEA 3LP2A 4DL6A 1ZTWA 5IT0A 2UUCF 1WF0A 4K4XA 1IR0A 2X51A 2PGCA 2V69A 3KJFB 4WFZA 5F0WA 2UXDF 1DBDA 2JFKA 1P6TA 4M94A 3R27A 1DQ8A 1WDTA 1AUDA 4LVNP 1Y3KA 1WHVA 2VFRA 4R0EA 3ZNUA 3FKBA 4X4OA 4DV3F 3PXGa 4EGLA 2MKIA 5A6PA 1BQMA 4DX8H 2ZVIA 3KHGA 4JI7J 1I6JA 3BN7A 3CCTA 2AJ4A 3MZIA 3CEDA 1NDLA 3BQ2A 3DGVA 2CQ3A 2IFXA 1C2PA 2PEBA 2OH2A 1MU2A 3RB6A 2Z0GA 1N88A 2EKNA 3EE3A 5IC4B 3L9ZA 3R6LB 1FD2A 5J2MB 1S6QA 4K5RA 1LW2B 2BOAA 5J1PA 2O3DA 2DR9A 2BRKA 3I5CA 2C3YA 1A6LA 4OHYA 1RWKB 3LW5C 2HHWA 4X4RA 2DD8S 4P9SA 2PI4A 3C2PA 3DFEA 1NM2A 3VF0B 3VHQA 1U25A 2VBWA 3JB9k 5KFKA 5K5MA 3L7PA 1VC6A 2VG5B 1CJTA 4CNZA 4X4UA 3TO8A 1FKOA 2KVQE 2EPIA 4PPZA 4ATNA 3D68A 1NCLA 4AQYJ 5CYQA 2MZTA 1XMQJ 1RAJA 4DL0C 2VJUA 2F8EX 1PAUB 2MJUA 1G7CB 2EK6A 3HMJG 3PX6A 3G6YA 4TQSA 2C2EA 4BDPA 4F2RA 2HRTA 1M5HA 3QBCA 4OI6A 1S9EA 4B3SJ 3PRBA 4JV5J 4RW9A 2DJWA 2VBZA 4ECQA 2FJWA 3MM9B 1CBKA 5AE2A 4JV5F 1F9EB 2IY5B 1KKHA 4DR7J 2YWHA 3MWBA 5K20B 5DGAA 2DH8A 1JJHA 3MCMA 1FE4A 4P52A 1GK8A 4UW2A 3QO9B 4ECUA 1PC4A 2P2CB 2FJAB 1FXRA 4YY3J 1T05B 5K8OA 5ITHA 1TK8A 3N4WA 1FRLA 4ZVQB 3BH6B 1Q81T 2NREA 1KOHA 2DR7A 1CPZA 4RW6A 4RNMA 4I6AA 3F73A 2NSBA 2V8GA 2DCLA 2O66A 3LF0A 2ZHBA 2X1BA 3PEHA 2ZKTA 4IH5A 4IH7A 4LRFA 3CCUS 4PG6A 1IBKJ 4GKJJ 3QSYB 4P2SA 4S0MA 1T9XA 4KH0B 2R7TA 1SIWB 2JVRA 5F9LA 3JXOA 3ILLA 1KTQA 2GMJA 2BJ9A 2GAHC 2R3VA 3OXLA 4GO5X 1KQFB 4H4OA 1GMVA 1KR4A 2BYCA 4Q43A 1FWLA 4P75A 1HQEB 2Z2LA 2ZWOA 4RUAA 1SKWA 3DDKA 3NMRA 1S5ZA 3GPAA 4X64J 4KBIA 3GR0A 3S6EA 3A8JA 3M6WA 2W9CB 2QMXA 2GIFA 2MQ8A 4L73A 5FIIA 2VQEF 5HN0A 4DL3A 3PO4A 4JI7F 3LGMA 5C2CA 1M1HA 3OQ2A 1M90T 1H7WA 3HVAA 2H5JB 3V4IA 3K8VA 3POTA 1EETB 3KLFB 3H7HB 5D0EA 2D3O1 1RKJA 3C8YA 3MF5A 4B3TJ 1PIEA 1N33J 1FKPA 1HD0A 1HWKA 3D7SB 1XR6A 3GILA 3J80Y 2Z57B 4OLOA 1YWXA 3O5TB 4QYZK 1HHQA 2FLNA 2BACA 2IVMA 3OFHA 2BJEA 2CA9A 4USKA 1XIQA 2V8VA 3IA0A 1VS3A 1LWEA 3JTNA 1N0UA 4OX8A 3W65A 3CMAS 3PJXA 1WDDA 4TNOA 2BE9B 4J9NA 4HDGA 4ECVA 5KFGA 3BQ1A 1TL7B 1XMOF 3A3OB 1KQGB 3CJ0A 5ETVA 4AXIA 1BC6A 1T9YA 1UEKA 5ETPA 4C6AA 4K2XA 4UZBA 3RB0A 2PMZD 3M8ZA 4PG7A 2BVZA 3OHAA 2A6OA 4IQMA 1R8BA 3U1LA 4A48A 4UQGA 4RW8A 2Y0SD 4KR0B 2ALYB 2O67A 2WSEC 4ZMMA 4N5SA 4IUFA 2OGUA 2RHSB 1RHQB 3M30B 4L75A 2YWKA 1D0EA 4L3NA 2G2YA 4ZPCA 1CG2A 1R89A 2G9OA 1RBOB 2CPJA 2H5IB 1RB0A 2KRBA 2RAQA 5KFCA 3CXCR 1IVZA 1RWUA 3FSIA 5LMUJ 2ZH1A 1FFGB 2C3OA 4YN3B 3AB2B 4DN0A 5HMXA 2J7WA 1DJ0A 1XBWA 3PFEA 5HMWA 4ZDNA 2JC1A 5E3QA 5J2QA 1GNKA 2AX1A 3I82A 4U95A 4NXMF 3W8GA 3J81U 2M3DA 3M8SA 1D9AA 1VQPS 2QIFA 1CJTB 3HF5A 5SZTA 4A4JA 2D9PA 1JLAA 1S1WA 2KU7A 5E2QA 2ZE2B 4ED5A 1TVRB 4ZLNA 3JYTA 2CNOB 1WOPA 4ZVUB 1T9VA 2W24A 4NCAA 4YB6A 1FHTA 3KG4A 1FERA 4IFVB 3OVBA 1N6QB 1EX8A 2FY8A 4OI0A 1IJEB 2E5LF 4WF9Q 1R43A 2DBBA 1BHNA 1GTHA 2H65B 3BGLA 3BYRA 3ZZUA 2J5AA 2OSQA 1DZ5A 1HLWA 1TUGB 2ILZA 1X5OA 3B6BA 1S0OA 4RW8B 5ETSA 2VKRA 3BS9A 3N6NA 1UJ4A 2PO4A 4GKKF 3MEEA 1XQIA 1WOSA 1Q95G 3ZO7A 4E2FB 4IKAA 4F25A 2ZOGA 4UOFA 1RAOA 1YSJA 2KXHA 2P5VA 1C1CA 4OJ3A 3UWTA 1S0MA 2I2YA 4ZPBA 4O4RA 3IO1A 4URQU 3QYYA 1U6BA 4RNFA 3TOQA 4F0HA 3I4HX 2GJFA 3GMGA 3TQ1A 2PFFB 4K4UA 3IMQJ 2UXCF 3CCMS 3EGWB 3FMWA 1FRIA 2QRRA 1CSJA 2MGZB 2M0GB 3AQOA 2YKMB 2WTFA 3KNAA 1WOOA 5M2PA 3QGGA 2MB0B 2KT5A 3F0NA 3DGPA 4DUYJ 1IN0A 1HR0F 4Q8EA 3KWMA 2HQGA 2AW0A 1H74A 1BMQB 2UUWA 2CPFA 1JWWA 1Q82T 1MN9A 2KI2A 2ROGA 1RAGB 3MMBA 5IM0B 5EWEA 4TVAB 2KG0A 1TFYA 2R9LA 2VG7B 3MEEB 4Y2IA 4D3HA 4WWSA 3A8KA 3NEKA 5B0DA 5KFEA 1NKBA 4F4AA 1Z4UA 3MPUB 1NK9A 2V4JB 1KVIA 4JI1F 1WELA 4USVA 2OIHA 1V3ZA 3GIMA 1KFSA 4JI1J 2HG4A 1SH3A 2XY7A 1N6QA 1MWQA 2QE5A 3RW7A 5JMNA 5KT6A 2V34A 1NKCA 3WC2A 4FPRA 5HI7A 1HQUA 1T03A 3DMJA 4RW4A 2HAFA 2M9KA 1CC8A 3UR3C 2E1CA 4IDKB 5DLFA 2UVUA 1RT5B 1XEZA 1Z2ZA 3LP1A 3A8IA 4AE5A 4Y2CA 4MH8A 3G4SS 3NMAA 1XNQF 5IWAF 1U45A 4X65J 2WCXA 4LF8F 1NAQA 2N3LA 3EMTA 3LTOA 4C11B 1A9NB 1OQ3A 3JQMA 2KJVA 2ACYA 1N34J 3I0RA 2DIUA 2FHJD 1HBUB 4DCPB 5B0GA 1NJZA 1Q8LA 3KUGA 3C19A 2HQIA 4V19X 1RWNB 2A10A 1N32F 2CRLA 4ZK7M 3CD7A 2LQBA 3K89A 5CCMA 3OT9A 2XYGB 5KFDA 5F8LA 4IG0A 3C6UA 4B3OA 4RW9B 2Y1JA 4GO7X 4ZHRB 2WW8A 1YDLA 4WU3A 4DG1A 8RUCA 2IBKA 4NEYA 1RBAA 4JV0A 1M5KC 4LSNA 4U8VA 2A2DA 2XGQA 3KDNA 4YEAA 1WC3A 2D69A 1RT4A 3R7BB 4LBHA 4ZP7A 3AB4B 3MM6A 1RAIB 1FCAA 2CQBA 2Z56B 1RCXB 2NUHA 4FBUA 3KK2A 1OO0B 3TAPA 4DZ6A 1NDCA 3FGVA 5LJ3Y 2E7WA 3S7RA 3DOLB 5IQQA 4OZLA 4B02A 2WSCC 3KKFA 1NHVA 5C24A 3MM8B 2AHOB 4WP3A 2QL5B 5B0EA 5CHCB 2IIHA 3NAHA 4WBFA 4KHRA 1F6TA 2F4VF 4CNYA 4OZ1A 3IRWP 1YK9A 3D1OA 3M9OB 2DXFA 1S7IA 3CCVS 3NBPB 3JSMB 3AQPA 1MU2B 4OYPA 3H25A 3L7OA 4HACA 4EK2A 2BE7D 1S6UA 3M4XA 4CDIA 1TAUA 2C2OB 4FYXB 2IC3B 4M5HA 2LCWA 2Y1LB 2DNMA 2B56A 3KJVA 1CS4A 3ILJA 2CJBA 3OTDA 3Q83A 2XCPA 1U1NA 2J6SA 3BH7B 3M6XA 2CQCA 2ZOMA 3NGDA 2IMOA 1VQSA 4Y28C 2R8HA 2VG6A 1YJ7A 3R7NB 1V5VA 3EZOA 4KE5A 4X4QA 2EWHA 1R7IA 2YBVA 3MMJA 5DETA 2F40A 3MPDA 3HDSA 5D3GA 2C2RA 4O0NA 1NK7A 4P7TA 2CZ4A 5DQHA 4CYUB 3K5LA 3BKUA 3L95X 3DOLA 4M5MA 4UF4A 5LL6d 4IYQA 4NRUA 3RGIA 5CZVA 4EBDA 3ET6B 1QVFR 4RW7A 4UOCA 1VIOA 2R7QA 3AOCA 4XPEA 1O8BA 1Q5VA 4N41A 1YZ6A 2VBXA 4EYIB 2HWTA 5U47A 2N4DA 5KT7A 2UUTA 5GAEI 3MR7A 4CT8A 1L3UA 2E5LJ 2VQEJ 2B9YA 2JEIA 2FGOA 2ACMA 4XDDA 1RHRB 6FDRA 2GX8A 2OSRA 4CQ1A 1U26A 2ZE2A 4XAKA 5FDLB 1FDDA 1DHMA 2B4UA 2XLJA 1G1XA 3W2VB 3PJ9A 1X5TA 1VLOA 1FFSB 3HJVA 4N47A 3G96A 2VFVA 1E6YB 2NS1B 1VQ9S 3M9MB 2GMHA 1S9GB 4IDKA 2AYEA 3MMCA 1ZOTA 1RABB 2MDAA 2B5JA 2FIUA 1JLQA 4GKJF 1U7LA 5J2PB 1K1QA 4OHWA 4QWDA 2UUAJ 1KVKA 3FMBA 1MMLA 2OUGA 5H9EJ 3DRRB 2HBRB 4WPAA 4LR9A 1O0PA 1TKZA 8ATCB 4B9VA 1VYAA 2JVOA 4L3KA 4A8XA 2P9GA 3MAAB 4X84A 5DDQC 5DQIA 5KFNA 3J81j 2DR5A 4UZCA 3CJ4A 3B54A 3M8PB 1TZ0A 4LREA 1QE1B 5FD1A 1C0UB 5HBMA 2JX2A 5F8MA 1RWWB 4IOAQ 5K14A 3H59A 2YQ0A 1RYRA 2R7XA 1B0VA 3IS9B 2LXFA 2XQCA 4NLTA 4ED3A 4ZITA 4CLUA 3T1YJ 1TTHB 2L9DA 3GYNA 3I5AA 1KVJA 4CZCA 3BO4A 2X3DA 1WACA 5SUHA 3M2RB 5HVHA 1N5QA 4LRCA 5F8IA 4PXBA 3DCAA 1X9MA 4MYUA 5RUBA 3MCOA 1XN9A 1E6VA 3SCLE 1OQ6A 2AEJA 2XG8A 5C7PA 2RU9A 1RCOB 4K4TA 1GMUA 1V5IB 4RBVA 3FBEA 4DR4F 2MGZA 4J9MA 3MM5A 1B3TA 2HRYA 3I56S 2X1AA 3D0HE 4LR7A 2MZSA 2G1DA 2MLZA 2ZH6A 3TANA 5HATA 2C22A 1S99A 3K5PA 2AIRB 2KYXA 4I4BA 2GV1A 3W9IA 4J9VA 3TAQA 2A6MA 2H54B 3M2UA 1S48A 2RB7A 4FYWB 5F8GA 4CLTA 1PO6A 4OI2A 2FDNA 1GMWD 4HL9A 4WZQA 3DLEA 2J0WA 1I94F 3OL8A 1C0UA 5HBMB 1X0FA 4XO0A 1I94J 1J5OB 3B82A 1FVSA 4AXJA 1TKTB 1RAFB 4Y00A 1V3SA 5GADU 4ANCA 4KGXB 4M5IA 1RWVB 2K1RB 1RLDA 1M5PC 3BPDA 4QWBA 5EX0A 3O1LA 3K2YA 3MEKA 1HNXJ 2AZ3A 4P74A 2VA3A 4OZJA 2CJKA 4O23A 1FNXH 1EKSA 2HHVA 1RXOB 2AF6A 2GO9A 4CH7A 1TVRA 1HQ2A 3PFOA 4ED8A 4FVCA 1WHXA 4ZS6A 4RNOA 2IJNA 4C8LA 2DR6A 3C16A 2Q6CA 3CO0P 3M6UA 3IM9A 2FVSA 5HJYA 3GV8B 2FJDB 3CCJS 3US5A 2CVIA 2ZH4A 3GU0A 3PCOB 2ZHOA 3MAHA 3W2VA 2AYBA 1IQTA 4A8OA 2GHVC 1UTAA 3VGSA 2KHCA 3IBWA 4BC9A 4RUHA 4C0BA 4KFBA 4ECYA 1VQMS 1J5EJ 4BC7A 1L3TA 3KLHA 1KBRA 4B9NA 1R31A 2IJFA 4IO1A 4AYBD 4DPWA 4LF6J 3FBFA 5D4NA 3VVTA 2E9RX 3ENWA 1R8HA 4YQWA 1MWYA 1QJHA 1QUPA 1X4HA 2M4MA 2XCAA 2QZ8A 1BWEA 2QSWA 3Q2TC 1TL1A 2YNHB 2C28A 1VQNS 2DHAA 2EFPA 4XIUA 2UUAF 1YBTA 3GLJA 5KT4A 3TEHB 5D0RA 2JLGA 2CYYA 1Q79A 1L5UA 3BDEA 4YS2A 2AWZA 3NS7B 3MPYA 4NLOA 4F36A 4H54A 5L1LA 4H4MB 2VBYA 3VAHA 4K8RA 4NCBA 3SQGB 3F41A 3N5FA 1FKPB 3BREA 4DPTA 1SJFA 3N01A 1S1VA 1QTMA 2E44A 3HZGA 2KG1A 3GIJA 4PUOB 5CXTA 2VC0A 4B3RF 3MCNA 3CCSS 3IGVA 3F56A 3H2LA 1FVQA 2W2QP 2E1MC 4V19J 2QA2A 4BS2A 2RF2B 3DLJA 3IXQA 3CC4S 3H5UA 1B64A 2HNDA 3H20A 1DRZA 5C42A 5CCLA 2IC3A 1SH2A 3VGUA 3T19A 3CJQA 3PIOQ 4O3OA 2XNRA 2AT1B 1NH8A 3CIMA 2ADCA 1NZAA 1Y9OA 3BO3A 2Z2MA 4X4VA 3TA0A 4DPOA 1OPZA 5F41A 2RRNA 1VQ8S 1F5BA 2M8DB 1Y10A 3OTOJ 1T3OA 4F3QA 2GHPA 1JMTA 1U2RA 5EX3A 1SUQB 2OPSB 1RT2A 2HFNA 3DN9A 5GVQA 1TK0A 4P2XA 1WI8A 4RW6B 5LSOA 3HI9A 3MEDB 3OTBA 3CJKA 3TJAA 2UUCJ 3K5OA 3DDIA 1U24A 1ZAXA 5D0GA 5AT1B 1NSPA 4YOEA 2W7OA 2YNFA 4GRSA 1M5SA 3V4MA 4ECXA 2B4OA 2GIRA 1LK5A 3CDEA 2HURA 1LWXA 1TQLA 3CW2C 4NLUA 4P7VA 3BBBA 4ZP6A 5A0YA 4IFYB 1NSQA 3TNVA 5A8WA 1DLOB 4ZVGA 3QIDA 2CUYA 4QW9A 4FF4A 2P8IA 2HS4A 3KLGA 2FVQA 4U7UD 2IYGA 4ZHRA 4TKTA 1QD1A 5DG8A 5EWGA 4B3OB 2W1BA 2UV8A 1K0TA 2XYPB 3KHRA 2EW9A 3PRDA 2AGOA 3SMZA 1U6ZA 2F7VA 4ETXA 4DBQA 4PR6A 1VQYA 4LFCF 2IAJB 1DLOA 1FNOA 3DRRA 1XERA 2CJQA 4MAKA 1RT1A 4QIWD 5ETMA 5JXSA 3FEYB 4RJVA 4FDFA 2XSJB 3LPYA 1P1TA 1ZA2B 4JYAF 3H5XA 4L74A 3VWSA 4ANEA 1FESA 4FPIA 4DLGA 4ECWA 4DFKA 2YKNA 1FWPA 4EO6A 3QLHB 3HLUA 4ZPDA 1RU2A 4A8WA 2MQQA 1FEEA 6FD1A 1N56A 1LXJA 2V8DA 3DRSA 5LMNF 1SKUB 2OTJS 1N48A 3C66A 3RAMA 2K1RA 1ROFA 4PQUA 2E1AA 2DPJA 5FDLA 2VV5A 3MGJA 3U27A 1ZZNA 1VQ4S 2HZVA 4ZKAA 1HARA 2CQDA 2BBEA 2VA2A 1FRJA 2FJVA 1ZAVA 2K3KA 4DDFA 5J1EB 2V63A 3GFYA 1TR0A 3JAMU 3RRHA 1OPIA 3D28A 2IAJA 3KK3B 3M9NB 1XJWB 3UD5A 4RNNA 1NLKL 3E51A 3PYEA 5L46A 1U4BA 4OJGA 1FJGJ 3L7UA 1FJGF 3TZYA 1TMMA 4M1KA 3DLKA 4HH1A 1CJUA 1D9FA 3PX4A 4ERDA 4X66F 2DK2A 1CQMA 3C15A 4TU9A 2IM2A 2MKJA 1SC6A 3W9HA 4I2QB 4B9UA 2V9WA 2R42A 2HQDA 3D2WA 1XR5A 5D3GB 1MLAA 4J91A 4DCJB 5T41A 3MR2A 2DEJA 1N5YA 2O01C 2CWXA 4Q0BA 4WE1B 2DGSA 2N4CA 3CVKA 5HROA 3M2RA 1Y4ZB 3SQGA 3TUZC 1LWCB 4H4MA 1F3VA 2DGWA 2GA7A 4FS2A 2XTJP 2JFDA 4LBPA 3ITHA 4OV6A 2ASJA 3N9UC 3IGNA 1EARA 2NQPA 1T94A 3ZZZA 4QYRA 3LOUA 1LK7A 4OI3A 3TVYA 3V5RA 3I32A 4LQ3A 2EC0A 3R5GA 1UL3A 2OAUA 5J1EA 4FVMA 3QGPA 4NI2A 5EGYA 4X62F 3OHBA 1LKZA 3CO9A 5FJ4A 3H2UB 3ZTPA 3UR0A 2W2PP 1B4SA 5CZXA 2CNKB 2BV3A 1OYDA 3CCWA 1J2VA 2HIYA 3UVJA 5AE3A 1K8AT 3HHKA 1QSYA 1T9UA 1B7YB 1HMVB 2DB1A 2R2RA 2BQ3A 2HMIB 4PCQA 5MLCV 1GX6A 2LMIA 5HQMA 5DLGA 4WIQA 1RTJB 1DQAA 1S57A 4FKXA 1SKRA 4A8KA 4RU9A 1VRTA 4F3OA 3FDSA 4DV1J 3NCQA 1RWXB 1LQ9A 2HLTA 4DQIA 2W4CA 4NZ0A 2NXCA 2YKQA 4ZJLA 1NMEB 2XZWA 2BEFA 1SBRA 2J9DE 5J1NA 4C0OC 1H98A 3W5YA 5KFXA 2RS8A 3W7BA 2XGPA 1YLXA 2DRDA 3EYZA 1FRXA 3OPKA 3VZIA 2W8KA 2HHSA 1S59A 3KUEA 1T05A 1FT8A 2LEPA 1WSVA 5KG7A 5IXUA 4F4KA 2BE2A 3MXHP 1PJ7A 3NGKA 1X4CA 2CPEA 4L6V3 3GONA 1X7VA 1BQNA 2WONA 1ZPWX 2WOMA 1N5TA 2D3ZA 1G4CA 2B8QA 1LXNA 1MROA 1Q53A 3HULA 4LVOP 4OFZA 4OJ1A 2B51A 4F0KA 5BYRA 1PBAA 1SXLA 4QWEA 3PM9A 3KK1B 2D41A 4Q8FA 3OFFA 4LF2A 3TI0A 4RZRA 3MFHA 3GWCA 1UVJA 1MMNA 1FRKA 4CYUA 1FK9A 2B4PA 3TJ8A 3CCQS 4ZPAA 3KLVA 4BHQA 1RT7A 1UWBB 1SJRA 3OBIA 4RL1A 3A13A 3JQJA 3GSIA 4NYPA 2LFVA 2RILA 4DV0J 1VBZA 2QLBB 3FZ2A 2OJ3A 3R2CJ 1XMQF 1R27B 4JV1A 5ADZA 3Q23A 1OWXA 4X2BA 5GAHI 3M8QB 3TQEA 5BJRA 3TARA 1T03B 4FKYA 1N54B 4ZPTR 1SQGA 3Q22A 5ETQA 4J9OA 5AXNA 3JSRA 1RAAB 2FHOB 2C3MA 2KT3A 3TZZA 5I3UA 4TYBA 2WRMA 1U1KA 2B8PA 2BDPA 3SV3A 4DLEA 1CJKA 2DHSA 3CCES 2DY1A 3BBFA 3DRPA 1AROP 3V2UC 2J6UA 3GZ7A 4DR7F 1UAWA 4BCAA 1WHWA 2XYHB 1IQZA 3T6JA 1KC8T 2UU9F 1X8DA 4Y0FA 2R7WA 2EG2A 2HBZB 3CDBA 1Q1KA 2AEMA 4UUXA 5LSLA 3SFUA 1N8RT 1T95A 4L76A 1JB0C 5CYMB 4DR4J 1ULRA 1VMBA 3KYLA 3QNWB 2CVEA 3K59A 2DNGA 2RD5C 1CULB 4G1QB 1NZ8A 4ZVTB 4PRFA 2YKMA 1ZM4A 4OIXA 1C0TB 1H72C 1CJVB 5ETTA 2ZBCA 4EU0A 4EUVA 2BJ8A 5DJBA 1S9FA 4FXDA 5KTQA 3PKMA 3MMCB 1LW0B 1X9SA 5A6WA 4CLWA 1VBXA 4HH0A 3QRPA 4CP5A 1YITS 2UV8G 1NU4A 4DL7A 2KZZA 2YH0A 1SIZA 1F5CA 4LUBA 5DDRC 3R7SB 1JXVA 2HFVA 1HBNB 1S76D 3KLHB 3CB4A 3M8PA 1CQNA 2QLXA 4P2FA 3X3UA 4Q2LA 2QA4S 4I7FB 1U1LA 1IM4A 2W4DA 3UDCA 2RH3A 4ZPVR 2U2FA 2WVBA 2KXFA 4YB1P 3R2DJ 1TKZB 2N7YA 3K57A 3V6JA 1EKRA 2V0NA 4DV4F 3SV4A 1WEXA 5AXMA 3C14B 2DVIA 1QY7A 1KLMA 2EEYA 4OJHA 3QJJA 1PSDA 1QDUB 2HQ3A 3EICA 4YHHJ 2QEXS 2FJXA 3GJRB 2VQFJ 3TA1A 2BJDA 1KONA 4ZA1A 3UFCX 3KOAA 1RUSA 5C5JA 2OPQA 1LOUA 1RTHA 1CULA 1HW9A 2W01A 2XB2D 4YMEA 2ZH2A 1XK8A 1FKAF 2B7BB 4OI4A 4AUKA 2IDLA 1KHWA 5KFRA 4F7VA 3V6KA 1GTEA 4WZMA 3CTRA 4OZ5A 4DJBA 2XHWA 3M32A 2Q3PA 4DV0F 2DXDA 3DLEB 1LWEB 2H1YA 2W7AA 3Q86A 3Q0AA 3W5ZA 2EFNA 2HHXA 3ICLA 3DOKA 2HS3A 2HSEB 3GSDA 4TQRA 4HDHA 3VQSA 2EFOA 2ZH5A 3T9ZA 5DM7Q 1YIJS 3HT3A 1BY9A 2WVDA 2FLPA 1FTCA 1IWGA 1R3NA 2NUUG 2ZDPA 1X9WA 2UU9J 4C4WA 1UFKA 1SQEA 2RF2A 3OJSA 2Y9HA 2OPRB 1S97A 4M5KA 3OL6A 4ED2A 1WTBA 3H4DA 3BSOA 2OEJA 1HBMA 3KJQB 4QIFA 5K8MA 1G2EA 4Q7AA 4KPYA 2HEKA 4OZ2A 4TXSA 2EFVA 2KFNA 3CULA 1CJKB 2OELA 1FJCA 2B9XA 2D7SA 3K7RA 3MEGA 3LUYA 5LM7E 4R5PA 2UUBF 4DFJA 1N4LA 2QFIA 3VAGA 1XR7A 4Y2KA 1B99A 1IM6A 3D67A 1XC9A 4LF8J 3KK2B 2BANB 1IWAA 3JTOA 5F8NA 3TRGA 4DU8A 2XM3A 2DNKA 3WIUA 3WX4A 2ROPA 1Z2LA 4JYAJ 2OPPB 1WI6A 3HCXA 2LU1A 3V4IB 2N3OA 3LALA 2WHOA 2VG6B 4I2QA 2RKIA 3H40A 1IBCB 3BV8A 1SC3B 5GMDA 3LAKA 2BQRA 1VFJA 1R0BG 2YWWA 4I1TA 4KV8B 4C8ZA 2ASYA 3HFZB 4FNHA 3KJVB 1CS4B 4JBCA 4WP8A 4ZN1A 3HPOA 4DV2F 1U1RA 1UA0A 1XNRJ 4NXNJ 2HVIA 3OFEA 2ZJQQ 1L3KA 4F26A 1QLNA 1KTVA 2FYXA 4EI2A 4KKOB 1I5OB 1RE1B 3DOKB 1B70B 2K06A 5DS7A 4ALZA 2R4FA 4HYKA 4NMLA 3C16B 2DIVA 2M5YA 2Y3YA 4USWA 4IH6A 2FHMA 3SIPB 4ES2A 2ASLA 1EQ0A 1WEZA 2JWNA 4WJBA 5L9XA 4G65A 3SEOA 1R6YA 5GAHU 2AYGA 1RLCL 4J5OA 1F3FA 5D6GA 2PE8A 3UD3P 1Q7LB 4USMA 4ZVHA 1RACB 3HT0A 3PYFA 5D0HA 3OJUA 2WBMA 3H4BA 4ILMA 2L9NA 3QLHA 2NYHA 4LF7F 2CAJA 3LP0B 2QSFA 4KHMA 1X5PA 1UVIA 2YNHA 2XZDB 3MD1A 4JB8B 1NJIT 3E2EA 1VC5A 1S1UB 3SI8A 5G0RB 3MD3A 1REVA 2CJAA 4LQ9A 2FGCA 1CC7A 1KP6A 2DGXA 3G86A 3N79A 4YB5A 2KB2A 4PAAA 4KV8A 2JRSA 3IAS9 4U7UK 4QBUA 2AJ1A 1EP4A 4ZCIA 2HW3A 1RA7A 4R8UB 3MOZA 4KRWA 4ANDA 3I0RB 1WTFA 3ZZPA 2RKIB 3P4UB 3H5SA 5JUMA 3VAJA 1UCNA 1Q7YT 2N82B 2RHQB 4CI0B 1PJ5A 3D66A 4NE9C 4F4YA 1JLEA 3BKTA 4JI8F 3CCLS 2ZZNA 1FKOB 2CJXB 2ZFHA 4KH1B 3TX8A 1R8CA 5IQ6A 2ALZA 3UPFA 4K0KJ 4I0WA 3DU5A 2PMHA 3CJRA 3W2WB 1SH0A 2KRRA 4Y2MA 4RNHA 1TL5A 2M88A 3MPVA 2W2NP 3OLAA 1N0VC 2XS5A 3UE2A 2I0XA 4LF9J 2KYZA 1SL1A 1S10A 3J7YI 2XI2A 4RLEA 2CQ0A 3Q8YA 2MTLA 3DC2A 1TV6A 1YG0A 4WXOA 4F50A 3PW5A 4E0DA 3RUBL 1C1CB 7FD1A 2CZ9A 3LP2B 2LP4A 2OPRA 2OHDA 3CJTA 1EQMA 1OSDA 1R8AA 4P71A 2RS2A 5E3PA 3ZXWA 2OD4A 3D3BJ 3JS9A 4KY3A 2BM1A 2G0CA 2MLYA 5HQ8A 3GIIA 3R1HA 2VFTA 2ZOFA 1N36F 3L4BC 1URNA 4PG5A 3K5MA 2YNIA 3JAMY 5E41A 3I55S 3EVWA 5GAGI 2DTJA 4OLPA 1Q8IA 4JI6J 3UD4P 2G4BA 4Q5VA 3RW6A 3H0PA 1VR6A 4QR2A 2SXLA 3T1AA 2BABA 2Y0BB 2AKWB 2YKAA 4CLZA 5IFMA 3M8WA 3MMBB 1CLFA 3M2VA 4AL7A 1MMDA 3PW2A 1UW9A 5LMNJ 5A8RB 1RT3A 2NCKL 2K7JA 2B9EA 3B4DA 3RG6A 1D8YA 2PI5A 4NXMJ 2MHNA 3MECA 1KNZA 3OR2A 2Z58B 3OVSA 1J27A 3QZ8A 1NJXA 3QGIA 3UQSA 1TUWA 4XDCA 1RQ0A 1HNXF 2AD9A 2ILYA 1UW4A 4J9UE 4NA1A 3KK1A 5KFMA 1HFEL 1UEVA 1G6BA 3J7Z5 1AA1B 2ZZMA 4B3MJ 2H51B 3MI7X 2XMVA 4B3MF 2GFFA 2FJEB 1X4BA 2VF3A 2WOMB 3X1LB 5I4MA 4YDDB 4TU7A 1UVMA 2GW8A 2CG4A 1V6HA 2YNFB 2VDIA 3QJPA 3FSXA 4N7TA 4FYDA 1BQXA 1TAQA 3JSYA 1AZSB 3BYPA 4CLKA 1LNQA 3QFHA 3SDEB 3DRSB 3CJKB 2VFUA 1RTHB 2YX7A 4DMZA 3MR5A 4DR5F 4JV2A 3N5BA 4RKUC 1H2TZ 3B78A 3AY0A 1SUQA 2OPSA 3E01A 1SJQA 2EK1A 2YWEA 4P72A 4RBUA 2WAQD 3WBZA 2HHHF 3EVOA 3M2VB 3VAIA 2J0XA 3ENAA 3HVWA 3NY0A 4M95A 2K7KA 3W64A 4JI6F 1SJ3P 3THTA 5EN1A 2EG1A 4ED1A 3MEDA 4E8UA 1M5OC 2YNGB 4DF8A 3NGSA 5I42B 1JXEA 3DRXA 8AT1B 2HWHA 3QFWA 3UI3A 4DSIA 4F02A 1WG4A 2L9WA 4LFAJ 5CYMA 4PEOA 1JNZB 3UDEA 3J7A1 3T1YF 3NGTA 1HI1A 2JZ5A 4C98A 5BYSA 4JI2F 2YPYA 1OSCA 2DNHA 3G6ES 3Q8SB 4ZLPA 2RUSA 3IR7B 2IBOA 1RWOB 4LF1A 3AA9A 4FF3A 2DISA 4O4GA 4WTYA 5GAEU 5ETRA 1QTNB 2G0IA 3N6MA 4H4OB 1EIYB 4F4ZA 4M5DA 4C7QA 2OI2A 1RP5A 3C46A 2F9JA 1SI9A 4USTA 1YVFA 2BXJA 5KFFA 2DO0A 2HNYB 4N8NA 5D77A 3RR7A 4K4YA 4DQPA 1IKWB 1RKIA 4MKYA 4KGZB 3DDNA 4MIBA 3TW0A 3RBEA 1WNEA 4NCGB 1FEHA 3DLGA 2QV6A 3QT5A 4H4KC 3Q8RB 4RX6A 3ZNJ1 5KT3A 1KN6A 3KHLA 3MURP 4ELUA 2CFXA 2MSSA 4JI5F 2KKHA 1X60A 4PYAA 3H42A 4CO4A 4JI4F 3E8OA 1R6VA 3OW2R 1HNVB 3GG0A 3KK3A 1VI7A 1XWLA 3SQOP 2J0QD 3PACA 2OKQA 2BE2B 3BPSP 4J90A 4Y3CA 3SSRA 1X4GA 4QU6A 4DR3F 1FNMA 3QT8A 2HAIA 4QW8A 2Z30B 2DKOB 4ZVRB 2VIHA 1SC1B 2HK3A 2M8HA 4NOHA 3RU0A 5KOXA 2OFGX 3LWMA 4DQSA 3D6FB 4A8QA 3PW0A 3OD2A 3GB0A 1FRHA 2R7OA 1I51B 2ZNYA 1JLQB 2VOOA 3P6YC 2MYFA 4DV6J 1J5OA 2JLFA 4B08A 3PY8A 3OV7A 3CCRS 3MTKA 1TMJA 1FWKA 2VDHA 4Q2MA 3QGHA 5DZ6A 5LXRA 3QAUA 3BM7A 3ZFVA 4DV2J 4DQQA 4DR3J 2JLEA 3VCDA 3PTWA 3MM9A 2KM8B 2LVWA 2MKKA 4LF5F 1R0CB 3HM9A 1IKYB 3QIPA 1Y5IB 2HGMA 1KEKA 4O3PA 2ZVSA 4OI1A 4CO0A 3DLGB 1HNVA 4U8YA 4YFUA 4UQTA 3TUPA 3A4TA 2H9ZA 2KZMA 1FF2A 4CTAB 2QL9B 4X64F 5IM0A 2DNLA 1GFWB 2IM3A 2VPYB 2WB1D 2HYIB 4Q44A 4WFAQ 4F04B 2XLKA 4P10A 4MFBA 2UZAA 3LGNA 2ZD1A 2DITA 3A8EA 4U7CA 1YTYA 1U49A 1Y5LB 2IM0A 3NLCA 5DDOC 4YR2A 1CJVA 3G82B 1U8SA 3P5TL 5ETLA 3UO0A 1KQSR 3QAEA 2I5JB 2PDAA 1VJWA 2A2CA 2J7KA 3THVA 4H4KA 2V68A 1NB7A 3D54A 5L8RC 5KFHA 2OMLA 2Y8YA 4TY8A 2L3MA 2J0SD 3AJ2A 2JEFA 5HP1B 3HD2A 4OZ0A 1ZPVA 3O3LA 3VQTA 1T02A 3C15B 4ED4A 3PIPQ 3K0JA 2LYVA 3G8TA 3P96A 3Q2SC 4CLLA 3CC2S 2RIJA 4CH0S 4K4WA 4BBYA 4URGA 1T8EA 4LF6F 3BBCA 1S77D 1UA1A 2I1RA 1F9FA 3M2UB 1F9HA 4U9RA 4WTOB 4IRDA 3R3TA 5LT5A 2ROEA 1S1TA 3BGUA 5KFZA 5HL7Q 4UOGA 3V6HA 3IC1A 1VIXA 5D15A 1AT1B 5EDWA 3CT9A 4HLBA 2XWXA 1GXUA 2GZOA 4ELVA 3KDOA 2XMUA 3IRXA 1T3NA 1M1KT 2DGTA 5GMEA 4DV3J 1NSKL 2QA1A 3ENVA 3NS6A 3FZBA 3WZ0A 1N5YB 2YX1A 4N76A 1T0TV 4EWTA 3TAMA 3M6VA 3DYAA 3O8WA 3SCIE 1KRPA 2F3JA 4MYTA 1PAEX 4HI2A 2RU3A 1QAXA 2OPQB 2GVZB 1YBUA 2MLXA 1JQGA 2V5HG 4P73A 2ZH9A 1U48A 2E5IA 4QU7A 1JKHA 5GADI 4PQAA 1QAYA 4OMFG 2IVFB 2HHHJ 4KSEB 3MMAB 1TP7A 4A47A 1UVNA 4OHXA 3EM1A 3H90A 2QYCA 2ZITA 3ZTOA 1R8PA 4B3TF 2V2ZA 2V8PA 1HWIA 3C14A 4KHPF 3PYDA 2BM0A 4DSEA 5K9FA 1S0NA 1REVB 4PPDA 2AJFE 5CABA 2OLWA 2ABYA 1S9EB 1OJ4A 2FHKA 4MKVA 4OV1A 3ZZ0A 3H5YA 3PV8A 1IBLJ 1C4AA 1GAOA 2I38A 4R8UA 2H48B 2JC0A 1URRA 4PABA 1QAJA 1U1MA 4GVBA 5C25B 2GAGC 2RVJA 3KLGB 1YZ7A 3FQLA 4LT6A 1UVLA 3RRKA 1NSAA 2JNJA 4DX7A 4ER8A 4DR6J 3MUMP 2W25A 5B0CA 1N5SA 4J9PA 3UCZP 4B9TA 1WF1A 1LW0A 2YPZA 1NO8A 3CDUA 3MMAA 2KM8C 2A3JA 2DXEA 2DNOA 2IRYA 3GJTB 5EHHA 1YJVA 3ELHA 3QSIA 3GCWP 3I31A 2EVZA 2VH7A 3KLIB 5ETOA 2WK4A 1YJTA 4J9RA 4C0HA 4W4MA 4IR9A 4EZ6A 1S4EA 1OYEA 3HHLB 2J6TA 1AW0A 3HFVA 3J7ZT 3QRRA 3GJQB 4DF4A 2KT2A 2QFJA 2L41A 2NR0A 2AJQA 4TLQA 4PG8A 2XMWA 2CPDA 4X66J 1TKTA 2WVCA 2XLIA 3EZ5A 5H9EK 2FY1A 1S79A 1PYTA 1RADB 4WYLA 4GKKJ 3I9ZA 4OHZA 2V4QA 1YJRA 5KFAA 5IT4A 4ZVPB 4GC7A 4IG3A 1K73T 2J9CA 1W7WA 4I2PB 3PRVA 4QWCA 1X4DA 1X0PA 4ICLB 4ITSA 1NK4A 2ZJPQ 3G8SA 1IBMJ 2BOPA 2RQ4A 1YHQS 1Y00A 4DV1F 1JLBB 1QAIA 2D3OR 1BLUA 1RT7B 1UWBA 1ITPA 2AYMA 2VPWB 2HPUA 2WSFC 2CPIA 2CXEA 2GNKA 3BGOP 2ASDA 1RHKB 2W9BA 4U67Q 4I2PA 1VJQA 1TL3B 2ZC4A 2H3EB 3KNGA 3L09A 4HHHA 1UWAA 4K7QA 4X65F 5CD4H 5IWAJ 4K0KF 1WC0A 1ZBTA 1NK0A 4HVZA 2A1BA 3AXMA 1RT4B 4Q45A 1TU0B 1M0SA 1S1UA 2BJ7A 3EDQB 4BWMA 2ZH8A 3IS9A 2NXJA 3KFWX 3BSCA 1GX5A 4LSLA 1HBMB 3GJSB 4DXLA 4PXCA 3FQKA 2YY3A 2B9WA 3UW1A 3WX8A 2VFSA 3D9BA 3RBZA 3RJMB 3LPEA 5KFLA 2EBGA 3EX7B 2R8KA 4K59A 3FNNA 2CPHA 3FFIB 1TFWA 2UVWA 4XTTA 2OMOA 2M70A 3T6BA 2JOQA 3HHNB 2H4YB 4A46A 1UZHA 4MKAA 2VPXB 2AP6A 1P1LA 2WZ1A 2D74B 4MK9A 2MHEA 4NX9A 3Q8QB 1UETA 3OSNA 2VL1A 2FUG9 4NPOA 3ISZA 4NLXA 2YKNB 4O3QA 2UXBF 1HBOB 1P9YA 2BW7A 3IAM9 3D1HA 3CD0A 4BLGA 5CH7B 4CRJA 4KKOA 1KFDA 4C2MA 1RISA 2HFOA 5KG6A 3FCHA 2ZEJA 1RA6A 2K3IA 3OVAA 4NLDA 1GXTA 3PYGA 4GMKA 1Y5NB 5HMZA 2GJIA 1JNRB 7FDRA 2PN6A 2XBPA 3MAQA 5A76A 1HKAA 4KAIA 5I3PA 3IBCB 2VONA 2YTCA 2HGNA 1RDRA 5IC6B 1TKXA 2NPIA 3QT7A 2F4VJ 4EBCA 1FA0A 3S01A 2Q43A 2V8HA 5JVHQ 2I9SA 3D5MA 5DRKA 3NNCA 4K50A 3NG8A 3LANA 1TELA 2IMWP 3HX9A 2AJ0A 3MDFA 4MK7A 4B17A 4C8KA 1HBUA 3HHDA 4WFNQ 1L3VA 1ZA1B 1UZDA 4NL5A 3AJ1A 4NMXA 2BZ2A 3FEXB 3SSQA 4DV7F 1R0AA 1FXDA 1PILA 3NKYA 3DKDA 4Q0BB 2LQJA 3H8YA 3PG9A 2NPFA 1U47A 3LAMA 1HI0P 5A8RA 4NYOA 4OYMA 5KFPA 3DMJB 4RW4B 2ZDOA 2J9DA 2JSXA 5D78A 3FRYA 4CO1A 2DRAA 3MOJB 3CE8A 1LFPA 3R5DA 1WC4A 1P9QC 3LQVA 3ZTSA 3W1YC 2BW2A 2DGQA 2IVYA 1D9DA 3M1VA 4JI0F 2CZVC 2P9CA 5A2QU 4J9QA 4LSZB 1IXKA 3W8PA 4JI0J 1H6KX 1HL6A 1RAEB 2PT0A 2MKCA 1VRUB 2HHUA 2BUNA 1KS2A 1DARA 1PC5A 4Z2XA 4LFAF 3I9V9 3IG1B 3IP0A 3JYTB 3AA8A 3EPGA 5KFQA 1H3DA 3FVYA 4B3SF 1TV6B 3THPA 1RHUB 1S6OA 3HHEA 3W61A 3A12A 1QSSA 4FF2A 5AXKA 3DXSX 2C1EB 2CJ9A 3NRBA 4DR2J 3NL0A 1T11A 2OP5A 3P45B 4M5GA 3OXGA 1HNZF 3UDLA 1DTQA 2GS8A 3MM7B 4MTPA 4I56A 2LXUA 1AUSL 1BE4A 3ULHA 4IRKA 4FXWA 4KGMA 4ECSA 5I3QA 1MN7A 5J2NA 3V81A 2BRLA 1FE0A 1LWFB 1S7HA 3DOMB 3GFHA 3KJNB 3MHYA 4I7FA 2XI3A 2ZUAA 3ONQA 5E5NA 5L38A 2QA4G 4WFXA 2XS7A 4QWAA 3D3CJ 3R1LA 1N33F 1Y3JA 4DSKA 2E5HA 3I4PA 4CLPA 2A0FB 2KL8A 1NKEA 4RUBA 3W66A 4O3RA 4PWUA 1RTIB 2GC8A 4MMOA 1S1XA 4F4WA 2PIIA 4PXDA 2DT9A 2HIQA 2ATCB 5F3ZA 1RTDA 3ZC4A 4YR0A 1V3RA 2KDOA 1FTRA 4RW7B 2ZNZA 4R0JA 3IWLA 5HVGA 5A2QY 3AT1B 5E7OB 3MECB 4FYVB 5KFVA 1Q86T 2NZ4A 5B7WA 2R7RA 2AJ2A 1RT3B 1FI4A 2C3PA 3DU6A 3OTOF 3A3PB 3QZ7A 2NXEA 4X4TA 3BJYA 2LU2A 4YY3F 3POTB 2CIMA 2VG5A 1UEUA 3ETMA 4NA2A 4LF4F 1C0TA 2HVHA 1RU1A 5KG0A 4DUTA 1JJ2R 3VAKA 1JJCB 3FCVA 1PCAA 1C1BB 2E9ZA 5D4LA 5LSRA 2WVFA 4R25A 4IR1A 4C3MA 4OX9J 3DLHA 4PWDA 4WIIA 5DGBA 4HTIA 3GV5B 4O44B 3CF5Q 2ADBA 3U1MA 2BA9A 1NNDA 4A8YA 2VUGA 2FVPA 2RSQA 2E1PA 2V4JA 3ET6A 1RWPB 1W2BR 1JX4A 4NEZA 1IKVA 1FDBA 4OZ3A 1FRMA 3HSGA 5A8KA 4UTGA 4KGVB 1FX2A 4WKYA 4PUOA 4DQRA 1FJ7A 3MTJA 4FZVA 1SV5B 4ID8A 3CC7S 3M7VA 1S4FA 3BDPA 4LMZA 2IRXA 3TP2A 2R7UA 2FC9A 1E6VB 1R0AB 3PEJA 5H1SV 2BANA 4FNIA 3BN4A 6AT1B 1KSPA 2W9BB 3RB4A 4NLVA 2XMKA 2OO4A 2HFSA 4WXWA 3GG1A 3K5NA 4R5PB 1RHJB 1ZTTA 2IA0A 2AX0A 5BR8F 4O3SA 2Q66A 1MNEA 4U96A 2C2DA 4QOTA 5HANA 3GYXB 1BQNB 2WONB 1GQEA 3P3DA 3U7JA 2UVRA 1JLFB 2DPIA 4ICLA 2QLWA 4HHUA 1WKLA 4K4VA 1FXLA 3OR1A 1RHMB 1AFIA 4DG1B 1IKYA 3QIPB 4KQZA 4LIWA 4CLSA 2ZZTA 4KTQA 2GQCA 1CJUB 2E1RA 2LDYA 2LXIA 2MZRA 4ZVEA 3I0SB 2C2MB 4IG0B 4ZVOB 1HQEA 5KG1A 4DOZA 1MROB 5KFWA 1SL2A 2DHGA 5C24B 3MM8A 2RQKA 1VC0A 5I42A 2YQ1A 5ETKA 1K1SA 2XSFA 3FJ2A 4B9SA 2KTQA 1FD8A 1X4AA 4IFVA 1H7XA 4YUDA 4B9MA 2G2ZA 5J2PA 3E3XA 3GV7B 2ZHAA 3K17A 3SYZA 3EWGA 5K8NA 3C6TA 3N0VA 4QZVB 1U2FA 4WCEQ 2E5JA 3W3SA 1S9GA 3SXLA 5HMYA 3HHLA 3OL7A 3ILOA 5KFSA 4OX6A 3BSNA 3GFXA 5KG5A 1S0VA 2VU5A 3BEGB 5M2UA 2JHEA 1O51A 4GVBB 1OY9A 2HVZA 4DSLA 2ZM6F 2XNQA 1UFLA 4LR8A 3R8YA 4JP8A 2BKOA 3NWGA 2XY5A 1DAXA 1BGXT 2IJRA 2AMCB 2XSJA 4JOUA 4WP9A 2XY6A 2XC9A 1S6PB 1H73A 5HO4A 5L1JA 1U1OA 4IFYA 1HMVA 3OLBA 4OYOA 1OY6A 2EC2A 2NYIA 4Z7YA 3HHLC 1VQ7S 4KHPJ 1U0HB 4ECRA 1OY8A 4OYZA 1BD6A 3NGRA 2HLUA 4CIOA 3CPWR 1VK8A 3FCWA 5KFUA 1HWJA 5J2NB 3V81B 5HJXA 1NXIA 2ZKUA 4KO0B 4USJC 3CJ3A 4DEZA 5CD4A 3R5BA 1RK8A 1W25A 3IBFB 4CO5A 3DYAB 3HXMA 4MIWA 3EJMA 5FLXY 1K0VA 1GEHA 2OFHX 1QUVA 4I68A 4QPTA 2D3UA 3SBMA 1JKHB 1S49A 3GTYX 2MMYA 3HSDA 2D9OA 2K2PA 1MSWD 4RUCA 3GQCA 5IZHA 1KHVA 2HVDA 2B43A 2CPZA 4CO2A 1YJWS 3HK2A 4O4GB 5K8PA 3P49B 4DS5A 1SV5A 2F9DA 1AXQA 3IR6B 1YJNS 2ZC3A 5F9NA 2DNRA 1VISA 2C3UA 3J80U 5J2MA 3NXZA 4OQJA 3HZEA 3AD8C 1BXNA 2DGVA 3CCZA 2HNDB 4UT4A 3N6LA 5L39A 2LEBA 3KLEA 2C2KB 3HVTB 1YJUA 1FDNA 4TU8A 2FLLA 2XEXA 5DZ7A 2LKZA 3VV2B 2W9CA 2IYIA 4J9SA 3LA0A 2GMLA 2Q1LA 4TY8B 4CH1A 4RWWA 4F2SA 2XMAA 1B0PA 3DGPB 1S1VB 5C42B 4FN5A 1QVGR 3HJFA 3KLIA 1GMWA 1H0HB 3UCUP 2DR8A 3G82A 2HFZA 3CJ5A 1WJ9A 2GVDA 3R5JB 4C48A 2HNZB 2B5JB 3ZZYA 1RSCA 2ZWPA 3NOGA 4G1PA 3VGTA 2XMMA 3NWRA 1E6YA 1UJ5A 4Z7CA 1N34F 1UVKA 5AJ3F 1RT6B 2CQ1A 1GT8A 2I5JA 4CO3A 5B09A 2FQQB 5IV3A 1KDNA 5BXIA 1HWUA 4ZPWR 1NDPA 5F0UA 1UMJA 4J7CA 3RZAA 2ZD1B 3TEGA 4IRCA 1JLGB 2KHDA 3P5BP 1I1GA 4W90B 1YKWA 1KD1T 1PYOB 3BF4A 4KFBB 1RT1B 5GMKa 3PDNA 2KO1A 4NZ6A 2XS2A 2R2UA 1HNWJ 4OL8A 2V50A 2XULA 2NXNA 2G13A 2W4PA 2XWYA 3FK4A 3R9LA 4ECZA 1U02A 5D4PA 1YBAA 2AU0A 2QMUB 3EXCX 5KFIA 2E7VA 3LH2S 1KOOA 4ZJOA 4CLYA 2EI5A 2K8GA 2FPHX 2M52A 1ZETA 1HPZA 1HBNA 2BX6A 4C8OA 2GVZA 4WYWA 3OR1B 2Y8WA 2V2QA 4LBIA 5DG7A 1T7PA 4USIA 4DWIA 2G2OA 4I6WA 3GIRA 5J2QB 3D1QA 1WWHA 5A0YB 2GGPB 4C11A 3BR8A 4DUZJ 5KT5A 4IOCQ 1VK3A 4DR2F 3RYLA 3GE9A 2BKPA 3AFGA 3HSJA 4ID5B 4YP3A 2RDDA 1U8WA 4EYHB 2G0JA 4YDXA 3U1NA 3M8YA 3LP1B 3ZZOA 3G71S 2RUGA 2DRBA 3TA2A 3PW7A 1VRQC 4DI6A 1XNQJ 3U02A 5HLFA 3K58A 2GQQA 3T9NA 2LLZA 2E7XA 4F0MA 4N56A 1N36J 2DY9A 2J9EA 4MKBA 3J7AN 1RZMA 1RT2B 1RTJA 1HW8A 3BKFA 3FFIA 2LEAA 1HNIA 4O0IA 3NCRA 5E3AA 3EGNA 3CJ8A 3VVUA 2GO8A 4Z37A 3CD5A 4JI5J 1VRUA 3PR4A 4QJVA 3DI6B 4DPYA 4E98A 4LSLB 2R7SA 2IRUA 2RDJA 5IV4A 4ZCKA 5DG9A 1RWMB 3M1VB 1RGVA 3T3FA 2VB6A 2V2KA 2RQCA 1IKXA 2DH7A 3UNYA 4X62J 1YJ9S 2EFGA 2BQUA 1EHWA 4HR2A 2CQHA 3ETOA 1F60B 3RR8A 3C3LA 1K47A 2X3GA 3CGIA 4I64A 2ATLA 4LFBF 3QQCD 4UUWA 3TZWA 1YRXA 5BYQA 1ZYQA 4EFAC 2H5EA 2BMBA 3RTVA 2HHTA 3D6HB 4CLFA 4ILLA 3QJLA 4JI8J 2VPZB 3HFKA 4NCGA 5AJ3J 2QGFB 2V6AA 4PKDB 2UXBJ 2F8MA 1IKXB 2KFYA 5CYJA 2V4RA 2FZKB 1D09B 3D4JA 2WB4A 2O1PA 4AD6A 3T5KA 1YI2S 2W8LA 3IM8A 4A8MP 3RRGA 4IO9Q 4QIVA 4NWBA 5A8KB 3OFGA 3UDVA 3HO1A 4FXVA 2GJ2A 3DI6A 4HHJA 5LJ5Y 1T9TA 4MFBB 3VAMA 1QE1A 5L1KA 2U1AA 1HNIB 2F1FA 5HQLA 3RAQA 1DTTB 3W62A 5G0RA 3CDAA 1TL1B 1TKXB 4U6PA 5KT2A 1S1XB 3HVRA 1B7FA 2B0GA 1SJ1A 1SL0A 3D0IE 4QR1A 4LF7J 3LP0A 5H9FK 5L9NA 1G3OA 1F2HA 3QT6A 5THWA 1RYSA 3AOBA 2HBQB 2Q79A 5T14A 2VICA 1ZS6A 1AYEA 3NGUA 4OZNA 4DZDA 3MAAA 1WD6A 1X31C 1IUJA 3E01B 4Y34A 2XO7A 4C9DA 2M2BA 2YWFA 4I67A 4NASA 4LF9F 2PA8D 1ACMB 1F5AA 3W63A 3FSYA 2MY7A 1Q5YA 1D3WA 1EAYC 2QL7B 4PZVA 9ATCB 1ZM9A 4OHVA 2DNQA 2MY8A 2BJ3A 5LOQA 5KFJA 3QO9A 4NA3A 1JXLA 1PYSB 1EB0A 1APSA 1FO1A 4DU7A 2RRAA 3T1HF 2CPYA 3NAIA 1VGYA 2GVDB 1KLMB 2PEHA 2XZTB 2ZBQA 3AH6A 2AGQA 2VOPA 1DFDA 3HD1A 4HT7A 2X1GA 3FBBA 3MFIA 4PWWA 5LMUF 1Q16B 1X4EA 4F3MA 1HNWF 2CQPA 2DNYA 1LW2A 4ILRA 2C42A 2BKNA 4ZOSA 2I6WA 3B4MA 1SJ4P 1M1GA 1H2VZ 1SB6A 2J7UA 5E3RA 3WC0A 1WG1A 2R8IA 2W2OP 3ADAC 4K5SA 3TWZA 3SZ2A 2YX4A 3UN5A 2OPPA 5CYQB 1OMSA 3SFGA 1KQKA 5KFOA 1IKWA 2HGLA 2DGOA 5A8WB 4ENOA 5IS2A 5F8HA 3GCXP 2PA3A 1KWMA 2QMWA 3TJ9A 2NZCA 3MM7A 4ZCLA 2HKEA 3F44A 1RJJA 2HHQA 2D1CA 4M5DB 3W60A 2Z2YB 1YQHA 2POKA 5F3TA 3PR5B 5CQGA 5HROB 3GR1A 3O6QA 4DL2A 3NOCA 3UCGA 5LXYA 1B0TA 2J76E 4G1IA 2V67A 5KFBA 5D4OA 2VJVA 3VR1A 2F63A 1MW7A 1MWZA 2FB0A 2UXCJ 3HSZA 4K4ZA 4Y2AA 3GYGA 3IG1A 3QMQA 5M2RA 2KN4A 2ZBRA 1UKUA 4QYZJ 3KLEB 4ZCMA 2DEIA 1WUUA 3AAWB 1TUVA 4ED7A 3T5LA 3CMES 4EZ9A 3NNHA 1VQKS 4JI3F 3DRPB 5G4DA 2HZCA 3VAFA 3RAXA 3T5HA 1IBLF 5GAGU 4C3LA 4RWXA 4TLRA 2CQGA 4DR1F 1P27B 4C8NA 3KTQA 3DRYA 1RBLA 5JJBA 1VBYA 3DNCA 4AFFA 1SVDA 1AB8A 3M32B 3CDWA 3NBPA 3JSMA 2IPOB 3D0GE 4QIGA 3DLLQ 2GIQA 4FBTA 1AFJA 5HP1A 4KGKA 3JSBA 3W2WA 1A7GE 1ZM2A 3D6MB 3GFZA 4P2MA 2HK2A 2IA6A 1QM9A 3AJDA 4QIEA 4X4NA 1WKKA 1JLEB 2YXLA 2YNGA 2HFUA 1Y0HA 2HWIA 4EMDA 2KXNB 3ZTRA 3GIKA 3EPIA 4DSFA 1IBMF 1HYSA 2VQFF 1PJ6A 4O3NA 1HHTP 2RE1A 3BO2A 2MQMA 1RTDB 2G1HA 1F0XA 4QR0A 1CVJA 3C6TB 1VHIA 3UN2A 1U0HA 2B4VA 4J9KA 5KFTA 3O44A 2WBRA 1RTIA 3C6UB 3O2IA 5EWFA 2AGPA 1DURA 4GVLA 2MPUA 3G8QA 4KO0A 5KOWA 1J5EF 2FD2A 3IFEA 1IR2A 3I5BA 2MSTA 4ZP8A 3PNIA 1UPMB 3BR9A 1JLGA 4J37A 2GCFA 3QWPA 4N77A 1DTTA 5B0AA 4CWBA 3EGZA 4LRBA 4NLRA 5T7LA 1WEYA 4DV5F 3AHPA 4ECTA 3NP5A 1NBEB 2VASA 2MQPA 4JI3J 2OEKA 3QATA 3OXFA 4KPCA 3NS5A 2MZ1A 4J9LA 1REGX 1BUXA 4DV6F 2F4FA 2VZ9A 3OUYA 3V6DB 3MCSA 1M5VC 1V9OA 3Q24A 3BZQA 1HI8A 2MZJA 1PGZA 2JH3A 2BJ1A 2DNNA 4NZ7A 3HHLD 4Y6IA 5CAAA 2QLFB 1JLCA 3PHTA 4L72B 4HEA9 4X4SA 2FZGB 3R5CA 4W92B 5IT9Y 3VTIA 3PX0A 4AQYF 3OR2B 4IOBA 4RO0A 1RI7A 1JIHA 5IOLA 1S72S 4LF4J 1XMOJ 3NNAA 4K2JA 1NB2A 1NH7A 2RQMA 2YNIB 1Y11A 2L08A 2MQLA 3CIZA 3J81Y 3KMSA 1WF2A 1NK8A 4DPUA 4QCLA 4QQBA 4FF1A 3JTPA 2W9AA 1EZZB 3AOAA 2R8GA 2FTRA 1PBUA 4LJMA 3QWUA 4HACB 4RPFA 2PC6A 1RT5A 4KC5A 2LA4A 2GQ2A 2Z2ZA 1F1BB 3TR5A 3FRZA 1T9WA 1S1TB 4IG3B 1NDKA 4USUA 3G9CA 2ZUGA 3AXKA 4AT1B 3OL9A 3I0SA 3BGRB 5I3UB 2I8EA 2Q6BA 3EUNA 2N7CA 2P9EA 3WHIA 2NXUA 2QG9B 4B3RJ 5DDPC 2COLA 3TUIC 4I69A 3I96A 1HWLA 4ZLJA 4HTJA 4BWJA 1DQ9A 1NPRA 3LGHA 2ZJRQ 3UNGC 1JLBA 2V9KA 3PJWA 2UVVA 1K9MT 2PSZA 1VLYA 5B08A 4PYDA 4DPXA 3Q8UA 2E66A 3V6DA 4M63A 1Q8BA 3HKZD 4HKQA 1Z1ZA 4ED6A 1NHKL 1IBKF 1VHFA 2E5GA 3ZZRA 5E0OA 4MIAA 4DR1J 1MG7A 1WSRA 5KG3A 1VQOS 3TVKA 4ZVFA 5HVFA 4WU2A 2EFQA 2J8AA 4WK1A 2MJNA 4JI2J 3P8BB 1WC5A 3TYTA 5KFYA 2FLOA 4DCOB 4EEYA 4M8LA 4DV5J 2YKPA 4MK8A 2QC3A 4JI4J 1WC1A 2VKZG 2F65A 2JDJA 3VZHA 2DCUB 3G2XA 2RDIA 1LEOA 2AV5A 2VD3A 3MUVP 2P6SA 3AD9C 4ZP9A 1JJ4A 1N32J 4TY9A 3PW4A 1QSLA 2PMWA 1ICEB 3ILIA 3SSSA 1RAHB 1TKDA 2UXDJ 2P6TA 1DTQB 2CADA 1HA1A 4DFMA 2MZQA 2E9TA 3R5AA 4DS4A 2ZH7A 2GGPA 4K4SA 4MT1A 3WIVA 2JJ4D 5DQGA 3OUYB 3NCPA 4F8RA 2HMIA 4NLQA 2CQ4A 4DR5J 3RB3A 4W98A 3TAMB 2LQ5A 1AZSA 3VALA 4FYYB 4NRTA 4AL5A 1Y7PA 2B6AA 2YKOA 5T7LB 4CM0A 3L3CA 4LIRA 5FLXU 1WHYA 3HVTA 1OS5A 1WORA 1JLFA 1XMBA 2MQNA 4XPCA 5DM6Q 4LF5J 4C8YA 4X4PA 1VOMA 1ZZFA 2AZ1A 3S1TA 2FJBB 2IDEA 3LO3A 3DXBA 4RBTA 4ZIWA 3CJSA 4A8FA 4PG4A 4DSJA 3D6TB 2NLWA 2OTLS 1LFWA 4UY85 1BQMB 1TL4A 2OEMA 1TL7A 4LRDA 4M5NA 4ETZA 3DLBA 4UY8T 1H2UX 4ZJQA 5ETNA 1LWFA 1C4CA 4JUZA 3IWNC 2XMJA 3MEGB 4NLGA 3T1HJ 1HD1A 4PXEA 3CMQA 3KMQA 3KXDA 2YQ3A 1ELOA 3WQPA 3Q8VA 5AE1A 1U0SA 4YB7A 2LA6A 2RNEA 4C3KA 2KH9A 1SC4B 4ED0A 1IKVB 3BB5A 2KJWA 4DUZF 5E3CA 4CT9A 1NJWA 3FEZA 3G87A 4N8OA 3DM2B 1NK5A 1FJEB 3CJ2A 3DLKB 2RRBA 1VCTA 1W26A 4G1QA 1FFWB 1U09A 3UN3A 4KJIA 4PWDB 4DFPA 1I3OB 4NLSA 2DO4A 4OYWA 2CJYB 1HIYA 3MPWA 3IN5A 3B8HA 3BGRA 2QYGA 3CSKA 3Q89A 4V1Ak 3GP9A 5EUHA 1Q4RA 1S6PA 2RMLA 4WFBQ 4CM2A 1N5VA 4CTAA 1U1QA 4F4XA 2C2ZB 4DL5A 4KIAA 4ZN3A 2HBYB 3M05A 2CPXA 2AEFA 2DYAA 3FC9A 3PHEA 4KB7A 3T41A 3HKWA 2JEJA 2B6AB 1FDAA 1RTZA 5BR8J 3FUYA 1A0OB 1GXLA 2QTWA 3JQKA 4G6VB 4ES1A 3MR6A 1TK5A 2KVIA 2PD1A 1HNZJ 3IWXA 5KG2A 2FVRA 2HHPA 1CEZA 2DHHA 5CA5A 3H98A 4OYBA 2CKWA 2QLJB 1SCJB 2QO3A 2WVEA 4YR3A 2LQ8A 3T5JA 1Q78A 1FK9B 1N52B 3J7YU 2YH1A 1UP1A 2J8SA 5HSPA 4WKRA 5D8HB 1HBOA 3TUJC 1ZAWA 2ERRA 1GH8A 2R8JA 2HZAA 2B7CB 1NPKA 2CG8A 4FP9A 4LFCJ 2MQOA 2PFDA 3QPIA 2YWGA 2FVCA 2L48A 3SCKE 1UFWA 3ISNC 1YRUA 3OTCA 2Z4PA 1PKUA 4LSNB 2CDRB 2R2SA 1SPBP 2APOA 2CQ2A 4Y65A 3H2VE 4FS1A 4AL6A 2JEGA 2BR0A 2RT3A 1HPZB 1YX2A 1D8ZA 4NLPA 4OX9F 3LWLA 3PZPA 1HHSA 3M8RA 1XTZA 3Q8PB 3BGFA 4MJKA 2JL9A 4HI1A 4DX5A 3EDRB 2ZBIA 5AXLA 4OX7A 2X7IA 3M30A 2IHR1 2RJZA 4EBEA 1Q0NA 3CNQP 3W5XA 2DNPA 1DY3A 3SCJE 3IR5B 2X1FA 2KFZA 2LDIA 3FBCA 4DUYF 1HR0J 1VQ6S 3KUHA 5MAOA 1VBKA 4KYZA 1WG5A 3OSPA 4DX6A 1W2IA 1BWVA 1O5JA 1P8GA 4ELTA 4DV7J 1VDHA 2XHCA 3ENQA 1LV5A 2EKYA 3ISND 1NEEA 1NHUA 1RT6A 2HRUA 4TYAA 4URSA 1EETA 1FX4A 4ZVSB 4F67A 1ZM3A 3IRXB 3UVJB 2DGUA 4A8SA 1KLNA 1PG5B 4C97A 4OYIA 2FC8A 1NK6A 4LFBJ 2UP1A 4ZIVA 2LECA 1HQUB 4DL4A 1U6FA 2FZCB 3BQ0A 2HS0A 4O44A 3RBDA 1X4FA 2WW4A 2MXYA 2DNZA 2E29A 2MKYA 4C8MA 2QJ3A 3KLFA 4EO8A 4DHVA 1NUEA 3TVZA 3HP6A 1XNRF 3A3NB 2YVSA 5B0FA 5HLFB 2QT7A 2CNLB 1NRKA 2C2NA 1U2CA 3CUNA 3EGVA 3DM2A 1IR1A 3M8QA 3KHHA 2CWKA 2VG7A 4RR5A 1S12A 3ZZTA 4NI2B 2DHXA 4WFYA 2VHGA 4ID5A 2QN6B 4GC6A 4XK8C 2IM1A 1UPPA 2NSCA 4G3IA 2UUBJ 1YRTA 2ZH3A 4CCHA 2HNYA 5HAOA 1O6XA 4NLWA 2LQ9A 3PKYA 3PO5A 1IJFB 4ZLLA 2O5DA 1SQFA 1F2GA 1LWCA 5B0BA 2V2VA 4D3GA 4KT0C 2GHWA 1VQLS 4LRAA 3G6VA 2R7VA 3MM6B 1SKSA 1Q8KA 2Y1RI 3K8WA 3MUTP 5F8JA 5H9FJ 2Y1IA 3QRQA 3S8SA 2FHJA 3AD7C 1NJYA 1D1UA 5K14B 1L3SA 1EP4B 4TN2A 1UJ6A 4NYZA 2MKSA 1X5SA 2F8HA 3OTEA 3KG0A 5E33A 4QPXA 2CNNB 4UOHA 3DOMA 4PQUB 3EZUA 2A18A 5KG4A 1EJ7L 2OD6A 5JVGQ 1C1BA 2XO6A 4USHA 3W9JA 4I6YA 2HVEA 4OYXA 2R2TA 5L1IA 2MEWA 3PVXA 4IQXA 1JLCB
chains in the Genus database with same CATH topology
2VC1A 1VRTB 1JLAB 1S1WB 3A1YG 2HNZA 4ES3A 2CQIA 1OIAA 4DN9A 4B9LA 3KG1A 2DH9A 1H38A 3CD6S 3SDEA 4DR6F 1U1PA 4NLYA 4RU2A 2V94A 3EXYA 5C25A 1YGYA 1S6QB 3BSAA 4P6QA 2VODA 4NXNF 4YHHF 3I87A 2MKHA 3G6XA 4HT5A 2CDQA 2W7PA 3WDOA 2M7SA 2B3TB 3I6PA 5DO2A 3CWJA 3ITHB 1TL3A 2XMTA 3DHWC 3DHXA 3N28A 4WK3A 1JK9B 3MR3A 1VQ5S 5KAKA 2Z8QA 3MM5B 1HYSB 1ZH5A 2AQ4A 4WE1A 2EBEA 3LP2A 4DL6A 1ZTWA 5IT0A 2UUCF 1WF0A 4K4XA 1IR0A 2X51A 2PGCA 4WFZA 5F0WA 2UXDF 1DBDA 2JFKA 1P6TA 4M94A 3R27A 1DQ8A 1AUDA 4LVNP 1Y3KA 1WHVA 2VFRA 4R0EA 4X4OA 4DV3F 3PXGa 4EGLA 2MKIA 5A6PA 1BQMA 4DX8H 3KHGA 1I6JA 3BN7A 3CCTA 2AJ4A 3MZIA 3CEDA 3BQ2A 2CQ3A 2IFXA 1C2PA 2OH2A 1MU2A 3RB6A 2Z0GA 1N88A 1FD2A 5J2MB 1S6QA 4K5RA 1LW2B 5J1PA 2O3DA 2DR9A 2BRKA 3I5CA 2C3YA 1A6LA 4OHYA 3LW5C 2HHWA 4X4RA 2DD8S 3C2PA 2PI4A 3DFEA 3VF0B 1U25A 2VBWA 3JB9k 5KFKA 5K5MA 3L7PA 1VC6A 2VG5B 4CNZA 4X4UA 3TO8A 1FKOA 4PPZA 2EPIA 4ATNA 5CYQA 2MZTA 1RAJA 4DL0C 2F8EX 2MJUA 3HMJG 1G7CB 2EK6A 3PX6A 3G6YA 4TQSA 4BDPA 4F2RA 1M5HA 4OI6A 1S9EA 3PRBA 4RW9A 2DJWA 2VBZA 4ECQA 2FJWA 3MM9B 4JV5F 5AE2A 2YWHA 3MWBA 5DGAA 2DH8A 1JJHA 1FE4A 4UW2A 3QO9B 4ECUA 1PC4A 2FJAB 1FXRA 1T05B 5K8OA 5ITHA 1TK8A 3N4WA 1FRLA 1Q81T 1KOHA 2DR7A 1CPZA 4RW6A 4RNMA 4I6AA 3F73A 2NSBA 2V8GA 2DCLA 2O66A 3LF0A 2X1BA 3PEHA 2ZKTA 4IH5A 4IH7A 3CCUS 4PG6A 4P2SA 2R7TA 1SIWB 2JVRA 5F9LA 1KTQA 2GMJA 4GO5X 3OXLA 1KQFB 4H4OA 1KR4A 2BYCA 4Q43A 1HQEB 2Z2LA 4RUAA 1SKWA 3DDKA 4KBIA 3GR0A 3S6EA 2W9CB 3M6WA 2QMXA 5FIIA 2VQEF 5HN0A 4DL3A 3PO4A 4JI7F 3LGMA 3OQ2A 1M90T 1H7WA 3HVAA 3K8VA 3V4IA 3POTA 1EETB 3KLFB 1RKJA 3C8YA 3MF5A 1FKPA 1HD0A 1HWKA 3GILA 1XR6A 3J80Y 4OLOA 1YWXA 3O5TB 2FLNA 2BACA 2IVMA 3OFHA 2BJEA 5H9EJ 3CMAS 2V8VA 3IA0A 1VS3A 1LWEA 3JTNA 1N0UA 4OX8A 4J9NA 2C2EA 3PJXA 4TNOA 4HDGA 4ECVA 5KFGA 3BQ1A 1XMOF 1KQGB 3CJ0A 4AXIA 1BC6A 4K2XA 3RB0A 2PMZD 4PG7A 2BVZA 3OHAA 4IQMA