4I2QB

Crystal structure of k103n/y181c mutant of hiv-1 reverse transcriptase in complex with rilpivirine (tmc278) analogue
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
424
structure length
416
Chain Sequence
b'IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gag-Pol polyprotein
publication title A comparison of the ability of rilpivirine (TMC278) and selected analogues to inhibit clinically relevant HIV-1 reverse transcriptase mutants.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Hydrolase, transferase/inhibitor
total genus 112
structure length 416
sequence length 424
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4i2qB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4i2qB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4i2qB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4i2qB03
5C25B 3FFIA 4NLDA 1JLAB 3KLGB 5L1KA 3LP1A 1HPZB 1R0AB 3DI6A 1SV5B 1RA7A 3GILA 3NKYA 4IQXA 3N6NA 1TV6B 1RT6A 3OLAA 2ASDA 2V4RA 4IR9A 4O3SA 4TYAA 3UDLA 4IFYA 5HBMA 2HNZB 3KLEB 4WYWA 1GX6A 2BE2A 2IJFA 3M8PB 5K14A 5KFFA 3BQ0A 2IBKA 2B43A 4Y2CA 2ATLA 4I7FB 5F8GA 4NLGA 3KNAA 4I2QA 1RT1B 4IG3A 4LQ9A 4YR0A 2FLLA 3QZ7A 5F8NA 3RB3A 1JKHB 1S10A 2R2SA 1VRTB 2HAIA 5KFNA 4ID5B 3QZ8A 5CYQB 3DLGA 3FDSA 3LAMA 3KK2B 5FDLA 4O3OA 1C1BA 2R8KA 4K4SA 2E9ZA 1RT3B 1TKZA 4EBCA 3JYTA 1XR6A 4FS1A 4RW8B 3BSCA 3NGDA 3DMJB 5KFTA 2YNHA 5F8MA 3PVXA 2C22A 4DL5A 5KFSA 2QE5A 3QIPB 1SH3A 2ZKUA 3KK3B 1RT5A 4MKAA 3G6XA 2JEIA 2FLNA 4Y2AA 1KHWA 4M94A 4TQSA 1KHVA 5HLFB 4NLUA 5J2PB 3HVWA 4J9NA 3PW4A 4XO0A 4ED0A 2RDIA 1S1TA 1RTHB 4M95A 2RDJA 3BSNA 1S6PB 1C0UA 3V81B 2FVQA 3QIDA 5KG0A 3DM2B 2I5JB 1UWBB 2C2EA 3DRPA 1BQNB 1EETA 2IM0A 2ALZA 2FVCA 4RUAA 3DLEB 4ZVGA 1N5YA 1RT4A 4ZPDA 4B3OA 5DGAA 2BRLA 1HQEA 1S6QA 4IDKB 5F8LA 1LWFA 4I2PB 5KFCA 4WZQA 3LP0A 4MK7A 4ZVEA 1S1XA 3ITHA 3MECA 2VA2A 3FFIB 3DRSA 4ECXA 1GX5A 3C6UA 1S9EA 1JLEA 3LP1B 5DG8A 3DI6B 3DOKA 1EP4B 3MF5A 2YKMB 5D3GB 3V6HA 1RT6B 4JUZA 3PW7A 4ECYA 3KOAA 5C42A 1NHVA 3KHGA 3CDUA 2R8HA 1DTQB 4IFYB 2JC0A 2OPRA 5HBMB 4KSEB 4K4UA 2J6SA 3M9OB 5CYMA 1T05A 3HVAA 4PQUA 3DYAA 5K14B 4JV2A 2R8JA 4MIBA 5L1IA 4XPCA 2FJWA 2UVUA 4NYZA 4IG3B 2D3ZA 4NLPA 1S4FA 3ICLA 3Q8RB 4ZP9A 5J2MB 4G3IA 4QWCA 3BREA 3PW0A 3RB6A 1IM4A 4PWDB 4KKOB 1LW0A 2YNFA 2IM1A 3DLGB 2I1RA 5FDLB 2AGPA 1C1BB 2W9AA 3SFUA 3RAQA 3G86A 1TKZB 3D28A 3CJ0A 4MFBA 1RAJA 1ZETA 2IC3B 4R8UA 1RDRA 4Y34A 3KLHA 3KLIA 4TXSA 2YNHB 3QLHB 5I42A 2XWYA 3GYNA 4MK9A 4LQ3A 1LWEB 4NRUA 4F4XA 2R2UA 1RT5B 1TKXB 1IKVB 3I0RB 1FKPB 4ICLA 3DDKA 1IKWB 2XC9A 1S0NA 3FSIA 1JLCA 2UVRA 2WTFA 5EUHA 3KHLA 3OSNA 3MEDB 4YR2A 2R8IA 1QAIA 2YNGB 3IS9A 1VRUA 3UR0A 5DG7A 3IRXA 2ILYA 1SH0A 5J2NB 4EYIB 2HNDA 3I5BA 4Q45A 3DRPB 3RB0A 3BSAA 1RYSA 5KG5A 1N5YB 1RT4B 2HMIA 4B3OB 3H5UA 5F9NA 1TL3A 3Q8PB 3BJYA 1HQEB 1S6QB 2ASJA 4DG1A 3BSOA 1LWCB 5KG4A 4KO0A 2B5JA 1RTDB 1T94A 2BR0A 4J9MA 2CJQA 4ED6A 3DOLA 5KFVA 3GV5B 1TVRB 2EC0A 1S9GB 3MECB 4U6PA 2CKWA 5F8IA 2JC1A 2W7PA 4IKAA 4QPXA 2UVVA 4IRDA 4RW6B 3CDWA 5HP1A 4J9QA 2C2RA 1T03B 4KV8A 1WNEA 4NLSA 4IFVA 3QGIA 3BR9A 3PZPA 4WE1A 4NLQA 2UUTA 3C6TA 4H4MB 3CWJA 3SFGA 2R8GA 1C1CA 4URGA 4FBTA 1S1WA 3ISNC 2RKIA 3I5CA 5KT5A 3V4IA 1LW2A 4ZPAA 3G6YA 4PQUB 3E01A 3BQ2A 4ED3A 3MEEA 4URSA 3PR5B 4EO6A 4DL7A 2IM2A 3KLFA 2WOMB 3QO9A 3LP2B 4O44A 1MU2B 2VG7B 4KHRA 1N4LA 1DLOB 3KJVA 4RU9A 1SUQA 4J9PA 2OPSB 4F4ZA 1LW0B 2VG5A 2E9TA 4RNOA 2HNYA 1HYSB 4H4OA 4KFBA 5J2QA 4NLRA 2IAJA 1SH2A 3NAIA 4KHMA 3KLHB 4K50A 1HQUA 4EYHB 4HKQA 1QUVA 1JLGB 1HMVB 2XGQA 2D41A 5DQHA 3PHEA 4ICLB 4IRKA 3H59A 1JLCB 4XPEA 1DTTA 1S1UA 4IOBA 3OLBA 2WCXA 3IG1B 2YKNA 4ECWA 3Q8SB 4ZHRA 1NHUA 2ZD1A 3IS9B 3V6DB 3IRXB 4RW7B 3NBPA 5KFUA 3UPFA 1JLFA 3H98A 4PUOB 4DL4A 2W8KA 3CJ2A 1JLQA 4F50A 4X2BA 1RTIA 5I3UA 1KLMA 2HWIA 3DRRB 5KFWA 2HMIB 2JEJA 1RT2B 3JSMA 4TY8A 1TKTA 4ZVHA 2IJNA 4IR1A 2W9CA 2YNIA 4K4WA 3KMQA 4QWDA 4FS2A 2BANB 4DL2A 3GIIA 2WONA 4RZRA 2O5DA 1JX4A 3M8QB 5KG6A 1QE1B 4K4ZA 4MKBA 3MEGB 1N6QA 3IGVA 2OPQB 5KT4A 3RAXA 1HNVA 2W9BA 4IFVB 2WRMA 3GIKA 3T19A 3PR4A 2IMWP 5KFXA 1C1CB 2XCAA 4QWAA 1S1WB 2FVSA 2RKIB 2D3UA 3I0SA 2XGPA 3V4IB 1LW2B 3TAMA 3MEEB 1RT7A 4LSNA 1QAJA 1ZTWA 4WXWA 3LAKA 2BE2B 1HNIA 4TQRA 4O4RA 1J5OA 2WB4A 2FJVA 4J9SA 1XR7A 2VG5B 4I2QB 2QV6A 3MR2A 5HROA 1RTJA 3KK1A 4KFBB 1JLBA 4NCGA 2IAJB 2OH2A 2HWHA 5DQGA 1S0MA 4ECSA 2B6AA 3H4BA 3OSPA 3M9NB 2ZE2A 2VA3A 5T14A 5F8JA 4DEZA 5KFGA 5C25A 3MR6A 3KHHA 3JYTB 1TP7A 3KLGA 2JEFA 1R0AA 1HPZA 3MFIA 4ZPBA 1SV5A 3UQSA 3T5HA 4RW9A 4NLTA 4NZ0A 2AU0A 2UVWA 3OHBA 1D1UA 4JV0A 4KAIA 3H4DA 3KLEA 1RA6A 1JLQB 4ECRA 4QW8A 4OL8A 3FRZA 4R0EA 2UUWA 3H40A 4K4TA 4ECTA 1S1TB 3M8PA 5KFPA 5KT6A 1C0UB 4TY8B 4Q8FA 4K4VA 1YVFA 1RT1A 1EETB 4WXOA 4RNNA 1JKHA 4NLOA 4K4YA 4J9LA 2C28A 2WONB 5F9LA 5KFRA 4ID5A 4ZPCA 5CYQA 2D7SA 5KT2A 1LWFB 3T5KA 3TQ1A 3PW2A 5JXSA 4KBIA 4ZP7A 1HARA 3LP0B 3EPIA 4HYKA 3OL6A 5EDWA 1S1XB 5EWFA 2V0NA 2AWZA 1JIHA 3ITHB 4RW8A 3FQKA 3GQCA 3KHRA 3DRSB 3T5JA 4R5PA 5KT7A 3C6UB 1S9EB 1JLEB 3QIPA 3MFHA 2JEGA 3KK3A 1S49A 2FLPA 3DOKB 4DL3A 1IKXA 3SI8A 1JXLA 5KFYA 2VG6A 4TYBA 5KG1A 3TAMB 5C42B 5J2PA 4RUCA 5EWEA 3NMAA 2OPRB 3IGNA 4GC6A 1S6PA 5CYMB 4WYLA 1HNIB 1T05B 4Q0BA 3DM2A 1J5OB 1UWBA 3DYAB 5KFAA 3VQSA 3V6JA 1BQNA 2V4QA 3DLEA 4WFZA 3BGRA 1RTJB 3RBEA 3DLKA 4Q8EA 5EWGA 4IDKA 4QWEA 2B6AB 1S9FA 5KFIA 2YNFB 1IKYA 3T1AA 4WFYA 5JUMA 1XR5A 4MIAA 4QWBA 3BQ1A 4MFBB 2AQ4A 3LALA 4LSLA 4MK8A 3CJ3A 4R8UB 3MR5A 4H54A 2WHOA 3KLIB 3NL0A 1BQMA 5I42B 3G6VA 2AX0A 1EP4A 2YKMA 4RW9B 5D3GA 1D0EA 4J9RA 3TVKA 4ED1A 3KLVA 2AGOA 1TL1A 4ZP6A 1DTQA 4QW9A 5KFDA 5KFEA 4ED8A 5KG3A 1VRUB 2V9WA 3D5MA 2WK4A 4IH7A 4O3QA 5DQIA 3Q8QB 2J6TA 4ECZA 4K4XA 3RB4A 1FK9A 2BQRA 2HNDB 2BQ3A 3QYYA 4EBEA 5KFMA 4U7CA 5J2MA 4YQWA 3H5XA 3HVTA 1TL3B 4PWDA 4KKOA 3ISND 2FVPA 4RNHA 4J9OA 4DL6A 4DG1B 4WFXA 1FKOA 4TLRA 4KO0B 2B5JB 3LANA 4G1QA 4O4GA 3DOLB 3GV7B 2R2RA 4IG0A 2IC3A 5J1EA 4O3PA 3GIMA 2DPIA 3GIJA 3QLHA 5KFOA 4R5PB 1LWEA 2ILZA 5HP1B 1TKXA 3MTKA 1IKVA 3OL9A 3I0RA 4KV8B 1FKPA 3QGHA 1I6JA 1IKXB 1IKWA 4EEYA 5F8HA 2VG6B 1U09A 4WE1B 3MEDA 2OPPA 1K1SA 2YNGA 3C6TB 1RYRA 3H5YA 3HHKA 4F4YA 1Z4UA 3I5AA 4ED2A 1C0TA 4RNMA 4IRCA 3CDEA 5J2NA 4RW4A 5KFKA 4Q0BB 3E01B 1ZTTA 4RNFA 1CSJA 5KG7A 1W25A 2GC8A 2GIQA 2DPJA 3BGRB 3KLFB 4O44B 3QO9B 1TQLA 3DLKB 3T5LA 3KJVB 4ECQA 1LWCA 3RBDA 1SUQB 1S1VA 1RTDA 2IM3A 4J9KA 5KG2A 1IKYB 3M9MB 2GIRA 1TVRA 2FJXA 1S9GA 2HNYB 3H5SA 4TY9A 4F4WA 4H4OB 3EZUA 3PW5A 4ECUA 5J2QB 2R2TA 4LSLB 4RW6A 4ZVFA 5C24A 1BQMB 1HQUB 4ZMMA 2RF2A 1MMLA 1T03A 4WZMA 4Y3CA 1REVA 5KFQA 5DGBA 3CO9A 1NNDA 3MR3A 1JLAA 1TL1B 1S97A 2XI3A 3NAHA 1DTTB 3IN5A 1S1UB 4H4MA 2YKNB 4ZHRB 2ZD1B 5DLFA 1TV6A 4URQU 3OL7A 3NBPB 4IH6A 1JLFB 1FK9B 3OL8A 2AGQA 1N56A 2HNZA 3GV8B 5L1LA 4MH8A 1RTIB 2WOMA 1KLMB 3LP2A 5I3UB 1MU2A 2VG7A 4TN2A 4YR3A 1DLOA 3N6MA 3EPGA 3V6KA 4Q44A 3HVTB 2F8EX 5L9XA 5KFLA 2OPSA 3JSMB 1TKTB 4I7FA 1K1QA 4NLXA 4EO8A 1FKOB 2C2DA 1HYSA 4JV1A 2W9CB 2YNIB 4G1QB 2AX1A 2BQUA 4O4GB 1N48A 4IG0B 5J1EB 1VRTA 2E9RX 2W7OA 5KFZA 2XCPA 2JLEA 3KK2A 1JLGA 5KFJA 1N6QB 1T3NA 1RT3A 5KT3A 1HMVA 5DLGA 3PJWA 3OHAA 4KB7A 4IH5A 2XI2A 1S0OA 4ZP8A 1HNVB 2W9BB 1S48A 3DMJA 3E51A 4NRTA 3IG1A 5KFHA 2OPPB 4KE5A 3V6DA 1C2PA 5DG9A 4YMEA 4YP3A 5C5JA 4Q43A 1C0TB 4RW7A 3QGGA 4PUOA 3I0SB 4EBDA 4RW4B 3N6LA 3H2LA 5HLFA 4ECVA 4NLWA 1RT7B 4O3RA 3DRRA 3CVKA 2IA6A 1RTHA 4LSNB 3CIZA 1RT2A 3V81A 3CJ4A 3PJXA 4GC7A 4NLYA 2I5JA 2BRKA 1S1VB 3FQLA 2BANA 5HROB 3KK1B 5KFBA 5L1JA 2J6UA 1JLBB 4NCGB 3M8QA 3CJ5A 4NLVA 1QE1A 4I2PA 1OS5A 4ED7A 3MEGA 2W8LA 2ASLA 5C24B 3HKWA 2RF2B 2OPQA 2ZE2B 4O3NA 2FVRA 3KMSA 4FBUA 1REVB
chains in the Genus database with same CATH superfamily
4PXBA 3KLGB 2JVOA 1YBUA 1VQOS 1PKUA 2C3MA 4IFYA 1NKCA 2ZUAA 1LEOA 1UZDA 2B43A 2JFDA 5F8GA 4NLGA 3TOQA 1JKHB 2RRAA 1H73A 4OI3A 1D9FA 4QIFA 3G6XA 1ZS6A 2FLNA 3JS9A 2UU9J 2W4CA 2XHCA 4OYBA 4CRJA 1RQ0A 4M95A 2R3VA 4ZVGA 1WG5A 4I2PB 2V68A 3T6BA 3C6UA 4DFPA 2QTWA 5CQGA 4DV5J 5ETSA 2J0SD 1M5HA 3H0PA 1VBYA 2MKHA 2R7QA 2K1RA 4MYUA 4NYZA 2VC1A 3HPOA 3A12A 2CZVC 1KR4A 3JSRA 3ET6A 2IC3B 2Z8QA 2Z2YB 3DHXA 5FLXY 4GVBB 2XC9A 4ZVSB 2GS8A 1X9MA 2DR9A 2R8IA 1VRUA 1KLNA 2YPYA 3SV3A 3RB0A 1TL3A 1GMUA 4F3OA 3M30B 4KO0A 2WBRA 1BY9A 3DOLA 1DARA 2KVIA 4WIIA 3CDWA 1Y5NB 1T03B 4DR6J 2FJEB 3QGIA 2UUTA 1TMJA 1SC4B 4N56A 3DLLQ 2G9OA 2PD1A 3E01A 1Y00A 5B0FA 3NGRA 4QIVA 1T9TA 3JAMU 2XMMA 1Y5LB 3I9ZA 2LXFA 2CVEA 3OLBA 3NGSA 5KFUA 3CB4A 1PAEX 3A3NB 4EK2A 2QLXA 2N3OA 3KMQA 1Y10A 3UN2A 2IY5B 1N88A 2RRBA 2YVSA 4A8YA 2QJ3A 3J81Y 2XMJA 1C1CB 5K8OA 1YITS 1CULB 2VUGA 3R97A 1RP5A 3IXQA 3DCAA 3PO5A 4E2FB 1F1BB 1JLBA 4MMOA 2HHVA 4QR0A 4O0IA 5B0AA 4DEZA 1RLCL 2MDAA 3UQSA 5HK4A 2CAJA 4B3SJ 1RWKB 1S1TB 1UFKA 3BBBA 4OYOA 2V8HA 1YJVA 3BR8A 2AEJA 4LVNP 4J9LA 3EPIA 2OTJS 2G0CA 3BH6B 2FJAB 1S9EB 3W2VB 4JI7J 3HDSA 4FXWA 3R5DA 1RU2A 1S6PA 4ZS6A 4Q0BA 3DGPA 3KFWX 1R31A 3DLKA 2PFFB 2V50A 3LF0A 1RKJA 3CIMA 1XR5A 5K8MA 3MM6A 2KM8C 3KLIB 3NL0A 2YWEA 2QLBB 2NREA 2V67A 2VU5A 2WK4A 3ENWA 4DV5F 3M7VA 3G96A 4F0MA 1JJ4A 5J2MA 4RNHA 2MB0B 2B56A 4RJVA 4O4GA 5M2RA 2MLYA 1TKXA 1IKVA 2VG6B 4UTGA 1F9HA 5HI7A 2YQ3A 1NZ8A 3TA1A 1YX2A 4ZJOA 3AXKA 3W8PA 3ONQA 4JP8A 4P73A 1TUWA 1TL7A 3L09A 3HHDA 5KG7A 2DPJA 3RBDA 1LWCA 2NPFA 2FJXA 3PW5A 4ECUA 4Z37A 4LFBF 3IAS9 4CTAA 5DLFA 4YB6A 4DR6F 5T7LB 3R7NB 1FK9B 2MSTA 1HI0P 2ACMA 2ZVIA 3JSMB 1K1QA 4J7CA 2Z4PA 4DUZJ 1AA1B 4ZVQB 4IH5A 2M52A 1VQPS 5DG9A 3DRYA 4OHWA 4DXLA 3MMJA 3W5YA 1NSQA 3TX8A 3MTJA 3IMQJ 5ETTA 5AE3A 5HROB 2KG0A 5KAKA 1K9MT 1X8DA 3ILLA 1YZ6A 3D9BA 3NKYA 1RT6A 2V4RA 4LFCJ 1M1GA 2DGWA 2Q3PA 2BE2A 3M8PB 3RRHA 2VL1A 4YR0A 3M8RA 5CYQB 4D3GA 3WHIA 4FS1A 2IA0A 3GLJA 1Z2ZA 5G0RA 4CLTA 3PM9A 4QQBA 4I56A 3VZIA 4M94A 4YUDA 2XO7A 1HBUA 5BJRA 4B3SF 5LXYA 4FVMA 3BSNA 2HG4A 1RI7A 2FVCA 3VHQA 4OX6A 1SC1B 5IOLA 1KFDA 2FGOA 1FEEA 1NU4A 2HLTA 1S1XA 4EGLA 3ZXWA 1ZAWA 5HJYA 3BGUA 3WBZA 1Z1ZA 4JI7F 1WC4A 2ZH6A 1OPZA 2L48A 3L9ZA 3CCQS 4JI1J 4PWDB 2W01A 4OZLA 4N7TA 1C1BB 3K89A 2V8DA 3KLHA 3BH7B 2DNQA 1DY3A 3SXLA 3FSIA 1NPRA 5L38A 1Z2LA 4CI0B 2MQOA 3GYXB 4X4UA 3UFCX 3BJYA 4IUFA 4DG1A 1F60B 5CCMA 3DU6A 2XZDB 3MOZA 4IRDA 1H7WA 3D2WA 1YRUA 4NLQA 3HHLD 3CWJA 2DHAA 1HW9A 5FJ4A 2J7WA 3LOUA 3GPAA 5D0HA 1VS3A 1B3TA 3UO0A 4KHRA 2HIYA 1FX2A 2QYCA 1LW0B 1DAXA 3SQGB 2HRTA 1LFWA 3LUYA 2Y0SD 3MM7B 4HKQA 4PXDA 3CGIA 4WCEQ 3H59A 3IS9B 1NM2A 3G82B 1N32J 4PUOB 4FDFA 3R7BB 3SIPB 3KDNA 1IBLJ 3THPA 1F2GA 3J7ZT 1DQ8A 2ZJRQ 4LSZB 4NA3A 3C46A 3UDCA 3WQPA 5CD4A 4GKJJ 4DUZF 1V6HA 4C8KA 2PMHA 2XG8A 2IMWP 3O2IA 1WORA 2RKIB 2EFVA 2GVDB 4C7QA 3QT5A 2JRSA 1NMEB 2QV6A 1V5IB 1RTJA 4DV1J 5DQGA 4DU8A 4M1KA 2JNJA 2H65B 1VHIA 1ZOTA 4XTTA 2AU0A 5D4NA 2BOPA 4OZNA 1NK9A 2L9NA 4L6V3 1NH7A 4LFCF 1F6TA 3MPUB 4I6WA 1VQSA 2LYVA 3FGVA 4KBIA 3MPWA 4B9SA 2V0NA 3EDQB 1H0HB 5K8PA 3T5JA 2VQEJ 4C6AA 2K7JA 1JXLA 3HLUA 5KG1A 1N5TA 2HRYA 4A8OA 4LF4J 2MMYA 2YXLA 2V4QA 2F7VA 3TZZA 2QYGA 1SKUB 1OQ3A 4ZIWA 4WFYA 4AE5A 4DSEA 2DGSA 4QWBA 1VRQC 2OUGA 5DRKA 4DFMA 3MM9B 2M4MA 1NK8A 1ZH5A 4DLEA 3MAQA 3UCZP 2J6TA 3OR1B 1FRXA 4KGKA 4HDHA 4I6YA 4U7CA 1UMJA 3MMBA 5MAOA 5E3CA 2N4DA 5HO4A 3QLHA 1R8CA 2NUHA 3G9CA 1PBAA 1I6JA 4OI0A 4WE1B 5KFKA 2GC8A 3THTA 4UOFA 3GR0A 4JV2A 1S72S 2Q66A 4PXEA 1CC7A 2RHSB 1S97A 4H4MA 5A8WA 2YKNB 1Q79A 3DHWC 1TV6A 5HQ8A 2WOMA 3H7HB 3EICA 3HVTB 4CO0A 3AAWB 4LRBA 3GP9A 4WTOB 4DN0A 2YH1A 3PJWA 3E51A 4QU7A 5IQ6A 3V6DA 1CLFA 4XAKA 2AIRB 4RW4B 3TZYA 1YJWS 2UXDJ 2HVDA 3MI7X 2NQPA 1N32F 2ADCA 2WSEC 2I5JA 2ZH1A 3MEKA 1U6BA 2ZH4A 3CCLS 3TX0A 3KDOA 1IBLF 5L1JA 4K59A 1UJ4A 1YRTA 1UKUA 1TP7A 3DDNA 2MKJA 5K5MA 1HPZB 4GKJF 1I51B 4C0HA 2H5IB 2Z0GA 1ICEB 1W2BR 2CQPA 3W9IA 3BQ0A 4DPUA 3C14B 3VZHA 1WHYA 1VRTB 2XO6A 1HBNB 2GW8A 4DV1F 4F02A 3CE8A 2GGPB 4MKVA 2DNPA 1SJ1A 5KFSA 3DXSX 1FEHA 4P2MA 3OD2A 1VK3A 2HK2A 1S5ZA 2YKOA 3O44A 4U8VA 1RT4A 4ZVTB 1X4HA 5KFCA 2VQFJ 3LP0A 5D4PA 4ZK7M 1CVJA 2XLIA 3JSBA 4AL7A 3NGUA 3HHNB 2VQEF 3GFHA 1DTQB 2J6SA 2QSFA 4F4AA 3UWTA 4L73A 4LF4F 1S4FA 4TU8A 3MCNA 2P6SA 5FDLB 2W9AA 3D28A 3DN9A 3LW5C 2KKHA 2XZWA 2YBVA 3ZZ0A 1FKPB 1PG5B 4DF8A 2M70A 3W63A 3M32B 2HVEA 2GAGC 1Q82T 1ZA1B 3RR7A 2ZHBA 2OLWA 4CO3A 3U1NA 4PYDA 4RW6B 1L3KA 3DLJA 4KR0B 3UNYA 2M5YA 2KT2A 4FBTA 2KL8A 4X65J 3V4IA 3DOMB 1QLNA 4URSA 4EO6A 1QSLA 4O44A 1Q7LB 2R7RA 2GMHA 2VG5A 2HNYA 1D9AA 3H2UB 4M8LA 3I96A 1HWIA 5GAHU 3QRPA 1Y11A 1O5JA 2IPOB 4QR2A 4Y65A 2LDIA 4CIOA 3CULA 1TKTA 1X31C 3OVBA 4QWDA 4FS2A 2X3GA 4NI2A 2Q1LA 3Q23A 5KOWA 2G13A 1W7WA 5DM7Q 3MEGB 4DCOB 2GAHC 2W9BA 2AJ1A 3GIKA 3CJTA 1CJUA 2FVSA 2XGPA 4JI4F 1SJ4P 4TQRA 2DRBA 4O4RA 4FF4A 1U26A 3PKYA 1Q86T 2YWKA 4BC7A 1X5SA 2DKOB 2VV5A 1RTZA 1TELA 1TL4A 5B7WA 3KLGA 1FRHA 4RW9A 2QA2A 2LEPA 1P1TA 1N5QA 3POTB 3H40A 1VJWA 4RNNA 1JKHA 1KP6A 1KDNA 3UR3C 4ZP7A 5H9EK 1L5UA 2Z57B 4KJIA 2V69A 3VAGA 2A1BA 5KT7A 4P74A 2FLPA 3SI8A 1KBRA 2VBXA 4ES1A 1MG7A 5C2CA 3P96A 1UZHA 1RWNB 2DNRA 3NOCA 2VOOA 3T1AA 1T02A 3V4MA 3IWXA 4L76A 3VVUA 2J76E 2YX1A 5I42B 4HI2A 1UTAA 3G6VA 4FPIA 1X5TA 4J9RA 4ZP6A 3MCOA 5KFDA 5DQIA 2D74B 4ECZA 4K4XA 4G1PA 2CQHA 3A13A 1WWHA 2HK3A 2CQ4A 3AD8C 2IC3A 3GIJA 5CZVA 5KFOA 3F73A 4GVBA 2NLWA 2FYXA 4F36A 1RGVA 1AUDA 4IOCQ 1YBAA 1XEZA 4HACA 3Q0AA 1IUJA 3M30A 4DSIA 4AL6A 3K8WA 1T03A 2ZWPA 1LKZA 2OGUA 2J0QD 3SDEB 2PT0A 1HWUA 1U1RA 1UL3A 3TVZA 4IO1A 4NA1A 4HTJA 2XY6A 2DHHA 3I4HX 1S12A 3NCPA 2JLEA 5KT3A 4ES2A 4PG8A 3EDRB 2XI2A 3J7A1 3BN7A 2B4UA 4AT1B 2PIIA 2F4FA 4LSNB 1Q8KA 2C3YA 2CPDA 2KFZA 1T9UA 5D15A 2APOA 5I3QA 1REVB 1WEYA 5L1KA 3LP1A 1R0AB 2CVIA 1RA7A 3M8ZA 1SL2A 1CULA 4ENOA 4NZ7A 3LA0A 2LA6A 3CCWA 3P45B 2KG1A 1PC5A 2CQBA 4DQRA 2HAIA 4ZDNA 2ZH5A 5E0OA 4X64J 4FKYA 3BSCA 2CQ1A 3DXBA 4GO5X 1RT5A 4PQAA 2M8HA 4OZ5A 3HVWA 2LXIA 1S1TA 1R8HA 1CEZA 5KG0A 1P27B 4U67Q 2RSQA 4B3OA 5L9NA 5F8LA 3PEHA 2BA9A 2XYPB 3HJFA 1S9EA 3IR6B 3DI6B 3W2VA 3ZTSA 4MYTA 1BXNA 2DR8A 3CMES 1T9XA 2R8JA 4JI6J 4ZVPB 3RB6A 4KKOB 1S7HA 3IR7B 4CO2A 4MIWA 2IRYA 1ZETA 3KLIA 2XWYA 2NCKL 1NDLA 1PO6A 2QLWA 1S0NA 4DDFA 1SJQA 3Q2SC 5DS7A 5DG7A 4LBPA 1JXEA 2R4FA 1U0HA 2H3EB 4Q45A 4LRCA 5KG5A 2HMIA 3TEGA 2ASJA 1NK0A 5KFVA 1TVRB 3SMZA 3MECB 4RPFA 1KN6A 2HFUA 3ADAC 4IFVA 3BR9A 1DFDA 4KQZA 4L3NA 3N9UC 4ZPAA 1R0BG 5DO2A 4DCPB 3MEEA 3M6XA 1SCJB 3I56S 3FVYA 3KG4A 4M5GA 2E9TA 2BM1A 2AT1B 1P9QC 4X4VA 2X51A 3HFVA 1YJUA 3B78A 3S1TA 1L3VA 2FY1A 1H72C 1KKHA 4CZCA 2OELA 3OFHA 2V2VA 1UA0A 1M5SA 2DD8S 4KT0C 3G87A 2ROPA 3UPFA 5T7LA 4DR1J 3CJ2A 4X4PA 2YWHA 3JSMA 4ZVHA 2R7VA 4X4NA 3O8WA 4RZRA 3RGIA 3HVRA 4J91A 3K2YA 3VCDA 1TK0A 3BZQA 1P6TA 2C2NA 2HHPA 4JI8J 4QWAA 1FXRA 4ZIVA 2AEMA 4LIWA 1J5OA 3MR2A 1B0VA 3CC2S 5HROA 4KFBB 3DLBA 2RIJA 3MWBA 3K59A 3MGJA 1YBTA 4I68A 4I6AA 5KFGA 2IVMA 3OR2B 1XN9A 4RX6A 3GJSB 3ZZRA 4JV0A 4P75A 1DRZA 3G8QA 1CJTB 1B70B 1GTEA 1D09B 2B9XA 3M8PA 1Y3KA 1C0UB 4TY8B 3QJPA 2WONB 2CPIA 5CYQA 3TQ1A 1JJHA 3KUGA 3FBEA 1HNIB 3V6JA 3DYAB 1WACA 2EFNA 3N5FA 2GJ2A 3UN5A 5H1SV 4OX8A 5JUMA 5GADU 1HLWA 4MK8A 1VQ8S 1SKWA 2WHOA 3R8YA 3T6JA 4ED4A 3D1OA 2U1AA 3W61A 1MW7A 3M2UB 3QQCD 4HT7A 1OYDA 4N8NA 5U47A 2XSFA 1LXNA 3BO4A 1VQMS 4YQWA 2GNKA 4PWDA 3ISND 3O5TB 4JI6F 2CJYB 3M05A 4O3PA 3GIMA 5HP1B 1CJKA 2CIMA 3R1HA 5GMDA 2I0XA 4ED2A 4EI2A 3E3XA 1KQGB 2VPWB 3QO9B 2CXEA 3TI0A 5AXMA 4DQPA 1QDUB 1NDCA 2R2TA 2AJ4A 4NXNJ 3SCJE 8AT1B 3NAHA 4ZHRB 1UEUA 1JLFB 4X4QA 1JNRB 1YJRA 1W26A 5I3UB 1TFWA 4N77A 1RHQB 4Q44A 4G1QB 3DGVA 3I4PA 3J7Z5 1N6QB 3OHAA 1U1KA 4UOCA 2QRRA 3NWGA 4NRTA 4L74A 3G82A 2NXEA 3GIRA 4PUOA 4BCAA 3MD1A 2PGCA 2QA4S 2DXFA 1RT7B 1V3ZA 2NSCA 4WFAQ 1HWJA 3AT1B 1S1VB 3C66A 4OYZA 4NCGB 4CLFA 1OSDA 3FZBA 3N28A 3PDNA 2LQ9A 3CT9A 1X9WA 1FE0A 4ZVOB 5AT1B 1U48A 5GVQA 3ENAA 3THVA 5K14A 2XHWA 2ABYA 5HL7Q 2FLLA 3QZ7A 5F8NA 2R2SA 4DF4A 2DNYA 2RJZA 4M5DB 4EBCA 3PKMA 3KK3B 2D9OA 4MKAA 3S6EA 1X4DA 2LQBA 3EXCX 2CJXB 1PC4A 2Y3YA 2EWHA 3V81B 3QIDA 2KZZA 2ALZA 3EWGA 3UVJB 1HQEA 1S6QA 3CPWR 3IFEA 2VA2A 1GX5A 2XY7A 3U7JA 2L41A 4K7QA 5D8HB 3GJTB 4IFYB 3AB2B 4K4UA 3GCWP 4I0WA 5L1IA 1VQ6S 3Q8RB 1DQ9A 3CF5Q 2C1EB 2I1RA 2AGPA 2G1HA 3IBWA 3MM9A 1LWEB 5EHHA 3BO2A 3CD5A 2R2UA 3NCQA 1JLCA 5E3AA 4HVZA 3IRXA 3OR1A 2DNHA 4EYIB 2F40A 3GONA 3RJMB 4A47A 2I2YA 4AXIA 2ZITA 2HIQA 2CJQA 3GV5B 2JL9A 1HR0J 3M1VB 1DURA 4F26A 2ZHAA 1REGX 2R9LA 3RW7A 2C2ZB 4WE1A 2CWXA 1MROA 4K8RA 4X4SA 4ED3A 3BQ2A 1NK5A 2QLJB 4KY3A 3UCUP 1J5EF 2VC0A 3QAUA 3OQ2A 1ACMB 4NLRA 1RCXB 3NAIA 1C4AA 2JVRA 4CLZA 4EMDA 2PEHA 1H38A 5AXLA 2D41A 2KHCA 4IRKA 5B0CA 4CWBA 3N0VA 2YKNA 1UWAA 4NXNF 3LPEA 3VF0B 4X66J 1AXQA 2DNZA 4FPRA 1AT1B 2HWIA 2JHEA 1S76D 3OTOJ 2BANB 4DL2A 5KG6A 4MKBA 2DTJA 2J9EA 1NLKL 4DZDA 4DV4J 4RL1A 1L3UA 3PV8A 5D77A 5KFXA 3FEYB 4E8UA 3GSDA 4O23A 4WXWA 2WB4A 4HH1A 2DK2A 1WOOA 2NS1B 2HWHA 4ECSA 5A76A 4PPZA 3M9NB 5B08A 1ELOA 1HPZA 1FX4A 3T5HA 4NLTA 5HVGA 1ZM9A 1T9VA 2VOPA 4R0EA 2UUWA 2IRXA 4LIRA 3G8SA 2BX6A 3R9LA 1EETB 2XULA 2OEKA 1HBNA 5JXSA 3HCXA 2ZBRA 2AWZA 2RQMA 3CCVS 2WZ1A 1FJEB 3DOKB 3FRYA 2OPRB 2P9GA 3VQSA 1T05B 4LBHA 3C3LA 3OV7A 3HD2A 5K9FA 2O67A 3T1YJ 2CG4A 4A48A 5D78A 2VDIA 2YNFB 3CCRS 1IBKJ 2DEJA 3PACA 4R8UB 3UE2A 5LMNJ 3JQKA 1RAGB 1OO0B 1DTQA 4ZITA 3FCHA 4IO9Q 4H4KC 4IH7A 4WKRA 2W2NP 3IC1A 1VC5A 1IWGA 1QVGR 3H5XA 1TTHB 4WFXA 3LANA 4K5SA 4U7UK 1FKPA 4JI3J 3C6TB 2F65A 3ZTPA 2W4DA 4Q0BB 1VQYA 1W25A 2CA9A 3DLKB 1KVKA 1SUQB 2E7WA 1YG0A 3EZUA 5A8KB 2QL7B 2CJ9A 2DEIA 4RW6A 3BPSP 1HR0F 3QNWB 2N7CA 1FNXH 4Y3CA 4CT8A 4LF9J 1JLAA 1UEVA 2MQNA 4OX9J 3DOMA 1Q81T 2Y8WA 3HHLB 4K4SA 1EX8A 1KLMB 2VJVA 4G65A 4CH1A 4JBCA 4O4GB 3VR1A 2AYEA 1WDDA 1RT3A 1URNA 3M6UA 3I0SB 1XMOJ 1TL7B 5HLFA 3HI9A 4ECVA 1B0TA 4X66F 3IWNC 3SBMA 4YY3F 2MQQA 1OS5A 1TU0B 3MEGA 3QT8A 3OTOF 3HKWA 3FMWA 1IJFB 4HT5A 4DV4F 4F7VA 4IQXA 2LXUA 5KOXA 1U1QA 2HHHJ 1GX6A 1O51A 2MEWA 2CNKB 2KJVA 2VKZG 1EKRA 5E41A 4HHJA 3DLGA 1KS2A 3CDAA 1SC3B 1NJXA 4RW8B 5CYJA 3CSKA 3QIPB 2QFJA 1Q95G 3IRWP 2XMAA 3POTA 2RDIA 5BYQA 1TZ0A 4OYWA 4RUAA 1CBKA 2FZKB 4HL9A 4ECXA 3MF5A 5D3GB 1RT6B 2C2MB 5DJBA 1WEXA 4C8MA 2IMOA 2FJWA 4ATNA 2JWNA 2Z30B 4CNZA 4NLPA 2E1MC 1X0FA 1Y0HA 2CRLA 2BKOA 4KPYA 4BLGA 3BEGB 3T1YF 4H4KA 4NXMF 3DNCA 2E5JA 5I42A 1IBKF 4CYUA 3A8JA 5G0RB 4NMLA 5EUHA 3DLHA 1HBUB 5J2NB 2C2OB 2QZ8A 5F9NA 2LVWA 1NKEA 3I31A 2ACYA 4B17A 4ZVRB 1WNEA 4NLSA 4RO0A 1FVSA 1I1GA 3G6YA 1GMVA 4JI3F 3MMAA 3MM8B 4HLBA 2IM2A 4E98A 2KHDA 3LP2B 2F9JA 1N4LA 1DLOB 5A8RB 2VF3A 1HYSB 1SH2A 3KLHB 1U0SA 2CPJA 3Q89A 1CC8A 4ANEA 4DV3J 2H9ZA 4B9LA 1K8AT 2GHWA 4LF9F 1JLQA 3ENVA 3L3CA 4FXDA 4OX9F 1NBEB 5ETKA 2PMZD 2B4VA 2PO4A 2E5LJ 1T11A 1H2UX 3ZNJ1 2UUCF 1D3WA 3P5BP 1WDTA 2V94A 2M7SA 4A8KA 1F9EB 4LSNA 4PG7A 1PJ5A 4YN3B 2DXEA 3HF5A 1NK6A 1AYEA 3K5MA 4M63A 3R3TA 4HDGA 1XTZA 1R0AA 2AZ1A 2ZM6J 1WF0A 3R6LB 4NCBA 4ECTA 2ROEA 2C3PA 4PAAA 2GMJA 2QA1A 1YVFA 2HHHF 2DGQA 3W5XA 2IVYA 6AT1B 2D7SA 3PW7A 5EDWA 1SJ3P 4X4RA 3KXDA 3DRSB 4F8RA 4R5PA 2GVZA 4AFFA 4DL3A 2AV5A 2MY8A 4Q2LA 3A8EA 1WHVA 1KTVA 1RTJB 5EWGA 3RTVA 1B99A 2GA7A 1Q0NA 3HSGA 1Q53A 5LJ5Y 5EX3A 2CDRB 5LSLA 4C0BA 4PCQA 4O3QA 5A2QY 4BWJA 1RHRB 4KKOA 2A6MA 4DUTA 3ILOA 4DV6J 3FBBA 4ZPTR 5IM0A 3OL9A 2YQ1A 4KV8B 5F8HA 2AD9A 4YDXA 3GG0A 2DNKA 4W98A 2Z2LA 4DR7J 1TQLA 2XMVA 2IM3A 2VFUA 2CUYA 1TVRA 4PRFA 2VFRA 1LXJA 2R42A 4ZMMA 1NO8A 4ANCA 4HTIA 1J27A 4LUBA 1NB7A 2HNZA 4OJ3A 3FC9A 3C15B 1D8ZA 4A8XA 2ZBPA 4I7FA 3MMBB 4A8WA 1H2TZ 3A8IA 1U8WA 1XMQF 5J1NA 5KFZA 3RBZA 1RISA 5GAEU 1T3NA 1NJIT 6FDRA 3J80Y 2C3UA 4OI6A 3QGGA 5CAAA 3UDEA 2IIHA 3H2LA 1UW9A 2ZH8A 2BRKA 2LMIA 3OW2R 3ZTRA 3GR1A 2Y9HA 5C25B 3FFIA 2YKPA 2E5LF 1C4CA 1TV6B 1P9YA 2QMWA 3KNAA 3CC4S 1S6OA 4LQ9A 3DDIA 2JLFA 2QA4G 4LMZA 2X7IA 1KTQA 2ZKUA 4KGMA 2VIHA 3IR5B 5SUHA 2OSRA 4BS2A 5DDOC 1C0UA 1U47A 2B4PA 2I5JB 4LF1A 3AJDA 5DGAA 1T7PA 3TW0A 5F41A 4ZVEA 1YSJA 1B64A 1NJYA 1X9SA 4OI4A 4OYMA 2XB2D 1UVIA 3D67A 1RBLA 2R8HA 2WVEA 5ETNA 4N5SA 2XM3A 3DYAA 3TANA 2ZH2A 2ADBA 3SCKE 5ETQA 3K57A 2DIVA 1FRJA 2ZOFA 2CQ0A 3CD6S 2KN4A 1SB6A 1U02A 1U6FA 1AROP 2DH9A 1HNZF 3G4SS 3T3FA 1JQGA 1VHFA 4USTA 4DFJA 2XYGB 1RT4B 2NXCA 4ED6A 2BJ7A 4HI1A 2W7PA 4LRAA 2FDNA 5HP1A 2EBGA 3I6PA 4DV6F 3HO1A 1HD1A 4DPYA 4UZCA 4USVA 3SFGA 2R8GA 3QAEA 2MJNA 4KGZB 3PR5B 3QO9A 2VG7B 1VQKS 1WELA 3IM8A 2N4CA 2PDAA 2H51B 1F3FA 1RWWB 2LKZA 2HGMA 4XPEA 4TNOA 3Q8SB 4ZHRA 1JLFA 1VYAA 3Q8VA 1FTCA 1MNEA 5I3UA 3HSJA 3FSXA 1MWYA 2JEJA 2QLFB 1VQLS 2IJNA 2BM0A 1N6QA 5IC4B 3TZXA 1ZPWX 2YY3A 2BMBA 3T19A 3NY0A 3IBFB 3V4IB 1HBOA 1SI9A 3F0NA 1RT7A 3BDPA 2Q6CA 3HD1A 3CCSS 4RKUC 2VG5B 4NCGA 1TKDA 3G2XA 1U45A 3KJQB 3MCMA 1BLUA 3MR6A 2P9CA 1HL6A 5GADI 2E7XA 5D0RA 3B54A 3OHBA 4QPTA 1VIOA 1FWPA 2ZEJA 5E7OB 1VISA 2C2KB 4PABA 1LWFB 3D7SB 5A6WA 1J2VA 2UXCJ 4M5DA 2JLGA 2AYGA 1O0PA 1B7YB 1U4BA 1IR0A 5IT9U 2EXUA 1JLEB 3KK3A 2KZMA 4A46A 2AHOB 2HS0A 3FEZA 2QMXA 2NZCA 4TLQA 3K8VA 1X4BA 2H5JB 1S59A 4X62J 4MIAA 3BQ1A 1FFSB 3ZZOA 1YK9A 2HQIA 4U96A 2HZCA 4NWBA 4LF6J 4RW9B 3Q83A 3KLVA 2V34A 1VBXA 4DV0J 1FXLA 4PWUA 3RB4A 2BQ3A 2ATCB 2RE1A 1FKOA 5H9EJ 5EN1A 4GVLA 1LWEA 3QGHA 2DO4A 1H6KX 1C0TA 2NZ4A 3WZ0A 2DXDA 5EGYA 4OV6A 2R7XA 3M1VA 5J2QB 1WD6A 2GIFA 3KTQA 3MR3A 2XI3A 1DTTB 4OHVA 1VBKA 4MT1A 2ZD1B 1QD1A 1N56A 1RTIB 3TYTA 5KFLA 2OO4A 1WG4A 7AT1B 2QC3A 2YNIB 3CEDA 1Y4ZB 2Q43A 3HHLC 3Q86A 1CG2A 3KK2A 3NWRA 5KFJA 5DLGA 1S48A 3W7BA 2FQQB 2QFIA 1SVDA 1YI2S 5HANA 2FHKA 4O3RA 4HACB 3K58A 2BANA 4ED7A 4P72A 1GXLA 3OLAA 1Q4RA 4KH1B 1YIJS 3KLEB 1SQGA 2E44A 4WBFA 5KFFA 1M5OC 4JI5J 1VQ9S 4C8LA 4DV2J 3BGLA 2ZWOA 2O3DA 3JAMY 2E9ZA 2XBPA 3C2PA 2YNHA 1XQIA 3D1HA 2HQFA 2B9YA 4HHHA 3LH2S 4J9NA 2EFPA 3AHPA 2AJQA 3DRPA 1EETA 1TUVA 1MLAA 3DLEB 1NB2A 4MK7A 3LP1B 5DG8A 4YS2A 3GFYA 3DOKA 3O1LA 1N54B 2GZOA 3DU5A 2JC0A 2OPRA 2AJFE 4OZ1A 1PJ6A 3AD9C 1T05A 3OXFA 1FD2A 1XNRJ 4YFUA 2J5AA 2CQ2A 4ZP9A 2DR6A 2ZBQA 2YNFA 4PR6A 3C8YA 1GXTA 1RWOB 2OD4A 4R8UA 4TXSA 1AZSB 1RT5B 3PYGA 1R3NA 4LF6F 2GMLA 3UR0A 3SQOP 5KTQA 1SH0A 3AJ1A 2HHTA 3I5BA 1NKBA 4B3OB 2D3OR 2DCLA 5C7PA 3DC2A 4CO1A 3I32A 3MXHP 2BXJA 2CKWA 4QPXA 1E6VA 3B6BA 5D4OA 3C6TA 1VGYA 1R27B 2WVFA 2UU9F 2D69A 3ETMA 5DDRC 2XQCA 2DVIA 4Q2MA 1XWLA 1SUQA 1NJZA 4RNOA 5A8KA 4Y2MA 1JLGB 2WW4A 3VAKA 2XGQA 5DQHA 3PHEA 1FA0A 5ADZA 2X1FA 1V9OA 2G2OA 2HHUA 2CWKA 4RW7B 2VFTA 5E3PA 5IWAJ 1U0HB 3HHLA 1QM9A 1KLMA 2XEXA 1IWAA 2HMIB 1WHXA 4QIGA 1VMBA 1A9NB 1JX4A 1OQ6A 3IGVA 4IFVB 1LK7A 2HQGA 2XCAA 3I0SA 2RB7A 3IWLA 1FNOA 3MEEB 1G6BA 2DNLA 4RBVA 1R8PA 1WC3A 2EFOA 2HQ3A 3JYTB 3KUHA 4WK3A 3M8SA 3ZFVA 2W2PP 3NS7B 2HFNA 2ZJPQ 2YX7A 2LQ5A 2X1GA 4K4YA 3SZ2A 2BBEA 4JI5F 1IBCB 2DNNA 2XMKA 3OXGA 4DV2F 4HYKA 3PW2A 1X60A 4RW8A 5HMYA 2KVQE 3QIPA 3MFHA 4I67A 3OBIA 3TNVA 1YRXA 2BOAA 4TVAB 4RUCA 5EWEA 1QSSA 1J5OB 4L3KA 4WFZA 1YTYA 2FHMA 2V5HG 3VV2B 3TUJC 3AXMA 2DO0A 5D3GA 2XWXA 1UETA 1WC6A 1NH8A 2DGTA 5KFEA 4ED8A 5KG3A 2A2CA 3OTCA 1RAEB 2BQRA 2KJWA 4HEA9 4D3HA 1K73T 1GMWA 5KFMA 3MDFA 1Q78A 4NEYA 1XNRF 4FVCA 1NCLA 4USHA 2MZRA 3OVSA 3GV7B 4IG0A 5J1EA 3HK2A 2DPIA 2OFGX 4B3MJ 4AYBD 3H5YA 1D9DA 3QFHA 5HMXA 5J2NA 1FRLA 2IDLA 4DU7A 1CQNA 2BV3A 2QIFA 3T5LA 1YDLA 4DR2J 1RCOB 2QEXS 4C98A 1GEHA 4TY9A 4CM2A 1CQMA 3T41A 2RF2A 4B9VA 2GJFA 3NP5A 1M5KC 3G6ES 4OJGA 3WIVA 1IBMJ 1Q5VA 1X4EA 3MM8A 3PCOB 3LP2A 1DLOA 3PX4A 5A8RA 5IFMA 3QMQA 5IS2A 4NLXA 1LOUA 1HYSA 4ERDA 4OLPA 3AQOA 4IYQA 2W7OA 3QATA 1NRKA 5HMWA 2QO3A 4LF7J 1CJKB 1F3VA 1U24A 2LA4A 1VQ5S 1SJRA 1KRPA 4DSKA 3N6LA 1TMMA 3CVKA 2IA6A 4USJC 3CIZA 5IWAF 1FESA 2J6UA 3CJ5A 4RU2A 1M5VC 3ZZYA 2JJ4D 1AB8A 2PI4A 5H9FJ 1I3OB 4BHQA 5HBMA 4ILLA 2ASYA 1U1NA 1SKSA 2CADA 1KFSA 4CP5A 3G71S 2DB1A 1RKIA 4ID5B 3T9NA 2UXBJ 1HHQA 3R6GB 2AF6A 3NGDA 4B9UA 3U1MA 4NE9C 3O3LA 4B3TJ 2RDJA 3OXLA 1XBWA 3CXCR 3JQMA 2RDDA 1SXLA 4DN9A 4OHXA 3BKUA 2DT9A 3PXGa 4FYDA 2MQ8A 3DRSA 1EP4B 1N36J 4DR3J 5AXNA 1NHVA 1Q8BA 2IHR1 2HAFA 4K2JA 5LSRA 3ZZTA 4PQUA 5K14B 4FKXA 3NGTA 2IM1A 4L72B 1QVFR 2F8MA 3R5BA 2EPIA 2HRUA 3GJQB 2DISA 4LQ3A 4NRUA 3CCMS 2HBZB 1IKWB 3WC2A 4KGVB 2YNGB 2B3TB 4QJVA 3BSAA 3H5UA 2ZJQQ 1HQEB 1S6QB 3GYGA 1RTDB 1PYSB 5HMZA 3MHYA 4PG5A 1ZZFA 9RUBA 1SC6A 4U6PA 3ELHA 2UVVA 4OQJA 2K3KA 3AFGA 4KV8A 3ILJA 5G4DA 2Z2MA 3AQPA 1RHUB 2ZNZA 1GMWD 4URGA 2NYHA 4B3MF 4DSLA 3G8TA 3OUYB 4ZCIA 4B9MA 2MPUA 4RU9A 2W4PA 3LTOA 4M5HA 2AJ0A 4DR2F 4C3KA 3PIOQ 1JLCB 3TUZC 1V5VA 4Z7YA 3IRXB 4FXVA 3C15A 3DRRB 1RT2B 4IR1A 3GIIA 2KXFA 4JI1F 1RB0A 2A10A 2XTJP 2OPQB 3W5ZA 1HNWJ 1RBAA 1MROB 4LF7F 2M0GB 1FDBA 1MWZA 3IAM9 1ITPA 4ZCKA 2K7KA 4C97A 1HIYA 4P2XA 3S01A 1XR7A 2W25A 2MZ1A 3Q2TC 4OZ2A 2OH2A 4NX9A 4DX8H 2VA3A 3I9V9 5C25A 4NYPA 3KHHA 3MFIA 4ZPBA 2NSBA 4F0HA 4KAIA 5HVHA 3W65A 3P4UB 1X0PA 1YKWA 1YWXA 4NLOA 4DFKA 5KT2A 2QSWA 2UXBF 3BGOP 2N82B 2BDPA 2R7WA 3O6QA 2F8HA 4ALZA 6FD1A 4B3TF 4PYAA 2FD2A 3LALA 4LSLA 3CJ3A 2FC8A 2MKSA 1R89A 2CNLB 3A3PB 2AGOA 1N36F 3GCXP 3HM9A 2HNDB 4EBEA 2PEBA 1Q8IA 1VQ7S 2MKKA 2G4BA 1RACB 4DL6A 1FWKA 1F5CA 5L46A 1ZPVA 1WOSA 1G3OA 1WSRA 3KWMA 1K1SA 3ULHA 3UD5A 1RHMB 3D0HE 3KUEA 3SSQA 1IQTA 1GT8A 4G1IA 3H42A 3NS6A 4NEZA 1HQUB 2DY9A 3A8KA 4ETXA 2XNRA 1UFLA 1NNDA 1S1UB 1N0VC 3H8YA 4UZBA 2CPHA 2NUUG 1PYTA 3OJUA 2VG7A 4OYAA 2C2DA 5B09A 2Y0BB 4UQGA 2YKAA 3MUMP 3S7RA 3J7YI 1FKAF 3PYEA 4FYVB 3RBXA 5B0EA 4KE5A 4WWSA 4NL5A 2FC9A 2LQ8A 1JJ2R 4NLWA 2MHEA 2MSSA 2XZTB 1RTHA 1OWXA 3ILIA 4TKTA 5KFBA 2Y8YA 3TR5A 3GB0A 1RK8A 3OFEA 1JLAB 1OYEA 3VAIA 3GILA 3N6NA 2XSJB 3FBCA 2MZTA 2IJFA 4Y2CA 1RT1B 4WFNQ 5ETPA 3LAMA 1RT3B 3R2CJ 3BB5A 2LCWA 3FKBA 4KGXB 4ZCMA 3W3SA 1SH3A 3VAHA 5HLFB 4IQMA 2LFVA 3D0GE 4A8FA 3QWPA 1WSVA 3ZTQA 5CH7B 3IO1A 1LWFA 4WZQA 1DJ0A 3D4JA 3DFEA 4PWWA 3E2EA 1QTNB 2I8EA 4ELUA 1WC1A 1JLEA 1M1KT 2YKMB 2O1PA 2RQCA 3HVAA 2UXDF 3IP0A 2RS8A 2RU3A 2KRBA 2HSEB 3ICLA 5D0GA 1FRIA 3BREA 1FERA 1T3OA 3DLGB 3TARA 2HZAA 4PPDA 3US5A 1RAJA 2CQ3A 1M90T 2CYYA 3CJRA 4Y34A 3GYNA 3TJAA 4Y00A 4ICLA 2WTFA 1N5SA 4YR2A 1MN9A 2BE7D 3BF4A 2H54B 3HT0A 1I5OB 2YH0A 4N47A 2MKCA 3UNGC 1S1WA 3ISNC 4YB5A 5KT5A 3CD7A 1LW2A 4YEAA 4DL7A 1MU2B 3PRDA 2OPSB 5J2QA 1OIAA 4OYXA 3GJRB 4LREA 2VQFF 3W60A 3N79A 4K50A 4EYHB 1SBRA 2GFFA 1U1OA 3D68A 4CYUB 1DTTA 1LQ9A 3IG1B 2ZD1A 4PKDB 1IJEB 3KKFA 1RTIA 1MWQA 2MLZA 3VALA 2LEAA 1SIZA 1BD6A 2YNIA 1LFPA 4LBIA 2HW3A 2CZ9A 2ZOGA 3GZ7A 4Z7CA 1QE1B 2RQKA 1G1XA 2NXNA 3PRVA 4LF8J 1EHWA 3MMAB 3QT6A 3VGUA 4J9SA 3AA8A 1ZA2B 5I3PA 2DR7A 3H4BA 2HZVA 3OSPA 5F8JA 3JTNA 2JEFA 2HHWA 4V19X 5FLXU 2W7AA 1I94J 1YJTA 2BABA 2VPXB 1TAQA 4P9SA 3KLEA 1RA6A 1JLQB 3FCVA 5DETA 4X65F 4C8YA 1KD1T 4F4KA 2BACA 3PTWA 1UVJA 3D1QA 3RG6A 4ZN3A 2B4OA 4CQ1A 4W92B 1HD0A 2CPEA 4NPOA 3GQCA 2V2QA 4LFBJ 1S49A 2GHPA 1G7CB 4QIEA 5KFYA 2L9WA 3J7AN 3M2VB 3KJNB 5ETLA 2IDEA 2E5HA 3DLEA 1S9FA 2HS3A 2HFOA 2JOQA 3LQVA 2J9DE 4QYRA 1TL1A 4EZ6A 1JB0C 1R8AA 3BN4A 1SKRA 5FIIA 3IM9A 4OYPA 1AZSA 3JTOA 1K0TA 4R5PB 3D66A 2GVZB 2ILZA 3J81U 5DZ7A 4CCHA 2DY1A 1LWXA 2Q79A 2J0WA 4RNFA 2ZZTA 4EWTA 2WBMA 4J9KA 5KG2A 2N7YA 4I69A 2GIRA 3N5BA 4A4JA 2LU1A 1MMLA 1S77D 4WZMA 1EQMA 3CO9A 1AFIA 3EJMA 3NNCA 4DUYJ 1APSA 3OL7A 3NBPB 3N6MA 3D6HB 5GMKa 4RLEA 2MQLA 2EK1A 4CDIA 3MUVP 5IM0B 1JLGA 2ZKTA 4UUWA 3B4MA 3ETOA 4RW7A 4C8ZA 3VGVA 3MCSA 2BW2A 2NYIA 3CJ4A 3D6MB 2HFSA 4DHVA 3T9ZA 1RAHB 5IC6B 2CFXA 5BXIA 4X4TA 2KTQA 3CCZA 3HSDA 4OHYA 1RWVB 3DRXA 4TYAA 3MAAA 4QYZK 4LF8F 2HNZB 1FNMA 2ZOMA 2IBKA 2I38A 4I7FB 4IG3A 1VR6A 2D1CA 1FTRA 3QZ8A 4O3OA 2J8SA 2MZSA 3ZZUA 1N33J 3JYTA 5M2UA 1LNQA 5F8MA 4DL5A 4Y2AA 2WVBA 1XIQA 3PW4A 2HGNA 1I94F 3EGVA 2X1BA 3QFWA 4OI1A 4C2MA 3DM2B 3FFIB 1RAFB 4BC9A 4EFAC 2R7SA 4UOGA 3KOAA 3KHGA 3JTPA 4KSEB 4XK8C 4W4MA 3M9OB 4C0OC 3Q24A 3B82A 1TL5A 1WG1A 3LGMA 4X84A 1WKJA 4KPCA 5CZXA 2IYGA 1E6YB 3HT3A 3RAQA 4FF3A 3CJ0A 1UW4A 5CCLA 5LT5A 4MK9A 5SZTA 1RZMA 4OMFG 3L4BC 3OSNA 3MEDB 4C8NA 1JK9B 3BV8A 2ILYA 2QT7A 4QIWD 2UP1A 1EKSA 2RHQB 1F0XA 2EFQA 4ZCLA 2DYAA 2QN6B 4AQYJ 3W62A 3MZIA 2X1AA 4X64F 1V3RA 2KT3A 4C11B 3PZPA 3NNAA 2HS4A 5GAGU 1VK8A 1T8EA 1T0TV 4IOAQ 2OP5A 4USUA 2KO1A 4WP8A 2KB2A 3EUNA 8RUCA 3D0IE 2B7CB 4CLPA 3A1YG 2WCXA 1YJNS 1NHUA 3F44A 4DUYF 5B0BA 1K0VA 2KRRA 5JVGQ 1HHTP 1NEEA 4NMXA 2BEFA 2H4WB 1Y7PA 2YPZA 4YHHJ 3WX8A 2BJ9A 3LAKA 4W90B 5IV3A 4FN5A 2CJBA 2EG1A 1ZM3A 4DI6A 2B9EA 2B6AA 2CPXA 3L7UA 2VHGA 4RWXA 2UVWA 4P52A 1WC0A 1D1UA 2CZ4A 4OL8A 1BQXA 2MZJA 1RHJB 4K4VA 2DIUA 2CPYA 5F9LA 1H7XA 3VVTA 4ID5A 4YDDB 3LGHA 4WU2A 1F5BA 4ZVUB 4OYIA 2BE9B 3ITHB 4MKYA 2MHNA 4FP9A 2JEGA 4J9UE 1A6LA 1N33F 4OI2A 1HBOB 4QZVB 1VLYA 1NXIA 4N8OA 3IGNA 5KFAA 4DR1F 3R1LA 5JJBA 1RAIB 2M8DB 1HWLA 2F3JA 1FJGJ 1BQMA 3GSIA 4DS5A 2XLKA 1EP4A 1CPZA 5HQMA 2OEJA 1BGXT 4JI8F 4QW9A 5L39A 2CG8A 2VONA 2R7OA 5HATA 4B9NA 4LFAJ 5FD1A 2YWGA 4U7UD 3PFEA 5K20B 2FVPA 3RZAA 3ENQA 2D9PA 5HJXA 7FD1A 3P5TL 2AJ2A 2IRUA 4WJBA 5J1PA 3MTKA 3W2WB 1FE4A 1IKWA 3WIUA 2A0FB 5E5NA 2OPPA 2YNGA 3BM7A 1CSJA 3SSSA 3EM1A 3KJVB 1RTDA 3K5LA 4UQTA 3M9MB 1DBDA 3H5SA 3D3CJ 4H4OB 3BYPA 3UN3A 3C16B 5LM7E 2EI5A 4ZVFA 5C24A 1HI8A 4AQYF 5DGBA 4MJKA 2PN6A 1PCAA 9ATCB 2M88A 3QRRA 2WB1D 3JXOA 2MJUA 2AW0A 4IH6A 2E66A 3OUYA 5IV4A 3RYLA 4Y0FA 3J81j 3FUYA 2F8EX 5L9XA 1GK8A 4EO8A 1FKOB 1FJCA 1T9WA 1Y9OA 1A7GE 5IZHA 2EVZA 1S0OA 1KOOA 2LDYA 1HNVB 3DMJA 4DZ6A 5C5JA 1FRKA 1C0TB 4TU7A 3DRRA 2XMTA 4AXJA 3TA2A 4Z2XA 4LF2A 1RT2A 1RU1A 1VQ4S 1RHKB 2B7BB 4NLVA 5C2GA 1H2VZ 3NLCA 2HGLA 2OPQA 2P8IA 4GMKA 2WVDA 3KMSA 5D4LA 1NZAA 4JV5J 1FDAA 3UD3P 2GO9A 3CJKA 4YHHF 1MN7A 4A8MP 2A6OA 1IN0A 4ELTA 3OT9A 2ATLA 4P6QA 3RB3A 2ZZMA 4I1TA 3KK2B 2A18A 1TKZA 2BVZA 2H1YA 3PVXA 1KHVA 1TUGB 5J2PB 4XO0A 2DRAA 1UWBB 2IM0A 1BQNB 3NEKA 1GAOA 5GMEA 1N5YA 4K2XA 4ZPDA 4IDKB 2KT5A 3EGWB 2YX4A 3H2VE 2W2OP 1NSKL 1URRA 3QPIA 4ECYA 1KVIA 4DWIA 4UT4A 2E5IA 2KH9A 2BJ8A 4MTPA 1T9YA 3SCIE 2JH3A 2UZAA 3CO0P 2D3ZA 1WJ9A 2AZ3A 1MSWD 2YNHB 4ILMA 3I0RB 2B0GA 3DDKA 4ZJQA 5IXUA 4BDPA 1FJGF 4JI4J 4DX6A 1L3SA 2LECA 2HNDA 2WW8A 3DRPB 1RYSA 2P5VA 4LFAF 2A3JA 1UA1A 1Q7YT 2RT3A 2YKQA 4B9TA 2X3DA 2DGOA 1ZBTA 2DBBA 1ULRA 3H90A 4ELVA 2BKNA 4J5OA 4WP3A 2V6AA 3IBCB 3GWCA 3UW1A 2DGUA 2IAJA 4U9RA 2UV8A 2EG2A 1HQUA 2CQGA 4M5IA 2MGZB 3PFOA 1S1UA 3W66A 2M2BA 3CJQA 8ATCB 1NUEA 2OJ3A 5LMUJ 2E1PA 1CS4B 1RXOB 2HHSA 2O5DA 4KRWA 1E6VB 4K4ZA 5IT0A 2EKYA 3TAMA 1Q1KA 4Y2IA 4ZJLA 2NXUA 1U1PA 2LU2A 1QAJA 3HHEA 1UVMA 1DQAA 2HURA 4LR8A 2ZH7A 1WTFA 1G4CA 2ZDPA 4NZ0A 2XSJA 1U2RA 4JV5F 4PZVA 4K4TA 5KT6A 2EFGA 2YWWA 5T41A 1Y3JA 3TEHB 3FNNA 1RT1A 2XMWA 1HBMA 3FQKA 2KDOA 3RRGA 3H20A 4XDDA 2DRDA 1IKXA 3K17A 3NMAA 1R0CB 1FFWB 3OFFA 1U49A 2RVJA 3LGNA 1HWKA 3BGRA 2AYBA 4QWEA 2V8PA 1IKYA 3R5JB 5E2QA 3MMCA 4MFBB 2AQ4A 3Q22A 1GFWB 2YKMA 1U25A 3M2RB 1VI7A 3MR7A 5ITHA 4V1Ak 3W9HA 3TRGA 2GJIA 3QYYA 3GE9A 3SV4A 1M0SA 2FLOA 1FCAA 1VIXA 3EYZA 1VC0A 2M3DA 1Y5IB 2XMUA 2PMWA 4TU9A 2MKIA 3HHKA 1WKKA 1WF1A 4IRCA 3CDEA 4DX5A 4JI0J 1U2CA 4ECQA 1RSCA 5LJ3Y 3RUBL 5A0YA 5AE2A 2OI2A 3IN5A 2IBOA 2PE8A 3D6TB 2MXYA 1SQEA 1SL1A 5E33A 1MU2A 1MMNA 2OPSA 2DGXA 2HKEA 3PYDA 1ZM2A 3MPYA 3LWMA 2AX1A 4U95A 4IG0B 5J1EB 4C48A 2OAUA 1OY8A 2XCPA 4ILRA 4ZP8A 5KFHA 3IG1A 5LMNF 1FI4A 2VPZB 1VQNS 5GAHI 2H48B 4Q43A 3R27A 4ZLPA 1CJVB 1BUXA 2VBZA 1JXVA 4GC7A 1EJ7L 5LMUF 1QE1A 4I2PA 2ASLA 5HSPA 2RF2B 1QJHA 2KFNA 1YGYA 4USIA 4NLDA 2O66A 3MM5B 1SV5B 4PEOA 4IR9A 4O3SA 3IA0A 4JI2J 3UDLA 2P9EA 4OFZA 3CCES 3SYZA 2Y1RI 2B51A 3LO3A 3AOAA 5KFTA 2C22A 4K0KJ 2QE5A 1W2IA 2OTLS 4TQSA 1H74A 1EIYB 3OTBA 1UFWA 2FVQA 2BJDA 1FWLA 1VCTA 2C3OA 1ZAVA 3CCTA 3FBFA 2BUNA 2JSXA 2QMUB 2V9KA 5E3QA 5L8RC 3W1YC 3CDUA 5HBMB 2HBRB 1U8SA 2FGCA 1XMOF 4DS4A 3M2VA 4UY8T 1AUSL 4XPCA 1QY7A 2VBYA 4AUKA 4UUXA 4G3IA 4QWCA 3CUNA 5HQLA 4DR5J 1UJ6A 1V3SA 3SFUA 1O6XA 1WI8A 1EARA 3VQTA 2RS2A 2B8PA 5E3RA 4ETZA 1GNKA 1GTHA 3SCLE 1NHKL 1SL0A 4AD6A 2QL9B 2EEYA 2E7VA 4BBYA 3TUPA 5CHCB 2QG9B 4J9MA 3CDBA 2EC0A 2C42A 5F8IA 2JC1A 2FJBB 3GTYX 2E1CA 2C2RA 2GCFA 3CMAS 1NPPA 1QTMA 1C1CA 3QRQA 3I5CA 3AOCA 4PQUB 2N3LA 3P3DA 1PAUB 3VGTA 2E5GA 3AD7C 3VAFA 3MAHA 5M2PA 4J9PA 2BKPA 4F4ZA 4JI0F 1YHQS 4RBTA 3ZC4A 2B9WA 5B0DA 1QUVA 4Q7AA 5F0UA 2A2DA 2CQCA 4DR4J 4IOBA 2BZ2A 4F04B 4UW2A 3NBPA 4GKKJ 1NSPA 1KQFB 4ZOSA 3TJ8A 2KI2A 1PBUA 2QL5B 4KYZA 2MY7A 3N4WA 2HFVA 2WRMA 5I4MA 1VJQA 2UUBJ 1NDPA 2DNMA 3UCGA 3HMJG 1OY6A 3I87A 3PYFA 4M5NA 4I2QB 2RMLA 1YLXA 4Y6IA 4OHZA 5T14A 3MURP 4FYWB 1FT8A 4XDCA 2J9DA 3QSIA 3B8HA 4QW8A 3NGKA 1U7LA 5KFPA 4JI2F 2FTRA 4Q8FA 4WXOA 4YOEA 4OV1A 2ROGA 4FYYB 3EZOA 2DNOA 5EWFA 1JIHA 3HKZD 4R25A 2VG6A 1BE4A 4DV3F 3GU0A 1ZAXA 5C42B 4K0KF 2ZVSA 5CYMB 3DM2A 1M1HA 4P2FA 4Q8EA 2B8QA 3FSYA 4CO4A 2P6TA 1RLDA 1TAUA 2BW7A 3OVAA 2GO8A 3VGSA 2V9WA 3LWLA 1FK9A 3OJSA 2PA8D 3AY0A 4DPTA 3HFZB 1E6YA 2B5JB 3RRKA 2R2RA 4DR5F 1OY9A 5HN0A 4F0KA 3B4DA 2F4VJ 1SQFA 4M5LA 5BYRA 4P71A 3MEDA 1RYRA 4F4YA 3I5AA 5AE1A 2EKNA 2ZM6F 2Y1JA 3KLFB 5IT4A 3L7OA 1SPBP 5ETRA 1ZZNA 2Q6BA 3GG1A 4LSLB 1IR2A 4L75A 3MPVA 4C11A 5KFQA 2XS2A 2VB6A 3EGNA 3NXZA 4RBUA 3UD4P 3OL8A 4E0DA 4JYAJ 1K47A 5L1LA 4TN2A 4YR3A 3MD3A 2YQ0A 2W9CB 1WEZA 1WC5A 1N48A 2F1FA 4J9VA 3RU0A 4KH0B 3PO4A 1UVLA 1XC9A 4WTYA 4KB7A 1U1MA 3SEOA 1NDKA 2V4JB 2BJ1A 4GRSA 1X4AA 2J7KA 3EXYA 4DR4F 2LP4A 4S0MA 4Y28C 3TWZA 4GKKF 5F0WA 2D3O1 4NLYA 1X5PA 3FEXB 1WKLA 3KK1B 1FFGB 4C4WA 2W8LA 2OMOA 2ZE2B 3HFKA 2HWTA 4DBQA 4QBUA 5ETMA 2VFVA 5EX0A 2UUBF 2G2YA 1OPIA 1KOHA 2HLUA 1G2EA 2QGFB 4DR7F 1R7IA 4F3QA 4F67A 1C1BA 2R8KA 1IVZA 2BJ3A 3JSYA 1Q16B 1PILA 1F9FA 2RUSA 4NLUA 2V8GA 1X7VA 1RTHB 3GFZA 2P2CB 1J5EJ 2ZFHA 2BRLA 5MLCV 4ZLNA 2XS7A 3ITHA 1FDNA 2YWFA 2O01C 2HPUA 4Y2KA 3V6HA 4JUZA 5IQQA 2V63A 1M5PC 5H9FK 2E1RA 5GAGI 1NK4A 3K0JA 2VASA 3EVOA 1KQSR 1LW0A 4J90A 3SQGA 5CABA 3U02A 1UEKA 4OZJA 2DJWA 4DX7A 3MM7A 3WDOA 4F3MA 1T95A 4OJHA 3PRBA 3PEJA 3MUTP 1QAIA 3IS9A 2JX2A 4NCAA 4ES3A 2OEMA 2DNGA 3QBCA 1WF2A 3BSOA 2BR0A 1T94A 1WOPA 3I55S 1S9GB 1X5OA 2WSCC 4LR9A 4IKAA 3PHTA 2U2FA 4J9QA 5IT9Y 4F25A 3W2WA 3F56A 1YJ9S 1TFYA 2F4VF 2RKIA 2GVDA 1MMDA 2FJDB 2E1AA 3KJVA 3C19A 4H4OA 1Q5YA 4WF9Q 3C16A 5DDQC 3H25A 3P6YC 4FNHA 1HMVB 4ICLB 2DHXA 4FYXB 2PSZA 2DH7A 4ANDA 1K44A 1VC6A 3FMBA 5DDPC 2GHVC 4JYAF 4NA2A 1QAYA 4F2SA 3HZGA 2RU9A 3M8QB 1B7FA 3ZNUA 3BBFA 3HJVA 1WI6A 1HNVA 2MYFA 3JB9k 1S1WB 2ZNYA 1LW2B 1JMTA 3NNHA 1S99A 4CH0S 3T1HJ 4DOZA 3HSZA 4DPOA 2FJVA 4CLYA 1UP1A 2AMCB 5CXTA 4UF4A 3EMTA 1HI1A 2DITA 1GQEA 2VPYB 2L9DA 1N5VA 1B0PA 2V2ZA 4OLOA 2EK6A 4ECRA 4DL0C 3BPDA 1FO1A 3HX9A 2GQ2A 3RR8A 2AKWB 2UUAJ 4B08A 1XK8A 1IM6A 2C28A 4ZPCA 5D0EA 5JMNA 3T5KA 5F3TA 1KVJA 1HARA 3OPKA 1BMQB 1X4GA 3KHRA 3C6UB 4QCLA 2HHQA 4LR7A 5J2PA 1GH8A 4GC6A 1UWBA 1BQNA 1XERA 2K1RB 5LOQA 5THWA 3CW2C 4IDKA 3ET6B 2JDJA 3MR5A 2J0XA 1RBOB 2OD6A 1S79A 2Z2ZA 4ED1A 2HBYB 4ED5A 1VRUB 3D5MA 3Q8QB 4OIXA 4DV7J 1ZM4A 1HKAA 1KQKA 2ZUGA 4YY3J 3HVTA 1TL3B 1FVQA 4TLRA 2OIHA 4KO0B 3DOLB 4RR5A 4N76A 3AB4B 3R2DJ 1VFJA 1NSAA 1YQHA 2W2QP 3I0RA 4NZ6A 1YJ7A 4EEYA 1RWPB 1U09A 4B3RJ 1Z4UA 2Y1IA 1YZ7A 3F41A 1FD8A 4RW4A 3NG8A 2HFZA 2OFHX 3E01B 1ZTTA 2FZGB 1U2FA 3BDEA 1IQZA 3TJ9A 2VKRA 2M9KA 1PIEA 2CPZA 1F5AA 1S7IA 2ZC4A 4LF5J 1HHSA 4A8SA 2UXCF 1KEKA 2EBEA 1TL1B 1WTBA 2VBWA 4PG4A 4URQU 5HAOA 1B4SA 1PYOB 3W8GA 2GV1A 4MH8A 3V6KA 4KC5A 2PA3A 3C14A 1R43A 4LVOP 4JV1A 4MAKA 2RAQA 2VH7A 2E9RX 1VRTA 2VD3A 2VDHA 4EUVA 4X62F 3CNQP 2MGZA 5AJ3J 2GGPA 2ALYB 1F2HA 3QWUA 1C2PA 3PX0A 1PSDA 4EU0A 4DV0F 2NXJA 4U8YA 2AEFA 4KIAA 1N8RT 2NR0A 4USWA 3ZZPA 1CS4A 2R7UA 1JLBB 2CJAA 4NXMJ 4DPWA 2DHGA 3U27A 2ZC3A 2W2MP 2ASDA 4WYWA 3NOGA 1TK8A 4DCJB 3BKTA 3T1HF 2FHOB 1JNZB 1FDDA 1BWVA 1OSCA 3AODA 2H4YB 3PX6A 5FDLA 3BYRA 4R0JA 1H98A 2DCUB 4WIQA 2ZH3A 2HEKA 2JEIA 2EC2A 4DSFA 1KNZA 5F3ZA 3M32A 2VODA 1S6PB 4FF2A 2C2EA 4CH7A 4EZ9A 1NJWA 5DZ6A 3DGPB 4NASA 2UUAF 1SIWB 1AFJA 3MM6B 1QUPA 2GQQA 1WUUA 3K7RA 4HH0A 3M6VA 4QYZJ 3MAAB 3TZWA 4YB7A 1VLOA 2Y1LB 4XIUA 4IG3B 4B02A 5J2MB 1EAYC 5A6PA 7FDRA 3QJLA 3PW0A 2JZ5A 4MFBA 3Q8UA 3HXMA 1RDRA 3L95X 2UUCJ 4G6VB 1PJ7A 1UVNA 3CTRA 4F4XA 1TKXB 1IKVB 2Z58B 3M2RA 3CC7S 4P7VA 2DH8A 1UCNA 2G0JA 1EB0A 4CLKA 1XJWB 3Q8PB 4DV7F 3K5PA 2HHXA 1LWCB 5KG4A 4HHUA 3R5GA 3ISZA 5LXRA 3M6WA 1BHNA 2JFKA 3RAMA 2XS5A 3CCJS 4CTAB 1RJJA 2F9DA 4FNIA 4B3RF 3D6FB 1FXDA 2ZDOA 2LLZA 3MPDA 1UPPA 5DM6Q 4KHMA 2CQIA 1O8BA 2J7UA 2FUG9 4LF5F 1U1LA 1HA1A 4CLSA 2HBQB 2SXLA 2YTCA 4X4OA 3TAPA 1PGZA 1HQ2A 4DL4A 1S57A 3UDVA 4DQIA 4ZPWR 1D8YA 2XYHB 4FZVA 2EW9A 3WC0A 4DQSA 3OTDA 5KT4A 3RAXA 3ZO7A 3PR4A 2DGVA 5AJ3F 2D3UA 2ZHOA 1CJVA 4Q5VA 4DQQA 2I9SA 3FJ2A 2BE2B 1EZZB 3OTEA 3NMRA 3NS5A 1FRMA 1S0MA 1L3TA 4DMZA 3PG9A 4P10A 2HQDA 3A3OB 3MM5A 1SV5A 2CJKA 1RWMB 2R7TA 2RILA 1OJ4A 2XY5A 2KXHA 3H4DA 5AXKA 2G1DA 4USKA 3TAQA 2CPFA 2VFSA 2WVCA 1HNXJ 4QOTA 4CLUA 1NAQA 3AA9A 1S1XB 4RUHA 3R5AA 2FHJA 2G2ZA 1N34J 1HW8A 4NYOA 4A8QA 2CNOB 3K5OA 1VBZA 2KM8B 3TO8A 3PIPQ 2G0IA 3KJFB 3RBEA 4UY85 1XMQJ 5K8NA 2B6AB 5KFIA 4LRFA 2ZZNA 3VAMA 1RWUA 1UJ5A 2AX0A 1D0EA 3TVKA 4OX7A 1RADB 3TA0A 1FHTA 2OSQA 3SDEA 2ZBCA 2MZQA 5ETVA 4PXCA 2KXNB 3TQEA 4DG1B 3P49B 4QU6A 3R5CA 3V5RA 2MKYA 4JOUA 4V19J 1Q8LA 2RQ4A 3SSRA 3A4TA 4RNMA 5JVHQ 3BKFA 3TP2A 2W24A 4F4WA 1RAAB 3EVWA 2FZCB 1WHWA 1BQMB 3QGPA 1DHMA 3HP6A 1REVA 1QAXA 4I64A 3CMQA 2L3MA 2AGQA 3EPGA 1UVKA 1TR0A 3R7SB 2LEBA 1SJFA 2KFYA 1FF2A 3ZZZA 2CQDA 2K2PA 3EX7B 2OPPB 3BS9A 3GFXA 4YP3A 1X4CA 3TVYA 2XLJA 4EBDA 4ZN1A 4WFBQ 3ZTOA 5D6GA 1X4FA 1NPKA 3PJXA 3BO3A 4C3LA 1UPMB 1P8GA 5BR8J 1KONA 5C24B 2PC6A 4FBUA 4O3NA 4OZ3A 4P7TA 3FZ2A 3TUIC 3DI6A 2Z56B 1HNZJ 2RD5C 3D3BJ 1ZYQA 1JJCB 5A2QU 2CNNB 2E29A 4LT6A 4I2QA 3VTIA 1DZ5A 1S10A 5KFNA 1EQ0A 3FDSA 3HULA 3GMGA 3X1LB 1XR6A 3DMJB 4C3MA 4KHPJ 1UAWA 1KHWA 3CJ8A 3EVMA 2HVZA 2RH3A 3NCRA 3AJ2A 1IBMF 4ED0A 3UI3A 2FB0A 4JB8B 1FJ7A 4ZA1A 2KYXA 2MQPA 3MECA 2W1BA 3PJ9A 1HNXF 3BGFA 3E8OA 2RRNA 5C42A 3CJKB 3KNGA 4QR1A 3M8WA 1N34F 1KWMA 5CYMA 4KTQA 4MIBA 3EGZA 2UVUA 2K8GA 1IM4A 1RWXB 3P8BB 4YB1P 2FHJD 4ER8A 3G86A 1TKZB 1IXKA 3V2UC 3PY8A 4WKYA 3QLHB 3RW6A 4N41A 3KYLA 3J80U 5CA5A 2UVRA 3KHLA 3AOBA 1RAOA 1RABB 2IYIA 3M4XA 5HVFA 1XNQJ 3PNIA 1VDHA 1BWEA 1N5YB 5B0GA 4ZPVR 2B5JA 3NRBA 1OMSA 2J9CA 3BBCA 1HFEL 4NOHA 4WU3A 1NK7A 4H4MB 5A8WB 2LQJA 2ZBIA 2F63A 3I82A 3QJJA 3FCWA 2ERRA 4DJBA 3KLFA 2WOMB 2VICA 3AH6A 4KFBA 3U1LA 3M8YA 1ROFA 3J7YU 3CJSA 4CLLA 4CT9A 3OR2A 3K5NA 4ECWA 3V6DB 2I6WA 2NPIA 4DR3F 3H98A 1JWWA 2W8KA 4F50A 4X2BA 1CJTA 4ID8A 5RUBA 5KFWA 4WPAA 2FY8A 4TY8A 3N01A 5LSOA 2AYMA 2W9CA 1LV5A 4K4WA 2WONA 1RUSA 2VZ9A 2V4JA 4WP9A 5GAEI 2IJRA 3VWSA 1AW0A 4FF1A 2MLXA 2K3IA 4OJ1A 1IR1A 2MTLA 2PFDA 1ZTWA 2HVIA 1HNIA 4DSJA 4PG6A 2GQCA 3KK1A 4K5RA 2IAJB 1R6YA 2ZE2A 3JQJA 5BR8F 2OHDA 4CNYA 1U6ZA 2CDQA 3M2UA 1N52B 3FRZA 1VOMA 4O0NA 3LPYA 2BYCA 3KG1A 3EZ5A 4F2RA 1S0VA 5KFRA 3EE3A 4CO5A 1XMBA 2IFXA 3LP0B 3OL6A 2XNQA 2ZH9A 1KC8T 4M5MA 3Q8YA 2UV8G 4TYBA 3TAMB 4KHPF 4BWMA 4RWWA 3QT7A 5ETOA 2KYZA 1N0UA 4WYLA 2COLA 2QX0A 3FK4A 4DLGA 4C9DA 1BC6A 2OKQA 3OFGA 1P1LA 4ITSA 2J8AA 2VJUA 4P2SA 1RE1B 2H5EA 3W9JA 4H54A 1HNWF 4I4BA 3QSYB 3HZEA 1LK5A 1HBMB 4J9OA 1S6UA 4G1QA 2OMLA 4CLWA 4ZLLA 2KU7A 4AL5A 2V8VA 2F5GA 2MQMA 1IKXB 1GXUA 4DPXA 4M5KA 2WSFC 3X3UA 2RUGA 2GIQA 3BGRB 4O44B 3L7PA 1XNQF 1A0OB 5CD4H 4CM0A 1QSYA 1S1VA 3KG0A 1IKYB 1S9GA 2HNYB 4GO7X 5BYSA 2L08A 3MMCB 4USMA 2V2KA 2RNEA 4LJMA 3CCUS 2IVFB 3WX4A 2FPHX 2DR5A 1KSPA 2WAQD 2BJEA 1S4EA 2K06A 3GV8B 4J37A 3CD0A 1TK5A 2FIUA 4HR2A 1TKTB 2POKA 3VAJA 2BQUA 4NI2B 4M5JA 2GX8A 4UOHA 3D54A 1H3DA 4ZKAA 1HMVA 4WK1A 3DKDA 3W64A 2W9BB 3S8SA 4OZ0A 4LRDA 1R6VA 4YMEA 1CJUB 1R8BA 2HVHA 2AP6A 3V81A 2PI5A 4ZLJA 3MOJB 3FQLA 4C8OA 5LL6d 2HQCA 3UVJA 4RUBA 3M8QA 5A0YB 2DHSA 2FVRA 2HYIB
chains in the Genus database with same CATH topology
1YGYA 4USIA 4NLDA 4PXBA 3KLGB 2O66A 3MM5B 1SV5B 2JVOA 3CT9A 1X9WA 2PI4A 1FE0A 1VQOS 5H9FJ 4BHQA 4IR9A 4O3SA 3IA0A 2C3MA 1U48A 5GVQA 3UDLA 4IFYA 5HBMA 2P9EA 4ILLA 4OFZA 2ASYA 1NKCA 3CCES 3THVA 5K14A 2XHWA 1U1NA 2ABYA 1SKSA 2B43A 2JFDA 5F8GA 1KFSA 3SYZA 4NLGA 3TOQA 5HL7Q 2FLLA 3QZ7A 3G71S 5F8NA 1JKHB 2DB1A 1RKIA 2RRAA 2R2SA 4ID5B 4DF4A 3T9NA 2AF6A 2DNYA 4OI3A 2Y1RI 2RJZA 4M5DB 2B51A 3LO3A 4EBCA 3NGDA 4B9UA 5KFTA 3PKMA 1D9FA 2C22A 4QIFA 2QE5A 3KK3B 3G6XA 2D9OA 4MKAA 3S6EA 1X4DA 2FLNA 1W2IA 2W4CA 3U1MA 2LQBA 2OTLS 3EXCX 4TQSA 1RQ0A 3O3LA 3OTBA 1PC4A 4M95A 2EWHA 2RDJA 1UFWA 3OXLA 3V81B 3QIDA 2FVQA 2BJDA 1XBWA 2KZZA 3CXCR 2C3OA 2ALZA 4ZVGA 1WG5A 1ZAVA 1SXLA 1HQEA 1S6QA 4DN9A 3CCTA 4OHXA 4I2PB 3CPWR 2BUNA 2DT9A 3PXGa 4FYDA 3IFEA 2JSXA 2VA2A 3DRSA 3T6BA 1GX5A 3C6UA 2XY7A 4DFPA 3U7JA 2L41A 1EP4B 5CQGA 5D8HB 2V9KA 5E3QA 5AXNA 5L8RC 1NHVA 1Q8BA 3CDUA 4IFYB 2IHR1 5HBMB 3AB2B 4K4UA 2J0SD 5LSRA 1U8SA 2FGCA 3ZZTA 1M5HA 1XMOF 4DS4A 4I0WA 1VBYA 4PQUA 2MKHA 5K14B 2R7QA 3M2VA 4UY8T 2K1RA 4XPCA 5L1IA 4MYUA 1QY7A 2VBYA 4AUKA 4NYZA 4UUXA 1VQ6S 3Q8RB 1DQ9A 2VC1A 3HPOA 4G3IA 4QWCA 2CZVC 3CUNA 1UJ6A 2IM1A 4L72B 3CF5Q 1QVFR 2I1RA 1KR4A 1V3SA 2AGPA 3SFUA 2F8MA 3JSRA 3R5BA 2IC3B 2EPIA 2HRUA 2Z8QA 2DISA 3IBWA 1WI8A 3VQTA 3DHXA 2RS2A 3MM9A 4LQ3A 1LWEB 4NRUA 5EHHA 3CD5A 2R2UA 5FLXY 5E3RA 3CCMS 3BO2A 4ETZA 2XC9A 1IKWB 1GNKA 1GTHA 3NCQA 1JLCA 3SCLE 3WC2A 5E3AA 1X9MA 2DR9A 2R8IA 2YNGB 4HVZA 1VRUA 1KLNA 1SL0A 3IRXA 2B3TB 3OR1A 2DNHA 4EYIB 4QJVA 3SV3A 2F40A 3RB0A 3BSAA 4BBYA 4A47A 3H5UA 1TL3A 2ZJQQ 1HQEB 1S6QB 4F3OA 2I2YA 4AXIA 2ZITA 3M30B 5CHCB 4KO0A 1RTDB 2HIQA 3MHYA 5HMZA 2WBRA 1BY9A 2CJQA 4J9MA 3DOLA 4PG5A 2JL9A 3CDBA 1DARA 1ZZFA 3M1VB 3GV5B 2EC0A 1SC6A 1DURA 4F26A 4U6PA 2ZHAA 2C42A 5F8IA 2JC1A 2UVVA 2KVIA 2FJBB 4WIIA 2E1CA 3CDWA 4OQJA 1Y5NB 2K3KA 2C2RA 1T03B 4KV8A 5G4DA </