4I2QB

Crystal structure of k103n/y181c mutant of hiv-1 reverse transcriptase in complex with rilpivirine (tmc278) analogue
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
424
structure length
416
Chain Sequence
IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A comparison of the ability of rilpivirine (TMC278) and selected analogues to inhibit clinically relevant HIV-1 reverse transcriptase mutants.
pubmed doi rcsb
molecule keywords Gag-Pol polyprotein
molecule tags Hydrolase, transferase/inhibitor
source organism Human immunodeficiency virus type 1 bh10
total genus 112
structure length 416
sequence length 424
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4i2qB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4i2qB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4i2qB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4i2qB03
1TL3A 4YQWA 1RT6A 5DG8A 3IG1B 2YNGB 2FVQA 4J9NA 1SH3A 2J6UA 1K1QA 1JLFA 3MEEA 1DTQB 4ICLB 2D3UA 4YMEA 4O44A 4Q45A 3DOLB 1RT7B 4KO0A 2R2UA 2W8KA 1RA6A 2YKMA 2ASJA 3GV7B 4J9MA 2IA6A 2ZE2A 1S49A 3NAIA 3OLBA 5L1LA 4NLRA 2OPSB 5C5JA 3H2LA 5KG3A 4I7FB 1IKXB 4RZRA 1HQUA 5CYQB 3M8QA 3DLKB 1RDRA 4FBTA 4RW9A 4IG3A 2E9ZA 4FS1A 2AWZA 3EPIA 5KG0A 2HNDB 3I0SA 2IM0A 4JV2A 4TQSA 4O3RA 1R0AB 3BSNA 4H4OB 2FLPA 1RT5B 4DL5A 2CKWA 4RW7B 2VG5B 3LP2A 2I1RA 3H98A 3G6XA 2OPQB 4O3NA 3DOLA 4ECTA 1MMLA 1RT7A 1JX4A 3DMJB 4Q8EA 1FKPB 3DRRB 4K4XA 4IRKA 3CJ4A 4ED6A 3DM2A 3E01A 4KSEB 3CIZA 5KT3A 2FVPA 1NHUA 1RTDA 1SH2A 3BSAA 3KJVB 3FQLA 3TQ1A 4I7FA 1JLBB 5DGAA 5CYQA 3TAMB 3DLKA 1S1TB 1T05B 4FBUA 3KLFA 4QWBA 5CYMB 1QUVA 5J2MA 2HNDA 2IAJA 2XC9A 5F8JA 3H59A 3LP0A 2C22A 4ZHRB 1R0AA 3NBPB 1TP7A 5EUHA 5KG2A 4O4GA 4RNMA 2FVSA 3V6KA 5DG9A 4ECVA 4JV0A 3RB6A 4LSLB 1VRUB 1JLGB 1TV6B 1N6QA 4H4MB 4M94A 3CDWA 4WFXA 2D41A 3FQKA 2WOMA 3KLEB 1VRTB 1TQLA 3JSMB 3T5LA 5DG7A 3C6TB 4KKOA 2W8LA 3H5UA 3KLGB 2BRKA 4TY9A 2VA2A 1GX5A 3KHRA 3M9MB 3GQCA 4GC6A 1JLBA 1S1TA 1SV5B 2RKIB 3QYYA 4IH5A 3JYTB 4WFYA 4ZVEA 3GV5B 1C1BB 4NLVA 4IOBA 3OHBA 2OPRB 5KFQA 4I2QA 4B3OA 4J9PA 1S1UB 3OL9A 5J2NA 2IM3A 3RB4A 5T14A 4WE1B 2YNIB 2OPPA 4K4SA 4M95A 5KFSA 3DOKA 3I0RB 2W9BA 3CJ5A 3LALA 5DLGA 1VRUA 1JLGA 4MKAA 1TV6A 3V4IB 1SUQB 1HYSA 1WNEA 1JLCB 2YKNA 4Q44A 1TKXA 4ECRA 3KLEA 4YR0A 1N48A 3JSMA 1EETB 2R2TA 2BRLA 5HLFB 3C6TA 2AU0A 5HROA 3N6NA 5EDWA 2BQ3A 2ZD1B 3HVTB 4K4UA 1OS5A 5KFYA 3NGDA 1T03B 1IKYB 4RNOA 2OPRA 2C28A 3ICLA 3N6LA 4RUCA 4K4TA 3PW2A 1S6QB 3D5MA 1S97A 1S0OA 4WE1A 3V6DB 1HPZA 1RT1B 3DRPB 1TL3B 5KFXA 1ZTWA 3CDUA 4EBEA 1RT6B 5HBMB 2R2RA 2B5JA 4YR2A 1SUQA 4ECWA 4K4VA 1JLFB 3MEEB 2IC3A 2IM2A 2R8JA 3FFIA 1S6PA 3PJXA 5HLFA 2FJXA 3H40A 1RT4B 4KAIA 2GIQA 3PHEA 3MEGA 4U7CA 3HVTA 4KO0B 5EWFA 4WYWA 2FVRA 2C2RA 3IS9B 2YKMB 3QIPA 1LWEA 3KLIA 3Q8SB 4QW8A 2ZE2B 1GX6A 3CO9A 3KMSA 4Y2AA 4R5PA 3DYAA 2WHOA 4ED1A 1S9FA 3V6DA 1T3NA 4RW9B 4IQXA 2WB4A 3HVAA 3MECB 1FKOA 4R8UA 4HKQA 3ITHA 3DRPA 1XR7A 3IGVA 5L1IA 4DL2A 5HBMA 3I0SB 1CSJA 4ED8A 4NLGA 2JEIA 4WFZA 3T5JA 1YVFA 4URGA 4G3IA 3G6VA 1DLOB 4K4WA 3LP2B 3KK1A 3BGRB 1ZTTA 1RT4A 4KB7A 2ATLA 1REVA 5F9LA 2DPJA 3UQSA 1JXLA 1KHWA 3H4DA 1U09A 3IS9A 3DM2B 2FJWA 2XCPA 3E01B 2XCAA 2F8EX 4PQUB 5DQGA 3FSIA 1RTDB 2BANB 2J6SA 3UR0A 3I5AA 4IFVB 2UVUA 4URQU 4IRDA 3MECA 5FDLA 2UUTA 3V81A 3KLFB 3CDEA 3PW7A 1RT3B 3DRSB 4WXOA 5J2MB 4NLSA 2IAJB 1N5YA 1J5OA 3IN5A 2FJVA 3LP0B 4Q0BA 2HNYA 4O4GB 5J1EA 4IKAA 4NLOA 3LAKA 3OSPA 2BQUA 1DLOA 3BGRA 1S9EA 3HVWA 3PR5B 4WYLA 1NNDA 5KFBA 5K14B 2WTFA 1C0TB 1N6QB 2R8IA 1TL1A 1TKTA 3MF5A 5L1KA 5EWGA 1NHVA 3LANA 2WOMB 4NLPA 1Z4UA 4PQUA 4NRUA 4KKOB 3OL6A 4ZVGA 1IKVA 2JEJA 2JC0A 2BANA 3GIMA 3EPGA 2VG7B 4IFVA 2R8GA 2V4RA 5KFKA 1RT3A 3DRSA 4J9QA 3QLHA 2IBKA 1K1SA 4Y34A 4I2QB 4B3OB 4GC7A 3H5YA 2J6TA 5J2NB 1QAJA 3GIIA 1KLMA 1W25A 3MR6A 2OPPB 4J9KA 3DI6A 2HNZA 2E9TA 1RT2A 2O5DA 3DOKB 4IG0A 2ILZA 2W9BB 4ED2A 5K14A 4TN2A 4F4YA 4NLXA 1C0TA 1HYSB 3HHKA 5KFZA 2ASLA 2YKNB 1TKXB 2V0NA 4MIBA 3GIKA 3KK2A 5KFHA 1LWFB 5HROB 4JV1A 4QWDA 5KFTA 1TKZB 2WONA 2VG7A 5C24B 4ZP8A 4DL4A 1C2PA 2HMIB 4YP3A 5HP1B 4QWCA 2AX1A 5F8MA 3M8PB 4KFBA 1LW2A 5F8LA 2UVVA 4ECUA 3HKWA 4NRTA 1N56A 3E51A 3PW5A 5KFNA 1HPZB 5DGBA 2AGOA 1RTHB 3M9NB 4Q43A 2B5JB 3OL7A 3PZPA 4ZP9A 2IC3B 4ZVFA 3FFIB 1S6PB 3CWJA 1JKHB 1LWFA 1EP4A 3MFHA 5C25B 1DTTA 4URSA 4XO0A 3MEGB 4PUOB 1TKZA 1KHVA 4MK7A 4NZ0A 2JC1A 4ECSA 5C24A 3VQSA 4KHRA 3T19A 2HMIA 5J2PA 5KFOA 1JLEA 3QIPB 4QW9A 5DLFA 5HP1A 2BQRA 1LWEB 3KLIB 1RTIA 3M8PA 5DQHA 4H54A 1ZETA 4J9RA 4MK8A 4R5PB 3QGIA 3DYAB 3Q8QB 2AQ4A 1N4LA 3BSOA 3G6YA 2VA3A 4R8UB 1FKOB 5JUMA 3ITHB 1RTHA 2FVCA 5L1JA 4O3QA 1HARA 3KLHA 2IMWP 2ASDA 5I3UA 4ED7A 2AX0A 3QZ8A 2R2SA 2CJQA 1JKHA 1RA7A 1FK9A 3KK1B 2ILYA 5C25A 4I2PA 4RUAA 2FLLA 1REVB 1UWBA 4PUOA 2XI3A 4ZPBA 5KFGA 1SH0A 3CJ0A 4EEYA 4DG1B 4ZMMA 3Q8RB 1HQEA 5D3GA 3RAXA 1BQNA 4TLRA 3MR3A 4ID5A 4KE5A 5KFJA 4EYIB 3QGHA 2I5JA 3OLAA 3OSNA 4KBIA 1HNIA 5J2QA 5KG5A 3PJWA 5KT5A 4X2BA 1IKWB 1TVRB 5KFLA 3BSCA 5F8NA 5FDLB 3V81B 4PWDA 3DDKA 4MK9A 3BREA 2GC8A 3KHGA 1N5YB 2XI2A 1J5OB 4NLYA 2JLEA 2XGPA 2RDIA 4IH6A 4Q0BB 2HNYB 5J1EB 1T94A 5I42B 1HMVA 3FDSA 3MEDB 1S9EB 1S1WA 4TY8A 3BQ1A 4J9OA 1D1UA 3RAQA 5KFFA 2JEFA 1BQMA 1TL1B 4DG1A 1TKTB 3Q8PB 2AGQA 4MKBA 5F8IA 2B6AA 1QAIA 2WCXA 2YNFB 4NLWA 3IRXB 4TYAA 3LP1A 1QE1B 4TYBA 4JUZA 3QZ7A 1RYRA 1IKVB 3MR2A 1LW0A 4RW6A 1HNVB 5KFAA 5EWEA 3MFIA 3C6UA 3CVKA 1IKWA 1TVRA 4F4XA 2E9RX 3OL8A 3RBEA 2C2EA 2B43A 3H5SA 3QLHB 4OL8A 1S9GB 2R8KA 3CJ2A 2AGPA 4WZMA 1RTJB 1S48A 1KLMB 4EO8A 4KV8A 3I5BA 4MFBA 5F9NA 3DI6B 2HNZB 2UVWA 4Y2CA 5I42A 1RT2B 4LSNB 4IG0B 4EBDA 3MEDA 1MU2B 4O4RA 3UDLA 3DLGA 3PVXA 2UVRA 5KFWA 1JLAB 4QWAA 5F8HA 4NLQA 2YNFA 3KK2B 1JLQA 3IRXA 1RAJA 1QE1A 1LWCA 2WRMA 4WXWA 3MTKA 4ECZA 4DL6A 2W7OA 2W9AA 4IR1A 2GIRA 2WONB 1HNVA 3DLEA 3QIDA 3PW4A 4RNNA 4J9LA 2V9WA 3IG1A 2YNGA 4NCGB 3SFUA 4KFBB 4ZP6A 4DEZA 3IGNA 1S9GA 3N6MA 4ZVHA 2HWIA 5KG1A 3UPFA 5F8GA 4DL7A 3OHAA 4LQ3A 1DTQA 1LW2B 1RTJA 3ISNC 4ICLA 4RW4B 2ZKUA 3TVKA 3GV8B 3KNAA 4O3SA 3NMAA 1S1VB 4LSNA 2RDJA 1MU2A 3ISND 3GILA 1XR6A 5KFMA 2ALZA 1S0NA 5DQIA 1JLAA 4G1QB 3KMQA 3BQ2A 3NAHA 3RB0A 1EP4B 2OPSA 4TQRA 1DTTB 1IKXA 2VG6B 3G86A 3QGGA 4Q8FA 5KFVA 4ZPDA 4K4ZA 2R8HA 5J2PB 4K4YA 1JLEB 5C42B 5KT6A 4ED3A 3KHHA 1RTIB 4NCGA 2QE5A 3KHLA 4DL3A 2EC0A 4IH7A 4H4OA 1I6JA 1RT5A 1JIHA 3FRZA 4RW4A 4RW7A 2VG5A 5KT7A 4QPXA 2OPQA 2HWHA 5KFCA 1S1VA 3I5CA 3DMJA 2W9CB 2BR0A 3QO9B 1FKPA 4ZPCA 3KLHB 3DRRA 5KG6A 4IFYB 4WZQA 4EO6A 5I3UB 4G1QA 4ZP7A 2W7PA 5KFIA 1XR5A 1IM4A 5KFEA 3KJVA 1FK9B 4RNHA 3D28A 4ECQA 4I2PB 3V6HA 3PW0A 2VG6A 1UWBB 4IR9A 3TAMA 3T5HA 3V6JA 5KFRA 4IRCA 1T05A 4XPEA 2UUWA 1HQEB 5D3GB 5CYMA 3MR5A 1BQNB 5C42A 4ID5B 3KLVA 1C1CB 2V4QA 2I5JB 4IDKB 3BR9A 4ZHRA 1HNIB 3NBPA 5J2QB 2IJNA 5L9XA 3NL0A 4MIAA 4ECXA 5KT4A 2D7SA 2XGQA 4ED0A 4RW8B 4XPCA 4LSLA 1S1XB 3LAMA 2W9CA 3H5XA 4PWDB 3QO9A 4H4MA 4LQ9A 5KT2A 1S10A 2OH2A 4IFYA 4J9SA 4F4WA 1VRTA 3KLGA 4QWEA 1HMVB 2DPIA 5KFPA 1S1WB 2RF2B 4TY8B 3M9OB 3H4BA 4HYKA 2IM1A 2WK4A 1SV5A 2BE2B 2RKIA 3KK3B 3JYTA 1BQMB 3GYNA 3PR4A 3GIJA 1C1BA 1C0UB 3CJ3A 1S0MA 2B6AB 1C1CA 1D0EA 4Y3CA 3LP1B 1S1UA 4IDKA 2YNHB 1LW0B 1RYSA 4RW6B 2YNIA 4R0EA 4U6PA 4NLTA 3EZUA 3C6UB 2HAIA 3I0RA 4RW8A 3BQ0A 4ZPAA 1S1XA 3V4IA 4NLUA 2D3ZA 4YR3A 1JLCA 4O3PA 1S4FA 3SFGA 4FS2A 5KG4A 4NLDA 5KFDA 1EETA 4O3OA 3RB3A 3BJYA 4KV8B 4O44B 4MFBB 4NYZA 2C2DA 4F4ZA 2ZD1A 3RBDA 2RF2A 4TXSA 3T1AA 4RU9A 4EBCA 3SI8A 2FLNA 2BE2A 3DLGB 3KK3A 1T03A 2XWYA 5JXSA 4EYHB 4MH8A 1C0UA 1IKYA 4RNFA 3KOAA 2JEGA 5KFUA 4KHMA 1JLQB 1LWCB 2IJFA 5KG7A 1S6QA 2QV6A 2YNHA 1HQUB 4ECYA 3M8QB 3T5KA 3NKYA 3DLEB 4IG3B 4F50A 4K50A 1RT1A
chains in the Genus database with same CATH superfamily
1RHUB 4YQWA 2AEJA 2ZBRA 3QJJA 5GADU 4ICLB 3GCWP 4KPYA 1E6YB 2CZ4A 3DRXA 4WFBQ 2RRNA 1RBOB 2Q1LA 4FS1A 2GHWA 3DOMB 3AFGA 3I0SA 5T7LA 2KFZA 5CZVA 3TNVA 4L3KA 1FJGF 2LXFA 3TANA 4U67Q 1H2VZ 2DGOA 4ZITA 3CCLS 4PG8A 1U24A 3C15B 3DC2A 4FBUA 8RUCA 3M05A 2DY9A 4JV0A 1PBAA 2HURA 4I6WA 1Q81T 1SQEA 1FJ7A 3HP6A 4LFBF 3R5GA 1HWIA 2XYGB 3M9MB 1X5TA 4YHHJ 4I2QA 1WKKA 1WSVA 4G1IA 3J7Z5 4X64F 1JLGA 4CLSA 1TKXA 1NPKA 2DCLA 4AD6A 3Q86A 4GRSA 3RJMB 4DV1J 4WE1A 4PYDA 1S77D 3CDUA 1RT6B 2J0SD 1BGXT 5F3ZA 4MYTA 4C3KA 1RT4B 5HVGA 3DNCA 3VAGA 3UCUP 4WYWA 3R97A 1T02A 3IGVA 4KGXB 3GJRB 2IRUA 1FERA 3KK1A 1OQ6A 3GSIA 4DV0J 2ZH7A 2FJWA 1WACA 1Q7LB 2HVIA 3FSIA 4NXNF 1RTDB 1XEZA 1QAYA 2QMXA 3CDEA 1VFJA 2EI5A 5J1NA 4JB8B 3PHTA 5EWGA 2WOMB 4KQZA 5LXRA 2DIVA 1OJ4A 2XS5A 1X5SA 4Y34A 2J6TA 3SCJE 1KLMA 2B4OA 3SDEB 4DN9A 4X66J 5KOXA 2R42A 4DV2J 1RHKB 5KFTA 1TKZB 4F26A 2AEMA 1FRIA 1LW2A 2ZBQA 2KT3A 2P2CB 3IMQJ 3GFHA 2W7AA 3VGSA 1F2HA 3BGOP 2B3TB 3K7RA 4MK7A 1IBLF 2XQCA 3VQSA 5A2QY 5J2PA 4DFMA 2H3EB 4GKJF 3OTBA 1VQ8S 5DETA 2OJ3A 4R8UB 1RTHA 4N5SA 3SQOP 2M2BA 4ZVPB 2R2SA 1JKHA 1RA7A 4NA1A 1BQNA 3QSIA 4OQJA 1HD1A 1IKWB 1TVRB 1MWQA 3M2VB 2GC8A 3AAWB 2Y0BB 2XGPA 8AT1B 4M5DB 2YKAA 1S9EB 3EXCX 1LQ9A 4DUZJ 3QJPA 3IRXB 5HANA 4WP8A 2UXCJ 3M8WA 3OL8A 3QLHB 2MQ8A 3GCXP 2AGPA 4X65F 3HHEA 2CQHA 5GMKa 2VQFF 3DI6B 1KOOA 2KJWA 4JI7F 3DLGA 5D4OA 2UP1A 4DLEA 4CNYA 1WTBA 4RNNA 4IUFA 4CM2A 4ICLA 2FGCA 2ZKUA 2HBRB 3KUEA 5A2QU 2DYAA 1X4HA 5KFMA 2HLTA 3RB0A 2CVEA 4WP9A 4ZLNA 2OUGA 4K4YA 3DOMA 1F3FA 4DX8H 4CLKA 3KHLA 2EFNA 4D3HA 5KT7A 2Z2LA 4PEOA 4DUYJ 3PJ9A 1GMWD 4IRCA 3ZNJ1 2XBPA 2OEMA 3W8GA 2OSRA 5J2QB 1Z2LA 2PO4A 5LJ3Y 4ZK7M 4GVLA 2OH2A 1F9FA 4JI8F 2O67A 3PDNA 3H4BA 5AXNA 1WOSA 2Z58B 2N4CA 1EQMA 2X7IA 4I6YA 4BBYA 2RRBA 2OKQA 4W4MA 1EKRA 3RBDA 5KFUA 1NM2A 2GCFA 3CPWR 5KG7A 2VU5A 1RT6A 3KXDA 4DPWA 4N8NA 2PI4A 1FDBA 2HG4A 4XK8C 3D6MB 2OEKA 2OPSB 5CYQB 4FBTA 1NHKL 2XMKA 1ZAVA 5IV3A 1TUWA 4QYZJ 4J9VA 1MMLA 5HQ8A 2HQGA 3CIZA 2LU2A 1RTDA 2W4DA 1OY8A 4YB1P 3HHLA 1JLBB 1W2BR 3AD7C 1QUVA 3CMES 3H59A 1R0AA 3FEZA 5KG2A 1B3TA 2J9DA 4FZVA 4LSLB 1VRUB 2BYCA 2FJAB 4H4MB 3QT8A 2WOMA 1Y5NB 3T5LA 5DG7A 5K8PA 3GR0A 3J7AN 4WTOB 2VOPA 4OYPA 3R5DA 1NDKA 5DDQC 3TUIC 3VQTA 4DR4J 3SDEA 2B51A 2HK2A 2R2TA 2BRLA 3MOZA 1GXTA 2MZ1A 2XWXA 3FEXB 4ZJQA 2UXDF 1NO8A 2HGMA 1IQTA 2I9SA 3J81j 2QLBB 1QVGR 4DR5J 5HBMB 4ELUA 4ZDNA 3MEEB 4OMFG 4ITSA 2WB1D 1CS4B 1X4DA 3EJMA 1LK5A 3A3OB 1Q78A 4V19X 3D7SB 5ETMA 1T3NA 2AJ2A 4R8UA 3TX0A 3CIMA 4AE5A 1S79A 5DDRC 4J7CA 4I68A 3PYDA 5IXUA 1N32F 1BQXA 1RSCA 2YQ1A 3G71S 2WSFC 2XCPA 2CJAA 4DX6A 3GU0A 4IFVB 3M2VA 3MECA 3KLFB 3P3DA 5J2MB 2IAJB 1AFIA 4QU7A 1LKZA 4M5DA 1DLOA 1S9EA 3DDNA 3PRDA 3PG9A 1C0TB 1R0CB 5L1KA 2CG8A 3U7JA 4CLLA 2KTQA 3VZIA 4LMZA 3QLHA 2IBKA 1QAJA 3DI6A 5K14A 2M8DB 3P5TL 3HHKA 3GYXB 4DCPB 3GIKA 3HHLC 3BKFA 5F8MA 1I1GA 3Q8UA 1I3OB 1MROB 2BX6A 2HEKA 4DN0A 2LU1A 2VDIA 1WC5A 1HNWF 2W2NP 2FJDB 4H54A 1RBAA 2EWHA 4X62J 3FBFA 2FD2A 3DDIA 4LF5F 1KFSA 5A8KB 2ZM6F 1U4BA 2Q43A 3MMAB 1HKAA 2PMWA 4ZPBA 1IBMF 1SJ1A 4EYIB 3QRPA 5J2QA 2QA4S 3EGWB 1H74A 5F8NA 3A8EA 2Y9HA 2O3DA 3ONQA 1N34J 1T94A 2AIRB 5ETRA 5KFFA 3BF4A 2Z4PA 2E9RX 2YKPA 2EKYA 3J7YI 1S48A 2LQ9A 3K59A 1UCNA 2YQ3A 2K2PA 4FF3A 1ZH5A 2YNFA 2VBYA 2XLJA 4DSLA 4MIWA 4DR1J 1H2UX 3AOCA 3MM6B 4ZP6A 5E3PA 1Q95G 3QAEA 1OSCA 9ATCB 2CIMA 3WDOA 2Q6CA 3O5TB 3H2UB 2OPSA 1SJQA 1WHWA 3QT5A 2FY1A 3P8BB 1MWZA 2MKIA 5I3UB 2LEPA 4A48A 1HQEB 1UVMA 1HNXJ 4ED0A 4LSLA 5U47A 1S1XB 3D2WA 3QO9A 4H4MA 4RBVA 1B4SA 3HD1A 2XY7A 2IM1A 4GO7X 1V3RA 2LFVA 1UWAA 1C1CA 1FXRA 4QQBA 9RUBA 2XMVA 3C6UB 1VISA 1FX2A 2M70A 2V5HG 5KG4A 3W62A 4NLDA 1XMQJ 1R31A 1T8EA 4RNFA 3UN2A 2XNQA 3K58A 4ER8A 3EICA 3ENQA 5H1SV 1K1QA 4OX8A 3UN3A 1KQKA 3MEEA 1NDLA 2G9OA 1NZ8A 3TJ8A 1CS4A 1U0SA 1S49A 1VQ7S 5IV4A 5KG3A 3M8QA 1CC8A 3TVYA 1K8AT 2VBZA 3BSNA 1ZPVA 2OPQB 1JX4A 3DMJB 3DRRB 1V3SA 1HBNA 3KJVB 2BW7A 4FF1A 3KLFA 3A3PB 4DMZA 5J2MA 2IAJA 1WEZA 3MMCA 2BKPA 2MMYA 4IOAQ 3E3XA 1L3KA 2D41A 5SZTA 3QYYA 1C1BB 3BN4A 1KS2A 1RAEB 4OLPA 3FRYA 2BEFA 4LF8J 2YNIB 5G4DA 4YN3B 2XHCA 4KGKA 3N6NA 5KTQA 2HAFA 4E0DA 2GVDA 3K57A 1MROA 1VRQC 1YWXA 2R2RA 4BC7A 5BR8F 2VBXA 3UNGC 5HLFA 2P5VA 4KAIA 3UR3C 5BJRA 5ETTA 4KO0B 3VGTA 4TU8A 4OI2A 3UNYA 4JI3J 2AV5A 4FF4A 3QJLA 2JH3A 5M2RA 1NJWA 1TKDA 2IDLA 3GR1A 3IBWA 2M9KA 4K4WA 3LP2B 1U48A 5F9LA 3H4DA 2F8EX 3QMQA 4Y0FA 4P7TA 1U8SA 4WKRA 2HHHJ 1VQKS 1OQ3A 4XDCA 3GONA 2B9EA 1N6QB 4NRUA 1FA0A 3SCLE 1RT3A 4J9QA 3C8YA 2JWNA 1RWMB 1CJVB 2KHCA 2ILZA 4ED2A 2IVMA 3OPKA 3B82A 1H73A 4ZPTR 4WP3A 3GIRA 4ZP8A 1RWUA 5HP1B 2AX1A 4WF9Q 1HI8A 2ROPA 2UVVA 3PW5A 3V5RA 1WG5A 2EFVA 3NMRA 2MY8A 3MPYA 1DQ9A 3ZTQA 2ABYA 2DGWA 4ZP9A 2VQEF 1IBCB 3FFIB 1LWFA 5C25B 3EGNA 1WSRA 4PUOB 5C24A 4KHRA 4JYAF 5ETKA 3M2RA 4F67A 2E1MC 3ENVA 5L1JA 5I3UA 2MQPA 3QZ8A 2VD3A 1ZM4A 4USMA 5CA5A 1XQIA 4CO3A 3NCRA 4DG1B 1HQEA 3OSNA 3UI3A 4DZ6A 2BA9A 4RLEA 2Z2MA 4J5OA 4NI2B 1E6VB 4KGZB 2NXUA 4IH6A 3D1OA 1CBKA 1M1GA 4HR2A 1TKTB 3GP9A 5ETVA 1IKVB 3MR2A 3M6UA 4B9VA 3C6UA 2M88A 2Z0GA 1S9GB 1RAOA 2XM3A 4OV6A 3DU5A 4EBDA 1EX8A 1XMOJ 1JJHA 4DR6F 4NLQA 3S8SA 1ZA2B 4FPIA 1HNVA 2QGFB 4R25A 5CYJA 2V9WA 1TK0A 2AYBA 5E2QA 3AODA 3MAAB 4ES2A 3ISNC 2Q79A 2V8VA 4DV5F 5B09A 4U7UD 5CXTA 5DQIA 1X0PA 1Y00A 4FNIA 4Q8FA 1VOMA 2RQ4A 5I3QA 2APOA 2XMWA 1PJ6A 4P73A 2EC0A 1I94J 1JIHA 3JQKA 1Q5VA 2OPQA 2HWHA 1GXUA 3DMJA 3DRRA 2ZEJA 4UUXA 4ZP7A 2CJ9A 3KJVA 3HD2A 3D28A 3ENAA 5KFRA 1IWGA 4IDKB 4OYBA 2F4VF 5HVFA 2W9CA 4IFYA 1B0TA 3LA0A 3M30B 4YB6A 3TJ9A 1N8RT 3PEHA 3FSYA 3KK3B 3PR4A 1C1BA 4GVBB 2YNIA 1RHMB 1HIYA 3BQ0A 2RMLA 2FZGB 2DNMA 2LVWA 2FLNA 1UETA 3KOAA 4KHMA 1JLQB 3ULHA 1ZM3A 3NKYA 2H9ZA 2E1RA 1U26A 1WHVA 1NMEB 3CCMS 1CJUB 3RRGA 4CIOA 4Q7AA 1IM6A 2GMHA 4WU2A 4KO0A 2XMUA 2W8KA 3PTWA 4YOEA 5D78A 1VIXA 3D68A 4RZRA 2MKCA 3H2LA 4I7FB 1IKXB 4UT4A 2IM0A 1HNZF 4JV2A 4WIIA 3LP2A 2I1RA 2DNGA 3H98A 3CCZA 1RT7A 2AZ3A 1F6TA 1YJTA 5KT3A 4X4PA 3TQ1A 1O5JA 4NMLA 5CCMA 2PA8D 1W26A 4RNMA 1UVJA 3FGVA 2C42A 1N6QA 4DSFA 4NA2A 4LR8A 4N77A 3MGJA 2LEAA 3BPSP 2BDPA 1TL7A 1CJVA 2EPIA 4JI6J 3K5LA 1VC0A 1JLCB 4ECRA 4K0KF 4LREA 1SJFA 2ZD1B 3PO5A 2L9DA 2AMCB 4QJVA 3Q23A 4U8VA 3NGUA 2EFOA 3TA2A 1KONA 2QJ3A 4AQYJ 2WVBA 2R8JA 3FFIA 3SMZA 3EVOA 2IYGA 1WI8A 3RR7A 1M1KT 3Q8SB 1P6TA 3F41A 3NOGA 3V6DA 4A8SA 3DRPA 4URGA 5K20B 2LXUA 3DLLQ 1KBRA 2N82B 1KHWA 4PKDB 1IJEB 2UUCF 3DGPB 2CQCA 2XLKA 3D0IE 2V8DA 4WXOA 3M32A 4NI2A 5D0GA 1WC1A 3IWXA 2PDAA 1M5PC 3AH6A 2EK1A 1TKTA 1ZYQA 1IKVA 4DHVA 2VFSA 3DHXA 4LVNP 4RX6A 4DV4J 1VC5A 1TAQA 2MQNA 4GC7A 5ADZA 3GIIA 2POKA 4J9KA 3TR5A 1KVJA 4UF4A 1U1QA 4QWDA 5D4NA 1DZ5A 4KH0B 1O8BA 4HTJA 2YX7A 3MAAA 1RAAB 2B5JB 2GHPA 4URSA 2DNHA 1V5IB 5ITHA 3ETMA 2H54B 3D1QA 2AQ4A 2CNLB 3P96A 2HIYA 3TJAA 1F60B 3G96A 1N52B 2VC0A 1RXOB 2JFKA 2ZH2A 4HI1A 2F1FA 4XDDA 3PJWA 3T1YF 2F63A 2HIQA 1RWVB 4IQMA 3CJQA 1VBKA 3M30A 4CO4A 2HNYB 3V4MA 5I42B 1CG2A 5L9NA 3SV4A 2QSFA 5BYSA 3CSKA 2DEJA 4NLWA 5LXYA 2F5GA 3HFZB 3QATA 2KG0A 2DO0A 2YWFA 4CI0B 4O4RA 3PVXA 2YY3A 3OJUA 4QWAA 1ZZNA 4ETZA 1JLQA 1K73T 1IVZA 2W7OA 2W9AA 4IR1A 4F2SA 2H5IB 3NP5A 1DQAA 3X1LB 5GAGU 4ELVA 2RD5C 1CJUA 5KG1A 3TVKA 2BZ2A 1PAEX 1BUXA 2E5LJ 1S1VB 1LXNA 3CTRA 2B4VA 1FXDA 1IKXA 3LOUA 4DUTA 4DV0F 4K4ZA 2B9WA 4ILLA 4DL3A 4LF7J 2A1BA 1FFWB 2HHWA 4C98A 3PYFA 2LLZA 2SXLA 2RH3A 4P7VA 3ZFVA 1P9QC 3MM7B 3O3LA 4RWXA 4FNHA 2QA1A 1RISA 5HAOA 1X9MA 4ZVQB 2QA2A 3NL0A 4ZVSB 3BO2A 3H5XA 4J9SA 3MCNA 1EB0A 2HQ3A 4V19J 1LOUA 4X66F 4NZ6A 4Y3CA 4DV2F 1X4GA 2HK3A 3GJTB 3PACA 4R0EA 4CO2A 5LM7E 1YJUA 4B9TA 4B3TJ 1JLCA 1R8AA 1SKSA 4FS2A 4O44B 2ZD1A 2MSSA 1AT1B 3PIPQ 5L39A 4EBCA 1M0SA 4EYHB 2L9NA 1U1OA 3NEKA 4J9NA 3UD3P 2D3UA 1KFDA 2PEHA 3GLJA 1X4BA 1KN6A 3BYRA 3OLBA 1SKWA 3FVYA 4B3MJ 5GADI 7FDRA 3OR2B 2XYPB 3RAMA 3DGPA 1MW7A 3TAMB 2RRAA 1S1TB 5HVHA 4DUZF 2GGPB 2XSFA 1RHQB 1X4AA 1NJIT 5D15A 2FQQB 4C8MA 2UXCF 4WFXA 1MG7A 1GMWA 4TY9A 3KHRA 3GQCA 4TVAB 1SV5B 4WFYA 1RU2A 1SB6A 5D0EA 2OPRB 2EFPA 4OYOA 4A8OA 2F8MA 3GZ7A 1VHIA 3I0RB 1SUQB 4WTYA 1FT8A 5K5MA 2P6SA 2BOAA 1RWKB 4DV6J 5LMNF 3L3CA 1IKYB 3CXCR 4USJC 2NUUG 4C0BA 4PXEA 5KFXA 2B5JA 4M5JA 2CZ9A 4U7CA 4P6QA 2OELA 2QT7A 4X84A 3D3BJ 3HSZA 3AB4B 3TEGA 3LUYA 3S6EA 2CPJA 2WW8A 2YKOA 2AJFE 3I4PA 2VODA 3BGRB 3MAQA 1SQGA 3JXOA 4QCLA 1U49A 3DM2B 2XCAA 4QYZK 2MKYA 2UVUA 1T9UA 1UW9A 1QTMA 2HNYA 5CHCB 1F9EB 3HVWA 1TFWA 3D67A 3T3FA 3OL6A 2RSQA 3GIMA 2D74B 3LWLA 2CYYA 5D8HB 1UVLA 4USKA 5J2NB 2C3OA 3DOKB 1QM9A 1R89A 3JQMA 4C6AA 2CQ0A 3ET6B 5DJBA 2R7XA 4DL4A 4C2MA 2J7WA 4OHXA 4ANDA 3H8YA 2QEXS 4EZ6A 4OI3A 1SCJB 4ZLLA 3HKWA 1M5KC 4MKVA 5KFNA 2VPXB 4HH1A 1LV5A 1B64A 2GZOA 1RE1B 4NZ0A 2CZVC 2HMIA 3I9V9 3QIPB 2ZC3A 4DWIA 1ZETA 3THPA 3L7OA 2CQDA 2HQDA 3MPUB 5IT9U 3CCVS 2M4MA 3CUNA 1HARA 2ASDA 2BMBA 1NK6A 4DU7A 3O8WA 3KG4A 4OI4A 1RADB 4KE5A 1RGVA 5DM7Q 5KFJA 3QGHA 2AEFA 6FDRA 1YLXA 4DR4F 2B4UA 3BPDA 1HR0J 2B9YA 2AGQA 1OWXA 1QE1B 2J0XA 3GPAA 3GMGA 4JUZA 4GO5X 2OMLA 4F4XA 1VCTA 1QVFR 3I32A 2CG4A 2HZAA 3KJFB 1U45A 2HHUA 4FDFA 4OZ3A 4EFAC 2HNZB 1RT2B 1UEKA 1KEKA 1ICEB 1UZHA 2UVRA 1DAXA 2EFQA 1J2VA 2OMOA 3UDVA 1YZ6A 1F5AA 2FB0A 2ZZTA 2DHXA 2DGQA 1D8ZA 5F8GA 3N6MA 1FDDA 2VDHA 2F65A 1MU2A 1X7VA 3N79A 3CC7S 3L7UA 1JLAA 2R7WA 4YB7A 1HHSA 2HS4A 2VG6B 3D4JA 4ZPDA 1Z2ZA 3CE8A 2V2KA 3T9NA 1RTIB 2RUSA 3FRZA 2E1CA 4PAAA 2XTJP 1GMVA 4ZPCA 2ZH9A 2K06A 3CNQP 1FHTA 2JFDA 5FJ4A 2GVZB 1UWBB 3TAMA 3V6JA 4XPEA 3MZIA 1N54B 4ZPVR 1KTQA 4UQGA 4ZPWR 1R6VA 1R0BG 3SSSA 3M8SA 2FC8A 1UJ5A 3FKBA 2MQQA 3N5FA 1SV5A 4U9RA 2KT5A 3CJ3A 3FJ2A 2VF3A 3OFFA 3W8PA 4DSJA 2HAIA 3I0RA 2YBVA 2B9XA 2LEBA 3DXBA 6AT1B 4LF9F 3CCTA 5HN0A 3ILOA 3EM1A 4UY85 1IKYA 2DHAA 1NRKA 4NASA 2YNHA 2WVDA 3QSYB 2FVQA 1TMJA 4N41A 5HK4A 3U1LA 5A6PA 1NUEA 1SQFA 1HW8A 1NK0A 1HBMA 1X4FA 2B8QA 5J1PA 1F0XA 1HQUA 3N28A 1SKUB 2DGSA 1FEHA 2PEBA 3JS9A 2ZVSA 2ZWOA 4K4XA 4ED6A 3DM2A 2IRXA 4Y00A 1N34F 4MJKA 1HHTP 3WIUA 4B02A 4FVMA 3NBPB 1TL4A 2DNPA 1Q8BA 5CD4A 1JMTA 1I51B 2XZWA 4LF1A 2CPYA 2BRKA 3KYLA 5I3PA 1YJ7A 3L09A 3IP0A 1PAUB 5K8MA 4J9PA 5J2NA 1UFKA 3M8ZA 3DOKA 3NLCA 2J8AA 5AJ3F 4P52A 4F02A 2HVEA 2HKEA 3T6JA 2DT9A 1N48A 2MLXA 3ET6A 3NGDA 3ZZOA 1WOPA 2D3OR 2K8GA 1NK5A 3BR8A 2IFXA 2GAHC 1U1KA 4K4VA 1FWLA 3H40A 1Q16B 3PHEA 2XMAA 1WHXA 3IS9B 3QIPA 3D6HB 5A8WA 3ZNUA 3KMSA 2AJ1A 2GIFA 3BDEA 4ED1A 1TTHB 4WFAQ 1TL5A 4E98A 4AL7A 2XO7A 3RBZA 4WFZA 4WBFA 4U95A 1S0VA 2DPJA 3UQSA 4RBUA 3IR5B 4C9DA 5FIIA 4NYOA 3G82B 5H9EJ 4LFCJ 1WOOA 2YTCA 3VGUA 4ED5A 2FLOA 2V4JA 3BS9A 2KHDA 3IC1A 3M2UB 4IKAA 3F73A 1VQNS 3NGSA 2ATCB 3VV2B 3OW2R 2HW3A 1XNRJ 3C14B 4J91A 3POTB 4LF4J 1S7IA 3NNCA 2Z57B 2HNZA 4F7VA 1RT2A 2O5DA 3W65A 4L72B 4DS4A 2YKNB 5HROB 1UL3A 2DKOB 2VG7A 2NXEA 2VZ9A 4ECUA 1FNXH 2MDAA 1ZA1B 3EGZA 1VQYA 3CWJA 2OO4A 1NSPA 1RTIA 2F8HA 2ZBIA 3G6YA 3K17A 4O3QA 3EZ5A 2AX0A 4FYYB 2IY5B 1ITPA 2ILYA 2HRYA 1UWBA 1NLKL 1IR2A 4DLGA 1P27B 5KT5A 4L73A 3O1LA 2CJKA 4P75A 3UE2A 2LYVA 1WUUA 2XSJB 3CO0P 4LF8F 1JJCB 3FDSA 3DU6A 2PI5A 3Q2SC 2A3JA 4CO0A 1QAIA 2WCXA 1RACB 4ZKAA 3BGFA 4N7TA 2B43A 1P9YA 4ATNA 1CQMA 2MLYA 1KQFB 3MEDA 1RJJA 4CM0A 4NL5A 3PV8A 2LP4A 2GMLA 2WRMA 4OZ5A 3Q0AA 3VVUA 1FXLA 4C11A 3IGNA 4C7QA 4W90B 4JI3F 2IBOA 3UCZP 5DS7A 3ISND 1RB0A 4MKYA 3CCES 4HH0A 2H1YA 4ZCLA 4AL5A 3VALA 2JVOA 4DJBA 5C42B 2L41A 3DLJA 2ZNZA 5K9FA 4EGLA 4ANCA 1FF2A 1NH8A 1G4CA 2JSXA 1L3SA 2FHKA 2QYGA 3N9UC 4DPOA 2ZHOA 1IBKJ 3NBPA 2XGQA 4RW8B 3EUNA 2MKKA 1SL0A 2GW8A 5T41A 1D0EA 2A2DA 2A10A 1HI1A 2QFJA 4HHJA 4G65A 6FD1A 2JLGA 2XMJA 3HHNB 1LWCB 1PG5B 3FBCA 1VGYA 4YMEA 2MPUA 1UZDA 4DQSA 2GFFA 1R43A 4X4QA 1T11A 2KG1A 3TRGA 3Q22A 1LFWA 4RW7B 2ZC4A 3AA8A 4LBHA 5CH7B 1FRLA 3CDAA 3S7RA 2FYXA 2FVPA 2J8SA 2CPDA 3H90A 5DGAA 3ZTPA 2IA0A 2X1BA 1ZM2A 4FYWB 5CYMB 2CDRB 2PIIA 4M5GA 3FNNA 4P10A 4OHZA 3V6KA 4CRJA 2EC2A 3FBBA 1JLGB 1UP1A 3LH2S 1CJKB 3QAUA 3P49B 3NS7B 1P1LA 2W2PP 1XMOF 3C14A 3A13A 3I96A 3GV5B 4IH5A 4OYMA 3SEOA 1V9OA 2XYHB 2X1GA 4WE1B 4K4SA 3CMAS 2V2QA 4OZJA 2YKNA 2V94A 2ZVIA 4YR0A 3JSMA 4NXNJ 5HROA 1SKRA 3F44A 1MNEA 2GQQA 5IT4A 3C16B 2YWWA 1U8WA 3G8QA 1S6QB 3W60A 3PCOB 3HX9A 3AJ2A 1I94F 3W66A 3HVTA 2Y1RI 1VQ6S 1QAXA 2KZZA 2G1HA 2CWXA 2QZ8A 3E8OA 5HL7Q 1VQPS 3CB4A 1EJ7L 5I4MA 2WB4A 3NCPA 4YS2A 3CCUS 4ED8A 1MWYA 1OYDA 3GSDA 1YVFA 2F9DA 4JP8A 3Q2TC 1VDHA 1JXLA 4QOTA 3ZXWA 3LPYA 1G2EA 1RWOB 2PFDA 4DFJA 1T9WA 3A4TA 5DQGA 2LQ5A 4LVOP 2P8IA 1VQMS 3I5AA 4ZOSA 3HVRA 3MM5A 3OVAA 2XSJA 1U25A 1HBUB 1NNDA 4ERDA 2BJ3A 4AXIA 1L5UA 2OLWA 2NR0A 4NLPA 1YRXA 3LO3A 1XC9A 2BANA 1OPZA 3RW6A 3TUPA 3HZEA 3DRSA 2VASA 1NCLA 4ANEA 1SIWB 2IJRA 5IOLA 3PRBA 3WBZA 5LSLA 1F5BA 1WJ9A 4YP3A 3K0JA 1O6XA 3I82A 4LIWA 4OYZA 1RTHB 5GMEA 3OL7A 5HATA 3PZPA 1IJFB 3MR7A 3QRRA 1JKHB 1YRTA 1SL1A 3SSRA 2CQBA 1DY3A 4HI2A 3KLIB 4KR0B 4FXDA 2G0IA 3HSJA 1RHJB 4JI7J 2XHWA 2DR5A 3DLBA 3VAJA 4KPCA 4DPUA 2DR9A 4PQAA 4O0NA 4EEYA 3Q8RB 1NH7A 3D1HA 3OT9A 2VICA 5E3AA 2COLA 2K7JA 4USTA 1S5ZA 4A8MP 1N5YB 2VV5A 3AT1B 5J1EB 4LFAF 2YPYA 3BQ1A 2F9JA 2IRYA 1MMDA 3VAMA 3KFWX 4TYBA 2LQJA 1HA1A 1OIAA 4F8RA 1GTEA 3W9HA 1LWCA 4ZN3A 2R3VA 3I87A 2VPWB 2DGXA 1VQLS 5RUBA 4ZVHA 4FPRA 1YZ7A 2K1RB 1Y5IB 5DO2A 4ES3A 4LSNA 2BM0A 3LTOA 3EXYA 4EZ9A 4F3QA 3TYTA 1H7XA 1F3VA 4B9UA 3CD6S 1Y7PA 5B0GA 1QD1A 1TZ0A 2O1PA 3JAMU 2CQ1A 4RW7A 2N7YA 1YQHA 1Q82T 1KOHA 3H7HB 1EQ0A 3T5HA 5CYMA 5IC6B 1X8DA 2HFNA 5A8RA 2I5JB 1B99A 1HNIB 3TW0A 5AE3A 1BC6A 2HZVA 1WHYA 1CJKA 2ZWPA 3K89A 1RBLA 4DPTA 4F0HA 4BCAA 1NJYA 3D9BA 5M2PA 1WF1A 2F3JA 2B6AB 2M52A 4CH7A 1RYSA 3P6YC 4NA3A 1UJ6A 2Z2YB 4C8KA 2HFOA 4YR3A 4KHPJ 2RF2A 2I2YA 2BE2A 5JXSA 3C16A 5DZ7A 1S6QA 4F50A 4ZLJA 1PC4A 1RA6A 2IA6A 3HHLB 1RDRA 2E9ZA 4DR7J 2LQBA 2H4YB 1R0AB 3TAPA 2J9CA 2P9EA 3DOLA 1HBOA 2QSWA 4DF4A 1Q53A 4IRKA 2J9DE 3I55S 3DLKA 4LF2A 2QLFB 4QWBA 4IOCQ 4BWJA 4X4RA 2HHPA 3A8KA 1HBUA 4DSEA 2DNQA 5AT1B 3VWSA 2ZHBA 1S76D 3VF0B 4QR0A 3H2VE 4ZVEA 2RKIB 2DNRA 3OHBA 5KFQA 1AXQA 2IM3A 2HBYB 3SYZA 3R2DJ 4CLYA 2V34A 1TV6A 2YH0A 2WAQD 4DCOB 1VK3A 3C6TA 4RUBA 2E5LF 1OY6A 4OZ0A 2KDOA 4RUCA 5EX3A 2EFGA 4FYVB 4GKKJ 1W2IA 4B3RF 3M7VA 3HZGA 1FE4A 2QLWA 2RT3A 5EWFA 3B78A 2YKMB 5DZ6A 3KLIA 2ASYA 3QT6A 1FDNA 3HVAA 3MECB 3PEJA 1X60A 3T5JA 1BHNA 2GV1A 2DGUA 2UUAF 1DLOB 3W1YC 3ISZA 4M5LA 1U09A 3H25A 3ZTOA 4P2SA 2E1PA 4QIFA 1EZZB 2NLWA 2W2MP 2KZMA 2RVJA 2XULA 1N5YA 3CJSA 3HJVA 5J1EA 2BQUA 1Q86T 5K14B 2G0CA 3JSBA 3R5JB 3RU0A 2R8IA 3MF5A 3OUYA 1U0HB 4KKOB 2JJ4D 4LF5J 2J0QD 3ILLA 1URRA 2VOOA 1AUDA 4OI1A 3PXGa 4TN2A 3TAQA 2BV3A 2ASLA 4OZLA 2CJYB 3DLHA 2KYXA 4JV1A 4PG5A 2H5JB 3NG8A 2Z56B 5LT5A 3G4SS 1PYTA 3MCOA 2EKNA 3IBCB 1NSKL 5KAKA 2K1RA 4M5HA 3FSXA 4B3MF 3FMBA 3MAHA 2RAQA 2JC1A 1CPZA 3T19A 2EEYA 2EBEA 5KFOA 2YPZA 2AJQA 1LWEB 2FZCB 3T6BA 4J9RA 4R5PB 3DYAB 3W2VB 5K8OA 3ITHB 2J7KA 2MZQA 2GQ2A 1NKEA 2FC9A 2E7WA 3MR3A 1SXLA 2I5JA 1HNIA 4DV3J 3RR8A 2H65B 1BWVA 3V81B 3M4XA 1T9XA 3U1MA 2JLEA 4NE9C 3KJQB 1ACMB 2ZOFA 2B6AA 2YNFB 2OD6A 3RG6A 2L3MA 4XIUA 1OYEA 3CVKA 4QR2A 5B0AA 2C2EA 4F36A 3D54A 5IT0A 4ED4A 2D1CA 4BHQA 2RE1A 4NOHA 4IG0B 4NMXA 1T9TA 1IWAA 3OSPA 4DQIA 2GIRA 4P71A 2ACYA 4R0JA 1TAUA 3SFUA 2CUYA 3GTYX 3JTOA 3NWGA 3GV8B 3AQOA 2XLIA 2Q66A 3UDEA 3PYEA 5GAGI 2L08A 2K3KA 4ILMA 5ETSA 3JTNA 4ED3A 3GFYA 1KQGB 3UW1A 1I5OB 4JOUA 2LQ8A 5IQQA 2CQIA 3QO9B 3CCSS 4DSKA 4Q5VA 4X4VA 1IM4A 2A0FB 2YVSA 2KXNB 4CO5A 1C1CB 1GTHA 3AD9C 2NYHA 3AA9A 1WORA 1F2GA 1TK8A 3LAMA 3R2CJ 4PWDB 4LQ9A 3IRWP 2E5IA 1RAHB 1B0VA 2RKIA 1WDDA 1FTRA 4DQPA 2V2ZA 4RW6B 4NLTA 4NX9A 3AB2B 2UZAA 1RLCL 1S4FA 3RB3A 2DNLA 1U1LA 2N4DA 4RU9A 3R1LA 1C0UA 1Q79A 4LBPA 5D77A 4UUWA 2QV6A 4ECYA 3M8QB 1GQEA 5DG8A 4U96A 2XS7A 1S99A 2DRDA 1R7IA 1AUSL 2R2UA 1D9AA 2FY8A 2G2YA 1RQ0A 2YKMA 1JJ4A 5HSPA 3GV7B 1HBNB 4IG3A 4JI1J 3IFEA 3MMCB 1QLNA 3MM8A 1VIOA 4UZBA 3PM9A 2CA9A 2DB1A 4PXDA 1FKPB 3CJ4A 4NPOA 2MHNA 4B9LA 1NAQA 1D8YA 2XC9A 1HR0F 1PILA 5BR8J 4OJGA 4ZHRB 5EUHA 1K9MT 2CPEA 1LK7A 4YEAA 2ZZNA 3VAHA 1TFYA 3D6FB 1TQLA 2WZ1A 1U0HA 3UDCA 4J37A 3KDOA 4KKOA 4WU3A 1FRMA 3TP2A 3E2EA 2AZ1A 2GVDB 3KG0A 3L9ZA 3CJ5A 3MEKA 4CLWA 4FYXB 3KLEA 2MJNA 1S12A 5HLFB 2GJIA 1X9SA 1VQSA 3KUHA 4WKYA 1BLUA 4HACA 2KXHA 2BABA 3HT3A 2YWEA 2C28A 4ZVUB 3D5MA 3KDNA 2VUGA 3GB0A 1BWEA 2MEWA 4KYZA 2MB0B 3KUGA 4I6AA 1YBAA 1ZM9A 3PRVA 4A4JA 3FK4A 2FVRA 2ZNYA 4X4TA 1LWEA 4Y2AA 4R5PA 4LR9A 3DYAA 4WIQA 3W2VA 3ZZ0A 4RW9B 2E29A 4HKQA 3ITHA 2JEIA 1PKUA 3G6VA 4RWWA 2LCWA 2HGLA 3LPEA 1T3OA 4LRBA 3KG1A 1KC8T 4P72A 2RU9A 1PIEA 3V81A 1RT3B 1VQ9S 2ZKTA 1UA0A 3HULA 2AP6A 4LT6A 2C2OB 4BWMA 2QLXA 1VR6A 4OZNA 4JYAJ 3HSGA 1Z4UA 2DNOA 2HFUA 3HLUA 4CCHA 2V8PA 2E7VA 2B7CB 3H5YA 2VFUA 2OPPB 2VKRA 3R5AA 2F40A 4IG0A 4NXMJ 2VKZG 1FKAF 3RGIA 3OVSA 1LWFB 5C24B 2JL9A 3T1HJ 1F9HA 3M2RB 5IC4B 1EAYC 1FWPA 5HQMA 4B17A 1ZS6A 5LSRA 4QW9A 2GA7A 3HHDA 3NGTA 2DH7A 2NXJA 1YRUA 4PPDA 2WVEA 1VQ4S 2E5GA 3TARA 4DR6J 2XMTA 5BXIA 1DFDA 1VLYA 4WPAA 5KFGA 2ZBPA 1NK9A 2X51A 1V5VA 3JSRA 5KFLA 1PCAA 4PWDA 4B9MA 5H9EK 3G87A 2RDIA 4Q0BB 1U2FA 5FLXY 1JB0C 2M8HA 1RI7A 3RAQA 1AB8A 1UAWA 1TL1B 1YJWS 3G2XA 1ZOTA 3RRKA 4XTTA 4O23A 1IQZA 3QFWA 3D3CJ 4HTIA 4RW6A 4QZVB 1HNVB 1GAOA 3EVWA 3UVJA 2ZH5A 1T0TV 2NYIA 4JV5J 3CCRS 1ELOA 3PFOA 1VS3A 5F9NA 2UVWA 4I4BA 4Y2CA 1SI9A 4C97A 2YWHA 4L75A 2DR7A 2PSZA 1L3TA 2F4VJ 3QIDA 2KO1A 1G1XA 4JI2F 3PW4A 2B4PA 3BO4A 3VAKA 2NXCA 4J9MA 3ELHA 1ZBTA 4USWA 1UMJA 2NSCA 2ZH8A 1FRKA 2ALZA 1PGZA 3Q83A 3FC9A 5KFVA 4Z2XA 1FVSA 2R7SA 4YFUA 4A8FA 4NCGA 4DX5A 4RUHA 3F56A 5G0RB 2CFXA 4RW4A 4LFCF 2Q3PA 3I5CA 2W9CB 2BR0A 1FKPA 5KG6A 4IFYB 1FO1A 2UU9J 2C3YA 5KFIA 2KJVA 1A0OB 2EG1A 3HFKA 1FK9B 3A8JA 2BJ9A 3WX4A 2UUWA 4UZCA 4Z7YA 2NUHA 4ZHRA 1NEEA 5FLXU 3DN9A 2YQ0A 1XNRF 4JI0J 1YGYA 1APSA 4LF4F 2J7UA 3H42A 4UQTA 3GYNA 3AOBA 3TVZA 3C3LA 2WW4A 1NSQA 1UKUA 1WC0A 2VHGA 4NLUA 2D3ZA 4LRAA 1NJXA 1LXJA 4WK3A 2QTWA 4DR3F 4HDGA 2KL8A 1KWMA 1YIJS 2LA4A 4EK2A 1OPIA 2GJFA 2M5YA 3NWRA 3W61A 5D0RA 2KXFA 1Y3KA 3W2WA 1RWPB 3CMQA 1DTQB 2C3PA 2D3O1 1RT7B 3CJ8A 3TI0A 2ASJA 2Y3YA 3UWTA 4DL0C 3J7A1 3FMWA 1JQGA 1HWLA 4RW9A 3MOJB 2AWZA 4DPXA 4YDDB 1J5EJ 4K0KJ 1BD6A 4TQSA 4PWWA 4IO1A 4Q8EA 1NKCA 1K0TA 5HMWA 1CULA 2YKQA 1SJRA 1NB2A 1NHUA 3BSAA 2NXNA 1T05B 1GK8A 2ZH1A 4TKTA 4HL9A 2JNJA 2HNDA 3GG0A 2ZJQQ 1TL7B 1ZAWA 4K2XA 3RB6A 5F3TA 3JQJA 1U6ZA 3W7BA 5IS2A 1FI4A 2OI2A 2ZH6A 4IOBA 2IMOA 1KVKA 2W01A 4QU6A 4A8KA 3RB4A 3BBFA 2OPPA 4M95A 5KFSA 4N56A 1DBDA 3LALA 4WJBA 2UUCJ 3NY0A 1WNEA 4Q44A 4FXVA 3BM7A 3SZ2A 4AT1B 1FESA 4M8LA 1A6LA 4YUDA 2DR6A 3PW2A 5BYQA 3V6DB 1FFGB 1RT1B 3DRPB 3W5YA 4KT0C 4DCJB 2CQ2A 3VVTA 3W9JA 2RU3A 2DEIA 2ZUGA 3CO9A 3MPDA 5C2CA 4N76A 4DL2A 3M32B 2MZSA 1IBKF 2ATLA 2ZZMA 3NOCA 1U7LA 3GWCA 4UOHA 3AHPA 3OR1B 1WWHA 3TQEA 4YDXA 3QRQA 1PSDA 3BKUA 2BXJA 3B6BA 3OTEA 1NB7A 1JJ2R 3LP0B 4Q0BA 3M6XA 3PR5B 3PX0A 5IM0A 5KFBA 1TL1A 4HT5A 4PQUA 2AYMA 5LMUJ 2V4RA 3DFEA 1K44A 2DIUA 2E9TA 3HK2A 4TU9A 4F4YA 2HS0A 3EYZA 4HDHA 3T1YJ 2J0WA 2EW9A 1M5VC 4ENOA 3MUVP 3C46A 5IZHA 2AGOA 3M9NB 5D4PA 2MQLA 4C3LA 3KWMA 1Q8LA 1XNQF 5B0BA 4DBQA 1R8PA 1FJCA 2BQRA 5DQHA 3M8PA 5G0RA 3Q8QB 3U27A 3IAM9 5K8NA 5JUMA 1J27A 4K59A 5E3QA 3EDQB 1MMNA 2A18A 3IBFB 1FK9A 2FLLA 1REVB 2XI3A 1YX2A 2CWKA 4ZMMA 4A8XA 2XI2A 4NLYA 3EWGA 1PC5A 3G9CA 2OGUA 4J9OA 2JEFA 4KTQA 1M5SA 4DR2J 2VL1A 1TMMA 2NZ4A 1YBUA 3BB5A 4UOGA 2JRSA 3BN7A 4PG4A 2KI2A 3IR7B 2Y0SD 1DTQA 1RTJA 4PG7A 3KNAA 1X31C 1D9DA 3K5PA 3BEGB 2XY5A 1XR6A 1B70B 3V2UC 3W9IA 4M5IA 2R8HA 3TA0A 3PIOQ 3KHHA 2QC3A 4F4AA 3JSYA 4I0WA 1MN9A 1QTNB 5B7WA 4G1QA 4LF6J 3LQVA 4HT7A 1YJVA 4DX7A 3ETOA 4EI2A 3LW5C 1T05A 1WTFA 2GNKA 2IJNA 4HHUA 4CWBA 2D7SA 4PRFA 3AXKA 2JHEA 2HSEB 1F1BB 2LDIA 2BW2A 5E3RA 1FX4A 2PGCA 2X1FA 1LW0B 4U6PA 3EZUA 2EK6A 1SJ4P 2CNKB 2F7VA 4O3PA 1IN0A 3OXLA 4DF8A 2MZTA 4TXSA 1WC4A 4B3SJ 1FCAA 2F4FA 3R7NB 3HI9A 4L3NA 2IDEA 2GMJA 5AXLA 4CYUA 1RT1A 5A76A 2DXFA 1MLAA 3PKMA 4CP5A 2VPZB 3ZZPA 1X4CA 3MWBA 4QPTA 5JJBA 5C5JA 1HL6A 3AXMA 4ZLPA 3EPIA 1TUVA 2Y8YA 3R7BB 4YY3F 2FLPA 4DL5A 3G6XA 5LMNJ 1E6YA 2DGVA 1JXEA 2XZDB 2ADBA 3OR1A 4KSEB 4CT8A 1YBTA 2VFRA 4OIXA 4XAKA 3FQLA 1EKSA 3WZ0A 1N33F 5F8JA 4QIEA 3LP0A 1DRZA 2H5EA 3BBCA 1Y11A 3QNWB 3D66A 1VK8A 4M94A 2BUNA 2QMWA 3TA1A 5AE1A 2ZH4A 3CT9A 2RQMA 2CPIA 3C15A 1HW9A 3CCQS 3W5XA 1C4AA 3N4WA 4V1Ak 2HBZB 1LNQA 1H6KX 3V4IB 1CLFA 1LFPA 2ZFHA 3CCJS 1YI2S 2BQ3A 2GX8A 3RUBL 2A6OA 4GMKA 1S0OA 2IIHA 4QIGA 1GMUA 1M5OC 3Q24A 1Z1ZA 2BE9B 2G13A 2ZJRQ 2IHR1 3BV8A 4FYDA 2I38A 4YB5A 4FF2A 2KM8C 2VONA 5E5NA 2ROEA 3AOAA 3W64A 4YHHF 2BJ7A 1KVIA 1CSJA 1RT4A 1REVA 2CQ4A 1KP6A 1TK5A 5EHHA 3OD2A 2XZTB 4IRDA 3UCGA 3PW7A 3IN5A 2FJVA 1NJZA 4NLOA 4DV1F 4WYLA 1VBZA 3RRHA 4WWSA 3LANA 1P1TA 4C8YA 4B08A 4KHPF 2ADCA 2CQ3A 1EIYB 2HZCA 1XERA 3LWMA 1DURA 1HYSB 5LL6d 5L38A 1VHFA 3EE3A 2DXEA 1U1PA 2GJ2A 1FWKA 2HMIB 3UD4P 3HMJG 2AF6A 3AY0A 3E51A 2LKZA 4DR7F 5DDPC 1S7HA 1YJNS 4HEA9 2EBGA 3MMBB 2L9WA 4BS2A 1S6PB 2VBWA 1S57A 1TKZA 4ECSA 2HQCA 3BH7B 5GAEI 3BGLA 3QGIA 1N4LA 4HVZA 4ZJLA 5AXKA 1FKOB 2E44A 2IMWP 2BVZA 2KKHA 2CJQA 2V8GA 3HCXA 4C3MA 2DGTA 3BSCA 2RS8A 1O51A 1YKWA 2OTLS 2X3DA 1GH8A 3EMTA 3THVA 3MPVA 3Q8PB 2YX1A 1LW0A 3HPOA 1G7CB 2HVHA 1IKWA 1TVRA 2VFVA 4JBCA 3RBEA 3MD1A 1H72C 2R8KA 1WG4A 4WZMA 2MHEA 3TZXA 4Y28C 2GS8A 1MU2B 2CQGA 1UEVA 5KFWA 1JLAB 1WC3A 5F8HA 4GKKF 5GMDA 1RAJA 3IRXA 3GFXA 1R3NA 1PYOB 1RAGB 1U02A 4KFBB 1QJHA 3OHAA 4ZVRB 3VZHA 5EGYA 1RZMA 3KMQA 3K5NA 4TQRA 1DTTB 2H51B 3VR1A 2R7VA 2XO6A 5KT6A 1FJEB 2QE5A 2DRAA 4LF9J 1Y9OA 1UA1A 1I6JA 5A0YB 4RL1A 1KQSR 4EO6A 2W7PA 5EN1A 5KFEA 2RJZA 1L3VA 2H48B 5D3GB 4ID5B 2V4QA 5HJXA 3ILJA 5KT4A 4OX9J 3SBMA 2FTRA 5D6GA 2LECA 3R6LB 3TZZA 4F4WA 3SQGB 4ZCIA 4QR1A 3IM8A 3ZO7A 3OQ2A 5CZXA 5B0DA 4MT1A 4DQRA 3RZAA 3SCKE 2YX4A 1U1RA 3NCQA 2YNHB 1UVKA 3V4IA 2C2KB 1SBRA 5KOWA 4KV8B 3B4DA 3TO8A 2AHOB 4OLOA 2XWYA 1HBMB 4DUYF 3R6GB 2YWKA 1HQUB 2MKHA 4K50A 3CULA 1WC6A 1KKHA 5MLCV 3AJDA 4K7QA 1FFSB 3A1YG 1JK9B 4WFNQ 3NAIA 2QX0A 1DHMA 3NGRA 5AJ3J 2UV8A 4X4UA 4DV3F 4FN5A 5CYQA 3OJSA 4B9NA 2KFNA 3R27A 4UOFA 4ZVOB 4ECVA 4LBIA 2OP5A 3RYLA 2W8LA 3KLGB 2VA2A 4RR5A 3A3NB 4PXBA 1JLBA 2L48A 3MXHP 4NCBA 3JYTB 4DV7J 4UOCA 1VLOA 5T14A 1VRUA 1HYSA 4DFPA 5ETLA 4PG6A 1FRHA 2OFHX 1OS5A 3MTJA 2CPHA 3AQPA 1S59A 5A8WB 2Z8QA 2QA4G 1S97A 2MXYA 3NXZA 4YR2A 7FD1A 2EXUA 1JLFB 3MMBA 1S6PA 4QIVA 2WSCC 3R8YA 2GIQA 3R7SB 5D0HA 5GAHI 1N36J 2MGZB 1S72S 2CAJA 5ETNA 2WSEC 2V4JB 1WKJA 1FKOA 2CPFA 5LOQA 5HBMA 4EWTA 1FE0A 1RAIB 2RIJA 3O2IA 3KNGA 3E01B 4HLBA 4OV1A 1RWXB 5IWAJ 4M5KA 2MZRA 2ACMA 2J6SA 3UR0A 4USHA 2FPHX 3OFGA 4URQU 2DRBA 1OSDA 2FHJD 5CABA 4BLGA 2WTFA 4DR5F 3MDFA 2G2OA 3FCHA 2OAUA 2JEJA 2CNNB 4Y2IA 2VG7B 4IFVA 3R9LA 1KDNA 4EUVA 1R8CA 2CPZA 3IM9A 4C8NA 1C0TA 1NSAA 4LJMA 1H98A 2HWTA 1XN9A 1NDCA 1M1HA 1C2PA 1AYEA 1REGX 4KFBA 4ZJOA 4PABA 5DGBA 1QSLA 4JI1F 2HHTA 1DTTA 3MEGB 1VI7A 1RLDA 2ZBCA 2AT1B 1R8BA 2VPYB 5A0YA 2MKSA 4C4WA 4TNOA 4J90A 4UY8T 5L8RC 2I8EA 3NNHA 4ED7A 1UPMB 2NCKL 4DPYA 5JVHQ 4RUAA 1SH0A 1U1NA 1A7GE 5D3GA 4ID5A 1HD0A 4KBIA 2OFGX 5FDLB 2X3GA 3DDKA 5A8KA 3SQGA 2HVZA 4KC5A 1OO0B 3K5MA 4U7UK 2B56A 3MMAA 3MEDB 2XS2A 1D1UA 4MKBA 4RPFA 4TYAA 2JZ5A 2BJ8A 3NNAA 4C8OA 3PFEA 2MSTA 4OZ1A 4CLFA 3IO1A 4C11B 3ZZTA 4OL8A 1NK7A 2HPUA 2DBBA 4EMDA 4EO8A 4KV8A 3I5BA 4X62F 1MN7A 2JOQA 2A2CA 3CGIA 3I56S 4ECZA 4DL6A 1U6FA 4J9LA 1CJTB 1CQNA 2HWIA 3UPFA 2ZH3A 4F3OA 4Q2MA 4O3SA 2RDJA 2E7XA 1HWUA 4OJHA 3HM9A 4I64A 3KKFA 1T95A 3MM6A 3B4MA 3MM9B 2M0GB 3SV3A 3EVMA 5KFCA 1M90T 4P2FA 3NS6A 4CLTA 2AKWB 2Y1IA 3V6HA 4QBUA 5HJYA 3D0HE 3BR9A 1RUSA 4DR1F 3SIPB 1UFLA 4ZVTB 3KLGA 4RKUC 1S1WB 3M9OB 4NXMF 3JYTA 3LGHA 4PYAA 2V69A 1Q8IA 4DXLA 3BDPA 4DSIA 1S1XA 3T1HF 3M8RA 4F4ZA 3T1AA 3SXLA 4MTPA 3QT7A 2XB2D 3C66A 3OV7A 2RB7A 4IR9A 1QSSA 3DLEB 2VB6A 2J9EA 1XBWA 2YNGB 1SH3A 4LIRA 1JLFA 1HNXF 1Q5YA 4UW2A 3I4HX 3L95X 2MGZA 4WK1A 2D9PA 1NPRA 2ZITA 5L1LA 2O66A 5B08A 1LEOA 5KG0A 3TEHB 2IPOB 1H0HB 2GO9A 2MYFA 4O3NA 4ECTA 2DK2A 3OTOJ 5H9FK 4FVCA 4L76A 3E01A 4DDFA 5CQGA 3WX8A 2DXDA 1XMQF 2P6TA 3BBBA 2KN4A 2KYZA 2W4CA 1A9NB 3J80Y 3CW2C 1WDTA 5LJ5Y 4JV5F 3JSMB 3MUMP 2R7QA 1FEEA 1B7YB 4W92B 3R5CA 1WF0A 4MAKA 3OL9A 1XWLA 4Q2LA 3NRBA 4NCAA 2UXBJ 3QWPA 4TU7A 4OJ3A 2DISA 1EETB 1CC7A 3HVTB 1NXIA 2PC6A 5E7OB 3M6VA 2DHGA 3B8HA 3FUYA 1ZPWX 2BKOA 1DQ8A 5C7PA 1ZTWA 2JLFA 1CEZA 3N5BA 4ECWA 1DARA 2UUBJ 2ZJPQ 4QIWD 3MEGA 3CD0A 4JI5J 5ETPA 3VGVA 2UU9F 2WHOA 1XK8A 4IQXA 1RK8A 3MM5B 2IVFB 5L1IA 2ROGA 1YITS 1WELA 1DJ0A 1IUJA 4KB7A 4JI0F 4IYQA 1ULRA 4DU8A 3BO3A 3FBEA 2BANB 1N5SA 1RWNB 1T9VA 3DHWC 1CVJA 3J80U 5FDLA 2UUTA 3DRSB 4NLSA 4JI4J 1XMBA 1FVQA 4CDIA 1PJ5A 4O4GB 1VJQA 1BE4A 2Q6BA 2N7CA 3ADAC 3WC2A 2DY1A 2HRTA 2JC0A 2R8GA 3W5ZA 3CJRA 2VJVA 4B3OB 3Q89A 2HQIA 2W9BB 1VJWA 2U2FA 1WG1A 5KFZA 4NYPA 3FCVA 2VC1A 5BYRA 2AYGA 2HLUA 1CJTA 4QWCA 1GFWB 2FUG9 4LFAJ 5F8LA 2HHHF 1P8GA 1J5EF 2HHXA 3IR6B 1FRJA 2MQOA 5B0CA 5HP1A 3US5A 1SPBP 1UFWA 3MM9A 3BSOA 2AJ0A 5ETOA 4AL6A 5C25A 4PUOA 1D09B 1KTVA 1FJGJ 1UVIA 2QMUB 3BH6B 1HWKA 5THWA 4CQ1A 2EG2A 4MK9A 5E33A 2NS1B 5DRKA 4ALZA 1S1WA 4A46A 1GEHA 4DG1A 5F8IA 2HS3A 3HKZD 2QN6B 4UTGA 3A12A 3MUTP 2PA3A 4LFBJ 1TELA 1AA1B 5SUHA 1NK8A 1E6VA 2N3OA 4N47A 1BMQB 4LSNB 2HHSA 1AW0A 3UDLA 5DM6Q 5HMZA 1Y4ZB 2C2NA 3CDBA 4X64J 2B0GA 2HHVA 3DLEA 2FIUA 4CH1A 2YNGA 2I0XA 4DEZA 1S9GA 2W2QP 4LQ3A 4LRDA 2CJXB 2XMMA 3NMAA 2P9GA 1K0VA 3OXGA 4WCEQ 3J81Y 1S6OA 4Y6IA 5MAOA 5A8RB 2PT0A 2ZHAA 4K5RA 2KH9A 4ZCMA 3H20A 4OHYA 4QYRA 3PW0A 3MI7X 3AJ1A 1VC6A 3PKYA 2V6AA 1X5OA 4OZ2A 3TOQA 2BOPA 5LMUF 2RF2B 2BE2B 2ZDPA 3LP1B 4IDKA 3OFEA 3CD7A 5HO4A 1VQOS 5KFDA 1EETA 3BJYA 4A8WA 4NYZA 2C2DA 3IWNC 2ZDOA 3SI8A 3KK3A 4GVBA 1JNZB 2DO4A 3T5KA 4ZCKA 1SC6A 3WHIA 3GJQB 4Q45A 3J81U 3DOLB 2JDJA 1HBOB 2GAGC 3VAIA 2V2VA 4OX7A 3DLKB 2W24A 1SVDA 4KGVB 1NDPA 2WBRA 2RQCA 2ERRA 4CO1A 5C2GA 4CT9A 1RT5B 3SSQA 3TZYA 2VG5B 1IBLJ 3EX7B 3H0PA 4GKJJ 3HSDA 4BC9A 4I7FA 3ZZUA 1UPPA 3DCAA 4B3RJ 2KRBA 5E3CA 4U8YA 2C22A 1TP7A 3MD3A 4O4GA 2FVSA 4DR2F 1TV6B 3CDWA 2MJUA 5IFMA 2KT2A 1HWJA 3C6TB 3H5UA 4GC6A 4AXJA 2R4FA 4B3OA 2C2MB 4KGMA 4P2XA 2OD4A 2UUAJ 7AT1B 3ZZRA 1W7WA 2W9BA 3CC2S 5DLGA 5GAEU 4MKAA 1RAFB 1N0UA 2RILA 5EDWA 1TR0A 4K4UA 4X65J 2VQFJ 2HHQA 4ELTA 3BGUA 1ZAXA 2DTJA 1TL3B 1RKJA 2C1EB 2CPXA 2IM2A 2G4BA 2FJXA 1SL2A 1MSWD 1NU4A 2C2RA 1BXNA 5D4LA 4LF6F 1S9FA 3JTPA 3UFCX 1RU1A 1XR7A 1XIQA 4NLGA 1S6UA 4JI6F 1R8HA 3OUYB 2N3LA 1B7FA 3HJFA 2AYEA 3Q8YA 4ZA1A 4PPZA 3IA0A 4F0KA 3DGVA 3VAFA 1VBYA 1JXVA 1Y5LB 4AQYF 2D9OA 1LWXA 4F04B 2KVIA 2DHSA 4AUKA 5KFKA 4B3SF 1K1SA 2RUGA 4JI8J 1FNOA 1HI0P 1YG0A 2M3DA 5E0OA 1KD1T 1VYAA 2V0NA 4MIBA 3J7ZT 3HXMA 2QLJB 2VIHA 4M5NA 4LSZB 4TLQA 2CADA 3QGPA 3CJKB 1HPZB 1U47A 4KIAA 3MHYA 2V68A 2IC3B 1WKLA 1U1MA 4ILRA 2LMIA 2NQPA 5DLFA 2AD9A 4K8RA 4OX6A 2KFYA 1QY7A 2I6WA 2VA3A 2FVCA 3ZZYA 4DV4F 2IYIA 1JWWA 2JVRA 4USIA 4BDPA 3DKDA 1YJRA 3CF5Q 3RAXA 3P4UB 4TLRA 2YWGA 3OLAA 5KG5A 2OIHA 4OYXA 3KHGA 1T7PA 1NPPA 1EARA 1ZZFA 1RABB 3J7YU 1FRXA 1S4EA 5IT9Y 3X3UA 3DRYA 1G3OA 3LP1A 2V9KA 3MFIA 4F0MA 3H5SA 2FJEB 2V67A 3CJ2A 4X4OA 5I42A 3G8SA 2CJBA 2BJEA 2C3MA 2QYCA 1H2TZ 4WXWA 1R27B 4Y2MA 2WONB 1FDAA 1X4EA 5F41A 3BYPA 4CLZA 4KH1B 3S1TA 2UXDJ 3BQ2A 3M6WA 3GJSB 2BKNA 3HHLD 2DHHA 4OFZA 4C8ZA 1IXKA 2E5JA 1RT5A 2VG5A 2ZUAA 3D0GE 3LF0A 1S1VA 1AZSB 3KLHB 4WZQA 4A8QA 3FEYB 4LRFA 1UJ4A 4HHHA 3G6ES 4I2PB 2LXIA 1RCXB 3KLVA 2E5HA 1N32J 3ENWA 1ROFA 3QWUA 2E1AA 1S10A 1FD2A 3HFVA 3CC4S 4QWEA 3MM7A 1HMVB 2VJUA 2G2ZA 1HFEL 4TY8B 3O6QA 4CLPA 1BQMB 4I69A 1C0UB 1S0MA 3ZTSA 1IR0A 5GAHU 4X4NA 4W98A 2KRRA 5HMYA 3SFGA 4OYAA 4LF7F 4MFBB 3CEDA 2HFVA 4MH8A 1N5QA 3ILIA 3QQCD 2FGOA 2VH7A 4IG3B 1TL3A 4DOZA 2DVIA 3IG1B 2NPFA 3MM8B 1KRPA 4O44A 4KRWA 1VBXA 2ZOMA 4H4KA 4F3MA 4PWUA 1V3ZA 3GE9A 2KB2A 4O3RA 3KTQA 4H4OB 1BY9A 2CKWA 2VFTA 4CTAB 1Y0HA 3U1NA 1HNWJ 3OVBA 4B3TF 4NWBA 2HQFA 1SH2A 3L4BC 3AD8C 3OTDA 4FKXA 4I1TA 3UD5A 1TUGB 2ZM6J 4C8LA 1C4CA 3OR2A 4FKYA 1IBMJ 2HBQB 4AYBD 2NREA 2BJDA 2E66A 5JMNA 3KLEB 1VRTB 5AE2A 2HVDA 1YJ9S 3MMJA 4OYIA 4HACB 2RHSB 1S1TA 4I56A 4NLVA 2GGPA 4P74A 2DH9A 1S1UB 2OEJA 2EVZA 2QG9B 1YSJA 4Z37A 1KR4A 3RBXA 2AU0A 1SJ3P 1WF2A 2OPRA 5CCLA 3CJKA 2CVIA 2MQMA 2MTLA 3Q8VA 1HPZA 2R7OA 2R7TA 4EBEA 1SUQA 4K5SA 2IC3A 2A6MA 1YHQS 3PJXA 4PR6A 1NBEB 3D6TB 3WIVA 3PX4A 4P2MA 4QW8A 2ZE2B 1GX6A 1PYSB 3M1VB 2MLZA 5LSOA 3VCDA 2Y1LB 3R5BA 3I6PA 4G3IA 3M8YA 1ZTTA 2G0JA 5A6WA 4OX9F 3K8WA 3IXQA 3L7PA 3WQPA 2GHVC 3G8TA 3RW7A 3F0NA 5E41A 4DV6F 3T41A 1O0PA 2DNNA 3LAKA 1N5VA 3BGRA 4DZDA 3GG1A 1H7WA 1TU0B 2DH8A 2NPIA 2W4PA 4H4KC 2Z2ZA 4C0OC 2P9CA 3LGNA 2DNZA 2R7RA 3LGMA 5F0UA 3CCWA 1W25A 3MR6A 3VTIA 4NLXA 1UVNA 4C48A 2WONA 1H3DA 1WD6A 5HQLA 3HDSA 1RWWB 1PBUA 2AJ4A 2C2ZB 5EX0A 4NRTA 2PN6A 2RNEA 4AFFA 3K5OA 2HFSA 3GFZA 2K7KA 4ZVFA 4OHVA 1G6BA 5ETQA 2WVFA 3EZOA 3UN5A 4D3GA 4LR7A 1AZSA 3CJTA 3KLHA 4DI6A 3PYGA 2UV8G 3THTA 2X1AA 3UO0A 4I2PA 4JI2J 4L6V3 3CJ0A 2J5AA 1M5HA 2NSBA 3UVJB 4ZN1A 5CD4H 4X2BA 4OHWA 4DV7F 1J5OB 2J76E 4MMOA 4KJIA 1Q8KA 1HMVA 4TY8A 3PX6A 1BQMA 5AXMA 2DNKA 2K3IA 3QZ7A 4DFKA 1RKIA 2DD8S 4KY3A 2HFZA 2FHJA 2MKJA 1SC4B 3BZQA 4MFBA 4L74A 3TX8A 3MCMA 5GVQA 3KK2B 2HRUA 1QE1A 4ETXA 2R7UA 3FZBA 4F2RA 2XY6A 3IG1A 4NCGB 1N36F 4X4SA 4P9SA 3SCIE 4RW4B 3T9ZA 3C2PA 2QL7B 4LRCA 2FHMA 2GQCA 2QIFA 1GXLA 1EP4B 3A8IA 2DJWA 3QGGA 2W1BA 3G86A 5FD1A 4USUA 2CQPA 2Y1JA 1JLEB 1JNRB 3WC0A 4IH7A 4DR3J 4H4OA 5IWAF 1FNMA 4CTAA 3B54A 1D9FA 4CH0S 1FTCA 1X0FA 1XR5A 4RNHA 2VG6A 2MY7A 3TZWA 3MR5A 3OFHA 3OXFA 4RU2A 2BE7D 4N8OA 4O0IA 1PO6A 3HO1A 3RTVA 4MIAA 4ECXA 2XEXA 4XPCA 5KT2A 2OHDA 1VRTA 2BM1A 1UEUA 2DPIA 4OJ1A 5KFPA 3PO4A 2GVZA 4A8YA 1RTZA 1S1UA 3FZ2A 1HHQA 4CLUA 3W2WB 1R6YA 1U2RA 4M1KA 4EU0A 2XNRA 2M7SA 2FHOB 1Q1KA 1N5TA 3P45B 2JEGA 2XG8A 1B0PA 1SC1B 2J6UA 3VHQA 3IAS9 3K8VA 4I67A 2B8PA 1CULB 4Y2KA 2ZE2A 4M5MA 4NLRA 4FXWA 3O44A 2U1AA 3M1VA 2DNYA 2MZJA 4RO0A 2HNDB 2CRLA 2VQEJ 1KLNA 1K47A 1GNKA 5L46A 2IVYA 5DG9A 3FQKA 1RHRB 2V50A 1GX5A 4ZS6A 5JVGQ 3I9ZA 1KSPA 2OTJS 3S01A 4IO9Q 3QFHA 1WEXA 3U02A 4DQQA 3QPIA 1WEYA 4G1PA 1VMBA 3TWZA 1UW4A 1QDUB 2PD1A 3K2YA 3NS5A 4DS5A 2Z30B 5KFYA 1T03B 8ATCB 4RNOA 3ICLA 3N6LA 4K4TA 1F5CA 2V8HA 2GO8A 1VQ5S 4C0HA 2QRRA 5CAAA 5F0WA 5B0EA 2FJBB 3KJNB 4F25A 1Y10A 3N01A 3PY8A 1Y3JA 4DV5J 4B9SA 3I0SB 5T7LB 2AW0A 3QBCA 1WI6A 4NEZA 5IM0B 3IS9A 3MURP 2YH1A 4PQUB 1U6BA 1YK9A 2BJ1A 4OI0A 3PNIA 1J5OA 1XNQJ 4OYWA 2QO3A 2W25A 3R1HA 1FD8A 4RBTA 1NHVA 5HI7A 2RQKA 3G82A 4ZVGA 2BBEA 3EPGA 4Y65A 3DXSX 2PMHA 1L3UA 1Q4RA 3FCWA 1HLWA 4NEYA 2ALYB 4I2QB 3M2UA 2KVQE 2YXLA 1AFJA 4K2JA 1TKXB 1YTYA 3OTCA 3KK2A 5KFHA 1NKBA 1XTZA 1X9WA 2Y8WA 3POTA 3CD5A 3M8PB 2CXEA 3MCSA 4F4KA 3BKTA 2DCUB 2OSQA 5H9FJ 3OBIA 1N56A 1QUPA 4A47A 2NZCA 1OY9A 4Q43A 2G1DA 1EP4A 5M2UA 3MFHA 4XO0A 2O01C 1KHVA 2ZOGA 2V63A 4ZIVA 2PE8A 1JLEA 3NGKA 3OTOF 4MK8A 3JB9k 5B0FA 3N0VA 1URNA 1V6HA 4FP9A 1QSYA 4PCQA 3KK1B 2RHQB 1NZAA 2RS2A 1HNZJ 2KU7A 4J9UE 2H4WB 4E8UA 1N88A 2WBMA 5HMXA 2DR8A 3W3SA 1IR1A 3BREA 2B7BB 4OI6A 3ZC4A 1SIZA 1SC3B 2UXBF 1PJ7A 3C19A 1KNZA 1RYRA 3R3TA 2JX2A 5KFAA 5EWEA 3HT0A 2FDNA 2LDYA 1RTJB 1KLMB 2BACA 3EDRB 3EGVA 1HQ2A 4G6VB 2D69A 2UUBF 2LA6A 3MTKA 1YDLA 1N0VC 3TUZC 1UTAA 4JI5F 1GT8A 2PMZD 4DL7A 4PXCA 3ZZZA 3ZTRA 1LW2B 1AROP 2QL5B 3HF5A 2W2OP 3GILA 1S0NA 3TUJC 4G1QB 4E2FB 5DDOC 3NAHA 1D3WA 4ID8A 1NK4A 4CNZA 5J2PB 2CNOB 4M63A 4MYUA 1RP5A 2C3UA 4RJVA 4QPXA 3W63A 1H38A 2WVCA 1Q7YT 2DITA 4JI4F 3GYGA 5IQ6A 4LUBA 3MPWA 4ECQA 2PFFB 4S0MA 2RDDA 1BQNB 4ES1A 5C42A 1RCOB 4USVA 1U2CA 5L9XA 2KM8B 4ZIWA 3P5BP 2QFIA 3IWLA 3JAMY 4HYKA 2HGNA 2WK4A 3GIJA 1X5PA 2R9LA 4YY3J 1Q0NA 4CYUB 4RW8A 4ZPAA 1OMSA 4NZ7A 4O3OA 1T9YA 2HYIB 4PZVA 3DLGB 1T03A 3I31A 4Z7CA 1N33J 1XJWB 1EHWA 2IJFA 2FZKB 2CDQA 2QL9B 4CZCA
chains in the Genus database with same CATH topology
4YQWA 1XBWA 5DG8A 2YNGB 2XS7A 4J9NA 1SH3A 3QJJA 4LIRA 1JLFA 5GADU 3UD3P 4ICLB 1S99A 2D3UA 1HNXF 1R7IA 2R2UA 1D9AA 4KPYA 1E6YB 1KFDA 2PEHA 4UW2A 1RQ0A 2YKMA 1JJ4A 2CZ4A 3DRXA 4WFBQ 3GV7B 3I4HX 3L95X 2MGZA 4WK1A 1HBNB 1X4BA 2D9PA 1KN6A 2RRNA 2ZITA 3OLBA 5L1LA 1SKWA 3FVYA 2O66A 5GADI 2Q1LA 4IG3A 3IFEA 4FS1A 5B08A 2GHWA 5KG0A 3I0SA 5T7LA 3MMCB 2KFZA 5CZVA 3TNVA 7FDRA 3MM8A 1QLNA 1VIOA 1FJGF 2LXFA 1H0HB 3TANA 3OR2B 2GO9A 2MYFA 4O3NA 4U67Q 3PM9A 1H2VZ 4ECTA 3RAMA 2DK2A 2DB1A 4PXDA 1FKPB 3CJ4A 2DGOA 4FVCA 3E01A 4DDFA 5CQGA 1XMQF 3CCLS 4NPOA 4PG8A 1U24A 1MW7A 2MHNA 3DGPA 3TAMB 4B9LA 2RRAA 1S1TB 1NAQA 3DC2A 4FBUA 2P6TA 1D8YA 4DUZF 2XC9A 1HR0F 2GGPB 2KN4A 1PILA 2KYZA 2XSFA 4OJGA 4ZHRB 2W4CA 5EUHA 1X4AA 3M05A 1K9MT 2CPEA 1NJIT 1LK7A 4YEAA 4JV0A 1A9NB 3J80Y 4I6WA 4C8MA 2UXCF 1Q81T 2ZZNA 3VAHA 1SQEA 4WFXA 5LJ5Y 1FJ7A 3HP6A 1TFYA 4LFBF 4JV5F 1TQLA 3JSMB 3UDCA 4J37A 3MUMP 4KKOA 1HWIA 2R7QA 4TY9A 4WU3A 1FEEA 1FRMA 3KHRA 3M9MB 3GQCA 1X5TA 4W92B 1SV5B 4WFYA 3R5CA 1WF0A 3TP2A 4MAKA 1SB6A 3E2EA 2OPRB 4I2QA 3OL9A 2EFPA 4A8OA 2F8MA 4G1IA 3J7Z5 1XWLA 3KG0A 4Q2LA 3GZ7A 4X64F 3NRBA 3I0RB 4NCAA 3CJ5A 3MEKA 1JLGA 3QWPA 1SUQB 4WTYA 4TU7A 4OJ3A 2DISA 1FT8A 1TKXA 5K5MA 3KLEA 2DCLA 2MJNA 2P6SA 1EETB 1CC7A 5HLFB 2GJIA 1X9SA 1VQSA 4WKYA 3HVTB 1BLUA 2PC6A 2KXHA 5E7OB 2BABA 5LMNF 3M6VA 3HT3A 3L3CA 1IKYB 2DHGA 2YWEA 2C28A 3B8HA 3CXCR 1ZPWX 4USJC 2NUUG 3D5MA 4WE1A 2VUGA 1DQ8A 3GB0A 4C0BA 1BWEA 1S77D 4PXEA 5KFXA 1ZTWA 2JLFA 3CDUA 1RT6B 2MB0B 4I6AA 2B5JA 1CEZA 2J0SD 3N5BA 1BGXT 4ECWA 1DARA 5F3ZA 1YBAA 1ZM9A 2ZJPQ 4MYTA 4C3KA 1RT4B 4P6QA 4A4JA 4QIWD 3MEGA 3DNCA 4U7CA 3VAGA 3UCUP 2QT7A 4X84A 4WYWA 2FVRA 2ZNYA 3CD0A 4X4TA 1LWEA 4Y2AA 4R5PA 2UU9F 3DYAA 2WHOA 3AB4B 3W2VA 3ZZ0A 4RW9B 1XK8A 2E29A 4IQXA 1T02A 3LUYA 1RK8A 4HKQA 3ITHA 3IGVA 3MM5B 2IVFB 3S6EA 5L1IA 2CPJA 2IRUA 2WW8A 2ROGA