4I2QB

Crystal structure of k103n/y181c mutant of hiv-1 reverse transcriptase in complex with rilpivirine (tmc278) analogue
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
424
structure length
416
Chain Sequence
IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A comparison of the ability of rilpivirine (TMC278) and selected analogues to inhibit clinically relevant HIV-1 reverse transcriptase mutants.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Hydrolase, transferase/inhibitor
molecule keywords Gag-Pol polyprotein
total genus 112
structure length 416
sequence length 424
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4i2qB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4i2qB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4i2qB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4i2qB03
4H4MB 4NYZA 3Q8RB 1RTHB 1VRUA 3KJVA 2W8KA 3I0RA 2IC3A 3CDEA 1LW0A 3H59A 3QGGA 3RBDA 1S1UB 1TVRB 3FSIA 2YKNB 3DYAB 1IKVA 4I7FB 2RF2A 2V0NA 3Q8QB 4ED7A 2IM0A 3MF5A 4H4OB 4J9RA 5J2MA 5KT2A 3KLFA 2YKMB 5L1KA 4Q8EA 3KJVB 2W9CB 4R5PA 3DLEA 3M8QA 1D1UA 3V6DB 4F4XA 4QW8A 2BQUA 4RW9A 4EYHB 1RTDA 2OPPA 3GIMA 1GX5A 4G1QA 2WOMB 5KFDA 3IG1B 3MTKA 1S49A 3DRPB 3OL8A 1S1WA 1RTIA 3DLEB 3M8QB 1KHVA 2UVRA 2OPSB 3I0SB 3OL7A 2W9AA 5C42B 3CJ2A 1U09A 4WYLA 5J2MB 3FFIB 3CDWA 3KLIB 1VRTB 4LSNB 1TKTA 3NL0A 3QIDA 4O3SA 5HP1B 5KFIA 4ID5B 2E9RX 3T5HA 2ALZA 5KFGA 2ATLA 3KHGA 2HNZA 2ZD1B 2IMWP 1RT3B 2GIRA 4NLRA 3HVTA 2FLLA 2HNYB 1R0AA 1LW2B 1Z4UA 3PHEA 3DM2B 4K4WA 4YR2A 2AWZA 1RT4A 2J6TA 1T05B 3C6UB 4IH7A 4NLDA 5F9NA 4QPXA 3DMJA 5FDLA 1HMVB 4NLSA 2YNHB 3SFGA 3UR0A 2BRLA 5KFAA 5KG4A 3OLAA 4XPCA 3PW0A 4IDKA 3H5SA 3DOKB 3QO9B 1RYRA 4X2BA 5DQIA 4TQRA 4J9OA 4EBEA 2ASDA 2VG5B 2W9CA 3C6UA 4M94A 2C2RA 3JSMA 3T5JA 1HQEA 4QWAA 2IAJA 5T14A 1N56A 4ZP8A 4NLGA 3KMQA 2HNYA 1JLCB 3LAMA 4O44B 2FJXA 1RAJA 4IH5A 4KHMA 4NLVA 4RZRA 2V4RA 1RT4B 3CDUA 3H4DA 2AU0A 5DG7A 1J5OA 3GIIA 2JEJA 4K50A 4ZHRB 3GIJA 4NLOA 5KFNA 1YVFA 2DPIA 4O3QA 4TYAA 2W7OA 1FKPB 2OPSA 3I0SA 2YNHA 4KBIA 1RT1A 1LWFA 4IDKB 1LWEB 3OHAA 4IFVB 2VG6A 4LSNA 4PWDB 5I3UA 2ILZA 3C6TB 3NBPA 1EP4A 3KLEA 3N6MA 5KFQA 5KFEA 4EYIB 5J2PB 5KFYA 4ZHRA 3QZ8A 1RDRA 3KK1A 1JIHA 4ZVFA 4K4VA 2IC3B 2HNZB 3T19A 5KG6A 4O44A 1LWFB 1JLAB 1DLOA 1IKWA 1RT5B 4DL4A 1J5OB 4IOBA 2ASLA 1S97A 4DL2A 3C6TA 4H4OA 1IKYB 2IM2A 3N6LA 5KFTA 4EBCA 2RDIA 1T3NA 4ED3A 5I42B 3TVKA 1N48A 4WZMA 4TYBA 5DG8A 4KV8B 2FVPA 5F8JA 5C25A 4JV0A 5DLGA 4ECZA 2E9TA 3FQLA 3CO9A 5KFHA 2W9BA 2VG6B 4PWDA 5C24B 1IKWB 1RT2B 3H5UA 4DG1B 3KK3A 5J2PA 4RUCA 3G6VA 4K4ZA 2YNFB 2OPQA 2HMIA 2XWYA 5DQHA 3KLVA 1XR6A 3NAHA 5HLFA 4ZMMA 2IBKA 5KFCA 2I5JA 2JEIA 4I2QA 3DRRB 4TY8B 2ZE2A 1S0OA 1S6QA 3MECA 3JYTB 1TV6B 1N5YA 3MFHA 3GIKA 2WCXA 1OS5A 1S9GA 2BR0A 3QLHB 1FKPA 3V6KA 2BRKA 2RKIA 1QE1B 1MMLA 3OHBA 3PW5A 4IKAA 5C24A 1JXLA 2IJNA 4KKOA 2XI2A 1RT3A 5I3UB 3IS9B 4WXOA 2YNFA 2IJFA 5DQGA 4ED8A 3KLFB 3IGVA 3PW7A 4RUAA 3FQKA 2I5JB 4FS2A 1SUQA 3V6DA 1FK9A 3DRRA 4TY8A 3CJ0A 3GV7B 2QE5A 3BSNA 1HMVA 1JLAA 3CJ4A 4J9PA 3MEEA 3H5XA 4XO0A 3RAQA 4KB7A 3IS9A 1UWBB 3GYNA 3TQ1A 2VG7A 3QLHA 1KLMA 1RT7B 4PUOB 2WB4A 4NRTA 3UQSA 5C5JA 1S1WB 5JUMA 4KV8A 4NLQA 5L1JA 3KHLA 3LAKA 3E51A 4RNOA 4ECYA 5KFVA 4J9QA 4Q43A 3MR2A 4KSEB 4RW8B 1S1UA 1REVB 1TVRA 2WONB 4MK8A 3KHRA 3MEEB 2IA6A 1RT2A 3QZ7A 3H4BA 1JLGA 2XGPA 4M95A 3BJYA 4YR3A 1N4LA 1KHWA 4MFBA 4ECTA 4RNHA 3MEDB 3M8PA 2WHOA 3H2LA 4LQ3A 2RF2B 2ZD1A 3V81B 2IM1A 4R8UB 4K4SA 4ECSA 1UWBA 1LWEA 1C1BA 4Y34A 4ZP6A 4TQSA 5EWEA 1EP4B 3ISNC 2FVCA 5KFJA 4MFBB 3DLKB 1C2PA 1SH2A 3FRZA 4IRDA 2ILYA 3PR5B 3DMJB 3MEGA 5FDLB 1RTDB 3QIPA 4MKBA 4URGA 1BQNB 3VQSA 5KFMA 4H54A 2R8KA 1RT6B 1RT5A 4KE5A 4ZVEA 2IM3A 5KG7A 2V4QA 4DL7A 2C28A 1LW0B 3DLKA 3SFUA 3JSMB 1XR7A 1FK9B 5L1IA 5F8MA 2YNIA 5F8GA 5CYMA 4J9KA 4EEYA 3H5YA 4RNFA 5D3GA 4ED2A 2YKMA 2B6AA 3PW4A 5EUHA 1S0MA 4ED1A 2CKWA 1ZTWA 2B43A 4Q44A 3GILA 1SH3A 2D3ZA 3BSAA 5KG3A 4XPEA 5CYMB 4QWDA 1TL1B 2XI3A 3IG1A 3KLEB 2EC0A 2B5JA 2JEGA 3MR6A 4KHRA 3QGIA 5KG5A 2YNIB 4NCGB 1HQEB 4B3OA 4QW9A 2FLNA 3V81A 3BQ0A 3ITHB 3LALA 2BANB 1T03A 4DEZA 5J2QB 2C2DA 3CWJA 4JV2A 4MKAA 3BSCA 1BQMA 4ZPBA 3BGRB 3LP2A 2B6AB 1MU2A 5CYQB 2J6UA 2UVUA 4J9SA 2V9WA 3DOLA 4WE1B 1S10A 3IRXB 5KFPA 4ID5A 3RB6A 4K4YA 1HNIA 3MEGB 3GV8B 1TQLA 4MK9A 4YQWA 3DLGB 3PZPA 3M9NB 4FS1A 1FKOB 3DM2A 3LANA 5HROB 4DG1A 3KK3B 3NKYA 3E01A 4RW7A 2FVQA 1ZTTA 3IGNA 1HQUA 2RDJA 3DOLB 3DRSB 3PJXA 1QUVA 4WFZA 4IG3B 4O4GA 3ICLA 1JLFA 3UDLA 2XCPA 4EO8A 5KT5A 1HARA 3G86A 2AQ4A 3ISND 4NLXA 4URQU 2R2RA 3OSPA 1JLQA 1TP7A 1REVA 1LWCB 3NBPB 1MU2B 1N6QA 5DGBA 1IKXA 3E01B 4RW7B 3KLHB 1S9GB 3RB3A 3KK1B 3DI6B 3KNAA 2OPRA 1HNIB 2QV6A 4O3NA 4O4GB 4IG3A 2R8JA 5KFSA 4GC6A 4DL6A 1RTJB 2WK4A 5F9LA 3MEDA 3Q8SB 5EDWA 5HROA 3KHHA 3NMAA 3QYYA 3TAMB 2GIQA 3T5LA 3DRSA 4GC7A 2OPQB 2HMIB 1K1SA 1HPZB 3CJ3A 1DTQA 3RB0A 4NRUA 4EO6A 4ED6A 1S9EA 4KO0A 4F4WA 1NHUA 2ASJA 1BQMB 1JLBA 4RW6B 1TKZA 5F8HA 1TV6A 2D7SA 4K4UA 2HNDB 4WE1A 4YMEA 2BE2B 1HNVB 1D0EA 5HBMA 4O3OA 2UVWA 4F50A 4I2QB 1C1CB 1S9EB 2XGQA 2AX0A 4RW8A 5JXSA 1C0UA 4ZVHA 2OPPB 1TKZB 3H98A 2D41A 1SH0A 2FJVA 2VA3A 5D3GB 5J1EB 1K1QA 4DL5A 3HVWA 1HNVA 2RKIB 1I6JA 4KFBB 1RTIB 3LP1A 3MR5A 4WXWA 4QWBA 4Y3CA 5C42A 5KFBA 2W9BB 4NLWA 1JLEA 2DPJA 4R8UA 4QWCA 3H40A 1IKVB 4RW4A 4YR0A 2R2SA 1W25A 3GQCA 5J2NB 2HWHA 1KLMB 3I0RB 5KFKA 4Q0BA 5KT7A 2C22A 4R5PB 3NGDA 2FVRA 3KK2B 1S4FA 2UUWA 2XC9A 3Q8PB 2AGQA 4RNNA 1S0NA 4ZP9A 4ZPAA 3LP0B 4G1QB 1TL3B 1SV5A 1RA6A 4ECWA 4QWEA 4FBUA 1XR5A 1DTQB 4IRKA 1WNEA 1TKXA 2ZKUA 4J9NA 4ECVA 1QE1A 2WRMA 3T1AA 4KO0B 5KG1A 1JLEB 3MFIA 3M8PB 2O5DA 3QGHA 2XCAA 1JLBB 4RW6A 1S1TA 1JLGB 3UPFA 3KLGB 3BREA 2WOMA 3LP0A 2YNGB 1C0TB 2BE2A 1TKTB 4H4MA 2UUTA 3EPIA 3BQ2A 2C2EA 1IM4A 2VA2A 1JX4A 5F8NA 3KK2A 2D3UA 2R8IA 2IAJB 1JLCA 5KFWA 3RAXA 2R8GA 1C1BB 1SV5B 2VG7B 4PUOA 4TY9A 2FJWA 3T5KA 4JUZA 3OL6A 4IFYB 3IN5A 4NCGA 4B3OB 3QIPB 3I5AA 5KFLA 1JKHB 4RU9A 4HYKA 2AGOA 4FBTA 4TLRA 4WZQA 2WONA 1RTJA 2BANA 5KFZA 3PR4A 4URSA 1DTTB 1S6PA 4MIAA 5KT6A 5J2NA 3DOKA 3QO9A 4ICLB 3DRPA 3D28A 2FLPA 4Q45A 1S9FA 5L9XA 3V4IB 4Q0BB 3IRXA 3G6YA 3DDKA 2AX1A 2FVSA 3BQ1A 4MIBA 2I1RA 3M9OB 1RYSA 4EBDA 5DG9A 1VRTA 4KAIA 3KOAA 3CIZA 4Q8FA 5EWFA 4TN2A 2R2TA 1S1XB 4I2PB 5HBMB 4ECUA 1JLFB 4O3PA 3RBEA 1EETA 5C25B 4I7FA 3PVXA 4NLPA 5DGAA 1S1TB 1TL1A 4PQUB 2W7PA 4ECXA 1LW2A 5J2QA 1C0TA 2YNGA 1N6QB 4Y2AA 4F4ZA 4ED0A 1T05A 3V4IA 5CYQA 5F8IA 3DI6A 3EPGA 1RA7A 2WTFA 3NAIA 5HLFB 4RW9B 4ZP7A 4ZPDA 3HHKA 5KFRA 1EETB 3ITHA 1NHVA 5L1LA 2J6SA 3BR9A 3BSOA 4IH6A 4PQUA 3GV5B 3EZUA 4YP3A 4ECQA 1DLOB 3PJWA 4ZVGA 1S6QB 3JYTA 4HKQA 2F8EX 4WYWA 4IQXA 3SI8A 1IKYA 2VG5A 1S1VA 1S1XA 4I2PA 1HQUB 1T94A 4WFYA 4U7CA 4NLTA 3V6JA 3KMSA 4LSLB 1FKOA 3N6NA 3FFIA 4KKOB 1JLQB 4OL8A 2GC8A 2HWIA 4ICLA 2B5JB 1IKXB 1TL3A 3KLHA 1QAIA 4NZ0A 2CJQA 4ZPCA 1GX6A 4K4TA 4IR9A 2R2UA 4F4YA 4ECRA 4IR1A 1NNDA 1SUQB 1TKXB 4R0EA 2JC1A 3HVTB 4RNMA 1T03B 1LWCA 3OSNA 2BQ3A 5KFXA 1QAJA 4LQ9A 2AGPA 3BGRA 3LP2B 3KLGA 5EWGA 1HYSA 2UVVA 2E9ZA 3OLBA 2W8LA 4NLUA 3MR3A 4WFXA 3D5MA 5F8LA 3DLGA 1CSJA 3V6HA 4DL3A 1S48A 3MECB 4RW4B 1N5YB 3TAMA 4IG0B 4MH8A 4NLYA 1HPZA 5DLFA 5I42A 3CJ5A 3HVAA 5KG0A 4JV1A 2OH2A 4IFYA 4Y2CA 4J9MA 1ZETA 3HKWA 3CVKA 5K14A 1C1CA 2JEFA 2JC0A 4O4RA 1JKHA 5KT4A 3M9MB 4J9LA 4IRCA 4G3IA 3I5BA 5KFFA 3RB4A 1HYSB 4U6PA 4K4XA 4IG0A 1DTTA 1S6PB 2HNDA 3KLIA 1S1VB 5KFOA 1RTHA 1VRUB 2R8HA 2OPRB 5J1EA 3I5CA 5KG2A 3PW2A 5HP1A 3LP1B 1RT1B 4KFBA 3FDSA 2JLEA 5KT3A 4O3RA 4LSLA 5K14B 1C0UB 2YKNA 3DYAA 4IFVA 2ZE2B 1BQNA 2HAIA 4MK7A 3OL9A 3G6XA 2BQRA 1R0AB 5KFUA 1RT6A 4TXSA 1RT7A
chains in the Genus database with same CATH superfamily
2XEXA 1Y3JA 3HX9A 3ADAC 4EI2A 2DIUA 3QAEA 3WIUA 2W8KA 1DBDA 4UOCA 5DZ7A 1N32J 2KFNA 4JI4J 5AXNA 1TVRB 3RBDA 2HZVA 1RAAB 4OZ2A 5F0WA 4BLGA 1FRLA 1UVKA 4H4OB 2IM0A 2GNKA 4DPXA 3J7YI 3PNIA 1BD6A 1NU4A 2DY1A 2VDHA 1LV5A 2HLUA 4PYAA 2YKMB 1DARA 1NUEA 3GFXA 2WSFC 2XMUA 4RJVA 4CT9A 3G8TA 3DLEA 2VQFF 1D1UA 4DV5F 2ZUAA 4B3TJ 4P2XA 2UUCF 1D9DA 1JNZB 2X1BA 2VODA 2OPPA 2M4MA 3GIMA 1GX5A 1WI8A 7FD1A 2CQGA 5D0HA 5E2QA 4P7VA 4F2SA 1T11A 1S49A 1VISA 3PEHA 4NL5A 5E3RA 5ADZA 3OL8A 3FMWA 3M8QB 4PEOA 1U6FA 2APOA 1ZBTA 5IC6B 1X0FA 4IUFA 1Y10A 3CJ2A 1U09A 4NI2A 4DSJA 1UL3A 2KJVA 3K17A 4OI6A 4ANCA 2ZH8A 3QJJA 5ETPA 5G0RA 3E2EA 1WEYA 3CDWA 2QLWA 3L4BC 1VRTB 1ZM9A 2W2NP 1FDNA 4R25A 3DRYA 5HP1B 5EX0A 4ID5B 2D69A 3MCSA 4WK1A 2ALZA 4P75A 1KN6A 2PE8A 3EGZA 4ZLLA 3BN7A 3THTA 1LKZA 3A4TA 4NLRA 3RRGA 1FEHA 3OD2A 1R0AA 1Z4UA 1JWWA 1KNZA 1KDNA 1TL5A 3D66A 3PHEA 1AZSB 1M1GA 1BE4A 8AT1B 3D0GE 3AA9A 2R3VA 5CD4A 2G0CA 3GR0A 4ZIVA 2I2YA 3BGLA 2HIQA 4A8YA 3UR0A 5KG4A 4XPCA 4IDKA 2BKPA 4JI7J 3QO9B 4EGLA 1MWZA 1RYRA 1RCOB 1HNWJ 4OX9F 3OPKA 2C2RA 2E1AA 3LPEA 3N79A 4CDIA 2HBYB 3IM8A 4OX6A 3T5JA 4DQIA 1N56A 4ZP8A 7FDRA 2DHXA 4DPTA 2HNYA 1JLCB 4IH5A 1RAJA 4KHMA 2V4RA 2ZHAA 2RHQB 1QUPA 2HQCA 3TAPA 2DJWA 3H4DA 1NK6A 2YWFA 2JEJA 4ZHRB 3EM1A 3K89A 1WC5A 4RUHA 3PDNA 1PILA 4IQMA 2KFYA 3GIJA 2DPIA 1FJGJ 4RO0A 2HK2A 4TYAA 1O51A 4OI4A 2W7OA 2JNJA 1HNZF 2EFGA 1X5TA 3DLJA 1ZAWA 5LL6d 2HKEA 2K7KA 3AQPA 3BDPA 1UWAA 3NLCA 3MTJA 3C6TB 1EP4A 2EFQA 3SSSA 3VGVA 1B0PA 2P5VA 2XQCA 1DY3A 2NXEA 1RDRA 2OTLS 2LDYA 2VFSA 2BVZA 3ENAA 2ZJPQ 3RW7A 2A1BA 4O44A 2XULA 3U1MA 3ZZOA 4CWBA 2AEFA 2J9DA 3FJ2A 4IOBA 2ASLA 2YX4A 1S97A 2J9EA 3C6TA 1WC6A 2XYHB 2MSTA 3JAMU 4FYDA 3SXLA 4OYOA 1N48A 2DNHA 4TYBA 4KV8B 4KYZA 1MWQA 5D0EA 1U0HA 3UDEA 4JV0A 4CP5A 4JV5J 2MPUA 3FQLA 8RUCA 4DR5F 2JVOA 3POTB 4P74A 5KFHA 1RLDA 1YK9A 2X3GA 1P1LA 4MYTA 3G96A 4DFKA 4RUCA 3Q8YA 5J2PA 2MZQA 4BWMA 3W1YC 4F26A 2MQLA 5IM0B 2HMIA 1NAQA 1NK7A 3BGUA 2LQ5A 3I32A 1B7YB 1NEEA 1RWMB 5K8MA 2HHTA 3OJSA 4F02A 1F3FA 3Q0AA 4DSKA 4DUTA 4A46A 3MECA 3HHLC 4Y2KA 5E0OA 5L1KA 3GIKA 2VOPA 2WCXA 2YWGA 4YDDB 5GMKa 3MM9B 4KGXB 2MQ8A 3QLHB 3AH6A 4BCAA 3CXCR 3V6KA 1R43A 3PM9A 1F2GA 2DY9A 3BH7B 3PW5A 4IKAA 2KVQE 3KUHA 4KKOA 2HVDA 1ZH5A 3MMAB 5M2UA 1RT3A 2CAJA 3UN3A 2YNFA 5CD4H 4CTAA 1W26A 4DZDA 1PSDA 2RDDA 2AW0A 4N56A 5DJBA 5A8KA 3CPWR 5GAEU 2G9OA 1NB7A 3V6DA 2DHAA 1MW7A 1FK9A 3DRRA 4TY8A 4WBFA 1Q1KA 3BSNA 3LGHA 4MKYA 3CDBA 4ZN1A 3H5XA 3TZYA 2DGOA 1FO1A 4HHUA 2IRXA 4KB7A 4ZPVR 3IS9A 4TU9A 1LQ9A 1CULA 1HFEL 1RT7B 5C5JA 1NPRA 3UQSA 2QGFB 4NLQA 2OD4A 3KHLA 4RNOA 4ECYA 4FKXA 2HYIB 3MR2A 2CYYA 4MK8A 1ZA2B 1F5CA 2G2YA 1JLGA 1Y5LB 1KFDA 4M95A 1RLCL 3FEZA 2F40A 5CYJA 1Z1ZA 4KC5A 1KHWA 3CD0A 3QSYB 3NCRA 2MQMA 2POKA 4LFBF 2VQEJ 4O23A 2W1BA 1NLKL 4OJ3A 2WTFA 2NZCA 3M8PA 2W01A 2NCKL 2Y0BB 3ZTPA 1F2HA 3V4MA 4YUDA 1UWBA 1VBXA 1TU0B 1LWEA 1NCLA 3EE3A 4Y34A 4F4AA 2AP6A 2GHVC 2JVRA 4A8XA 1NK0A 2PDAA 5KFJA 1FWKA 3DLKB 2L3MA 1H38A 2HQ3A 3FRZA 4C6AA 2N3LA 1RHMB 2CNNB 1RTDB 1Q5YA 2NXNA 1XERA 3L9ZA 2Z0GA 1XN9A 3G87A 4FYXB 4XDDA 4ZCMA 4URGA 5KFMA 1NDKA 3G8QA 2V69A 5IQ6A 2R8KA 2LFVA 4C11A 3M8SA 1TK0A 2C28A 4LF1A 1FK9B 2EI5A 2AEMA 3TA0A 1WUUA 2PMHA 1I3OB 3HHLB 3MCMA 4EEYA 3M32A 2GHWA 4USJC 3SCJE 4X4NA 5D4OA 2VV5A 4RNFA 3IP0A 3FKBA 2CJAA 1SCJB 4LREA 2WSCC 5CH7B 1REGX 2E29A 1SC4B 1NJZA 1QSYA 1V3RA 4Q44A 3GILA 4AQYF 4OI0A 2D3ZA 4USTA 5KG3A 1RACB 5HMZA 3D67A 2D3O1 2PMZD 4LRDA 2DB1A 4OZ0A 1TMJA 2K1RA 2MQNA 1CJTB 2KO1A 2V8VA 1HBMA 2WSEC 3EGWB 3M05A 3ZZPA 1OQ3A 3NRBA 3EGVA 4OJ1A 3HK2A 1YG0A 2BMBA 4WFBQ 4KHRA 1NSAA 1FT8A 2YNIB 4B3OA 3PIOQ 3G8SA 2W24A 4E8UA 1EX8A 2YKOA 3FGVA 3GWCA 4M5MA 4Y28C 1XWLA 4U9RA 4K2XA 3BGRB 3FRYA 5CYQB 2J6UA 3DOLA 1S10A 1NSKL 4AUKA 4PPZA 2VHGA 4ANEA 1HW9A 1JJ4A 2H65B 3C3LA 2CNLB 1PAEX 2CQ4A 3DLGB 1SKWA 2HVEA 4NX9A 2QG9B 3ILJA 4JI4F 4NOHA 2XLKA 4FN5A 3DM2A 3KK3B 3TVZA 2AKWB 3C15B 2FVQA 3OR2B 1IQZA 2RDJA 1PKUA 3DRSB 2Y3YA 1QUVA 2O1PA 4WFZA 1YKWA 3UDLA 4WIIA 4EO8A 3BBBA 1HARA 2ZBPA 3AHPA 3G86A 3RRKA 3W63A 5DM7Q 2AQ4A 1XMQJ 3OSPA 1KONA 2V2QA 1REVA 1U1OA 4P52A 4F0HA 1Z2LA 3TYTA 5THWA 2HHSA 1KQFB 1RKIA 2ZOFA 1IKXA 3E01B 4RW7B 1U8WA 3KG1A 2JWNA 2XBPA 5DGBA 3RB3A 2ZH9A 2WAQD 1HNIB 2M8HA 4ZPWR 4F25A 4JI6J 2H48B 5KFSA 3W2WB 2N7CA 2C2NA 2FIUA 5IT0A 3Q8SB 3TZZA 3VQTA 1Q8LA 3NMAA 1HBMB 4WKYA 2E1MC 4DV6F 2GIQA 3T5LA 2LEPA 2J7KA 3BF4A 3MD1A 4DJBA 2LMIA 2XHCA 3R8YA 1GTEA 5E3QA 1AW0A 1CVJA 3C8YA 3SCIE 1VJQA 2H5EA 1I94J 2IY5B 2Z8QA 5ETOA 2HFZA 4F4WA 3HULA 3ZTRA 2EG2A 3OXFA 4LF4F 1TKZA 1YITS 5IT9U 2RQMA 1TV6A 1VK8A 1M5SA 1HBNB 1LXNA 3DXBA 3JSBA 2IYIA 4NZ7A 2DRBA 1ACMB 2ZWPA 4FF1A 4F50A 1E6VA 4HR2A 4B3SJ 4OZ5A 1SC1B 4DR1F 4F3QA 1S9EB 2AX0A 2J0WA 5JXSA 4DFJA 1Q5VA 1C0UA 2JL9A 4ZVHA 2OPPB 1JXVA 3AT1B 2B51A 3THPA 2E44A 1RWNB 1B70B 4WIQA 3V5RA 1VI7A 2EEYA 3CCMS 1HNWF 4L3NA 1Q79A 4KFBB 5FIIA 3HT3A 3T1HF 3HMJG 2ZH7A 4DR2J 4LMZA 5EN1A 1H2UX 4Y3CA 3VZIA 3JSRA 3HHEA 3MAHA 2W9BB 4FPRA 3PX4A 1HKAA 4YR0A 2R2SA 2UXCF 5LJ5Y 3R3TA 1YBTA 2HWHA 2LVWA 1KLMB 1WF1A 3I0RB 1JJCB 5E41A 2LQBA 2CDRB 2DNLA 3OFFA 4IO1A 5KFKA 3IR7B 3P96A 2HVIA 3NGDA 2FVRA 2GV1A 3EX7B 1S4FA 4ILRA 3PACA 2UUWA 5GAEI 3MGJA 4I1TA 1S0NA 2UV8G 4J9UE 4ZP9A 4ZPAA 3AQOA 4X4TA 1SV5A 4FBUA 5E3AA 1XR5A 3E8OA 1DTQB 3I4PA 4A8MP 2ZKUA 4J9NA 2CJKA 4W98A 4WKRA 3R2DJ 4ZLPA 4NXMJ 4C4WA 3F44A 2GO9A 3F41A 4U8VA 2ZBIA 1A0OB 4KHPJ 1JLGB 1YJVA 3KLGB 5ETSA 5DS7A 2XS2A 4K0KF 2YNGB 3BQ2A 4B9SA 3EPIA 4WTYA 1IM4A 2HGMA 2UXDJ 1WD6A 1NK4A 4X65F 3HF5A 3IBWA 2DHGA 2QT7A 4EFAC 3FK4A 3PRBA 4ER8A 4GVBA 4U7UD 1FA0A 2H4WB 4TY9A 4DPWA 2QLXA 5ITHA 3T5KA 5T7LB 2RSQA 4EK2A 2RD5C 1V5VA 1VR6A 1WTBA 4WWSA 2YWWA 3P5BP 2ZM6J 3CCLS 4HYKA 5KOXA 3CCSS 2ZOGA 2HS4A 4USKA 3CMES 2GCFA 1Y5IB 1Y11A 5KFZA 2HBRB 2L9DA 9RUBA 1IBMJ 5C2CA 2UUBJ 4GVBB 3QO9A 5B0AA 4DCJB 1SJQA 5JMNA 4P6QA 4ETXA 3PKMA 3IRXA 3A8EA 3T1YJ 1N5QA 3B54A 1OJ4A 2KDOA 3TVYA 3A8IA 1SB6A 2Z2YB 4C8NA 3TR5A 2RU9A 1YZ6A 5EGYA 1GXUA 4ZCLA 3M9OB 4EBDA 3E3XA 1VRTA 5ETMA 3KOAA 1IBCB 1V5IB 3PYGA 5EWFA 1VQ5S 2DRAA 3FZ2A 4ZPTR 4ETZA 1FTCA 4K5SA 1S1XB 2GJIA 2HVHA 4DV3J 1JLFB 3RBEA 5DGAA 4AL6A 1H2VZ 3R7SB 1X5SA 3ZNJ1 3M2VA 1TL1A 4PQUB 1M1HA 3O5TB 4OZLA 5J2QA 2YNGA 4ED0A 2PSZA 2R7SA 4LFAJ 1XEZA 2R7OA 4OJHA 3WQPA 5IV3A 3QT6A 5KFRA 1R3NA 2J8AA 5GVQA 3M8WA 2RQCA 1SJ4P 1FEEA 3PEJA 1O8BA 6FD1A 4YP3A 2ERRA 1H72C 4ZVGA 2DRDA 3GFZA 1MROA 1LFPA 4WYWA 3HPOA 4CIOA 2DO0A 3RJMB 2K3IA 2VG5A 1EZZB 4I2PA 3T3FA 4F36A 2DCUB 1U1NA 5D4PA 4U7CA 3SQOP 2HHHJ 1SL1A 3MHYA 2EK1A 1CC7A 1JK9B 4KKOB 4J90A 3WC2A 4DU7A 2NXUA 4PCQA 4CI0B 2QMWA 2VASA 4W90B 4ELTA 2B5JB 3GR1A 2MB0B 5F8NA 4J91A 1B0TA 2ZVIA 1FVQA 4M5HA 1EQ0A 1Q16B 1VQPS 4DLGA 4R0EA 3GJQB 1J5EF 2AZ3A 2JC1A 2LEAA 3HVTB 2M88A 2CQ0A 2V2VA 1S99A 1VDHA 3OSNA 5D15A 1UW4A 2A6MA 1RCXB 4C7QA 2QX0A 3TA1A 2OGUA 4PAAA 3C16A 3CCQS 3A8KA 4DU8A 4GMKA 4NLUA 2L08A 1Y3KA 2WB1D 2AD9A 4UY8T 3TUJC 1Q7YT 3MUVP 1YJRA 1CSJA 1RBLA 1ZZFA 5DRKA 4DL3A 1N5YB 3PFEA 2XY5A 1P9YA 4LF8F 1TMMA 1HPZA 1TR0A 3BYPA 3H2UB 1SVDA 3I9V9 3HVAA 2B56A 3K8VA 5KG0A 4ES3A 5A8KB 4KGZB 4Y2CA 2KHDA 4P2FA 2DNNA 2ZJRQ 2A3JA 2JEFA 2EVZA 1L3VA 4O4RA 1JKHA 5BR8J 3M9MB 3R7NB 3DLLQ 4IRCA 4G3IA 5D6GA 2MQOA 1X4GA 1Q86T 2AZ1A 3AXKA 4L73A 1M90T 4DV0J 1RTHA 4FF4A 2QL7B 5KG2A 1XJWB 1JJHA 4YB5A 5K8PA 3G71S 1YIJS 4B9TA 1RT1B 3QQCD 1VK3A 1RWXB 1V6HA 4OQJA 1D8ZA 4BWJA 4ES2A 5L9NA 4YB1P 2YKNA 5LMNJ 3OXLA 4DQQA 2HAIA 4FPIA 3BO4A 4AL7A 2BJ7A 2J9CA 1RT6A 2DGSA 3FEXB 4KTQA 2Y1JA 2QSWA 4DV7F 1RTHB 2PO4A 2W4PA 4P7TA 3NOCA 4DQPA 1LW0A 4DLEA 2XTJP 3H59A 3LWLA 2CQ2A 4LF2A 5HQLA 2DR9A 3K8WA 1GQEA 2PA8D 1CPZA 2YKPA 3M6UA 1IBKF 3FSIA 2YKNB 2DGWA 1IKVA 3ZZTA 4YHHF 3RAMA 2MKHA 5D4LA 4ED7A 3NNHA 1U24A 4JBCA 1FJEB 2CQIA 5KT2A 4QJVA 1TL7A 2L48A 4CLKA 2Y1IA 3K5MA 2QLJB 4OHWA 1VFJA 4F4XA 3M8QA 2OMLA 1GMUA 4KGMA 4QQBA 5K8NA 4QW8A 3T9NA 1KRPA 1O5JA 1H7WA 2Z57B 1RTDA 2RE1A 3PXGa 5HO4A 2V8PA 1NJXA 3OVBA 1WC3A 1FVSA 2CZVC 4G1QA 4M8LA 2KG0A 3AJ1A 1BXNA 2WOMB 2BV3A 2LQ9A 2K1RB 1X31C 4LFCJ 1TL7B 1NO8A 3MTKA 1K0VA 1S1WA 2DXFA 2FPHX 4ELVA 2PFFB 4AD6A 1RB0A 3I0SB 2GMJA 5C42B 1C4CA 1SC6A 3ZZ0A 4WYLA 1IWGA 3AB2B 3FFIB 5SZTA 2VDIA 4LSZB 1Q53A 3F73A 3EGNA 2YWEA 4CM2A 4X62F 2GVDB 2HG4A 4O3SA 2EPIA 5KFIA 1CLFA 3DGVA 4G65A 2K7JA 1YX2A 1GAOA 3KHGA 2HNZA 5A76A 2IMWP 3C66A 1EIYB 3AJDA 2FLLA 1AUSL 4WPAA 2LA4A 2CQDA 2HS3A 3G82A 1VCTA 2A18A 3DM2B 2MQPA 4YR2A 4CLYA 1RT4A 2J6TA 2NR0A 2UUAF 4DSLA 1RAIB 1TL4A 2YQ1A 3V2UC 2XM3A 4JI0F 4IH7A 5L38A 1NKCA 1V3SA 3GYGA 1RUSA 4NLSA 4PXCA 1X4EA 2YNHB 2HGLA 3GLJA 3SFGA 5KFAA 3OLAA 4QYZJ 3OTOF 4H4KC 3JTNA 3DOKB 1VIOA 2GVZA 4C11B 4DR6J 1MG7A 1ZYQA 4GKJF 1AUDA 3C6UA 4M94A 1J27A 3JS9A 1X60A 1Z2ZA 3MWBA 3R5GA 2PT0A 2XZTB 4NLGA 2OKQA 4LF7J 3LAMA 2FJXA 4J9KA 4B3TF 2VC1A 3NNCA 4NLVA 2B8PA 1X5PA 3EVOA 1WDTA 5GAGU 3SDEB 2FJBB 3RYLA 4K50A 2WVDA 3EICA 2V63A 1QSLA 3DXSX 1YLXA 3VTIA 2KG1A 3I0SA 3KKFA 5L39A 2KM8C 1UEUA 3O8WA 1E6YA 3CGIA 4LF9J 3M2VB 2ZFHA 4ALZA 4IDKB 4IFVB 2VG6A 4PWDB 2ILZA 5I3UA 3AB4B 5KFEA 4ECZA 3N6MA 3KLEA 3QT5A 1XK8A 3I56S 4EYIB 5IZHA 3GYXB 1RHRB 3A13A 1RP5A 1JIHA 4K4VA 2IC3B 1NB2A 5KG6A 1HL6A 2E7WA 3OBIA 1UFLA 1OSCA 2LP4A 1WKJA 1JLAB 1NDLA 1IKWA 5IQQA 1RT5B 1UZDA 3AXMA 1T7PA 1ZM3A 2ZZMA 1CJKB 1VYAA 4QR1A 4DL2A 1YJ9S 5KFTA 1X9MA 1FJ7A 2G0JA 3M4XA 4UOGA 1VQ6S 2GMLA 5I42B 4USWA 2KH9A 4WZMA 3PYDA 2DGUA 3HM9A 1PAUB 2YPZA 5DLGA 2E9TA 3R6LB 3KDNA 3CO9A 3I6PA 2W9BA 2P6TA 1IKWB 5MLCV 1MLAA 5K9FA 1RT2B 2RQKA 3KK3A 3IWLA 1Q8BA 3QBCA 5HMWA 3ETMA 5HMYA 3G6VA 1NK5A 2KN4A 2BJ9A 2DTJA 2ZH6A 4OYAA 2XWYA 2DNPA 1UFKA 4ZMMA 2IBKA 2JEIA 1DRZA 4I4BA 2D9OA 4I2QA 4FVMA 4AYBD 3Q22A 4DMZA 4C0BA 2FLOA 5HJXA 1S6QA 3JYTB 2DH9A 2Q6CA 5ETRA 3MFHA 1BY9A 3RUBL 2BR0A 2DR8A 4U8YA 1GT8A 3C2PA 1W2BR 4C98A 3MM7B 1QE1B 2YXLA 4DSFA 1FJGF 1UCNA 3JAMY 4DXLA 1IQTA 2FJDB 3A12A 5C24A 3L95X 3VGSA 2IJNA 6AT1B 1F5AA 4XAKA 1JXLA 1FXLA 2GA7A 5I3UB 3ENVA 3LA0A 3JQMA 3IS9B 2PN6A 3H42A 3CJQA 4V1Ak 5IM0A 5DQGA 1U4BA 2XNRA 3IGVA 2NPIA 1NJWA 4U96A 6FDRA 1F3VA 1Y5NB 4E2FB 4YY3F 3CJ0A 2N7YA 3GV7B 1JLAA 3RAQA 1SJ3P 3VVTA 3UW1A 4NXNJ 3DN9A 3GYNA 5GADU 1FWPA 2WB4A 4NRTA 5A8RB 1IJEB 4KV8A 2R4FA 3LAKA 2LCWA 4ZVSB 3ET6B 4KSEB 3MPDA 1TVRA 2DK2A 1ROFA 2ZUGA 1NSPA 2H51B 3MUMP 1RT2A 3QZ7A 3OJUA 3TQEA 4UOFA 4DR5J 1R8AA 4I64A 4FYWB 4CLWA 3AD8C 1VBYA 1SJRA 2E1PA 5MAOA 2XZDB 4X4QA 3SSQA 4NE9C 4N76A 2RHSB 1EHWA 2AF6A 1YJNS 4K4ZA 4IOCQ 2KT2A 2E7VA 3H2LA 1X4DA 1SC3B 2RF2B 2ZD1A 2O01C 1QVFR 1GH8A 4YDXA 3QMQA 2NUUG 3W2VB 4X4RA 4KGKA 2G13A 1CQMA 4NA2A 2YH0A 4ZVUB 3KWMA 1EP4B 5EWEA 1SQEA 2OHDA 4MFBB 2V94A 5EX3A 2LQJA 4E98A 5B0DA 4OIXA 2QYCA 4N77A 3C46A 4JOUA 2HW3A 3DMJB 5FDLB 2LXIA 1DQ8A 2QFJA 3MPWA 3MAQA 5HVFA 4DQRA 4JI5F 1F0XA 2R7QA 4UF4A 3MURP 1RADB 3Q24A 1SXLA 1YSJA 3MMCA 1SJ1A 1U1QA 4ZVEA 4F3OA 4JI3F 3FBBA 3AY0A 3SFUA 3HZGA 1F6TA 3DGPA 1XR7A 3TRGA 4DV1F 2HAFA 5F8MA 3OUYA 5L1IA 1VGYA 1TFWA 4PWWA 5F8GA 3TOQA 3CCES 2CZ4A 2IDEA 1VQKS 1U25A 1N36F 2ZH1A 2QYGA 2WVEA 1WHYA 2G1HA 2V8DA 4LRCA 3H5YA 1FDDA 4B3RJ 3D1QA 3VAJA 3LWMA 4ED2A 1YJWS 3MMCB 2P6SA 2KJWA 2MKYA 3BO3A 1Y4ZB 2OMOA 3PW4A 2JRSA 3GJRB 4M5JA 4ED1A 2CKWA 2XSFA 2QC3A 2B43A 2C2OB 3ET6A 1S0MA 1SKRA 2MKCA 1KVJA 3GIRA 1SH3A 3WHIA 2DH7A 4TNOA 1IN0A 1ZZNA 4DV6J 1TL1B 1XNQJ 2HIYA 2Y1LB 3A1YG 1WF0A 1FNMA 2CWXA 3IG1A 2XI3A 3GSDA 4Q7AA 3KXDA 1S0VA 2EC0A 2JEGA 2IFXA 1IR0A 3LUYA 5A0YA 3MUTP 2XY7A 1CS4B 1D09B 5HJYA 4LFBJ 2G2OA 2VBYA 3BQ0A 3ITHB 3LALA 4DEZA 4DFMA 1RAEB 2V6AA 3R5DA 3VAHA 4UUXA 1MU2A 2RS8A 2BJEA 2UVUA 2LU1A 2V9WA 4B3SF 3IRXB 1SIZA 3EJMA 5U47A 1VQ8S 4K4YA 2ZHOA 4AFFA 2ZH3A 2N82B 3GB0A 4YQWA 2J76E 5HN0A 3M9NB 2XMKA 5ETQA 1XIQA 2O3DA 5DDPC 4DG1A 5AE3A 3E01A 4RW7A 4FF2A 3P5TL 1HQUA 3PJXA 4WU2A 4OI1A 4IG3B 1JLFA 2B9XA 5KT5A 3HFKA 2FGCA 2FZKB 1BQXA 3Q86A 4URQU 2EFOA 2R2RA 2UXCJ 3NP5A 1TP7A 2WW4A 1P9QC 3VCDA 3VWSA 2R9LA 4A8SA 3UI3A 3KK1B 3DI6B 1TUWA 2XYGB 3AOBA 2FQQB 3MAAB 1R8BA 2F63A 2QV6A 4BHQA 4IG3A 4J5OA 4C0HA 3UDVA 4F0MA 2R8JA 2RB7A 2F4VF 5F9LA 2BYCA 4P71A 3S7RA 1IBLJ 1KSPA 5HROA 4JI1J 5D8HB 4RR5A 4AQYJ 4USIA 3TAMB 1Q8KA 2HMIB 5HSPA 3IWXA 1EJ7L 1HPZB 2GJ2A 4I6WA 2AIRB 2Z4PA 4DPYA 2RRAA 3MPYA 4NRUA 4ED6A 1S9EA 1VHIA 4KR0B 3TO8A 3HT0A 5D77A 2E5IA 2VFTA 1JLBA 2ZWOA 3DKDA 2BJ1A 2VPWB 3EDRB 2CPIA 3G2XA 4UT4A 5F8HA 1WACA 2ACMA 3F0NA 4Q2LA 1JJ2R 2UXDF 4X65J 1SQFA 1VBKA 2FUG9 4O3OA 5HBMA 4LUBA 2C3PA 2ZDOA 1HI1A 1OPIA 4I2QB 2JLGA 2EFNA 5CCMA 1TELA 4RW8A 1H3DA 2MZRA 2HQGA 2W25A 3AD9C 4C8KA 4OV1A 1URNA 3DFEA 3GJSB 3RW6A 2BBEA 2VPYB 3C15A 2D41A 1SH0A 2FJVA 3O2IA 3Q2SC 3O6QA 3MXHP 5J1EB 2ZM6F 5GAGI 2DGVA 1R6YA 3D6TB 1LEOA 4Z7CA 3KDOA 1VQ4S 4L75A 4HDHA 3HSGA 5C42A 2I9SA 5IT4A 4NLWA 3QRRA 2N4CA 3M6VA 1IKVB 5GADI 3HHLD 5AXLA 2WBMA 3SCLE 1XMQF 3S8SA 1KS2A 1KQSR 4X64J 5J2NB 2B0GA 2FHMA 1FFGB 4QIGA 4DV2F 3D0HE 2G2ZA 4WF9Q 4CO2A 1GFWB 2NREA 4LF5J 1T02A 4I6YA 2C22A 4C8YA 4R5PB 4EU0A 2CQBA 3H90A 3PHTA 3KK2B 2H1YA 3W61A 4KJIA 1MN7A 4YOEA 4LF9F 4HH0A 1P6TA 3AA8A 5B0GA 4CO1A 2X1FA 4G1QB 2MDAA 4LBHA 1FD8A 4DV3F 5E3PA 1U26A 3EXCX 4PG8A 1TKXA 1RU2A 2X7IA 4ECVA 2NYHA 1B99A 2WRMA 3JSYA 4OJGA 5KG1A 1CEZA 1JLEB 4FNHA 3M8PB 2O5DA 3QGHA 5GMDA 2GQCA 1JLBB 1UZHA 3W65A 3FVYA 2KU7A 1T9WA 3LP0A 3H7HB 3NCQA 4TVAB 1XNRF 2C2EA 1OYDA 1WI6A 3GFYA 3W62A 3QNWB 2AYGA 3MM6B 1E6VB 3PJ9A 1OMSA 1CJUA 4CCHA 2LXUA 4QZVB 2JZ5A 2R8IA 1RXOB 5L46A 1EARA 1R7IA 2Z2LA 1JLCA 3RAXA 3M2RB 3CJKA 5LJ3Y 4ELUA 3G82B 5AT1B 4DS5A 2VG7B 4PUOA 2C2MB 2MLYA 1D3WA 4JUZA 3OL6A 4IFYB 2HHPA 3I55S 3IN5A 1HWLA 3TWZA 1S77D 4AT1B 3QIPB 4LF6F 4RU9A 2H5JB 5FLXU 2ZBRA 3TANA 2WONA 4N8OA 1RTJA 3P3DA 2BANA 1NM2A 3A3OB 1IJFB 4M5LA 5CAAA 2UU9F 3MR7A 1DTTB 1S6PA 4KH1B 2EXUA 4MIAA 4URSA 3UN5A 5J2NA 5KT6A 3DOKA 1S72S 3M30B 1EQMA 2KVIA 5L9XA 3V4IB 3UE2A 2YBVA 1KBRA 3ELHA 1M5KC 2AX1A 2EKYA 2I38A 3GU0A 4WP3A 3ZTOA 1UVJA 1I51B 1UA1A 2B4VA 2HHUA 3BQ1A 3R9LA 1NBEB 4A4JA 3CUNA 2HURA 2CUYA 2MXYA 2DBBA 1WSVA 1IXKA 5DG9A 3ZZYA 1HD0A 4Q8FA 4TN2A 5LMUF 3DNCA 4DX7A 2GX8A 3RR7A 3P8BB 1K47A 4RWXA 2CQCA 2ASYA 2PEBA 4DV4J 2KB2A 4OI3A 4ZVPB 1HBOB 3PVXA 4B9MA 1B64A 1WKLA 2FYXA 1OY8A 2R7TA 1S6OA 5LXRA 1N6QB 4Y2AA 3ONQA 3PX0A 3AFGA 1PO6A 2J5AA 2M5YA 1GMWA 3NAIA 2ZC4A 4HL9A 3PFOA 4RW9B 2FHJA 5BR8F 3J81U 3L09A 1PC4A 3J7ZT 1FTRA 3ITHA 1HWKA 3B78A 5L1LA 3VGUA 4PR6A 1ZAXA 4JB8B 1RWPB 3D3CJ 4J37A 4UZCA 1S6QB 3JYTA 2E5LJ 4IQXA 3CO0P 1AFIA 1IKYA 5T7LA 1S1XA 3LPYA 3OTDA 3UNYA 3K7RA 1DHMA 3K5LA 4KH0B 5A8WA 1R31A 4CYUA 1GXTA 4LSLB 2IRUA 1FNOA 2GC8A 2HWIA 5FD1A 1UA0A 3SDEA 4KRWA 3LW5C 4ID8A 3KLHA 1TL3A 4ZPCA 2HWTA 2CJQA 3A8JA 1GX6A 1VQYA 3CB4A 2R2UA 2GGPB 4IR9A 2IHR1 3MPUB 4JYAJ 4ED4A 1PCAA 1U0SA 2XMVA 2DITA 1T03B 3ILIA 2CQHA 1A9NB 3EXYA 2NS1B 2BW2A 2I6WA 5E33A 2BQ3A 4LQ9A 2AGPA 2UP1A 2UVVA 2ZC3A 2OAUA 4DN0A 4MYUA 2E9ZA 1H98A 1JMTA 4DR7F 4JI3J 1VC0A 4WFXA 3D5MA 4W92B 3CD6S 4DV1J 2VJVA 4PXDA 3QATA 2MGZA 5K5MA 3EZOA 2J0QD 1S48A 3MECB 3MPVA 1CJVB 3TAMA 5B0BA 4NLYA 4DL0C 2F9DA 1G1XA 3OT9A 5I42A 3CJ5A 4USUA 4OYPA 5LXYA 2OJ3A 4C8MA 4J9MA 1ZETA 3HKWA 1N5SA 1C1CA 4C8LA 4N41A 3CCRS 2MGZB 2LKZA 3I5BA 3L3CA 1UVLA 3VGTA 3BGOP 4NMLA 4U6PA 1HR0F 4RL1A 2EBGA 3KLIA 4CLZA 1M1KT 1R6VA 1VRUB 2OPRB 2JLFA 3CCTA 3I5CA 2Q6BA 1ZM2A 4HTIA 1GTHA 4ZCIA 5KAKA 2FC9A 3LP1B 3KJQB 3FDSA 2BABA 4O3RA 3Q89A 1U1PA 2CPFA 3J81Y 2DHSA 3OL9A 1YRUA 5CQGA 2V4JA 2DNZA 5HK4A 2E66A 4ZCKA 4ZJOA 4JI0J 3CE8A 4KQZA 2PC6A 4TXSA 1B3TA 3Q8RB 1VRUA 3KJVA 1PIEA 3IM9A 3I0RA 4DQSA 3CMQA 3QGGA 4C3LA 2ZBQA 1S1UB 2VFRA 2Y8YA 2MZSA 2V0NA 4I7FB 3GG0A 2BKOA 2RF2A 2OO4A 5B09A 2Y1RI 2KM8B 4F7VA 3M32B 2CNOB 4JP8A 2CJYB 5J2MA 2EFPA 4UZBA 4L6V3 3ZXWA 4CQ1A 2EKNA 1MWYA 3J7YU 3BH6B 3KJVB 4JI2J 1K44A 3LTOA 2W9CB 4R5PA 4LF7F 4Q8EA 5H9FK 3V6DB 4F0KA 2DT9A 1RKJA 4QU6A 3PY8A 3U7JA 1CG2A 2QA1A 4OHYA 2EBEA 2QTWA 3MD3A 2G0IA 5KFDA 3IG1B 3VR1A 1AZSA 2HFVA 3DRPB 1HW8A 5A8RA 3PG9A 1RTIA 1KHVA 1MNEA 3VAMA 2OPSB 1X4CA 1G4CA 1WHVA 3H8YA 4L3KA 1TUGB 4ENOA 3OL7A 2W9AA 2XS5A 4QR2A 2DR5A 2XY6A 5JVHQ 2RNEA 5D0RA 1UJ4A 2CFXA 4JI1F 4OZ3A 1TKTA 1WKKA 2XMJA 3NEKA 3NL0A 2QA2A 3QIDA 3MDFA 2F3JA 3QT7A 4MIWA 3MM6A 1U02A 4MMOA 5DO2A 2D9PA 5HANA 4BC7A 2W2MP 4DBQA 5KFGA 2LDIA 3DDIA 1HHSA 1G6BA 2DCLA 4C8ZA 1RT3B 2GIRA 2LQ8A 2PIIA 2QEXS 4M1KA 2VU5A 2B4PA 2GQ2A 4CLLA 3AODA 1T05B 4WK3A 4LR8A 3C6UB 1JQGA 1RE1B 3KJNB 3EVWA 2NUHA 3ZZUA 4QPXA 3DMJA 5FDLA 1HMVB 3FZBA 3HD1A 4Y2MA 3TJAA 3UWTA 3W9HA 5HMXA 1KC8T 4C9DA 2BRLA 3PW0A 2FD2A 3MM5A 1FFWB 3J7A1 2CPXA 3H5SA 4GO5X 4AE5A 3ZZRA 2YQ0A 3OW2R 4X2BA 2MZJA 4A47A 2I8EA 4EBEA 4KY3A 2KT3A 2Q1LA 4M5DB 4RX6A 4DR2F 3DGPB 3H20A 1HQEA 4U95A 4QWAA 2IAJA 1SIWB 5T14A 1U47A 2YX7A 5GMEA 1H7XA 1FI4A 1X4FA 4RZRA 3IBFB 3GG1A 3TW0A 2FZCB 4ANDA 5IWAJ 3MM5B 4XIUA 3ETOA 3ILOA 3VAIA 1IVZA 5A2QU 2JJ4D 3UDCA 1J5OA 4JI7F 4J9VA 4LFCF 3D3BJ 1TK5A 1FKPB 2OPSA 3OTBA 2YNHA 1N5TA 2QIFA 5EHHA 4UOHA 2HHXA 1VRQC 5HI7A 4WTOB 1FHTA 1N5VA 4HACA 1YBUA 2FTRA 5DDRC 3RBXA 4DCPB 3NBPA 1WJ9A 1N52B 1LFWA 2FDNA 1VHFA 2AJ2A 2P2CB 5KFYA 3QZ8A 5J1NA 3KK1A 2F7VA 2XHWA 4NXMF 2KXHA 3HKZD 4ZVFA 4A8WA 2DKOB 2HNZB 3T19A 2RIJA 3H0PA 2QJ3A 1AYEA 2MLZA 1LWFB 2G1DA 2H5IB 2OP5A 5HVHA 2ZOMA 2U2FA 3OUYB 2AYBA 4OYZA 4RBVA 2FZGB 4ZKAA 2ROGA 4H4OA 1IKYB 1T9XA 3FEYB 2GJFA 4EBCA 2RDIA 2FY1A 2NSCA 4PWUA 1VQ9S 2H4YB 3CJ8A 5DG8A 2FVPA 2A0FB 2CPHA 4M5KA 2UUAJ 1LK5A 1PYOB 1K0TA 4B9NA 1O0PA 3GMGA 4O0IA 2GVZB 4DG1B 1M0SA 3H5UA 3VV2B 3WIVA 2MTLA 5IV4A 2OPQA 2UV8A 2IRYA 2RVJA 3NAHA 2BM0A 4YB7A 2I5JA 2ZEJA 8ATCB 3HJVA 4GKJJ 5G4DA 4Q2MA 1SBRA 5H1SV 2RQ4A 3QT8A 1M5VC 4F3MA 2ZE2A 1S0OA 1NK9A 5IC4B 2R7VA 1CJTA 1TV6B 1A7GE 4KGVB 5G0RB 3PO4A 3VZHA 4DX6A 1SL2A 4DI6A 2HS0A 3ZTSA 3BM7A 1DJ0A 1CULB 1FKPA 2RKIA 2Z30B 1MMLA 2PGCA 3OHBA 2J0XA 4JI5J 3RRHA 4QCLA 4FVCA 4P73A 4UQGA 3BKTA 2XI2A 3SIPB 2DNYA 2UXBJ 2IJFA 3ENQA 3GCWP 2DVIA 2HRTA 3KLFB 3PW7A 4RUAA 1S57A 5F41A 1LNQA 4DUZJ 1SUQA 4FS2A 1I1GA 1IBMF 2RAQA 2GIFA 1HNXJ 2D1CA 4C3MA 3CJ4A 1Q81T 3MEEA 3PRDA 4XO0A 2IDLA 5F3ZA 2AJ1A 3OVAA 1VJWA 3W8GA 3TQ1A 4LFAF 1UFWA 2VG7A 3QLHA 2B9YA 4PUOB 2HVZA 3KFWX 3NGUA 4RPFA 5E3CA 3U1LA 3G6ES 1KKHA 2OI2A 3QAUA 5L1JA 3KTQA 3E51A 1P1TA 2CXEA 5KFVA 4Q43A 4RW8B 3KHRA 2IA6A 2XSJB 3MEEB 2DEIA 2YWKA 3W5XA 3H4BA 1W2IA 1APSA 3AOCA 2RUSA 4Z2XA 3BJYA 2HZCA 3WX8A 4QIFA 3IR5B 2AV5A 4MFBA 4B3MF 2V2KA 3AJ2A 4ECTA 1XBWA 2GFFA 3HSDA 2VKZG 3MI7X 4LRBA 3W5ZA 3EDQB 3MEDB 4KT0C 4YEAA 4NA1A 1UEVA 4HVZA 2ROEA 4Q5VA 1U48A 3HO1A 1TAUA 4PYDA 1CBKA 1NJYA 4ECSA 2B8QA 2HLTA 4K2JA 2F1FA 2LYVA 4N8NA 3UNGC 4D3GA 3QRQA 2K3KA 3IC1A 3IBCB 3ISNC 1C4AA 1H74A 1C2PA 1R8HA 3M6XA 4BC9A 1SH2A 4QIWD 1RZMA 4IRDA 2ILYA 4MKBA 3QIPA 3L7UA 1UVMA 3LO3A 1FRIA 1HWIA 2CNKB 3B4DA 4FDFA 2HPUA 4H54A 1SKSA 2BJ3A 2E5JA 2KRRA 2KT5A 3B6BA 1RT5A 3PYFA 1Y00A 2KRBA 2XMAA 1U1RA 1N54B 2ADCA 3IAS9 3JSMB 2BDPA 2R7UA 2MKJA 5ETKA 1FWLA 1R8CA 1RU1A 1WEXA 2YNIA 3HI9A 2MKIA 1U0HB 2COLA 1HA1A 1X5OA 2RRBA 3H2VE 5CCLA 1ITPA 2VC0A 4LF8J 4DOZA 1QDUB 2W7AA 3OTEA 5D3GA 3GE9A 2DNMA 4NXNF 2YKMA 3JB9k 2B6AA 2PD1A 1GXLA 4Y00A 3UN2A 2JDJA 3CTRA 3EUNA 1WELA 1OYEA 2JFDA 4QWDA 4ED5A 4XPEA 5CYMB 3ZTQA 1T9UA 4RKUC 3CJTA 3CNQP 2DGXA 3US5A 2DR7A 4NYPA 4FXWA 1YBAA 5C7PA 3RBZA 3D9BA 3R7BB 5HQ8A 2HQFA 1B4SA 2B5JA 1WORA 3MR6A 2GZOA 3QFHA 3RU0A 3MCOA 3QGIA 3FBFA 5KG5A 3CD7A 3NXZA 3Q2TC 2FLNA 4PABA 4C48A 3LF0A 1XMOJ 4JV2A 5LM7E 5J2QB 1G2EA 3CWJA 4MKAA 3BZQA 5BYRA 4DV7J 4ZPBA 2J8SA 1K8AT 4RWWA 5ETNA 3UFCX 4V19J 2MYFA 3X3UA 4CTAB 4J9SA 2DHHA 4WE1B 5KFPA 4ID5A 3RB6A 2E5GA 3HCXA 1HNIA 4LRFA 1EKSA 3R5CA 5HL7Q 3BPDA 1YI2S 1N32F 3CCJS 3K5PA 4N47A 5C2GA 2XLIA 3M8ZA 3N5BA 3PZPA 4DSIA 2VOOA 4FS1A 2RMLA 3LOUA 2EW9A 4QYZK 2X51A 3VALA 1TFYA 2PEHA 3NKYA 5A0YB 2XG8A 1ZTTA 3IGNA 2Q3PA 3TP2A 2HGNA 3N28A 4ZLNA 4OFZA 1YWXA 4O4GA 3ICLA 4BBYA 1FCAA 4CO0A 1X9WA 2G4BA 2VFVA 4JI2F 3D4JA 4ZIWA 3T6BA 3ISND 4NLXA 2UUCJ 2WVCA 2XB2D 3NG8A 3O3LA 1JLQA 2GO8A 4NEZA 4DV2J 4B9LA 4F8RA 3NBPB 1FFSB 1N0UA 2NXCA 1HQ2A 3HSJA 1WOSA 1S9GB 2QL9B 5B0CA 1WOPA 1U1KA 1B7FA 2OPRA 1KTVA 1K9MT 4O4GB 2RS2A 2AEJA 3HD2A 2I0XA 4HLBA 1S7IA 4M5NA 3BGFA 3OFEA 5AXMA 2XNQA 3VHQA 2L9NA 1JB0C 5LT5A 2BJDA 4DR4F 4N5SA 4ERDA 2X1GA 4X62J 3DRSA 4GC7A 3U27A 4FF3A 1RHKB 1T9YA 3AOAA 3RB0A 4HT7A 3W60A 2OSQA 2XS7A 1N33J 2QZ8A 4G1PA 1NHUA 2SXLA 2ASJA 3NGKA 4WJBA 3QPIA 3WBZA 4CLPA 4X4VA 5B08A 2CZ9A 2D7SA 2HBZB 3A3PB 3VAKA 1M5OC 4K4UA 3SSRA 2HNDB 4WE1A 3UO0A 4YMEA 1HNVB 1D0EA 1VQOS 3SV3A 3RGIA 4OYIA 1RQ0A 4DX5A 4C97A 1UEKA 3CJSA 5H9EJ 4CM0A 2BJ8A 3OTOJ 2X1AA 2XGQA 1UVNA 2E5HA 4X66F 3NOGA 2XZWA 4H4KA 3SEOA 1FD2A 3MMAA 1WG5A 3EVMA 4OX7A 1DURA 2VA3A 1UPPA 4OYXA 4DF8A 3Q23A 1G3OA 3HVWA 1HNVA 4LF6J 2RKIB 4NCBA 1VLOA 4OX9J 1KLNA 2O66A 1NRKA 2GQQA 4WP8A 1U6BA 4WXWA 1JNRB 4QWBA 2UU9J 1UETA 5A6WA 4R8UA 3H40A 1EAYC 2R7XA 2WZ1A 1W25A 4P2SA 2OFGX 3IWNC 3CULA 2BUNA 1WSRA 2P9CA 4JI8F 2QFIA 2PI5A 1YRXA 4MT1A 4Q0BA 1WTFA 3GJTB 1RBOB 5ETTA 4IYQA 3RZAA 3W66A 5KT7A 4ILMA 5CABA 4YFUA 3UD4P 2F4VJ 3Q8PB 2F4FA 2AGQA 3N9UC 1ZM4A 3IO1A 3ISZA 3CT9A 3JQKA 3G9CA 3LP0B 2CDQA 3PIPQ 1RA6A 4D3HA 5GAHU 4QWEA 4ECWA 4ILLA 4QU7A 2FC8A 2ZDPA 3H25A 4IRKA 2HQDA 3QGPA 2DISA 2EFVA 2JH3A 3T1AA 2AHOB 2MMYA 4YN3B 3W9JA 3BEGB 4ZJQA 2R7RA 3W64A 3TJ9A 2XCAA 2B4OA 2VPXB 3UPFA 1S1TA 3CJKB 3BREA 2RILA 3DU5A 2WOMA 3TUIC 1C0TB 2UUTA 1TKTB 1LXJA 1WC0A 1RAGB 1GMVA 2OEKA 2PA3A 3NY0A 5B0EA 2VA2A 1X4AA 2JFKA 3KK2A 2CQ1A 1N34F 2D3UA 3D6HB 2IAJB 3CF5Q 4NI2B 3BKUA 3DRXA 3J80U 1XTZA 4DR6F 5F0UA 4JV5F 2HHWA 1F60B 2R8GA 2V50A 4DZ6A 4BDPA 1SV5B 2QMXA 4HDGA 2CWKA 2FJWA 3FC9A 3N01A 1U49A 3OR1B 4DUYJ 2C2ZB 2CPYA 3TX8A 2M0GB 4NCGA 3I5AA 1BHNA 2P9GA 4ZOSA 5KFLA 1PJ6A 1Q7LB 1E6YB 2AYMA 1WF2A 2Y0SD 5I3PA 4EZ6A 2J9DE 3GP9A 4OZJA 3PR4A 1S12A 2IPOB 2BE7D 4X84A 3DLBA 1OPZA 4ICLB 1NSQA 3D28A 4CLUA 2FLPA 4JYAF 4Q45A 1NJIT 4M5DA 4X64F 4XDCA 4XK8C 5D4NA 5KTQA 4LF5F 2I1RA 2MJUA 3WX4A 2A2CA 3QJLA 4LR9A 1WWHA 1RHJB 1RYSA 1FJCA 2QRRA 3IMQJ 3CCVS 4KAIA 2MHNA 3CIZA 1X8DA 1U6ZA 3OR2A 4DFPA 2UXBF 2R2TA 1G7CB 3JTOA 1UMJA 4OHVA 4YY3J 5HBMB 4ECUA 4DUZF 3NWGA 4NLPA 1VQLS 3CCZA 1S7HA 1A6LA 2KYZA 2LXFA 4ECXA 1XNQF 1Q4RA 2AJFE 1C0TA 2HBQB 4DSEA 1HHTP 3V4IA 3ZNUA 5CYQA 3FMBA 3TEGA 4OYMA 3CC4S 4HI1A 1XNRJ 1OY9A 4KIAA 4ZP7A 4ZPDA 3HHKA 1S6UA 3X1LB 1EETB 3BS9A 4P10A 3BR9A 3BSOA 3DOMB 3SQGB 2CPZA 2LU2A 3U1NA 4ZJLA 1YJUA 4CLSA 3PJWA 2DIVA 3R1HA 1QTNB 2F8EX 2BX6A 3B82A 1H6KX 3SI8A 1T94A 1S1VA 3CC2S 2GS8A 3C16B 3D54A 4UTGA 5HATA 3HVRA 1MN9A 3FNNA 5IFMA 3CC7S 2VF3A 2RJZA 2CPJA 3J7Z5 3V6JA 3UCGA 3KMSA 5H9EK 1FKOA 1T3OA 3FFIA 1X9SA 2GAGC 2C3YA 4GKKJ 1ZS6A 3RTVA 1EB0A 2OELA 2XMWA 3M1VB 2Z58B 1IKXB 9ATCB 4NZ0A 3BO2A 4IR1A 2C2KB 2UZAA 1FESA 4OHXA 4F2RA 2MZTA 1TKXB 2BOAA 4Y6IA 1R89A 4C3KA 3FCVA 1T8EA 4NASA 1UTAA 3M8RA 1B0VA 2BM1A 1LWCA 1OO0B 3A3NB 1MROB 5KFXA 2ZBCA 3LP2B 1RHQB 3KLGA 2M9KA 3L7PA 1HYSA 1RWUA 5EWGA 4A8KA 1KFSA 4CH7A 4UW2A 2HZAA 3HHNB 1RSCA 1M5PC 1QTMA 2YVSA 3LQVA 3OVSA 4OZ1A 4WFNQ 3MR3A 3TARA 2GMHA 3CW2C 4CYUB 4IOAQ 1D8YA 3DLGA 1RWOB 3M6WA 4QPTA 4B3RF 1RJJA 4DCOB 3V6HA 4RW4B 1FX2A 4ZN3A 1L3UA 4UY85 3PCOB 3GONA 5HAOA 1Q8IA 3S1TA 1D9FA 4A48A 4RUBA 1H0HB 2AJQA 2MZ1A 4DS4A 2WVBA 1FDAA 2C42A 3CVKA 3P6YC 5KT4A 3ZFVA 1O6XA 3KYLA 2IVMA 4J9LA 2AJ4A 2BA9A 3BV8A 1U7LA 1WG4A 4L74A 4B08A 1HI0P 1F5BA 4X4SA 4K4XA 2K06A 4IG0A 1DTTA 1S6PB 2HNDA 1HBUB 1S1VB 4O0NA 5KFOA 1N8RT 4AL5A 2R8HA 2P9EA 5J1EA 2E1CA 1S4EA 3MM8A 2E5LF 2PI4A 1FRXA 5HP1A 4KFBA 3D1OA 3O44A 4DDFA 5E7OB 4LSLA 1IWAA 2BXJA 3N4WA 3DYAA 2ZE2B 3FSYA 1CJVA 2VH7A 4MK7A 4P9SA 4I56A 1X4HA 3T41A 1R0AB 3TI0A 1Y0HA 5KFUA 3BB5A 1XMOF 2M8DB 2ADBA 2AJ0A 1RWVB 4H4MB 1RT7A 2OUGA 1AT1B 2HFSA 4NYZA 1P8GA 2A10A 4NMXA 2WW8A 5JJBA 2IC3A 3CDEA 1NDCA 5E5NA 2NQPA 2L41A 3T9ZA 1NXIA 3QWPA 5L8RC 2YPYA 3Q8QB 3DYAB 1ZOTA 1QAYA 4B17A 2OEMA 4ZVOB 5LSRA 2NYIA 2RU3A 3MF5A 3QFWA 2ZH4A 2QA4G 4LRAA 4J9RA 3SMZA 2EWHA 1OSDA 2CA9A 3BDEA 3IR6B 4ZA1A 3EYZA 3KLFA 2VIHA 3TJ8A 2QL5B 4LVOP 3QWUA 4CO5A 1DZ5A 3P45B 3DDNA 3GCXP 3IAM9 2Y9HA 2J7WA 4OZNA 4RW9A 4EYHB 2BQUA 4DR7J 2MQQA 3UCZP 3KG0A 2V5HG 1LK7A 1YZ7A 2QO3A 3W2VA 1FKAF 2R42A 4PG6A 3K0JA 4PG7A 3L7OA 1KVKA 3T6JA 1OY6A 4NPOA 1RK8A 2VBZA 4U67Q 2FB0A 1F9EB 3DLEB 2UVRA 1NPPA 1KWMA 1IBLF 3W9IA 1VBZA 3TZXA 5ETVA 5J2MB 3Q8VA 2CJBA 4V19X 4IO9Q 2VD3A 2YWHA 3KLIB 1FRMA 4LSNB 2DXEA 3MM9A 1ZPWX 3QJPA 5D0GA 2DNGA 3SYZA 1HR0J 2DNQA 4ZS6A 2E9RX 3T5HA 2GGPA 2YX1A 1KOHA 4PG5A 2ATLA 4HT5A 2HHVA 2ZD1B 2AMCB 3HVTA 3MZIA 3G4SS 2HNYB 1LW2B 4P72A 3MOJB 3W3SA 3R1LA 2L9WA 4K4WA 2AWZA 1ICEB 1U2CA 2ABYA 2EG1A 2MSSA 2ROPA 3I9ZA 1QSSA 4NLDA 4PXBA 5F9NA 4ZLJA 2ZNZA 4FXVA 1FE0A 1FNXH 3CCUS 4C8OA 4QYRA 2W4DA 5CA5A 3TAQA 1IM6A 1XC9A 5AXKA 4X66J 5DQIA 4TQRA 4J9OA 1F1BB 2ASDA 2VG5B 2KXNB 2W9CA 3EZ5A 3JSMA 1ZPVA 2B9EA 2Q79A 2Z2ZA 5CZXA 3BYRA 1FRJA 2F65A 3K2YA 4K5RA 3W7BA 5LSLA 2VQFJ 4DV5J 2BOPA 1KQGB 3KMQA 4O44B 4DHVA 1RT4B 3CEDA 4OX8A 3CDUA 4HTJA 2QLBB 2AU0A 5DG7A 3GIIA 2YTCA 4NLOA 4I6AA 1YVFA 5AE1A 2CRLA 1N88A 4O3QA 5KFNA 3BPSP 4DR3J 4JI8J 4BS2A 2K2PA 4CNYA 4PZVA 1Q82T 4QBUA 4KBIA 4FKYA 1RT1A 1LWFA 1LWEB 2XO7A 3UD5A 3B4MA 1BLUA 4RBUA 2YQ3A 4LSNA 3OHAA 1KR4A 5KFQA 5J2PB 4ZHRA 2DNOA 4CLTA 4EMDA 5K8OA 2F8HA 3OQ2A 1NH7A 1HNXF 2KTQA 1NDPA 1NH8A 5GAHI 1GMWD 1NZ8A 2CIMA 4Y65A 3OFGA 3D6MB 5J1PA 2F5GA 3VVUA 3UCUP 2N3OA 3P4UB 1DLOA 1H2TZ 4DL4A 2CQ3A 1J5OB 1AA1B 1V9OA 3M8YA 2IM2A 3ZO7A 3N6LA 1T9TA 4KHPF 2Q43A 1T3NA 4F4KA 3WZ0A 2JOQA 4ED3A 2F8MA 3TVKA 3HXMA 1ULRA 5F8JA 1T95A 5M2RA 5C25A 2BEFA 2OSRA 3JQJA 4HI2A 4OHZA 4KPCA 1X0PA 3DHXA 4G6VB 4W4MA 5I4MA 3PX6A 2C3OA 1YHQS 2VG6B 4PWDA 5C24B 2YKAA 2BACA 4CO3A 1VIXA 3KJFB 3DU6A 4ZDNA 2YNFB 4CLFA 4I0WA 2XMTA 4ZVTB 2VQEF 1KD1T 1MSWD 3C14B 5DQHA 1FXRA 3KLVA 1XR6A 2XLJA 5HLFA 5KFCA 1L3SA 2DYAA 2KYXA 2JHEA 3DRRB 4OLOA 1VLYA 3POTA 4MJKA 2DH8A 4TY8B 1OQ6A 1CJKA 2IA0A 2OTJS 1N5YA 1IR1A 1FXDA 3VAFA 1OS5A 2VKRA 1S9GA 1CC8A 1N0VC 5H9FJ 2A2DA 2FJAB 3D2WA 1R0BG 2WBRA 3C14A 2UUBF 4LBIA 2BRKA 1Y9OA 4USVA 3WDOA 3S6EA 2IBOA 2VBWA 3CDAA 1HLWA 3OFHA 3HDSA 4K8RA 3J80Y 1KEKA 1HNZJ 2ZZNA 1KOOA 1RABB 4WXOA 5LMUJ 3FCHA 4ED8A 1TKDA 3TUZC 2KL8A 3R5AA 3R27A 1PBUA 2LEBA 2LLZA 3FQKA 2I5JB 4DV4F 2DGTA 2NLWA 4X4UA 2VB6A 4RBTA 2DEJA 5BXIA 3I87A 3D68A 2QE5A 2N4DA 1HMVA 3WC0A 4J9PA 1QVGR 2HFUA 5AE2A 3M2RA 1S5ZA 1UWBB 4USHA 5DM6Q 3UVJB 2F9JA 4X4PA 1KLMA 2RT3A 4B9UA 3BKFA 1S1WB 4CH0S 5JUMA 1BMQB 1KVIA 4J9QA 3BBCA 1DQAA 2VBXA 1L5UA 1S1UA 1REVB 1FRHA 2WONB 3NGSA 2M3DA 4QOTA 7AT1B 1NMEB 1HHQA 2XGPA 3LGNA 4YR3A 1V3ZA 1MMDA 1N4LA 3NWRA 2GVDA 4LT6A 4FYVB 4OI2A 3MMBA 4RNHA 2WHOA 4LQ3A 2ZH2A 1UP1A 3V81B 2IM1A 3EMTA 3N0VA 4R8UB 4K4SA 2C3UA 3D1HA 2GAHC 2HHHF 3CD5A 2M7SA 4HACB 4HH1A 1C1BA 4ZP6A 4TQSA 3R97A 4GKKF 1HIYA 4EUVA 2FVCA 5DLFA 5K20B 3IRWP 3GTYX 1CJUB 1PYTA 1AFJA 3PR5B 4NYOA 1U2RA 3MEGA 1NZAA 1WC4A 4OLPA 3TX0A 4K7QA 2Z2MA 5F3TA 1BQNB 3F56A 3K5OA 3VQSA 4ATNA 3SV4A 2R7WA 1J5EJ 1UVIA 1RWKB 4OYWA 1HD1A 4DWIA 1P27B 2ALYB 1HBNA 1RT6B 3I82A 4LR7A 5KOWA 2B7CB 4KE5A 1PG5B 2EC2A 3OTCA 2IM3A 5CZVA 5KG7A 3U02A 2V4QA 1LW0B 3DLKA 3AAWB 4DL7A 2YKQA 3ULHA 1CS4A 2M52A 2DXDA 3BBFA 4LVNP 4PKDB 5CYMA 1FRKA 2E1RA 1YJTA 1Y7PA 4U7UK 5AJ3F 3DOMA 4QIVA 3KNGA 3SQGA 4C2MA 4PRFA 1RAFB 1UAWA 1S76D 2FHKA 2NPFA 4L76A 2MLXA 3ZZZA 2VJUA 2IMOA 1QM9A 2CPEA 1RISA 2OLWA 2FHJD 5EUHA 3VF0B 1ZTWA 4FXDA 3SCKE 1YRTA 4CZCA 5IOLA 4X4OA 3BSAA 2B7BB 1TTHB 3HHLA 4A8QA 1FDBA 4R0JA 4KPYA 4FYYB 2NZ4A 3KLEB 2CADA 2HK3A 2OEJA 2W2QP 3KUGA 2FY8A 2ZNYA 4OV6A 4DV0F 3MMBB 4QW9A 1MMNA 4NCGB 1HQEB 3OV7A 2H54B 4XTTA 1VQMS 3V81A 3MEKA 4F04B 4LF4J 1WOOA 1UJ5A 2DR6A 2BANB 1T03A 1KQKA 4UUWA 4Z37A 5BJRA 2C2DA 1DFDA 1AB8A 3BSCA 1BQMA 3IA0A 1UW9A 4K59A 1U1MA 1VC5A 3LP2A 2B6AB 3GSIA 4TU7A 1PGZA 3GFHA 2HFOA 3RR8A 3HSZA 1XMBA 1R0CB 3MAAA 3MEGB 2W2PP 2QSFA 2ATCB 3FSXA 3OXGA 4B02A 1TQLA 4PQAA 4MK9A 5ETLA 3GV8B 2VICA 3MMJA 4CH1A 3DLHA 1FKOB 1S79A 1IBKJ 1PJ7A 1RTZA 2JSXA 2XYPB 3LANA 5HROB 1RWWB 1NHKL 2X3DA 2B9WA 3R5JB 3SBMA 5JVGQ 3T1HJ 3B8HA 1RAHB 3DOLB 1AROP 2QN6B 2XO6A 3M2UA 2A6OA 3PO5A 5B7WA 2XCPA 2V2ZA 3N5FA 4C0OC 1NPKA 1R8PA 1LWCB 4DF4A 4NWBA 1MU2B 1N6QA 1VQ7S 4ITSA 3KLHB 3P49B 1SPBP 3KNAA 1LOUA 1UKUA 2ZJQQ 3KG4A 2IJRA 3NGRA 4PG4A 5DDQC 1OIAA 4O3NA 1GNKA 3MM7A 4GC6A 3D6FB 3MCNA 1YQHA 4DL6A 1RTJB 1VQSA 1DQ9A 2AYEA 2V34A 2WK4A 3MEDA 1T0TV 4ZVRB 1Q0NA 5EDWA 2MKSA 2H3EB 3K57A 3KHHA 2YY3A 3QYYA 4GRSA 3KUEA 2MEWA 1SL0A 2WVFA 1ELOA 1BGXT 3FCWA 2OPQB 3DCAA 2JX2A 1K1SA 4S0MA 1QD1A 3CJ3A 1DTQA 4CO4A 1WHXA 4EO6A 3W2WA 3NMRA 4KO0A 4WU3A 1K73T 1IUJA 1BQMB 1KP6A 4RW6B 2NSBA 2KFZA 1BC6A 4WP9A 2YH1A 2AT1B 3HJFA 4Z7YA 1FE4A 1N34J 2BE2B 2UVWA 2IIHA 1PJ5A 2MY8A 3MOZA 4Y2IA 3LH2S 2W2OP 3Q8UA 4NEYA 1BUXA 1HBOA 4P2MA 1C1CB 2V8GA 2K8GA 1U8SA 1PBAA 1TKZB 3H98A 4DUYF 3NNAA 3ZC4A 5D3GB 4DL5A 1K1QA 3M2UB 1X4BA 3D7SB 5SUHA 5T41A 1GK8A 1I6JA 3LP1A 1RTIB 1ZAVA 4I69A 4M63A 2Z56B 4TKTA 5IWAF 3MR5A 4J7CA 3CCWA 2BW7A 2CJ9A 1RBAA 1PC5A 1JLEA 4DPOA 5KFBA 4QWCA 3HP6A 2DPJA 4RW4A 3QSIA 2PFDA 3IXQA 3T1YF 3GQCA 2ACYA 4QR0A 1M5HA 1JXEA 4DN9A 2DGQA 4ZK7M 1GEHA 1F9FA 3AD7C 4UQTA 2KZMA 2CPDA 3PTWA 5A8WB 1NKBA 5IT9Y 1TZ0A 4HHJA 4Y0FA 1WG1A 3I4HX 3HLUA 1SQGA 3BN4A 1HI8A 5D78A 4JI6F 3S01A 2ZITA 4A8OA 4CNZA 4RNNA 2XC9A 3J7AN 3FBEA 1TL3B 1HBUA 1X7VA 2W4CA 5RUBA 1YDLA 3O1LA 1D9AA 1QAXA 1UJ6A 2DD8S 3MM8B 5DETA 1WNEA 1QE1A 4DR4J 1RAOA 1VOMA 1F9HA 4KO0B 2QLFB 5A2QY 1URRA 4LIRA 3MFIA 4I68A 4NA3A 2XMMA 4LBPA 4DPUA 2DNRA 4YS2A 4RW6A 1WC1A 3PRVA 1J2VA 2QMUB 4G1IA 1I94F 1N33F 3R5BA 5I3QA 1Q78A 2VPZB 2BE2A 4H4MA 2ZZTA 3JXOA 2QA4S 2M2BA 4LIWA 3M30A 1JX4A 3CIMA 5HVGA 3TA2A 1R27B 1UPMB 2CQPA 2KKHA 2BE9B 3JTPA 3ENWA 1YTYA 1W7WA 4DR3F 5KFWA 1RHUB 1U2FA 4M5GA 1C1BB 3M7VA 4DR1J 2B4UA 4AXIA 3PV8A 1L3KA 4A8FA 3J81j 3LGMA 3TEHB 1WEZA 2DO4A 4NCAA 3SZ2A 2D74B 2H9ZA 2C3MA 4B3OB 4B9VA 1OWXA 4FBTA 1JKHB 2AGOA 4WZQA 4TLRA 1FERA 3HHDA 3W5YA 4USMA 1DAXA 4GVLA 1VQNS 2CG8A 3CJRA 2KHCA 3HFZB 4CRJA 4WCEQ 3THVA 1TK8A 3DRPA 1QY7A 1TAQA 2C1EB 4FZVA 1VC6A 1S9FA 2GW8A 4Q0BB 1ZA1B 3NCPA 2CVIA 3DDKA 5DZ6A 3G6YA 1BWEA 2FVSA 1H73A 2IVYA 3TNVA 2RH3A 4MIBA 2HRYA 2V4JB 5BYQA 5HQMA 3I31A 4HHHA 2HFNA 2LA6A 4ZITA 4L72B 4F67A 3NS6A 5LSOA 3HZEA 1HWUA 4RU2A 4I67A 4I2PB 3UD3P 2VFUA 4O3PA 1EETA 5C25B 4I7FA 3QRPA 2M70A 2O67A 2HRUA 1S1TB 1WHWA 2W7PA 3TUPA 2CJXB 1LW2A 2MJNA 2PMWA 1SKUB 1U45A 3GPAA 4MAKA 3PKYA 4F4ZA 2DNKA 2FGOA 1T05A 1IR2A 1RI7A 2E7XA 5F8IA 3DI6A 2CVEA 5CHCB 3EPGA 1RA7A 1NKEA 1CQNA 2OIHA 4K0KJ 1YJ7A 5HLFB 3K58A 3VAGA 3I96A 1RGVA 1NHVA 2J6SA 2ZKTA 2VL1A 1HWJA 1VS3A 4IH6A 4PQUA 3GV5B 3DHWC 3EZUA 4ZVQB 5DDOC 1DLOB 3PYEA 4ECQA 1U1LA 2Q66A 4CT8A 4HKQA 4B3MJ 1FX4A 5FJ4A 3OR1A 1SJFA 1XQIA 4WFYA 1HQUB 2HSEB 4ES1A 2IYGA 4PXEA 4WFAQ 2ZH5A 3R6GB 3CMAS 5LMNF 2P8IA 2OD6A 4NLTA 2VZ9A 3N6NA 3K5NA 1S59A 1SI9A 1Q95G 3HFVA 1JLQB 4OL8A 2V9KA 3FBCA 2HEKA 4ICLA 4TLQA 2V67A 2BKNA 3D0IE 1NK8A 1QAIA 4K4TA 3NGTA 5IS2A 4ECRA 4F4YA 2CG4A 1NNDA 1SUQB 4YHHJ 1EKRA 2RRNA 2MY7A 4RNMA 1AXQA 4MTPA 4DX8H 2GHPA 1QAJA 1LWXA 2U1AA 5FLXY 3BGRA 3GZ7A 3K59A 2LECA 2KXFA 1QLNA 4YB6A 4FNIA 3UR3C 4QIEA 3W8PA 4NZ6A 4E0DA 2HQIA 5LOQA 3EWGA 2B3TB 3ILLA 4M5IA 2V68A 2MKKA 3OLBA 2W8LA 1PYSB 4GO7X 5F8LA 2BZ2A 4EZ9A 2V8HA 4EWTA 2XWXA 2VONA 1KTQA 2ZVSA 2XSJA 2FJEB 3NS5A 3Q83A 2OFHX 4IG0B 4MH8A 4FP9A 5AJ3J 1N36J 5B0FA 1QJHA 3BR8A 3IFEA 4JV1A 2OH2A 4IFYA 5M2PA 5K14A 2KZZA 2JC0A 1TUVA 5CXTA 4RLEA 2J0SD 5KFFA 5BYSA 5A6PA 5IXUA 3RB4A 3R2CJ 1HYSB 4OMFG 1FF2A 2KI2A 2D3OR 1BWVA 3UVJA 2EK6A 3DC2A 3TZWA 2Y8WA 2MHEA 4MKVA 4OYBA 3PW2A 4LJMA 3CSKA 4PPDA 5KT3A 2RUGA 1L3TA 2JLEA 2ZHBA 1WDDA 5K14B 1I5OB 1C0UB 1YGYA 2FHOB 4IFVA 2VUGA 1BQNA 3NS7B 1T9VA 4N7TA 4AXJA 4TU8A 3G6XA 1VMBA 2NXJA 3C19A 2IVFB 2J7UA 3M1VA 4HEA9 2BQRA 2HHQA 3FUYA 3RG6A
chains in the Genus database with same CATH topology
2XEXA 1Y3JA 3HX9A 2W8KA 2DIUA 3QAEA 2KFNA 1DBDA 4UOCA 5AXNA 1TVRB 3RBDA 5F0WA 1FRLA 1UVKA 4H4OB 2IM0A 2GNKA 3J7YI 3PNIA 1BD6A 1NU4A 1LV5A 2HLUA 2YKMB 1DARA 3GFXA 4CT9A 2WSFC 2XMUA 3G8TA 2VQFF 5L1KA 3DLEA 4DV5F 1D1UA 3HHNB 2UUCF 1D9DA 1JNZB 2X1BA 2VODA 2OPPA 2M4MA 3GIMA 1GX5A 1WI8A 7FD1A 2CQGA 5E2QA 4P7VA 4F2SA 1S49A 4NL5A 3PEHA 5ADZA 5E3RA 3OL8A 3FMWA 3M8QB 1U6FA 2APOA 1ZBTA 1X0FA 4IUFA 3CJ2A 1U09A 4DSJA 1UL3A 2KJVA 4OI6A 2ZH8A 3QJJA 5G0RA 1WEYA 3CDWA 2QLWA 1VRTB 1ZM9A 1FDNA 4R25A 3DRYA 5HP1B 5EX0A 4ID5B 3MCSA 4WK1A 2ALZA 1KN6A 2PE8A 3EGZA 3BN7A 3THTA 1LKZA 4NLRA 3RRGA 1FEHA 1R0AA 1Z4UA 1JWWA 1KNZA 3PHEA 1TL5A 3D0GE 3AA9A 2G0CA 3GR0A 2I2YA 3BGLA 2HIQA 4A8YA 3UR0A 5KG4A 4XPCA 4IDKA 3QO9B 4EGLA 1MWZA 1RYRA 4OX9F 3OPKA 2C2RA 2E1AA 3N79A 3T5JA 4OX6A 4DQIA 1N56A 4ZP8A 7FDRA 2DHXA 2HNYA 1JLCB 4IH5A 1RAJA 4KHMA 2V4RA 2ZHAA 1QUPA 3TAPA 2DJWA 3H4DA 1NK6A 2YWFA 2JEJA 4ZHRB 4RUHA 2KFYA 3PDNA 1PILA 4IQMA 3GIJA 2DPIA 4TYAA 2W7OA 1O51A 4OI4A 1HNZF 2EFGA 1X5TA 3DLJA 1ZAWA 5LL6d 2K7KA 3AQPA 3BDPA 3NLCA 3MTJA 3C6TB 1EP4A 2EFQA 3SSSA 1B0PA 2P5VA 2OTLS 1RDRA 2LDYA 2VFSA 2BVZA 2ZJPQ 3RW7A 2A1BA 4O44A 2XULA 3U1MA 3ZZOA 2J9DA 3FJ2A 4IOBA 2ASLA 2YX4A 1S97A 2J9EA 3C6TA 2MSTA 4FYDA 3SXLA 1N48A 2DNHA 4TYBA 4KV8B 4JV0A 2MPUA 3FQLA 4DR5F 2JVOA 3POTB 5KFHA 2X3GA 3G96A 4MYTA 1P1LA 4DFKA 4RUCA 4BWMA 5J2PA 2MZQA 4F26A 4B9NA 2MQLA 5IM0B 2HMIA 1NAQA 1NK7A 3BGUA 2LQ5A 3I32A 1NEEA 5K8MA 2HHTA 3OJSA 4F02A 3Q0AA 4DSKA 4A46A 3MECA 3HHLC 4Y2KA 5E0OA 3GIKA 2VOPA 2WCXA 2YWGA 4YDDB 5GMKa 3MM9B 3AH6A 3QLHB 4BCAA 3V6KA 1R43A 3PM9A 1F2GA 3PW5A 4IKAA 4KKOA 1ZH5A 3MMAB 5M2UA 1RT3A 2YNFA 5CD4H 4CTAA 3CPWR 1PSDA 2AW0A 4N56A 5A8KA 5GAEU 2G9OA 1NB7A 3V6DA 2DHAA 1MW7A 1FK9A 3DRRA 4TY8A 1Q1KA 3BSNA 4MKYA 3CDBA 3H5XA 2DGOA 1FO1A 4ZPVR 2IRXA 4KB7A 3IS9A 4TU9A 1LQ9A 5C5JA 1HFEL 1RT7B 3UQSA 4NLQA 2OD4A