4I2UA

Crystal structure of the reduced glutaredoxin from chlorella sorokiniana t-89 in complex with glutathione
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
109
structure length
109
Chain Sequence
b'SAAKQLVDSTISGNKVVIFSKTYCPYCVKGKRALEKFLPKSKITAIELDGRNDGAAIQDYLLELTGGRSVPRVFIDGQFIGGGDDTDALARNGKLEVMLRNAGVLLEHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords glutaredoxin
publication title Crystal structure and functional analysis of glutaredoxin from Chlorella sorokiniana T-89
rcsb
source organism Chlorella sorokiniana
molecule tags Oxidoreductase
total genus 34
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2012-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00462 Glutaredoxin Glutaredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4i2uA00
2DJKA 2OBIA 2P31A 3KP9A 3LORA 2P5RA 3M0FA 2OADA 4AJ7A 2MMAA 4ZIJA 5D96A 5ELAA 3VI5A 1GSYA 5LCZA 5JWQB 4XS4A 5DAKA 4XCSA 4MDCA 1O7UA 2H0GA 4F9ZA 4ULXA 1Z5YE 2CA8A 4LMVA 3D4TA 1FVKA 1O85A 1Q4JA 2YCDA 2GZYA 2FHEA 3CMIA 3KEBA 3M8NA 5JCUA 3GKKA 1JLWA 2GSSA 2C8UA 3L9SA 2YOIA 4X43A 5B7CA 5D93A 2KP2A 1WWJA 3IBHA 2A4VA 4NWYA 3WYWA 2WULA 4JR4A 3DEXA 1UA5A 1FOVA 4ECCA 5ECQB 4EO3A 4O5RA 5ID2B 4JZQA 4EKZA 3G9BA 2C1YA 5JCGA 2LNTA 3DIEA 1M2BA 4OFMA 3TKSE 3UAPA 4L0WA 1XIYA 4K8MA 1ZMAA 2YN1A 2GTUA 4G19A 3UVHA 1Z7PA 1GP1A 4PQ1A 1YDKA 1XOBA 2NBSA 2IMFA 2OJLA 3FZ5A 1SJ6A 1TRVA 2OE3A 4YAVA 5DBQA 4TXOA 1PMTA 4V2MA 3IA1A 1PX6A 1PN9A 4BVYA 1WJKA 4OCEA 3N5OA 3HKRA 3MNGA 1TU8A 3P90A 2BJXA 2PVQA 1VRSD 2E2GA 1HNCA 4CDOA 1WMJA 3LSZA 2YJ7A 5H5RA 1DSBA 1GUHA 3TKRA 1EP7A 3P7XA 3TOUA 2WZ9A 2PBJA 1WOUA 4BWQA 4GLTA 4POBA 4Z7XA 5DALB 2V1MA 4KA0A 1S3AA 3BOAA 1AUCA 1I9DA 1YQ1A 1PX7A 4TN8A 2WS2A 2OKAA 1AQWA 1M2DA 3CRUA 2XBQA 5IPGA 4POMA 3GSTA 2MMNA 2L5LA 1BJXA 5DQYA 4ZB8A 1K3LA 1HNBA 1YKAA 3IOSA 2JU5A 2JADA 2L57A 2GQMA 4WF4A 4NMUA 2HZFA 1XW5A 2ON7A 3DWVA 1KNGA 4WXTA 1ZZYA 3C7MA 1THOA 1BYEA 2AV4A 2LQQA 1QMVA 3NOFA 1Y25A 3H8QA 4MJBA 5GAPD 3D22A 2JL4A 2GSQA 4LMWA 2LNSA 3DVWA 1B48A 2A2RA 6GSWA 3IDVA 1TRUA 1O81A 2JSYA 2H19A 1A2MA 3F3RA 1T1VA 3KH7A 4DSQA 4FYUA 4GQFA 1XWBA 2FA4A 4EDZA 2HZEA 4KGIA 4KH7A 3ME7A 3QFBC 3WT1A 3QFAC 5CYYA 1BEDA 4H86A 2F8FA 3HJOA 4PQHA 1K0AA 1FB0A 4I97A 4ML1A 1R7HA 3SBCA 4HEA2 5ECLB 2MBTA 5G30A 2X8GA 1RK4A 1Y6EA 4TR4A 3GX8A 1A0FA 4PNGA 5IIZA 4F2IA 2LRTA 3U5RE 2VCWA 1Q98A 2R2JA 4EDYA 4MA9A 3GURA 1TOFA 4DSSA 4V2LA 1GTIA 3ZLPA 4POLA 4WEYA 2VCZA 3O76A 2ZUPA 1K0MA 4I5QA 4L0UA 2X64A 3FKFA 2L4QA 2MMOA 4IW9A 4ZILA 4AJ6A 1EZKA 1RQMA 1Z7RA 2VLTA 3WGDA 4MK3A 3EU4A 3HY2A 4KSOA 4MJEA 3FZ4A 3GL3A 3Q18A 2IJYA 3ZMKA 4N0VA 3EC3A 3DMLA 5H5SA 3EMPA 1X9WB 3HVSA 2IN3A 2LUSA 2X8HA 2H0IA 3GL5A 2YP6A 4IN0A 1TJDA 2E0QA 1FB6A 1XWAA 5J4UA 4KDUA 1J9BA 3C8EA 1X0RA 2WFCA 4MABA 4PXOA 3DGQA 3FR3A 5IO2A 3O6TA 2HFDA 1FG4A 3ZRDA 1GRXA 4GRFA 2YWOA 1QXHA 3TJGA 1KBNA 3APQA 4GSSA 4G10A 2ES7A 5E59A 1X9SB 3UIWA 3LGCA 3EWLA 1GWCA 2M72A 3KM6A 1PKZA 2VCTA 1GTUA 4IJ3A 1G6YA 3PH9A 6GSSA 2LS5A 3GHAA 3HVXA 4HJ2A 2VLUA 4NPBA 1QQ2A 1HQOA 1SYXA 5J3RA 5CRGA 3TKSA 3QOUA 4BWSA 1Z9HA 3VWVA 3MAKA 3KZQA 5HQPA 5ENUA 4HZ4A 1ACVA 3ZL5A 1GSDA 1EOHA 1U3AA 5GSTA 5E4WA 3GIXA 2CVBA 1X5DA 3ZVJD 2VUPA 3TRXA 3GKNA 5AISA 4LL1B 2PPTA 3TRQA 1R5AA 1SK2A 1GL8A 1ZGNA 3KJYA 3C1RA 1JLVA 3D4MA 2FWFA 1U88A 3J7Yb 2E2MA 1SD8A 4HDEA 1OC8A 2N5BA 2CAIA 4TR1A 1XCCA 3LYKA 4NV2A 3RHCA 4NAXA 3HVVA 4AGSA 2FY6A 2DJ1A 2JZTA 1XW9A 1SJIA 1PA3A 3TKQA 1T7PB 2YWMA 2J23A 2KLXA 3F6FA 4YQMA 2IMEA 4XRAA 5CREA 3L4NA 4K7NA 4ZBAA 1F37A 1M0UA 5HFGA 4PUFC 3BCKA 5ELGA 3TJFA 4IKHA 1BX9A 2HXKA 4HI7A 5B8AA 1F2EA 5D9TA 1SENA 5L71A 2C0FA 3UEMA 1BQ7A 1JZDA 1XWKA 4KB3A 2JSZA 4ECJA 4ZL9A 8GSSA 2VL3A 3LYPA 3F6DA 5DDLA 4FIWA 6GSUA 1X9MB 3CTFA 3TJBA 2V41A 3CSIA 1GLQA 4FYCA 3QDNA 4G2EA 3HCZA 2VM1A 4MP4A 2G2QA 5D9WA 2LV3A 1LU4A 3C71A 4N30A 2NPBA 4N10A 2MZCA 3WGEA 1IYHA 2B1LA 4X1UA 1USBA 2C4JA 2R4VA 3GFKA 2JZSA 1M99A 2ZNMA 3D5JA 5ECOB 5HFIA 5IMFA 3LEFA 1OAZA 3UARA 2V2GA 3GTUA 1PQNA 2M80A 1EEJA 2NDOA 3TKSC 5J5NA 3TCOA 3IXRA 4BVXA 2YNXA 3ED3A 3ZTLA 4HQSA 3I9V2 1R5PA 3LXTA 3G7IA 2IWTA 3MDKA 2YZUA 5ABRA 2L6DA 5KEJA 2FWEA 2VAFA 4QL7A 3D21A 1OC9B 2PERA 3EYTA 4BPYA 3CSHA 5J9BA 3WGXA 3TRPA 2XC2A 3CYNA 3IRAA 3KMOA 3L9UA 1S3DA 4IBPA 3U6VA 2VM2A 2TRXA 3ZIVA 2CAQA 2H6ZA 2HLSA 4OD7A 5IMAA 3GN3A 3BJ5A 1X5CA 4K6XA 2OA7A 4MMMA 2FWHA 2RM5A 1MTCA 2H1DA 5AIXA 1XVQA 1JZOA 4MH3A 4OO5A 4TRXA 3IR4A 3KCMA 2YV9A 1K0CA 2VL2C 2PMTA 2OBKA 4CHSA 4YAPA 2HYXA 2OACA 3GKMA 1LBKA 4FYBA 1JHBA 4EE0A 4OFNA 5D9XA 4LL4B 2GZZA 2QC7A 1EV4A 1WE0A 2B1KA 1K0DA 3FY7A 4N11A 12GSA 4XTSA 2K6VA 1A2LA 1XZOA 4O7HA 5HR3A 2VOCA 3M1GA 3ZFLA 4JEDA 4DEJA 5INYA 1A0RP 2WJUA 4MZWA 4XIHA 2MMZA 4HQZA 1SD9A 1U6TA 3S9FA 3F4SA 4Q5QA 1EP8A 1GSQA 1K0BA 2EIRA 16GSA 2AAWA 1ERUA 3A2XA 2CQ9A 14GSA 5EPFA 1E6BA 3KMNA 4YQUA 1DE1A 4NHZA 4XS4B 4LA1A 5DAKB 1W89A 2H74A 4O92A 3TGZA 4ECIA 1NHOA 2GSRA 5ECMB 3IE3A 4Q5NA 1F3AA 4OWYA 4QQ7A 3C1SA 2A2SA 1VF1A 1ILOA 2FCHA 3BCIA 1M7TA 2BTOT 2AYTA 3O3TA 1OKTA 3PR8A 1GLPA 2XPDA 1CQGA 3QAGA 1AC1A 1XOAA 2LKUA 4KSMA 1YF0A 2F9SA 5C00A 3QMXA 10GSA 1YJ6A 3F9UA 3JCML 4EUYA 4IS0A 4HS1A 1GUMA 1M9BA 3OR5A 3KTBA 3I6AA 2FA8A 3IHQA 4K0NA 2F8AA 3Q74A 1AQVA 2B5XA 3V1WA 1GNEA 4TXVA 3E9JB 2PN8A 3HHVA 2FGXA 2NTOA 4RI6A 2HSYA 4KE3A 4D73A 2IFQA 2V6OA 3ERWA 3LJRA 4GQCA 2GLRA 2IMKA 5LD0A 5IMZA 3H4KA 5ECPB 5CNWA 4ILFA 4OCFA 3UOMA 2PU9C 4JE1A 2IIYA 1VF3A 1NSWA 2WRTA 3QCPA 4JU5A 1A8LA 2GT6A 2TIRA 1OYJA 3RHBA 2KHPA 3UVTA 3W6GA 5JWOB 3VPTA 4TXOB 1A24A 2EIOA 1AAZA 4KNDA 3A2WA 2RUFA 4IVFA 3FRCA 5ECIB 2ON5A 1ON4A 5F0GA 1UC7A 2PUKC 1SL1B 3IPZA 3I69A 5IO0A 4GWRA 2MYGA 3GNJA 5ECKB 1GH2A 5AIVA 1HYUA 2RIIA 3F4RA 2DMMA 4PQIA 1SK0A 2N5AA 4FH8A 2FLSA 4ZL7A 3F0IA 1AIUA 5ECNB 4L5OA 2O8VB 2WB9A 5D8IA 1O6JA 5G5FA 5A5KA 5JWRB 1SL2B 4KDYA 3G7YA 2LTKA 3W8JA 1N8JA 2VCQA 3FHKA 1GSSA 3VWUA 5F06A 4HZ2A 3TKPA 2DIZA 3VI7A 5HR0A 1PKWA 2LRCA 3FR9A 2REMA 2LJAA 1WP0A 5G2ZA 1KTEA 2VD0A 4K7IA 4E8HA 3J7Yk 3FK8A 18GSA 3F8UA 1TKDB 5J9CA 4N0ZA 2R37A 2OE0A 2PVOC 5CRHA 1F9MA 3GKXA 1QUWA 3WD6A 4MH2A 1THXA 1PD21 1QFNA 2I4AA 5KN3A 1FW1A 5EY6A 1SU9A 3VWXA 1G7OA 3MSZA 3TDGA 1GUKA 2B5YA 1EOGA 3D0ZA 3SWLA 3FYGA 2N5FA 2GVPA 3ME8A 1MDJA 5G1KA 1ERWA 3LQ7A 4XHMA 1GTBA 4WR5A 2WDUA 3RBTA 3IK7A 2H75A 4DSRA 4WETA 4WBRD 3F4TA 2DBCA 9GSSA 1WIKA 1T4ZA 1Z6MA 3TUEA 1AXDA 2HZEB 4RQRA 3ZYWA 2VIMA 3L78A 4JR6A 2MBSA 2XPEA 4RI7A 4F0CA 4ZB6A 2K9FA 4IP6A 2TRCP 2B3SA 3GUSA 2ALBA 2GGTA 1ZYQB 1SJZA 3L0HA 1PGTA 2IL3A 1YZXA 1YEPA 3KIJA 1HNAA 1XPVA 3MWHA 3TB2A 3BD2A 4Q5FA 1TDIA 2L5OA 3VK9A 2PWJA 4BL7A 2VL2A 6GSXA 4ECBA 2C0EA 5CRWA 4DSSB 1FHEA 2F51A 2ZCTA 4ZL8A 2L4CA 4IQAA 2DJ2A 2H73A 1C72A 3VURA 1B8XA 1T8EB 4IHUA 5F05A 4NHWA 1W4VA 5ID2A 2VL9A 2X8CA 1DUGA 2H1AA 4G9HA 4K2DA 2FUG2 5IM9A 1XXUA 3KXOA 1V57A 4QL9A 2HRFA 2P0GA 1Z6NA 2RM6A 4MJCA 3Q6OA 2JACA 2CVDA 1PSQA 2PGTA 1VGLA 3QD9A 1OVNA 3GX0A 2HRNA 1VF2A 1DBYA 2H66A 2J9HA 2C3QA 3VFIA 2IMIA 3HYPA 3M3MA 3VPQA 3H93A 2GQLA 1V58A 2O85A 3FW2A 3QAWA 5IMCA 5DJMA 3IV4A 1WPIA 4GF0A 3KP8A 2VO4A 2DJ3A 1XFLA 1F6MC 3E0UA 4PNFA 3I43A 4ID0A 4KW6A 2CX4A 1NM3A 2K8SA 3ERFA 3ZREA 4MPGA 3GH9A 1ML6A 2IMDA 3EURA 2GDRA 2O89A 3FR6A 5DALA 1ABAA 4GCIA 2GS3A 2FD3A 1TRWA 1FVJA 3KGKA 3FZAA 20GSA 5D9VA 4XS1A 4PURA 2H76A 19GSA 1R4WA 4JRRA 4HU7A 5A4WA 1DE2A 3IK9A 4TVEA 4V1Ap 4PGTA 2I3YA 3TJJA 4TR3A 3GV1A 3RDWA 4HJMA 5EL8A 1A23A 1ERTA 4F03A 1TK5B 2F3MA 1CQHA 4L5LA 1U3IA 3US3A 3DRNA 4P3YB 3Q19A 3P2AA 4POKA 2DJJA 1GULA 7GSSA 4TR1B 4ZBBA 4MZCA 1SKRB 1OKDA 1AQXA 3UL3A 4IQ1A 1V40A 5A4UA 4MF7A 2CT6A 1F3BA 5CO3A 3VLNA 2LJKA 3UMAA 1BG5A 1EV9A 4KCAA 3WT2A 2L59A 1TTZA 4ZB9A 2HE3A 2WCIA 1PL2A 1ST9A 2CZ3A 3ISOA 3GMFA 5G1LA 2VCXA 4J56E 1GTAA 5FWGA 1J08A 2VD1A 4WKWA 5G31A 2R3XA 5KN2A 2B7KA 2H71A 5F07A 2WGRA 4KDXA 2CVKA 1U87A 4FO5A 2DIYA 2H6YA 3HA9A 1RW1A 1K0OA 4NXIA 1IYIA 4AJ8A 1UVZA 1JZRA 2CZ2A 1OC3A 5HR2A 4ACSA 4KCEA 4EF0A 4HU9A 3KTLA 4XS6A 2V6KA 1Z3EA 1EGOA 4MCUA 2VLVA 4ZXGA 1G6WA 4HUAA 2I1UA 3AY8A 1T3BA 2LSTA 2YWIA 5CP1A 2EC4A 2H70A 3LWAA 4EXJA 2E7PA 6GSYA 5JCWA 4EC0A 3HZ4A 1G0TA 1JZWA 4TOPA 1K3OA 1EEMA 3GA4A 5EVOA 2P5QA 1SL0B 2B6MA 1BAYA 4WR4A 5A4VA 2GSTA 1E2YA 4OFTA 2JZRA 3GTUB 3GRXA 1XBSA 2XHFA 3RPPA 1T4YA 4KUNA 1YKCA 5DQSA 4MF5A 4EVMA 4I2UA 2C80A 3ERGA 4YH2A 1SKSB 1GSFA 5IPHA 5FHIA 3DXBA 3H1NA 1R26A 3P8WA 2B7JA 4GTUA 1AW9A 3L9VA 2QSIA 3HXSA 4I6XA 1TI3A 4ZBDA 2O87A 4X0XA 4MF6A 5DJLA 4I2TA 5ECRB 3M9JA 2LRNA 3ZZXA 4CW9A 2NVLA 2C0GA 1GNWA 1SK1A 4AF2A 4MZBA 3E3EA 1S3CA 3EE2A 2H72A 1B4PA 5AGYA 1OE7A 4K1FA 5KN1A 5KN0A 1B9XC 3A3TA 3RPNA 2YV7A 4F82A 2L6CA 5H5QA 1GSUA 2AB6A 2H1GA 1T00A 3A5WA 3ZVJA 3HJMA 1ZYEA 2YZHA 3PGTA 2CX3A 5J41A 5ECHB 3TJKA 1K3YA 3IC4A 3BBYA 4GSTA 1QGVA 2YPMA 3HJPA 11GSA 2V32A 4IP1A 4WBJA 2HSHA 3W8SA 1WRYA 1H4OA 2H1BA 1O8XA 4K0GA 1TW9A 4MJAA 4O32A 2X99A 5GSSA 2M46A 3IAS2 4V2NA 2DMLA 3TOTA 4I8BA 1N2AA 1TK0B 2YWNA 4YQVA 4PX1A 2RUEA 2IPAA 4DVCA 3PINA 2LQOA 1KEBA 1V9WA 3NIVA 2O7KA 1MEKA 3LXZA 2YJHA 1LJRA 1SKWB 1J0FA 4E8EA 4K7OA 4KAEA 1MD3A 2HNLA 1GSEA 4V1Ag 5GZZB 2G0FA 1A8YA 3ZIJA 3M9KA 1B4QA 2C3TA 2KP1A 2QKEA 2DJ0A 4WF5A 5HR1A 17GSA 3H79A 3RAZA 3QAVA 1FAAA 5IOXA 3DVXA 3HZ8A 2FNOA 3EVIA 3NZNA 4J57E 2QGVA 3K8NA 3UBLA 1ZOFA 22GSA 3D6IA 3HDCA 4RQXA 3HD5A 3G7JA 3VWWA 2YANA 4KX4A 2KUCA 1EGRA 3ZFBA 3A2VA 3CXGA 4F0BA 5DVBA 4D73B 1TI1A 3CTGA 5LNKe 2IFQB 1PL1A 1FO5A 1ERVA 3CBUA 5AN1A 1OE8A 1M9AA 2EIQA 3F3QA 3GH6A 3UJ1A 2HI7A 5ECSA 4L8EA 5C04A 2K18A 2AUVA 2B5EA 13GSA 2AJQB 1MDKA 6GSVA 1MD4A 3DD3A 4EL1A 1V2AA 2H6XA 2D2ZA 4K9ZA 4MPFA 5F8BA 1TRSA 1V98A 1MDIA 1B9YC 2AHEA 4IELA 4LLRA 5HFKA 4TW5A 1O8WA 2HT9A 1ZL9A 2DC5A 5D73A 1URMA 1UN2A 2CV4A 5COHA 2H8LA 2FWGA 2R5GA 5B6NA 3R2QA 3EMXA 3QPMA 5DCGA 3QR6A 3ZITA 2BMXA 4OMVA 5G5EA 3GSSA 6GSTA 1K0NA 3FEUA 3IAM2 5B6MA 5CAXA 2C0DA 1OC9A 3UBKA 4JBBA 1NW2A 2KOKA 5IMDA 3EINA 5IMVA 4BA7A 1O73A 4GSNA 2LEGA 2C3NA 4GXZA 2OE1A 1I5GA 1HD2A 4Q5RA 4XRDA 3CSJA 1VF4A 1TU7A 3KH9A 1EWXA 3FZ9A 3DYRA 4ML6A 1YF1A 5DCHA 4NV5A 1JFUA 3APSA 1YY7A 4J2FA 4IGJA 4ISDA 3ZMLA 1ZCPA 1NHYA 1PRXA 1XWGA 1M2AA 1SYRA 3N9JA 1H75A 5B8BA 3LFLA 1TK8B 5GAND 4TKYA 3GYKA 3CRTA 1YEXA 2VCVA 2H01A 2DLXA 2GZPA 1XWCA 2H30A 1X5EA 3EU3A 1TXXA 2I81A 2LJRA 2RLIA 4PUAA 1G7EA 2Z9SA 2K8VA 2R6KA 5FT3A 1QK8A 3F63A 1XVWA 2I9HA 3APOA 3LG6A 4HOJA 2DSAA 4MLYA 4RUVA 4IJIA 1A2JA 2GT5A 3C73A 4OO4A 1TP9A 5CRDA 2H0HA 5IOWA 1XW6A 3KD0A 2XBIA 4TR0A 3DKSA 2GQKA 5IQYA
chains in the Genus database with same CATH superfamily
2DJKA 2OBIA 2P31A 3KP9A 3LORA 1PN0A 2P5RA 3M0FA 2OADA 4AJ7A 2MMAA 4ZIJA 5D96A 5ELAA 3VI5A 1GSYA 5LCZA 5JWQB 4XS4A 5DAKA 4XCSA 4MDCA 1O7UA 2H0GA 4F9ZA 4ULXA 1Z5YE 2CA8A 4LMVA 3D4TA 1FVKA 1O85A 1Q4JA 2YCDA 2GZYA 2FHEA 3CMIA 3KEBA 3M8NA 5JCUA 3GKKA 1JLWA 2GSSA 2C8UA 3L9SA 2YOIA 4BL7B 4X43A 5B7CA 5D93A 2KP2A 1WWJA 3IBHA 2A4VA 4NWYA 3WYWA 2WULA 4JR4A 3DEXA 1UA5A 1FOVA 4ECCA 5ECQB 4EO3A 4O5RA 5ID2B 4JZQA 4EKZA 3G9BA 2C1YA 5JCGA 2LNTA 3DIEA 1M2BA 4OFMA 3TKSE 3UAPA 4L0WA 1XIYA 4K8MA 1ZMAA 2YN1A 2GTUA 4G19A 3UVHA 1Z7PA 4A5PA 1GP1A 4PQ1A 1YDKA 1XOBA 2NBSA 2IMFA 2OJLA 3FZ5A 1SJ6A 1TRVA 2OE3A 4YAVA 5DBQA 4TXOA 1PMTA 4V2MA 3IA1A 1PX6A 1PN9A 4BVYA 1WJKA 4OCEA 3N5OA 3HKRA 3MNGA 1TU8A 3P90A 2BJXA 2PVQA 1VRSD 2E2GA 1HNCA 4CDOA 1WMJA 3LSZA 2YJ7A 5H5RA 1DSBA 1GUHA 3TKRA 1EP7A 3P7XA 2A2PA 3TOUA 2WZ9A 2PBJA 1WOUA 4G0LA 4BWQA 4GLTA 4POBA 4Z7XA 5DALB 2V1MA 4KA0A 1S3AA 3BOAA 1AUCA 1I9DA 1YQ1A 1PX7A 4TN8A 2WS2A 2OKAA 1AQWA 1M2DA 3CRUA 2XBQA 5IPGA 4POMA 3GSTA 2MMNA 2L5LA 1BJXA 2HRKA 5DQYA 4ZB8A 1K3LA 1HNBA 1YKAA 3IOSA 2JU5A 2JADA 2L57A 2GQMA 4WF4A 4NMUA 2HZFA 1XW5A 2ON7A 3DWVA 1KNGA 4WXTA 1ZZYA 3C7MA 1THOA 1BYEA 2AV4A 2LQQA 1QMVA 3NOFA 1Y25A 3H8QA 4MJBA 5GAPD 4PTSA 3D22A 2JL4A 2GSQA 4LMWA 2LNSA 3DVWA 1B48A 2A2RA 6GSWA 3IDVA 1TRUA 1O81A 2JSYA 2H19A 1A2MA 3F3RA 1T1VA 3IHGA 3KH7A 4DSQA 4FYUA 3HVNA 4GQFA 1XWBA 2FA4A 4EDZA 2HZEA 4KGIA 4KH7A 3ME7A 3QFBC 3WT1A 3QFAC 5CYYA 1BEDA 4H86A 5BRTA 2F8FA 3HJOA 4PQHA 1K0AA 2A4HA 1FB0A 4I97A 4MNNA 4ML1A 1R7HA 3SBCA 4HEA2 5ECLB 2MBTA 5G30A 2X8GA 1RK4A 1Y6EA 4TR4A 3GX8A 1A0FA 4PNGA 5IIZA 4F2IA 2LRTA 3U5RE 2VCWA 4USSA 1Q98A 2R2JA 4EDYA 4MA9A 3GURA 1TOFA 4DSSA 4V2LA 1GTIA 3ZLPA 4POLA 4WEYA 2VCZA 3O76A 4HSCX 2ZUPA 1K0MA 4I5QA 4L0UA 2X64A 3FKFA 2L4QA 2MMOA 4IW9A 4ZILA 4AJ6A 1EZKA 1RQMA 1Z7RA 2VLTA 3WGDA 4MK3A 3EU4A 3HY2A 4KSOA 4MJEA 3FZ4A 3GL3A 3Q18A 2IJYA 3ZMKA 4N0VA 3EC3A 3DMLA 5H5SA 3EMPA 1X9WB 3HVSA 2IN3A 2LUSA 2X8HA 2H0IA 3GL5A 2YP6A 4IN0A 1TJDA 2E0QA 1FB6A 1XWAA 5J4UA 4KDUA 1J9BA 3C8EA 1X0RA 4Z2UA 2WFCA 4MABA 4PXOA 3DGQA 3FR3A 5IO2A 3O6TA 2HFDA 1FG4A 3ZRDA 1GRXA 4GRFA 2YWOA 1QXHA 3TJGA 1KBNA 3APQA 4GSSA 4G10A 2ES7A 5E59A 1X9SB 3UIWA 3LGCA 3EWLA 1GWCA 2M72A 3KM6A 1PKZA 2VCTA 1GTUA 4IJ3A 1G6YA 3PH9A 6GSSA 2LS5A 3GHAA 3HVXA 4HJ2A 2VLUA 4NPBA 1QQ2A 1HQOA 1SYXA 5J3RA 5CRGA 3TKSA 3QOUA 4BWSA 1Z9HA 3VWVA 3MAKA 3KZQA 5HQPA 5ENUA 4HZ4A 1ACVA 3ZL5A 1GSDA 1EOHA 1U3AA 5GSTA 5E4WA 3GIXA 2CVBA 1X5DA 3ZVJD 2VUPA 3TRXA 3GKNA 5AISA 4LL1B 2PPTA 3TRQA 1R5AA 1SK2A 1GL8A 1ZGNA 3KJYA 3C1RA 1JLVA 3D4MA 2FWFA 1U88A 3J7Yb 2E2MA 1SD8A 4HDEA 1OC8A 2N5BA 2CAIA 4TR1A 1XCCA 3LYKA 4NV2A 3RHCA 4G0IA 4NAXA 3HVVA 4AGSA 2FY6A 2DJ1A 2JZTA 1XW9A 1SJIA 1PA3A 3TKQA 1T7PB 2YWMA 2J23A 2KLXA 3F6FA 4YQMA 2IMEA 4XRAA 2X49A 5CREA 3L4NA 4K7NA 4ZBAA 1F37A 1M0UA 5HFGA 4PUFC 3BCKA 5ELGA 3TJFA 4IKHA 1BX9A 2HXKA 4HI7A 5B8AA 1F2EA 5D9TA 1SENA 5L71A 2C0FA 3UEMA 1BQ7A 1JZDA 1XWKA 4KB3A 2JSZA 4ECJA 4ZL9A 8GSSA 2VL3A 3LYPA 3F6DA 5DDLA 4FIWA 6GSUA 1X9MB 3CTFA 3TJBA 2V41A 3CSIA 1GLQA 3IC8A 4FYCA 3QDNA 4G2EA 2HSMA 3HCZA 2VM1A 4MP4A 2G2QA 5D9WA 2LV3A 1LU4A 3C71A 4N30A 2NPBA 4N10A 2MZCA 3WGEA 1IYHA 2B1LA 4X1UA 1USBA 2C4JA 2R4VA 3GFKA 4Z2TA 2JZSA 1M99A 2ZNMA 3D5JA 5ECOB 2UZ8A 5HFIA 5IMFA 3LEFA 1OAZA 3UARA 2V2GA 3GTUA 1PQNA 2M80A 1EEJA 2NDOA 4FQUA 3TKSC 5J5NA 3TCOA 3IXRA 4BVXA 2YNXA 1ZYPA 3ED3A 3ZTLA 4HQSA 3I9V2 1R5PA 3LXTA 3G7IA 2IWTA 3MDKA 2YZUA 5ABRA 2L6DA 5KEJA 2FWEA 2VAFA 4QL7A 3D21A 1OC9B 3MYDA 2PERA 3EYTA 4BPYA 3CSHA 5J9BA 3WGXA 3TRPA 2XC2A 3CYNA 3IRAA 3KMOA 3L9UA 1S3DA 4IBPA 3U6VA 2VM2A 2TRXA 3ZIVA 2CAQA 2H6ZA 2HLSA 4K5RA 4OD7A 5IMAA 3GN3A 4KF9A 3BJ5A 4MMMA 1X5CA 2OA7A 4K6XA 3LW9A 2FWHA 2RM5A 1MTCA 2H1DA 5AIXA 1XVQA 1JZOA 4MH3A 4O5UA 4OO5A 4TRXA 3IR4A 3KCMA 2YV9A 1K0CA 2VL2C 2PMTA 3A5IA 2OBKA 4CHSA 4YAPA 2HYXA 2OACA 3GKMA 1LBKA 4FYBA 1JHBA 4EE0A 4OFNA 5D9XA 4LL4B 2GZZA 2R0CA 2QC7A 1EV4A 1WE0A 2B1KA 1K0DA 3FY7A 4N11A 12GSA 4XTSA 2K6VA 1A2LA 1XZOA 4O7HA 5HR3A 2VOCA 3M1GA 3ZFLA 4JEDA 4DEJA 5INYA 1A0RP 2WJUA 4MZWA 4XIHA 2MMZA 4HQZA 1SD9A 1U6TA 4EIPA 3S9FA 3F4SA 4Q5QA 1EP8A 1GSQA 1K0BA 2EIRA 16GSA 2AAWA 1ERUA 3A2XA 2CQ9A 14GSA 5EPFA 1E6BA 3KMNA 4YQUA 1DE1A 4NHZA 4XS4B 4LA1A 5DAKB 1W89A 2H74A 4O92A 3TGZA 4ECIA 1NHOA 2GSRA 5ECMB 3IE3A 4Q5NA 1F3AA 4OWYA 2DKHA 4QQ7A 3C1SA 2A2SA 1VF1A 1ILOA 2FCHA 3BCIA 1M7TA 2BTOT 2AYTA 3O3TA 1OKTA 3PR8A 1GLPA 2XPDA 1CQGA 3QAGA 1AC1A 1XOAA 2LKUA 4KSMA 1YF0A 2F9SA 5C00A 3QMXA 10GSA 1YJ6A 3F9UA 3JCML 4EUYA 4IS0A 4HS1A 1GUMA 1M9BA 3OR5A 3KTBA 3I6AA 2FA8A 3IHQA 4K0NA 2F8AA 3Q74A 1AQVA 2B5XA 3V1WA 1GNEA 4TXVA 3E9JB 2PN8A 3HHVA 2FGXA 2NTOA 4RI6A 2HSYA 4KE3A 4D73A 2IFQA 2V6OA 3ERWA 3LJRA 4GQCA 2GLRA 2IMKA 5LD0A 5IMZA 3H4KA 5ECPB 5CNWA 4ILFA 4OCFA 3UOMA 2PU9C 3MIXA 4JE1A 2IIYA 1VF3A 1NSWA 2WRTA 3QCPA 4JU5A 1A8LA 2GT6A 2TIRA 5KOWA 1OYJA 3RHBA 2KHPA 3UVTA 3W6GA 5JWOB 3VPTA 4TXOB 1A24A 2EIOA 4BVYB 1AAZA 4KNDA 3A2WA 5KOXA 2RUFA 4IVFA 3FRCA 5ECIB 2ON5A 1ON4A 5F0GA 1UC7A 2PUKC 1SL1B 3IPZA 3I69A 5IO0A 4GWRA 2MYGA 3GNJA 5ECKB 1GH2A 5AIVA 1HYUA 2RIIA 3F4RA 2DMMA 4PQIA 5BMUA 1SK0A 2N5AA 4FH8A 2FLSA 4ZL7A 3F0IA 1AIUA 5ECNB 4L5OA 2O8VB 2WB9A 5D8IA 1O6JA 5G5FA 5A5KA 5JWRB 1SL2B 4KDYA 3G7YA 2LTKA 3W8JA 1N8JA 2VCQA 3FHKA 1GSSA 3VWUA 5F06A 4HZ2A 3TKPA 2DIZA 3VI7A 5HR0A 1PKWA 2LRCA 3FR9A 2REMA 2LJAA 1WP0A 5G2ZA 1KTEA 2VD0A 4K7IA 4E8HA 3J7Yk 3FK8A 18GSA 3F8UA 1TKDB 5J9CA 4N0ZA 2R37A 2OE0A 2PVOC 5CRHA 1F9MA 3GKXA 1QUWA 2QA1A 3WD6A 4MH2A 1THXA 1PFOA 1PD21 1QFNA 2I4AA 5KN3A 1FW1A 5EY6A 1SU9A 3VWXA 1G7OA 3MSZA 3TDGA 1GUKA 2B5YA 1EOGA 3D0ZA 3SWLA 3FYGA 1S3RA 4CY8A 2N5FA 2GVPA 3ME8A 1MDJA 5G1KA 1ERWA 3LQ7A 4XHMA 1GTBA 4WR5A 2WDUA 3RBTA 3IK7A 2H75A 4DSRA 4WETA 4WBRD 2QA2A 3F4TA 2DBCA 9GSSA 1WIKA 1T4ZA 1Z6MA 3TUEA 4YKGA 1AXDA 2HZEB 4RQRA 3ZYWA 2VIMA 3L78A 4JR6A 2MBSA 2XPEA 4RI7A 4F0CA 4ZB6A 2K9FA 4IP6A 2TRCP 2B3SA 3GUSA 2ALBA 2GGTA 3EPTA 1ZYQB 1SJZA 3L0HA 1PGTA 2IL3A 1YZXA 1YEPA 3KIJA 1HNAA 1XPVA 3MWHA 3TB2A 3BD2A 4Q5FA 1TDIA 2L5OA 3VK9A 2PWJA 4BL7A 2VL2A 6GSXA 4ECBA 2C0EA 5CRWA 4DSSB 1FHEA 2F51A 2ZCTA 4ZL8A 2L4CA 4IQAA 2DJ2A 2H73A 1C72A 3VURA 1B8XA 1T8EB 4IHUA 5F05A 4NHWA 1W4VA 5ID2A 2VL9A 2X8CA 1DUGA 2H1AA 4G9HA 4K2DA 2FUG2 5IM9A 1XXUA 2HRAA 3KXOA 1V57A 4QL9A 2HRFA 2P0GA 1Z6NA 2RM6A 4MJCA 3Q6OA 2JACA 4BIKA 2CVDA 1PSQA 2R0GA 2PGTA 1VGLA 3QD9A 1OVNA 3GX0A 1M3JA 2HRNA 1VF2A 1DBYA 2H66A 2J9HA 2C3QA 3VFIA 2IMIA 3HYPA 3M3MA 3VPQA 3H93A 2GQLA 1V58A 2O85A 3FW2A 3QAWA 5IMCA 5DJMA 3IV4A 1WPIA 4GF0A 3KP8A 2VO4A 2DJ3A 1XFLA 1F6MC 3E0UA 4PNFA 3I43A 4ID0A 4KW6A 2CX4A 1NM3A 2K8SA 3ERFA 3ZREA 4MPGA 3GH9A 1ML6A 2IMDA 3EURA 2GDRA 2O89A 3FR6A 5DALA 1ABAA 4GCIA 2GS3A 2FD3A 1TRWA 1FVJA 3KGKA 3FZAA 20GSA 5D9VA 4XS1A 4PURA 2H76A 19GSA 1R4WA 4JRRA 4HU7A 5A4WA 1DE2A 3IK9A 4TVEA 4V1Ap 4PGTA 2I3YA 3TJJA 4TR3A 3GV1A 3RDWA 4HJMA 5EL8A 1A23A 1ERTA 4F03A 1TK5B 2F3MA 1CQHA 4L5LA 1U3IA 3US3A 3DRNA 4P3YB 3Q19A 3P2AA 4POKA 2DJJA 1GULA 7GSSA 4TR1B 4ZBBA 4MZCA 1SKRB 1OKDA 1AQXA 3UL3A 4IQ1A 1M3IA 1V40A 5A4UA 4MF7A 2CT6A 1F3BA 5CO3A 3VLNA 2LJKA 3UMAA 1BG5A 1EV9A 4KCAA 3WT2A 2L59A 1TTZA 4ZB9A 2HE3A 2WCIA 1PL2A 1ST9A 2CZ3A 4YKFA 3ISOA 4Z2RA 2X4AA 3GMFA 5G1LA 2VCXA 4J56E 1GTAA 5FWGA 1J08A 2VD1A 4WKWA 5G31A 2R3XA 4X4JA 5KN2A 2B7KA 2H71A 5F07A 2WGRA 4KDXA 2CVKA 1U87A 4FO5A 2DIYA 2H6YA 3HA9A 1RW1A 1K0OA 4NXIA 1IYIA 4AJ8A 1UVZA 1JZRA 2CZ2A 1OC3A 5HR2A 4ACSA 4KCEA 4EF0A 4HU9A 3KTLA 4XS6A 2V6KA 1Z3EA 1EGOA 4MCUA 2VLVA 3FMWA 4ZXGA 1G6WA 4HUAA 2I1UA 3AY8A 1T3BA 2LSTA 2YWIA 5CP1A 2EC4A 2H70A 3LWAA 4EXJA 2E7PA 6GSYA 5JCWA 4EC0A 3HZ4A 1G0TA 1JZWA 4TOPA 1K3OA 1EEMA 3GA4A 5EVOA 2P5QA 1SL0B 2B6MA 1BAYA 4WR4A 5A4VA 2GSTA 1E2YA 4OFTA 2JZRA 3GTUB 3GRXA 1XBSA 2XHFA 3RPPA 1T4YA 4KUNA 4BVXB 1YKCA 5DQSA 4MF5A 4EVMA 4I2UA 2C80A 3ERGA 4YH2A 1SKSB 1GSFA 5IPHA 5FHIA 3DXBA 3H1NA 1R26A 3P8WA 2B7JA 4GTUA 1AW9A 3L9VA 2QSIA 3HXSA 4I6XA 1TI3A 4ZBDA 2O87A 4X0XA 4MF6A 5DJLA 4I2TA 5ECRB 3M9JA 2LRNA 3ZZXA 3CQFA 4CW9A 2NVLA 2C0GA 1GNWA 1SK1A 4AF2A 4MZBA 3E3EA 1S3CA 3EE2A 2H72A 1B4PA 5AGYA 4O5QA 1OE7A 4K1FA 5KN1A 5KN0A 1B9XC 3A3TA 3RPNA 2YV7A 4F82A 2L6CA 5H5QA 1GSUA 2AB6A 2H1GA 1T00A 3A5WA 3ZVJA 3HJMA 1ZYEA 2YZHA 3PGTA 2CX3A 5J41A 5ECHB 3TJKA 1K3YA 3IC4A 3BBYA 4GSTA 3PPUA 1QGVA 2YPMA 3HJPA 11GSA 2V32A 4IP1A 4WBJA 2HSHA 3W8SA 1WRYA 1H4OA 2H1BA 1O8XA 4K0GA 1TW9A 4MJAA 4O32A 2X99A 5GSSA 2M46A 3IAS2 4G0KA 4V2NA 2DMLA 4EIQA 3TOTA 4I8BA 1N2AA 1TK0B 2YWNA 4YQVA 4PX1A 2RUEA 2IPAA 4DVCA 4ICYA 3PINA 2LQOA 1KEBA 1V9WA 3NIVA 2O7KA 1MEKA 3LXZA 2YJHA 1LJRA 1SKWB 1J0FA 4E8EA 4K7OA 4KAEA 1MD3A 2HNLA 1GSEA 4V1Ag 5GZZB 2G0FA 1A8YA 3ZIJA 3M9KA 1B4QA 2C3TA 2KP1A 2QKEA 2DJ0A 4WF5A 5HR1A 17GSA 3H79A 3RAZA 3QAVA 1FAAA 5IOXA 3DVXA 3HZ8A 2FNOA 3EVIA 3NZNA 4J57E 2QGVA 3K8NA 3UBLA 1ZOFA 22GSA 3D6IA 3HDCA 4RQXA 3HD5A 3G7JA 3VWWA 2YANA 4KX4A 2KUCA 1EGRA 3ZFBA 3A2VA 3CXGA 4F0BA 3R3EA 5DVBA 4D73B 1TI1A 3CTGA 5LNKe 2IFQB 1PL1A 1FO5A 1ERVA 3CBUA 5AN1A 1OE8A 1M9AA 2EIQA 3F3QA 3GH6A 3UJ1A 2HI7A 5ECSA 4L8EA 5C04A 2K18A 2AUVA 2B5EA 13GSA 2AJQB 1MDKA 6GSVA 1MD4A 3DD3A 4EL1A 1V2AA 2H6XA 2D2ZA 4K9ZA 4MPFA 5F8BA 1TRSA 1ZYNA 4K5SA 1V98A 1MDIA 1B9YC 1XG8A 2AHEA 4IELA 4LLRA 5HFKA 4TW5A 1O8WA 2HT9A 1ZL9A 2DC5A 5D73A 1URMA 1UN2A 2CV4A 5COHA 2H8LA 2FWGA 2R5GA 5B6NA 3R2QA 3EMXA 3QPMA 5DCGA 3QR6A 3ZITA 2BMXA 4OMVA 5G5EA 3GSSA 6GSTA 1K0NA 3FEUA 3IAM2 5B6MA 5CAXA 2C0DA 1OC9A 3UBKA 4JBBA 1NW2A 2KOKA 5IMDA 3EINA 5IMVA 4BA7A 1O73A 4GSNA 2LEGA 2C3NA 4GXZA 2OE1A 1I5GA 1HD2A 4Q5RA 4XRDA 3CSJA 1VF4A 1TU7A 3KH9A 1EWXA 3FZ9A 3DYRA 4ML6A 1YF1A 5DCHA 4NV5A 1JFUA 3APSA 1YY7A 4J2FA 4IGJA 4ISDA 3ZMLA 1ZCPA 1NHYA 1PRXA 1XWGA 1M2AA 1SYRA 3N9JA 1H75A 5B8BA 3LFLA 1TK8B 5GAND 4CY6A 4TKYA 3GYKA 3CRTA 1YEXA 2VCVA 2R0PA 1FOHA 2H01A 2DLXA 2GZPA 1XWCA 2H30A 4K2XA 1X5EA 3EU3A 1TXXA 2I81A 2LJRA 2RLIA 4PUAA 1G7EA 2DKIA 2Z9SA 2K8VA 2R6KA 5FT3A 1QK8A 3F63A 1XVWA 2I9HA 3APOA 3LG6A 4HOJA 2DSAA 4MLYA 4RUVA 4IJIA 1A2JA 2GT5A 3C73A 4OO4A 1TP9A 5CRDA 2H0HA 5IOWA 1XW6A 3KD0A 2XBIA 4TR0A 3DKSA 2GQKA 5IQYA
chains in the Genus database with same CATH topology
2DJKA 2OBIA 2P31A 3KP9A 3LORA 1PN0A 2P5RA 3M0FA 2OADA 4AJ7A 2MMAA 4ZIJA 5D96A 5ELAA 3VI5A 1GSYA 5LCZA 5JWQB 4XS4A 5DAKA 4XCSA 4MDCA 1O7UA 2H0GA 4F9ZA 4ULXA 1Z5YE 2CA8A 4LMVA 3D4TA 1FVKA 1O85A 1Q4JA 2YCDA 2GZYA 2FHEA 3CMIA 3KEBA 3M8NA 5JCUA 3GKKA 1JLWA 2GSSA 2C8UA 3L9SA 2YOIA 4BL7B 4X43A 5B7CA 5D93A 2KP2A 1WWJA 3IBHA 2A4VA 4NWYA 3WYWA 2WULA 4JR4A 3DEXA 1UA5A 1FOVA 4ECCA 5ECQB 4EO3A 4O5RA 5ID2B 4JZQA 4EKZA 3G9BA 2C1YA 5JCGA 2LNTA 3DIEA 1M2BA 4OFMA 3TKSE 3UAPA 4L0WA 1XIYA 4K8MA 1ZMAA 2YN1A 2GTUA 4G19A 3UVHA 1Z7PA 4A5PA 1GP1A 4PQ1A 1YDKA 1XOBA 2NBSA 2IMFA 2OJLA 3FZ5A 1SJ6A 1TRVA 2OE3A 4YAVA 5DBQA 4TXOA 1PMTA 4V2MA 3IA1A 1PX6A 1PN9A 4BVYA 1WJKA 4OCEA 3N5OA 3HKRA 3MNGA 1TU8A 3P90A 2BJXA 2PVQA 1VRSD 2E2GA 1HNCA 4CDOA 1WMJA 3LSZA 2YJ7A 5H5RA 1DSBA 1GUHA 3TKRA 1EP7A 3P7XA 2A2PA 3TOUA 2WZ9A 2PBJA 1WOUA 4G0LA 4BWQA 4GLTA 4POBA 4Z7XA 5DALB 2V1MA 4KA0A 1S3AA 3BOAA 1AUCA 1I9DA 1YQ1A 1PX7A 4TN8A 2WS2A 2OKAA 1AQWA 1M2DA 3CRUA 2XBQA 5IPGA 4POMA 3GSTA 2MMNA 2L5LA 1BJXA 2HRKA 5DQYA 4ZB8A 1K3LA 1HNBA 1YKAA 3IOSA 2JU5A 2JADA 2L57A 2GQMA 4WF4A 4NMUA 2HZFA 1XW5A 2ON7A 3DWVA 1KNGA 4WXTA 1ZZYA 3C7MA 1THOA 1BYEA 2AV4A 2LQQA 1QMVA 3NOFA 1Y25A 3H8QA 4MJBA 5GAPD 4PTSA 3D22A 2JL4A 2GSQA 4LMWA 2LNSA 3DVWA 1B48A 2A2RA 6GSWA 3IDVA 1TRUA 1O81A 2JSYA 2H19A 1A2MA 3F3RA 1T1VA 3IHGA 3KH7A 4DSQA 4FYUA 4GQFA 1XWBA 2FA4A 4EDZA 2HZEA 4KGIA 4KH7A 3ME7A 3QFBC 3WT1A 3QFAC 5CYYA 1BEDA 4H86A 5BRTA 2F8FA 3HJOA 4PQHA 1K0AA 2A4HA 1FB0A 4I97A 4MNNA 4ML1A 1R7HA 3SBCA 4HEA2 5ECLB 2MBTA 5G30A 2X8GA 1RK4A 1Y6EA 4TR4A 3GX8A 1A0FA 4PNGA 5IIZA 4F2IA 2LRTA 3U5RE 2VCWA 4USSA 1Q98A 2R2JA 4EDYA 4MA9A 3GURA 1TOFA 4DSSA 4V2LA 1GTIA 3ZLPA 4POLA 4WEYA 2VCZA 3O76A 2ZUPA 1K0MA 4I5QA 4L0UA 2X64A 3FKFA 2L4QA 2MMOA 4IW9A 4ZILA 4AJ6A 1EZKA 1RQMA 1Z7RA 2VLTA 3WGDA 4MK3A 3EU4A 3HY2A 4KSOA 4MJEA 3FZ4A 3GL3A 3Q18A 2IJYA 3ZMKA 4N0VA 3EC3A 3DMLA 5H5SA 3EMPA 1X9WB 3HVSA 2IN3A 2LUSA 2X8HA 2H0IA 3GL5A 2YP6A 4IN0A 1TJDA 2E0QA 1FB6A 1XWAA 5J4UA 4KDUA 1J9BA 3C8EA 1X0RA 4Z2UA 2WFCA 4MABA 4PXOA 3DGQA 3FR3A 5IO2A 3O6TA 2HFDA 1FG4A 3ZRDA 1GRXA 4GRFA 2YWOA 1QXHA 3TJGA 1KBNA 3APQA 4GSSA 4G10A 2ES7A 5E59A 1X9SB 3UIWA 3LGCA 3EWLA 1GWCA 2M72A 3KM6A 1PKZA 2VCTA 1GTUA 4IJ3A 1G6YA 3PH9A 6GSSA 2LS5A 3GHAA 3HVXA 4HJ2A 2VLUA 4NPBA 1QQ2A 1HQOA 1SYXA 5J3RA 5CRGA 3TKSA 3QOUA 4BWSA 1Z9HA 3VWVA 3MAKA 3KZQA 5HQPA 5ENUA 4HZ4A 1ACVA 3ZL5A 1GSDA 1EOHA 1U3AA 5GSTA 5E4WA 3GIXA 2CVBA 1X5DA 3ZVJD 2VUPA 3TRXA 3GKNA 5AISA 4LL1B 2PPTA 3TRQA 1R5AA 1SK2A 1GL8A 1ZGNA 3KJYA 3C1RA 1JLVA 3D4MA 2FWFA 1U88A 3J7Yb 2E2MA 1SD8A 4HDEA 1OC8A 2N5BA 2CAIA 4TR1A 1XCCA 3LYKA 4NV2A 3RHCA 4G0IA 4NAXA 3HVVA 4AGSA 2FY6A 2DJ1A 2JZTA 1XW9A 1SJIA 1PA3A 3TKQA 1T7PB 2YWMA 2J23A 2KLXA 3F6FA 4YQMA 2IMEA 4XRAA 2X49A 5CREA 3L4NA 4K7NA 4ZBAA 1F37A 1M0UA 5HFGA 4PUFC 3BCKA 5ELGA 3TJFA 4IKHA 1BX9A 2HXKA 4HI7A 5B8AA 1F2EA 5D9TA 1SENA 5L71A 2C0FA 3UEMA 1BQ7A 1JZDA 1XWKA 4KB3A 2JSZA 4ECJA 4ZL9A 8GSSA 2VL3A 3LYPA 3F6DA 5DDLA 4FIWA 6GSUA 1X9MB 3CTFA 3TJBA 2V41A 3CSIA 1GLQA 3IC8A 4FYCA 3QDNA 4G2EA 2HSMA 3HCZA 2VM1A 4MP4A 2G2QA 5D9WA 2LV3A 1LU4A 3C71A 4N30A 2NPBA 4N10A 2MZCA 3WGEA 1IYHA 2B1LA 4X1UA 1USBA 2C4JA 2R4VA 3GFKA 4Z2TA 2JZSA 1M99A 2ZNMA 3D5JA 5ECOB 2UZ8A 5HFIA 5IMFA 3LEFA 1OAZA 3UARA 2V2GA 3GTUA 1PQNA 2M80A 1EEJA 2NDOA 4FQUA 3TKSC 5J5NA 3TCOA 3IXRA 4BVXA 2YNXA 1ZYPA 3ED3A 3ZTLA 4HQSA 3I9V2 1R5PA 3LXTA 3G7IA 2IWTA 3MDKA 2YZUA 5ABRA 2L6DA 5KEJA 2FWEA 2VAFA 4QL7A 3D21A 1OC9B 3MYDA 2PERA 3EYTA 4BPYA 3CSHA 5J9BA 3WGXA 3TRPA 2XC2A 3CYNA 3IRAA 3KMOA 3L9UA 1S3DA 4IBPA 3U6VA 2VM2A 2TRXA 3ZIVA 2CAQA 2H6ZA 2HLSA 4K5RA 4OD7A 5IMAA 3GN3A 4KF9A 3BJ5A 4MMMA 1X5CA 2OA7A 4K6XA 3LW9A 2FWHA 2RM5A 1MTCA 2H1DA 5AIXA 1XVQA 1JZOA 4MH3A 4O5UA 4OO5A 4TRXA 3IR4A 3KCMA 2YV9A 1K0CA 2VL2C 2PMTA 3A5IA 2OBKA 4CHSA 4YAPA 2HYXA 2OACA 3GKMA 1LBKA 4FYBA 1JHBA 4EE0A 4OFNA 5D9XA 4LL4B 2GZZA 2R0CA 2QC7A 1EV4A 1WE0A 2B1KA 1K0DA 3FY7A 4N11A 12GSA 4XTSA 2K6VA 1A2LA 1XZOA 4O7HA 5HR3A 2VOCA 3M1GA 3ZFLA 4JEDA 4DEJA 5INYA 1A0RP 2WJUA 4MZWA 4XIHA 2MMZA 4HQZA 1SD9A 1U6TA 4EIPA 3S9FA 3F4SA 4Q5QA 1EP8A 1GSQA 1K0BA 2EIRA 16GSA 2AAWA 1ERUA 3A2XA 2CQ9A 14GSA 5EPFA 1E6BA 3KMNA 4YQUA 1DE1A 4NHZA 4XS4B 4LA1A 5DAKB 1W89A 2H74A 4O92A 3TGZA 4ECIA 1NHOA 2GSRA 5ECMB 3IE3A 4Q5NA 1F3AA 4OWYA 2DKHA 4QQ7A 3C1SA 2A2SA 1VF1A 1ILOA 2FCHA 3BCIA 1M7TA 2BTOT 2AYTA 3O3TA 1OKTA 3PR8A 1GLPA 2XPDA 1CQGA 3QAGA 1AC1A 1XOAA 2LKUA 4KSMA 1YF0A 2F9SA 5C00A 3QMXA 10GSA 1YJ6A 3F9UA 3JCML 4EUYA 4IS0A 4HS1A 1GUMA 1M9BA 3OR5A 3KTBA 3I6AA 2FA8A 3IHQA 4K0NA 2F8AA 3Q74A 1AQVA 2B5XA 3V1WA 1GNEA 4TXVA 3E9JB 2PN8A 3HHVA 2FGXA 2NTOA 4RI6A 2HSYA 4KE3A 4D73A 2IFQA 2V6OA 3ERWA 3LJRA 4GQCA 2GLRA 2IMKA 5LD0A 5IMZA 3H4KA 5ECPB 5CNWA 4ILFA 4OCFA 3UOMA 2PU9C 3MIXA 4JE1A 2IIYA 1VF3A 1NSWA 2WRTA 3QCPA 4JU5A 1A8LA 2GT6A 2TIRA 5KOWA 1OYJA 3RHBA 2KHPA 3UVTA 3W6GA 5JWOB 3VPTA 4TXOB 1A24A 2EIOA 4BVYB 1AAZA 4KNDA 3A2WA 5KOXA 2RUFA 4IVFA 3FRCA 5ECIB 2ON5A 1ON4A 5F0GA 1UC7A 2PUKC 1SL1B 3IPZA 3I69A 5IO0A 4GWRA 2MYGA 3GNJA 5ECKB 1GH2A 5AIVA 1HYUA 2RIIA 3F4RA 2DMMA 4PQIA 5BMUA 1SK0A 2N5AA 4FH8A 2FLSA 4ZL7A 3F0IA 1AIUA 5ECNB 4L5OA 2O8VB 2WB9A 5D8IA 1O6JA 5G5FA 5A5KA 5JWRB 1SL2B 4KDYA 3G7YA 2LTKA 3W8JA 1N8JA 2VCQA 3FHKA 1GSSA 3VWUA 5F06A 4HZ2A 3TKPA 2DIZA 3VI7A 5HR0A 1PKWA 2LRCA 3FR9A 2REMA 2LJAA 1WP0A 5G2ZA 1KTEA 2VD0A 4K7IA 4E8HA 3J7Yk 3FK8A 18GSA 3F8UA 1TKDB 5J9CA 4N0ZA 2R37A 2OE0A 2PVOC 5CRHA 1F9MA 3GKXA 1QUWA 2QA1A 3WD6A 4MH2A 1THXA 1PD21 1QFNA 2I4AA 5KN3A 1FW1A 5EY6A 1SU9A 3VWXA 1G7OA 3MSZA 3TDGA 1GUKA 2B5YA 1EOGA 3D0ZA 3SWLA 3FYGA 4CY8A 2N5FA 2GVPA 3ME8A 1MDJA 5G1KA 1ERWA 3LQ7A 4XHMA 1GTBA 4WR5A 2WDUA 3RBTA 3IK7A 2H75A 4DSRA 4WETA 4WBRD 2QA2A 3F4TA 2DBCA 9GSSA 1WIKA 1T4ZA 1Z6MA 3TUEA 4YKGA 1AXDA 2HZEB 4RQRA 3ZYWA 2VIMA 3L78A 4JR6A 2MBSA 2XPEA 4RI7A 4F0CA 4ZB6A 2K9FA 4IP6A 2TRCP 2B3SA 3GUSA 2ALBA 2GGTA 3EPTA 1ZYQB 1SJZA 3L0HA 1PGTA 2IL3A 1YZXA 1YEPA 3KIJA 1HNAA 1XPVA 3MWHA 3TB2A 3BD2A 4Q5FA 1TDIA 2L5OA 3VK9A 2PWJA 4BL7A 2VL2A 6GSXA 4ECBA 2C0EA 5CRWA 4DSSB 1FHEA 2F51A 2ZCTA 4ZL8A 2L4CA 4IQAA 2DJ2A 2H73A 1C72A 3VURA 1B8XA 1T8EB 4IHUA 5F05A 4NHWA 1W4VA 5ID2A 2VL9A 2X8CA 1DUGA 2H1AA 4G9HA 4K2DA 2FUG2 5IM9A 1XXUA 2HRAA 3KXOA 1V57A 4QL9A 2HRFA 2P0GA 1Z6NA 2RM6A 4MJCA 3Q6OA 2JACA 2CVDA 1PSQA 2R0GA 2PGTA 1VGLA 3QD9A 1OVNA 3GX0A 2HRNA 1VF2A 1DBYA 2H66A 2J9HA 2C3QA 3VFIA 2IMIA 3HYPA 3M3MA 3VPQA 3H93A 2GQLA 1V58A 2O85A 3FW2A 3QAWA 5IMCA 5DJMA 3IV4A 1WPIA 4GF0A 3KP8A 2VO4A 2DJ3A 1XFLA 1F6MC 3E0UA 4PNFA 3I43A 4ID0A 4KW6A 2CX4A 1NM3A 2K8SA 3ERFA 3ZREA 4MPGA 3GH9A 1ML6A 2IMDA 3EURA 2GDRA 2O89A 3FR6A 5DALA 1ABAA 4GCIA 2GS3A 2FD3A 1TRWA 1FVJA 3KGKA 3FZAA 20GSA 5D9VA 4XS1A 4PURA 2H76A 19GSA 1R4WA 4JRRA 4HU7A 5A4WA 1DE2A 3IK9A 4TVEA 4V1Ap 4PGTA 2I3YA 3TJJA 4TR3A 3GV1A 3RDWA 4HJMA 5EL8A 1A23A 1ERTA 4F03A 1TK5B 2F3MA 1CQHA 4L5LA 1U3IA 3US3A 3DRNA 4P3YB 3Q19A 3P2AA 4POKA 2DJJA 1GULA 7GSSA 4TR1B 4ZBBA 4MZCA 1SKRB 1OKDA 1AQXA 3UL3A 4IQ1A 1V40A 5A4UA 4MF7A 2CT6A 1F3BA 5CO3A 3VLNA 2LJKA 3UMAA 1BG5A 1EV9A 4KCAA 3WT2A 2L59A 1TTZA 4ZB9A 2HE3A 2WCIA 1PL2A 1ST9A 2CZ3A 4YKFA 3ISOA 4Z2RA 2X4AA 3GMFA 5G1LA 2VCXA 4J56E 1GTAA 5FWGA 1J08A 2VD1A 4WKWA 5G31A 2R3XA 4X4JA 5KN2A 2B7KA 2H71A 5F07A 2WGRA 4KDXA 2CVKA 1U87A 4FO5A 2DIYA 2H6YA 3HA9A 1RW1A 1K0OA 4NXIA 1IYIA 4AJ8A 1UVZA 1JZRA 2CZ2A 1OC3A 5HR2A 4ACSA 4KCEA 4EF0A 4HU9A 3KTLA 4XS6A 2V6KA 1Z3EA 1EGOA 4MCUA 2VLVA 3FMWA 4ZXGA 1G6WA 4HUAA 2I1UA 3AY8A 1T3BA 2LSTA 2YWIA 5CP1A 2EC4A 2H70A 3LWAA 4EXJA 2E7PA 6GSYA 5JCWA 4EC0A 3HZ4A 1G0TA 1JZWA 4TOPA 1K3OA 1EEMA 3GA4A 5EVOA 2P5QA 1SL0B 2B6MA 1BAYA 4WR4A 5A4VA 2GSTA 1E2YA 4OFTA 2JZRA 3GTUB 3GRXA 1XBSA 2XHFA 3RPPA 1T4YA 4KUNA 4BVXB 1YKCA 5DQSA 4MF5A 4EVMA 4I2UA 2C80A 3ERGA 4YH2A 1SKSB 1GSFA 5IPHA 5FHIA 3DXBA 3H1NA 1R26A 3P8WA 2B7JA 4GTUA 1AW9A 3L9VA 2QSIA 3HXSA 4I6XA 1TI3A 4ZBDA 2O87A 4X0XA 4MF6A 5DJLA 4I2TA 5ECRB 3M9JA 2LRNA 3ZZXA 4CW9A 2NVLA 2C0GA 1GNWA 1SK1A 4AF2A 4MZBA 3E3EA 1S3CA 3EE2A 2H72A 1B4PA 5AGYA 4O5QA 1OE7A 4K1FA 5KN1A 5KN0A 1B9XC 3A3TA 3RPNA 2YV7A 4F82A 2L6CA 5H5QA 1GSUA 2AB6A 2H1GA 1T00A 3A5WA 3ZVJA 3HJMA 1ZYEA 2YZHA 3PGTA 2CX3A 5J41A 5ECHB 3TJKA 1K3YA 3IC4A 3BBYA 4GSTA 3PPUA 1QGVA 2YPMA 3HJPA 11GSA 2V32A 4IP1A 4WBJA 2HSHA 3W8SA 1WRYA 1H4OA 2H1BA 1O8XA 4K0GA 1TW9A 4MJAA 4O32A 2X99A 5GSSA 2M46A 3IAS2 4G0KA 4V2NA 2DMLA 4EIQA 3TOTA 4I8BA 1N2AA 1TK0B 2YWNA 4YQVA 4PX1A 2RUEA 2IPAA 4DVCA 4ICYA 3PINA 2LQOA 1KEBA 1V9WA 3NIVA 2O7KA 1MEKA 3LXZA 2YJHA 1LJRA 1SKWB 1J0FA 4E8EA 4K7OA 4KAEA 1MD3A 2HNLA 1GSEA 4V1Ag 5GZZB 2G0FA 1A8YA 3ZIJA 3M9KA 1B4QA 2C3TA 2KP1A 2QKEA 2DJ0A 4WF5A 5HR1A 17GSA 3H79A 3RAZA 3QAVA 1FAAA 5IOXA 3DVXA 3HZ8A 2FNOA 3EVIA 3NZNA 4J57E 2QGVA 3K8NA 3UBLA 1ZOFA 22GSA 3D6IA 3HDCA 4RQXA 3HD5A 3G7JA 3VWWA 2YANA 4KX4A 2KUCA 1EGRA 3ZFBA 3A2VA 3CXGA 4F0BA 3R3EA 5DVBA 4D73B 1TI1A 3CTGA 5LNKe 2IFQB 1PL1A 1FO5A 1ERVA 3CBUA 5AN1A 1OE8A 1M9AA 2EIQA 3F3QA 3GH6A 3UJ1A 2HI7A 5ECSA 4L8EA 5C04A 2K18A 2AUVA 2B5EA 13GSA 2AJQB 1MDKA 6GSVA 1MD4A 3DD3A 4EL1A 1V2AA 2H6XA 2D2ZA 4K9ZA 4MPFA 5F8BA 1TRSA 1ZYNA 4K5SA 1V98A 1MDIA 1B9YC 2AHEA 4IELA 4LLRA 5HFKA 4TW5A 1O8WA 2HT9A 1ZL9A 2DC5A 5D73A 1URMA 1UN2A 2CV4A 5COHA 2H8LA 2FWGA 2R5GA 5B6NA 3R2QA 3EMXA 3QPMA 5DCGA 3QR6A 3ZITA 2BMXA 4OMVA 5G5EA 3GSSA 6GSTA 1K0NA 3FEUA 3IAM2 5B6MA 5CAXA 2C0DA 1OC9A 3UBKA 4JBBA 1NW2A 2KOKA 5IMDA 3EINA 5IMVA 4BA7A 1O73A 4GSNA 2LEGA 2C3NA 4GXZA 2OE1A 1I5GA 1HD2A 4Q5RA 4XRDA 3CSJA 1VF4A 1TU7A 3KH9A 1EWXA 3FZ9A 3DYRA 4ML6A 1YF1A 5DCHA 4NV5A 1JFUA 3APSA 1YY7A 4J2FA 4IGJA 4ISDA 3ZMLA 1ZCPA 1NHYA 1PRXA 1XWGA 1M2AA 1SYRA 3N9JA 1H75A 5B8BA 3LFLA 1TK8B 5GAND 4CY6A 4TKYA 3GYKA 3CRTA 1YEXA 2VCVA 2R0PA 1FOHA 2H01A 2DLXA 2GZPA 1XWCA 2H30A 4K2XA 1X5EA 3EU3A 1TXXA 2I81A 2LJRA 2RLIA 4PUAA 1G7EA 2DKIA 2Z9SA 2K8VA 2R6KA 5FT3A 1QK8A 3F63A 1XVWA 2I9HA 3APOA 3LG6A 4HOJA 2DSAA 4MLYA 4RUVA 4IJIA 1A2JA 2GT5A 3C73A 4OO4A 1TP9A 5CRDA 2H0HA 5IOWA 1XW6A 3KD0A 2XBIA 4TR0A 3DKSA 2GQKA 5IQYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DJK A;  2OBI A;  2P31 A;  3KP9 A;  3LOR A;  2P5R A;  3M0F A;  2OAD A;  4AJ7 A;  2MMA A;  4ZIJ A;  5D96 A;  5ELA A;  3VI5 A;  1GSY A;  5LCZ A;  5JWQ B;  4XS4 A;  5DAK A;  4XCS A;  4MDC A;  1O7U A;  2H0G A;  4F9Z A;  4ULX A;  1Z5Y E;  2CA8 A;  4LMV A;  3D4T A;  1FVK A;  1O85 A;  1Q4J A;  2YCD A;  2GZY A;  2FHE A;  3CMI A;  3KEB A;  3M8N A;  5JCU A;  3GKK A;  1JLW A;  2GSS A;  2C8U A;  3L9S A;  2YOI A;  4X43 A;  5B7C A;  5D93 A;  2KP2 A;  1WWJ A;  3IBH A;  2A4V A;  4NWY A;  3WYW A;  2WUL A;  4JR4 A;  3DEX A;  1UA5 A;  1FOV A;  4ECC A;  5ECQ B;  4EO3 A;  4O5R A;  5ID2 B;  4JZQ A;  4EKZ A;  3G9B A;  2C1Y A;  5JCG A;  2LNT A;  3DIE A;  1M2B A;  4OFM A;  3TKS E;  3UAP A;  4L0W A;  1XIY A;  4K8M A;  1ZMA A;  2YN1 A;  2GTU A;  4G19 A;  3UVH A;  1Z7P A;  1GP1 A;  4PQ1 A;  1YDK A;  1XOB A;  2NBS A;  2IMF A;  2OJL A;  3FZ5 A;  1SJ6 A;  1TRV A;  2OE3 A;  4YAV A;  5DBQ A;  4TXO A;  1PMT A;  4V2M A;  3IA1 A;  1PX6 A;  1PN9 A;  4BVY A;  1WJK A;  4OCE A;  3N5O A;  3HKR A;  3MNG A;  1TU8 A;  3P90 A;  2BJX A;  2PVQ A;  1VRS D;  2E2G A;  1HNC A;  4CDO A;  1WMJ A;  3LSZ A;  2YJ7 A;  5H5R A;  1DSB A;  1GUH A;  3TKR A;  1EP7 A;  3P7X A;  3TOU A;  2WZ9 A;  2PBJ A;  1WOU A;  4BWQ A;  4GLT A;  4POB A;  4Z7X A;  5DAL B;  2V1M A;  4KA0 A;  1S3A A;  3BOA A;  1AUC A;  1I9D A;  1YQ1 A;  1PX7 A;  4TN8 A;  2WS2 A;  2OKA A;  1AQW A;  1M2D A;  3CRU A;  2XBQ A;  5IPG A;  4POM A;  3GST A;  2MMN A;  2L5L A;  1BJX A;  5DQY A;  4ZB8 A;  1K3L A;  1HNB A;  1YKA A;  3IOS A;  2JU5 A;  2JAD A;  2L57 A;  2GQM A;  4WF4 A;  4NMU A;  2HZF A;  1XW5 A;  2ON7 A;  3DWV A;  1KNG A;  4WXT A;  1ZZY A;  3C7M A;  1THO A;  1BYE A;  2AV4 A;  2LQQ A;  1QMV A;  3NOF A;  1Y25 A;  3H8Q A;  4MJB A;  5GAP D;  3D22 A;  2JL4 A;  2GSQ A;  4LMW A;  2LNS A;  3DVW A;  1B48 A;  2A2R A;  6GSW A;  3IDV A;  1TRU A;  1O81 A;  2JSY A;  2H19 A;  1A2M A;  3F3R A;  1T1V A;  3KH7 A;  4DSQ A;  4FYU A;  4GQF A;  1XWB A;  2FA4 A;  4EDZ A;  2HZE A;  4KGI A;  4KH7 A;  3ME7 A;  3QFB C;  3WT1 A;  3QFA C;  5CYY A;  1BED A;  4H86 A;  2F8F A;  3HJO A;  4PQH A;  1K0A A;  1FB0 A;  4I97 A;  4ML1 A;  1R7H A;  3SBC A;  4HEA 2;  5ECL B;  2MBT A;  5G30 A;  2X8G A;  1RK4 A;  1Y6E A;  4TR4 A;  3GX8 A;  1A0F A;  4PNG A;  5IIZ A;  4F2I A;  2LRT A;  3U5R E;  2VCW A;  1Q98 A;  2R2J A;  4EDY A;  4MA9 A;  3GUR A;  1TOF A;  4DSS A;  4V2L A;  1GTI A;  3ZLP A;  4POL A;  4WEY A;  2VCZ A;  3O76 A;  2ZUP A;  1K0M A;  4I5Q A;  4L0U A;  2X64 A;  3FKF A;  2L4Q A;  2MMO A;  4IW9 A;  4ZIL A;  4AJ6 A;  1EZK A;  1RQM A;  1Z7R A;  2VLT A;  3WGD A;  4MK3 A;  3EU4 A;  3HY2 A;  4KSO A;  4MJE A;  3FZ4 A;  3GL3 A;  3Q18 A;  2IJY A;  3ZMK A;  4N0V A;  3EC3 A;  3DML A;  5H5S A;  3EMP A;  1X9W B;  3HVS A;  2IN3 A;  2LUS A;  2X8H A;  2H0I A;  3GL5 A;  2YP6 A;  4IN0 A;  1TJD A;  2E0Q A;  1FB6 A;  1XWA A;  5J4U A;  4KDU A;  1J9B A;  3C8E A;  1X0R A;  2WFC A;  4MAB A;  4PXO A;  3DGQ A;  3FR3 A;  5IO2 A;  3O6T A;  2HFD A;  1FG4 A;  3ZRD A;  1GRX A;  4GRF A;  2YWO A;  1QXH A;  3TJG A;  1KBN A;  3APQ A;  4GSS A;  4G10 A;  2ES7 A;  5E59 A;  1X9S B;  3UIW A;  3LGC A;  3EWL A;  1GWC A;  2M72 A;  3KM6 A;  1PKZ A;  2VCT A;  1GTU A;  4IJ3 A;  1G6Y A;  3PH9 A;  6GSS A;  2LS5 A;  3GHA A;  3HVX A;  4HJ2 A;  2VLU A;  4NPB A;  1QQ2 A;  1HQO A;  1SYX A;  5J3R A;  5CRG A;  3TKS A;  3QOU A;  4BWS A;  1Z9H A;  3VWV A;  3MAK A;  3KZQ A;  5HQP A;  5ENU A;  4HZ4 A;  1ACV A;  3ZL5 A;  1GSD A;  1EOH A;  1U3A A;  5GST A;  5E4W A;  3GIX A;  2CVB A;  1X5D A;  3ZVJ D;  2VUP A;  3TRX A;  3GKN A;  5AIS A;  4LL1 B;  2PPT A;  3TRQ A;  1R5A A;  1SK2 A;  1GL8 A;  1ZGN A;  3KJY A;  3C1R A;  1JLV A;  3D4M A;  2FWF A;  1U88 A;  3J7Y b;  2E2M A;  1SD8 A;  4HDE A;  1OC8 A;  2N5B A;  2CAI A;  4TR1 A;  1XCC A;  3LYK A;  4NV2 A;  3RHC A;  4NAX A;  3HVV A;  4AGS A;  2FY6 A;  2DJ1 A;  2JZT A;  1XW9 A;  1SJI A;  1PA3 A;  3TKQ A;  1T7P B;  2YWM A;  2J23 A;  2KLX A;  3F6F A;  4YQM A;  2IME A;  4XRA A;  5CRE A;  3L4N A;  4K7N A;  4ZBA A;  1F37 A;  1M0U A;  5HFG A;  4PUF C;  3BCK A;  5ELG A;  3TJF A;  4IKH A;  1BX9 A;  2HXK A;  4HI7 A;  5B8A A;  1F2E A;  5D9T A;  1SEN A;  5L71 A;  2C0F A;  3UEM A;  1BQ7 A;  1JZD A;  1XWK A;  4KB3 A;  2JSZ A;  4ECJ A;  4ZL9 A;  8GSS A;  2VL3 A;  3LYP A;  3F6D A;  5DDL A;  4FIW A;  6GSU A;  1X9M B;  3CTF A;  3TJB A;  2V41 A;  3CSI A;  1GLQ A;  4FYC A;  3QDN A;  4G2E A;  3HCZ A;  2VM1 A;  4MP4 A;  2G2Q A;  5D9W A;  2LV3 A;  1LU4 A;  3C71 A;  4N30 A;  2NPB A;  4N10 A;  2MZC A;  3WGE A;  1IYH A;  2B1L A;  4X1U A;  1USB A;  2C4J A;  2R4V A;  3GFK A;  2JZS A;  1M99 A;  2ZNM A;  3D5J A;  5ECO B;  5HFI A;  5IMF A;  3LEF A;  1OAZ A;  3UAR A;  2V2G A;  3GTU A;  1PQN A;  2M80 A;  1EEJ A;  2NDO A;  3TKS C;  5J5N A;  3TCO A;  3IXR A;  4BVX A;  2YNX A;  3ED3 A;  3ZTL A;  4HQS A;  3I9V 2;  1R5P A;  3LXT A;  3G7I A;  2IWT A;  3MDK A;  2YZU A;  5ABR A;  2L6D A;  5KEJ A;  2FWE A;  2VAF A;  4QL7 A;  3D21 A;  1OC9 B;  2PER A;  3EYT A;  4BPY A;  3CSH A;  5J9B A;  3WGX A;  3TRP A;  2XC2 A;  3CYN A;  3IRA A;  3KMO A;  3L9U A;  1S3D A;  4IBP A;  3U6V A;  2VM2 A;  2TRX A;  3ZIV A;  2CAQ A;  2H6Z A;  2HLS A;  4OD7 A;  5IMA A;  3GN3 A;  3BJ5 A;  1X5C A;  4K6X A;  2OA7 A;  4MMM A;  2FWH A;  2RM5 A;  1MTC A;  2H1D A;  5AIX A;  1XVQ A;  1JZO A;  4MH3 A;  4OO5 A;  4TRX A;  3IR4 A;  3KCM A;  2YV9 A;  1K0C A;  2VL2 C;  2PMT A;  2OBK A;  4CHS A;  4YAP A;  2HYX A;  2OAC A;  3GKM A;  1LBK A;  4FYB A;  1JHB A;  4EE0 A;  4OFN A;  5D9X A;  4LL4 B;  2GZZ A;  2QC7 A;  1EV4 A;  1WE0 A;  2B1K A;  1K0D A;  3FY7 A;  4N11 A;  12GS A;  4XTS A;  2K6V A;  1A2L A;  1XZO A;  4O7H A;  5HR3 A;  2VOC A;  3M1G A;  3ZFL A;  4JED A;  4DEJ A;  5INY A;  1A0R P;  2WJU A;  4MZW A;  4XIH A;  2MMZ A;  4HQZ A;  1SD9 A;  1U6T A;  3S9F A;  3F4S A;  4Q5Q A;  1EP8 A;  1GSQ A;  1K0B A;  2EIR A;  16GS A;  2AAW A;  1ERU A;  3A2X A;  2CQ9 A;  14GS A;  5EPF A;  1E6B A;  3KMN A;  4YQU A;  1DE1 A;  4NHZ A;  4XS4 B;  4LA1 A;  5DAK B;  1W89 A;  2H74 A;  4O92 A;  3TGZ A;  4ECI A;  1NHO A;  2GSR A;  5ECM B;  3IE3 A;  4Q5N A;  1F3A A;  4OWY A;  4QQ7 A;  3C1S A;  2A2S A;  1VF1 A;  1ILO A;  2FCH A;  3BCI A;  1M7T A;  2BTO T;  2AYT A;  3O3T A;  1OKT A;  3PR8 A;  1GLP A;  2XPD A;  1CQG A;  3QAG A;  1AC1 A;  1XOA A;  2LKU A;  4KSM A;  1YF0 A;  2F9S A;  5C00 A;  3QMX A;  10GS A;  1YJ6 A;  3F9U A;  3JCM L;  4EUY A;  4IS0 A;  4HS1 A;  1GUM A;  1M9B A;  3OR5 A;  3KTB A;  3I6A A;  2FA8 A;  3IHQ A;  4K0N A;  2F8A A;  3Q74 A;  1AQV A;  2B5X A;  3V1W A;  1GNE A;  4TXV A;  3E9J B;  2PN8 A;  3HHV A;  2FGX A;  2NTO A;  4RI6 A;  2HSY A;  4KE3 A;  4D73 A;  2IFQ A;  2V6O A;  3ERW A;  3LJR A;  4GQC A;  2GLR A;  2IMK A;  5LD0 A;  5IMZ A;  3H4K A;  5ECP B;  5CNW A;  4ILF A;  4OCF A;  3UOM A;  2PU9 C;  4JE1 A;  2IIY A;  1VF3 A;  1NSW A;  2WRT A;  3QCP A;  4JU5 A;  1A8L A;  2GT6 A;  2TIR A;  1OYJ A;  3RHB A;  2KHP A;  3UVT A;  3W6G A;  5JWO B;  3VPT A;  4TXO B;  1A24 A;  2EIO A;  1AAZ A;  4KND A;  3A2W A;  2RUF A;  4IVF A;  3FRC A;  5ECI B;  2ON5 A;  1ON4 A;  5F0G A;  1UC7 A;  2PUK C;  1SL1 B;  3IPZ A;  3I69 A;  5IO0 A;  4GWR A;  2MYG A;  3GNJ A;  5ECK B;  1GH2 A;  5AIV A;  1HYU A;  2RII A;  3F4R A;  2DMM A;  4PQI A;  1SK0 A;  2N5A A;  4FH8 A;  2FLS A;  4ZL7 A;  3F0I A;  1AIU A;  5ECN B;  4L5O A;  2O8V B;  2WB9 A;  5D8I A;  1O6J A;  5G5F A;  5A5K A;  5JWR B;  1SL2 B;  4KDY A;  3G7Y A;  2LTK A;  3W8J A;  1N8J A;  2VCQ A;  3FHK A;  1GSS A;  3VWU A;  5F06 A;  4HZ2 A;  3TKP A;  2DIZ A;  3VI7 A;  5HR0 A;  1PKW A;  2LRC A;  3FR9 A;  2REM A;  2LJA A;  1WP0 A;  5G2Z A;  1KTE A;  2VD0 A;  4K7I A;  4E8H A;  3J7Y k;  3FK8 A;  18GS A;  3F8U A;  1TKD B;  5J9C A;  4N0Z A;  2R37 A;  2OE0 A;  2PVO C;  5CRH A;  1F9M A;  3GKX A;  1QUW A;  3WD6 A;  4MH2 A;  1THX A;  1PD2 1;  1QFN A;  2I4A A;  5KN3 A;  1FW1 A;  5EY6 A;  1SU9 A;  3VWX A;  1G7O A;  3MSZ A;  3TDG A;  1GUK A;  2B5Y A;  1EOG A;  3D0Z A;  3SWL A;  3FYG A;  2N5F A;  2GVP A;  3ME8 A;  1MDJ A;  5G1K A;  1ERW A;  3LQ7 A;  4XHM A;  1GTB A;  4WR5 A;  2WDU A;  3RBT A;  3IK7 A;  2H75 A;  4DSR A;  4WET A;  4WBR D;  3F4T A;  2DBC A;  9GSS A;  1WIK A;  1T4Z A;  1Z6M A;  3TUE A;  1AXD A;  2HZE B;  4RQR A;  3ZYW A;  2VIM A;  3L78 A;  4JR6 A;  2MBS A;  2XPE A;  4RI7 A;  4F0C A;  4ZB6 A;  2K9F A;  4IP6 A;  2TRC P;  2B3S A;  3GUS A;  2ALB A;  2GGT A;  1ZYQ B;  1SJZ A;  3L0H A;  1PGT A;  2IL3 A;  1YZX A;  1YEP A;  3KIJ A;  1HNA A;  1XPV A;  3MWH A;  3TB2 A;  3BD2 A;  4Q5F A;  1TDI A;  2L5O A;  3VK9 A;  2PWJ A;  4BL7 A;  2VL2 A;  6GSX A;  4ECB A;  2C0E A;  5CRW A;  4DSS B;  1FHE A;  2F51 A;  2ZCT A;  4ZL8 A;  2L4C A;  4IQA A;  2DJ2 A;  2H73 A;  1C72 A;  3VUR A;  1B8X A;  1T8E B;  4IHU A;  5F05 A;  4NHW A;  1W4V A;  5ID2 A;  2VL9 A;  2X8C A;  1DUG A;  2H1A A;  4G9H A;  4K2D A;  2FUG 2;  5IM9 A;  1XXU A;  3KXO A;  1V57 A;  4QL9 A;  2HRF A;  2P0G A;  1Z6N A;  2RM6 A;  4MJC A;  3Q6O A;  2JAC A;  2CVD A;  1PSQ A;  2PGT A;  1VGL A;  3QD9 A;  1OVN A;  3GX0 A;  2HRN A;  1VF2 A;  1DBY A;  2H66 A;  2J9H A;  2C3Q A;  3VFI A;  2IMI A;  3HYP A;  3M3M A;  3VPQ A;  3H93 A;  2GQL A;  1V58 A;  2O85 A;  3FW2 A;  3QAW A;  5IMC A;  5DJM A;  3IV4 A;  1WPI A;  4GF0 A;  3KP8 A;  2VO4 A;  2DJ3 A;  1XFL A;  1F6M C;  3E0U A;  4PNF A;  3I43 A;  4ID0 A;  4KW6 A;  2CX4 A;  1NM3 A;  2K8S A;  3ERF A;  3ZRE A;  4MPG A;  3GH9 A;  1ML6 A;  2IMD A;  3EUR A;  2GDR A;  2O89 A;  3FR6 A;  5DAL A;  1ABA A;  4GCI A;  2GS3 A;  2FD3 A;  1TRW A;  1FVJ A;  3KGK A;  3FZA A;  20GS A;  5D9V A;  4XS1 A;  4PUR A;  2H76 A;  19GS A;  1R4W A;  4JRR A;  4HU7 A;  5A4W A;  1DE2 A;  3IK9 A;  4TVE A;  4V1A p;  4PGT A;  2I3Y A;  3TJJ A;  4TR3 A;  3GV1 A;  3RDW A;  4HJM A;  5EL8 A;  1A23 A;  1ERT A;  4F03 A;  1TK5 B;  2F3M A;  1CQH A;  4L5L A;  1U3I A;  3US3 A;  3DRN A;  4P3Y B;  3Q19 A;  3P2A A;  4POK A;  2DJJ A;  1GUL A;  7GSS A;  4TR1 B;  4ZBB A;  4MZC A;  1SKR B;  1OKD A;  1AQX A;  3UL3 A;  4IQ1 A;  1V40 A;  5A4U A;  4MF7 A;  2CT6 A;  1F3B A;  5CO3 A;  3VLN A;  2LJK A;  3UMA A;  1BG5 A;  1EV9 A;  4KCA A;  3WT2 A;  2L59 A;  1TTZ A;  4ZB9 A;  2HE3 A;  2WCI A;  1PL2 A;  1ST9 A;  2CZ3 A;  3ISO A;  3GMF A;  5G1L A;  2VCX A;  4J56 E;  1GTA A;  5FWG A;  1J08 A;  2VD1 A;  4WKW A;  5G31 A;  2R3X A;  5KN2 A;  2B7K A;  2H71 A;  5F07 A;  2WGR A;  4KDX A;  2CVK A;  1U87 A;  4FO5 A;  2DIY A;  2H6Y A;  3HA9 A;  1RW1 A;  1K0O A;  4NXI A;  1IYI A;  4AJ8 A;  1UVZ A;  1JZR A;  2CZ2 A;  1OC3 A;  5HR2 A;  4ACS A;  4KCE A;  4EF0 A;  4HU9 A;  3KTL A;  4XS6 A;  2V6K A;  1Z3E A;  1EGO A;  4MCU A;  2VLV A;  4ZXG A;  1G6W A;  4HUA A;  2I1U A;  3AY8 A;  1T3B A;  2LST A;  2YWI A;  5CP1 A;  2EC4 A;  2H70 A;  3LWA A;  4EXJ A;  2E7P A;  6GSY A;  5JCW A;  4EC0 A;  3HZ4 A;  1G0T A;  1JZW A;  4TOP A;  1K3O A;  1EEM A;  3GA4 A;  5EVO A;  2P5Q A;  1SL0 B;  2B6M A;  1BAY A;  4WR4 A;  5A4V A;  2GST A;  1E2Y A;  4OFT A;  2JZR A;  3GTU B;  3GRX A;  1XBS A;  2XHF A;  3RPP A;  1T4Y A;  4KUN A;  1YKC A;  5DQS A;  4MF5 A;  4EVM A;  4I2U A;  2C80 A;  3ERG A;  4YH2 A;  1SKS B;  1GSF A;  5IPH A;  5FHI A;  3DXB A;  3H1N A;  1R26 A;  3P8W A;  2B7J A;  4GTU A;  1AW9 A;  3L9V A;  2QSI A;  3HXS A;  4I6X A;  1TI3 A;  4ZBD A;  2O87 A;  4X0X A;  4MF6 A;  5DJL A;  4I2T A;  5ECR B;  3M9J A;  2LRN A;  3ZZX A;  4CW9 A;  2NVL A;  2C0G A;  1GNW A;  1SK1 A;  4AF2 A;  4MZB A;  3E3E A;  1S3C A;  3EE2 A;  2H72 A;  1B4P A;  5AGY A;  1OE7 A;  4K1F A;  5KN1 A;  5KN0 A;  1B9X C;  3A3T A;  3RPN A;  2YV7 A;  4F82 A;  2L6C A;  5H5Q A;  1GSU A;  2AB6 A;  2H1G A;  1T00 A;  3A5W A;  3ZVJ A;  3HJM A;  1ZYE A;  2YZH A;  3PGT A;  2CX3 A;  5J41 A;  5ECH B;  3TJK A;  1K3Y A;  3IC4 A;  3BBY A;  4GST A;  1QGV A;  2YPM A;  3HJP A;  11GS A;  2V32 A;  4IP1 A;  4WBJ A;  2HSH A;  3W8S A;  1WRY A;  1H4O A;  2H1B A;  1O8X A;  4K0G A;  1TW9 A;  4MJA A;  4O32 A;  2X99 A;  5GSS A;  2M46 A;  3IAS 2;  4V2N A;  2DML A;  3TOT A;  4I8B A;  1N2A A;  1TK0 B;  2YWN A;  4YQV A;  4PX1 A;  2RUE A;  2IPA A;  4DVC A;  3PIN A;  2LQO A;  1KEB A;  1V9W A;  3NIV A;  2O7K A;  1MEK A;  3LXZ A;  2YJH A;  1LJR A;  1SKW B;  1J0F A;  4E8E A;  4K7O A;  4KAE A;  1MD3 A;  2HNL A;  1GSE A;  4V1A g;  5GZZ B;  2G0F A;  1A8Y A;  3ZIJ A;  3M9K A;  1B4Q A;  2C3T A;  2KP1 A;  2QKE A;  2DJ0 A;  4WF5 A;  5HR1 A;  17GS A;  3H79 A;  3RAZ A;  3QAV A;  1FAA A;  5IOX A;  3DVX A;  3HZ8 A;  2FNO A;  3EVI A;  3NZN A;  4J57 E;  2QGV A;  3K8N A;  3UBL A;  1ZOF A;  22GS A;  3D6I A;  3HDC A;  4RQX A;  3HD5 A;  3G7J A;  3VWW A;  2YAN A;  4KX4 A;  2KUC A;  1EGR A;  3ZFB A;  3A2V A;  3CXG A;  4F0B A;  5DVB A;  4D73 B;  1TI1 A;  3CTG A;  5LNK e;  2IFQ B;  1PL1 A;  1FO5 A;  1ERV A;  3CBU A;  5AN1 A;  1OE8 A;  1M9A A;  2EIQ A;  3F3Q A;  3GH6 A;  3UJ1 A;  2HI7 A;  5ECS A;  4L8E A;  5C04 A;  2K18 A;  2AUV A;  2B5E A;  13GS A;  2AJQ B;  1MDK A;  6GSV A;  1MD4 A;  3DD3 A;  4EL1 A;  1V2A A;  2H6X A;  2D2Z A;  4K9Z A;  4MPF A;  5F8B A;  1TRS A;  1V98 A;  1MDI A;  1B9Y C;  2AHE A;  4IEL A;  4LLR A;  5HFK A;  4TW5 A;  1O8W A;  2HT9 A;  1ZL9 A;  2DC5 A;  5D73 A;  1URM A;  1UN2 A;  2CV4 A;  5COH A;  2H8L A;  2FWG A;  2R5G A;  5B6N A;  3R2Q A;  3EMX A;  3QPM A;  5DCG A;  3QR6 A;  3ZIT A;  2BMX A;  4OMV A;  5G5E A;  3GSS A;  6GST A;  1K0N A;  3FEU A;  3IAM 2;  5B6M A;  5CAX A;  2C0D A;  1OC9 A;  3UBK A;  4JBB A;  1NW2 A;  2KOK A;  5IMD A;  3EIN A;  5IMV A;  4BA7 A;  1O73 A;  4GSN A;  2LEG A;  2C3N A;  4GXZ A;  2OE1 A;  1I5G A;  1HD2 A;  4Q5R A;  4XRD A;  3CSJ A;  1VF4 A;  1TU7 A;  3KH9 A;  1EWX A;  3FZ9 A;  3DYR A;  4ML6 A;  1YF1 A;  5DCH A;  4NV5 A;  1JFU A;  3APS A;  1YY7 A;  4J2F A;  4IGJ A;  4ISD A;  3ZML A;  1ZCP A;  1NHY A;  1PRX A;  1XWG A;  1M2A A;  1SYR A;  3N9J A;  1H75 A;  5B8B A;  3LFL A;  1TK8 B;  5GAN D;  4TKY A;  3GYK A;  3CRT A;  1YEX A;  2VCV A;  2H01 A;  2DLX A;  2GZP A;  1XWC A;  2H30 A;  1X5E A;  3EU3 A;  1TXX A;  2I81 A;  2LJR A;  2RLI A;  4PUA A;  1G7E A;  2Z9S A;  2K8V A;  2R6K A;  5FT3 A;  1QK8 A;  3F63 A;  1XVW A;  2I9H A;  3APO A;  3LG6 A;  4HOJ A;  2DSA A;  4MLY A;  4RUV A;  4IJI A;  1A2J A;  2GT5 A;  3C73 A;  4OO4 A;  1TP9 A;  5CRD A;  2H0H A;  5IOW A;  1XW6 A;  3KD0 A;  2XBI A;  4TR0 A;  3DKS A;  2GQK A;  5IQY A; 
#chains in the Genus database with same CATH topology
 2DJK A;  2OBI A;  2P31 A;  3KP9 A;  3LOR A;  1PN0 A;  2P5R A;  3M0F A;  2OAD A;  4AJ7 A;  2MMA A;  4ZIJ A;  5D96 A;  5ELA A;  3VI5 A;  1GSY A;  5LCZ A;  5JWQ B;  4XS4 A;  5DAK A;  4XCS A;  4MDC A;  1O7U A;  2H0G A;  4F9Z A;  4ULX A;  1Z5Y E;  2CA8 A;  4LMV A;  3D4T A;  1FVK A;  1O85 A;  1Q4J A;  2YCD A;  2GZY A;  2FHE A;  3CMI A;  3KEB A;  3M8N A;  5JCU A;  3GKK A;  1JLW A;  2GSS A;  2C8U A;  3L9S A;  2YOI A;  4BL7 B;  4X43 A;  5B7C A;  5D93 A;  2KP2 A;  1WWJ A;  3IBH A;  2A4V A;  4NWY A;  3WYW A;  2WUL A;  4JR4 A;  3DEX A;  1UA5 A;  1FOV A;  4ECC A;  5ECQ B;  4EO3 A;  4O5R A;  5ID2 B;  4JZQ A;  4EKZ A;  3G9B A;  2C1Y A;  5JCG A;  2LNT A;  3DIE A;  1M2B A;  4OFM A;  3TKS E;  3UAP A;  4L0W A;  1XIY A;  4K8M A;  1ZMA A;  2YN1 A;  2GTU A;  4G19 A;  3UVH A;  1Z7P A;  4A5P A;  1GP1 A;  4PQ1 A;  1YDK A;  1XOB A;  2NBS A;  2IMF A;  2OJL A;  3FZ5 A;  1SJ6 A;  1TRV A;  2OE3 A;  4YAV A;  5DBQ A;  4TXO A;  1PMT A;  4V2M A;  3IA1 A;  1PX6 A;  1PN9 A;  4BVY A;  1WJK A;  4OCE A;  3N5O A;  3HKR A;  3MNG A;  1TU8 A;  3P90 A;  2BJX A;  2PVQ A;  1VRS D;  2E2G A;  1HNC A;  4CDO A;  1WMJ A;  3LSZ A;  2YJ7 A;  5H5R A;  1DSB A;  1GUH A;  3TKR A;  1EP7 A;  3P7X A;  2A2P A;  3TOU A;  2WZ9 A;  2PBJ A;  1WOU A;  4G0L A;  4BWQ A;  4GLT A;  4POB A;  4Z7X A;  5DAL B;  2V1M A;  4KA0 A;  1S3A A;  3BOA A;  1AUC A;  1I9D A;  1YQ1 A;  1PX7 A;  4TN8 A;  2WS2 A;  2OKA A;  1AQW A;  1M2D A;  3CRU A;  2XBQ A;  5IPG A;  4POM A;  3GST A;  2MMN A;  2L5L A;  1BJX A;  2HRK A;  5DQY A;  4ZB8 A;  1K3L A;  1HNB A;  1YKA A;  3IOS A;  2JU5 A;  2JAD A;  2L57 A;  2GQM A;  4WF4 A;  4NMU A;  2HZF A;  1XW5 A;  2ON7 A;  3DWV A;  1KNG A;  4WXT A;  1ZZY A;  3C7M A;  1THO A;  1BYE A;  2AV4 A;  2LQQ A;  1QMV A;  3NOF A;  1Y25 A;  3H8Q A;  4MJB A;  5GAP D;  4PTS A;  3D22 A;  2JL4 A;  2GSQ A;  4LMW A;  2LNS A;  3DVW A;  1B48 A;  2A2R A;  6GSW A;  3IDV A;  1TRU A;  1O81 A;  2JSY A;  2H19 A;  1A2M A;  3F3R A;  1T1V A;  3IHG A;  3KH7 A;  4DSQ A;  4FYU A;  3HVN A;  4GQF A;  1XWB A;  2FA4 A;  4EDZ A;  2HZE A;  4KGI A;  4KH7 A;  3ME7 A;  3QFB C;  3WT1 A;  3QFA C;  5CYY A;  1BED A;  4H86 A;  5BRT A;  2F8F A;  3HJO A;  4PQH A;  1K0A A;  2A4H A;  1FB0 A;  4I97 A;  4MNN A;  4ML1 A;  1R7H A;  3SBC A;  4HEA 2;  5ECL B;  2MBT A;  5G30 A;  2X8G A;  1RK4 A;  1Y6E A;  4TR4 A;  3GX8 A;  1A0F A;  4PNG A;  5IIZ A;  4F2I A;  2LRT A;  3U5R E;  2VCW A;  4USS A;  1Q98 A;  2R2J A;  4EDY A;  4MA9 A;  3GUR A;  1TOF A;  4DSS A;  4V2L A;  1GTI A;  3ZLP A;  4POL A;  4WEY A;  2VCZ A;  3O76 A;  4HSC X;  2ZUP A;  1K0M A;  4I5Q A;  4L0U A;  2X64 A;  3FKF A;  2L4Q A;  2MMO A;  4IW9 A;  4ZIL A;  4AJ6 A;  1EZK A;  1RQM A;  1Z7R A;  2VLT A;  3WGD A;  4MK3 A;  3EU4 A;  3HY2 A;  4KSO A;  4MJE A;  3FZ4 A;  3GL3 A;  3Q18 A;  2IJY A;  3ZMK A;  4N0V A;  3EC3 A;  3DML A;  5H5S A;  3EMP A;  1X9W B;  3HVS A;  2IN3 A;  2LUS A;  2X8H A;  2H0I A;  3GL5 A;  2YP6 A;  4IN0 A;  1TJD A;  2E0Q A;  1FB6 A;  1XWA A;  5J4U A;  4KDU A;  1J9B A;  3C8E A;  1X0R A;  4Z2U A;  2WFC A;  4MAB A;  4PXO A;  3DGQ A;  3FR3 A;  5IO2 A;  3O6T A;  2HFD A;  1FG4 A;  3ZRD A;  1GRX A;  4GRF A;  2YWO A;  1QXH A;  3TJG A;  1KBN A;  3APQ A;  4GSS A;  4G10 A;  2ES7 A;  5E59 A;  1X9S B;  3UIW A;  3LGC A;  3EWL A;  1GWC A;  2M72 A;  3KM6 A;  1PKZ A;  2VCT A;  1GTU A;  4IJ3 A;  1G6Y A;  3PH9 A;  6GSS A;  2LS5 A;  3GHA A;  3HVX A;  4HJ2 A;  2VLU A;  4NPB A;  1QQ2 A;  1HQO A;  1SYX A;  5J3R A;  5CRG A;  3TKS A;  3QOU A;  4BWS A;  1Z9H A;  3VWV A;  3MAK A;  3KZQ A;  5HQP A;  5ENU A;  4HZ4 A;  1ACV A;  3ZL5 A;  1GSD A;  1EOH A;  1U3A A;  5GST A;  5E4W A;  3GIX A;  2CVB A;  1X5D A;  3ZVJ D;  2VUP A;  3TRX A;  3GKN A;  5AIS A;  4LL1 B;  2PPT A;  3TRQ A;  1R5A A;  1SK2 A;  1GL8 A;  1ZGN A;  3KJY A;  3C1R A;  1JLV A;  3D4M A;  2FWF A;  1U88 A;  3J7Y b;  2E2M A;  1SD8 A;  4HDE A;  1OC8 A;  2N5B A;  2CAI A;  4TR1 A;  1XCC A;  3LYK A;  4NV2 A;  3RHC A;  4G0I A;  4NAX A;  3HVV A;  4AGS A;  2FY6 A;  2DJ1 A;  2JZT A;  1XW9 A;  1SJI A;  1PA3 A;  3TKQ A;  1T7P B;  2YWM A;  2J23 A;  2KLX A;  3F6F A;  4YQM A;  2IME A;  4XRA A;  2X49 A;  5CRE A;  3L4N A;  4K7N A;  4ZBA A;  1F37 A;  1M0U A;  5HFG A;  4PUF C;  3BCK A;  5ELG A;  3TJF A;  4IKH A;  1BX9 A;  2HXK A;  4HI7 A;  5B8A A;  1F2E A;  5D9T A;  1SEN A;  5L71 A;  2C0F A;  3UEM A;  1BQ7 A;  1JZD A;  1XWK A;  4KB3 A;  2JSZ A;  4ECJ A;  4ZL9 A;  8GSS A;  2VL3 A;  3LYP A;  3F6D A;  5DDL A;  4FIW A;  6GSU A;  1X9M B;  3CTF A;  3TJB A;  2V41 A;  3CSI A;  1GLQ A;  3IC8 A;  4FYC A;  3QDN A;  4G2E A;  2HSM A;  3HCZ A;  2VM1 A;  4MP4 A;  2G2Q A;  5D9W A;  2LV3 A;  1LU4 A;  3C71 A;  4N30 A;  2NPB A;  4N10 A;  2MZC A;  3WGE A;  1IYH A;  2B1L A;  4X1U A;  1USB A;  2C4J A;  2R4V A;  3GFK A;  4Z2T A;  2JZS A;  1M99 A;  2ZNM A;  3D5J A;  5ECO B;  2UZ8 A;  5HFI A;  5IMF A;  3LEF A;  1OAZ A;  3UAR A;  2V2G A;  3GTU A;  1PQN A;  2M80 A;  1EEJ A;  2NDO A;  4FQU A;  3TKS C;  5J5N A;  3TCO A;  3IXR A;  4BVX A;  2YNX A;  1ZYP A;  3ED3 A;  3ZTL A;  4HQS A;  3I9V 2;  1R5P A;  3LXT A;  3G7I A;  2IWT A;  3MDK A;  2YZU A;  5ABR A;  2L6D A;  5KEJ A;  2FWE A;  2VAF A;  4QL7 A;  3D21 A;  1OC9 B;  3MYD A;  2PER A;  3EYT A;  4BPY A;  3CSH A;  5J9B A;  3WGX A;  3TRP A;  2XC2 A;  3CYN A;  3IRA A;  3KMO A;  3L9U A;  1S3D A;  4IBP A;  3U6V A;  2VM2 A;  2TRX A;  3ZIV A;  2CAQ A;  2H6Z A;  2HLS A;  4K5R A;  4OD7 A;  5IMA A;  3GN3 A;  4KF9 A;  3BJ5 A;  4MMM A;  1X5C A;  2OA7 A;  4K6X A;  3LW9 A;  2FWH A;  2RM5 A;  1MTC A;  2H1D A;  5AIX A;  1XVQ A;  1JZO A;  4MH3 A;  4O5U A;  4OO5 A;  4TRX A;  3IR4 A;  3KCM A;  2YV9 A;  1K0C A;  2VL2 C;  2PMT A;  3A5I A;  2OBK A;  4CHS A;  4YAP A;  2HYX A;  2OAC A;  3GKM A;  1LBK A;  4FYB A;  1JHB A;  4EE0 A;  4OFN A;  5D9X A;  4LL4 B;  2GZZ A;  2R0C A;  2QC7 A;  1EV4 A;  1WE0 A;  2B1K A;  1K0D A;  3FY7 A;  4N11 A;  12GS A;  4XTS A;  2K6V A;  1A2L A;  1XZO A;  4O7H A;  5HR3 A;  2VOC A;  3M1G A;  3ZFL A;  4JED A;  4DEJ A;  5INY A;  1A0R P;  2WJU A;  4MZW A;  4XIH A;  2MMZ A;  4HQZ A;  1SD9 A;  1U6T A;  4EIP A;  3S9F A;  3F4S A;  4Q5Q A;  1EP8 A;  1GSQ A;  1K0B A;  2EIR A;  16GS A;  2AAW A;  1ERU A;  3A2X A;  2CQ9 A;  14GS A;  5EPF A;  1E6B A;  3KMN A;  4YQU A;  1DE1 A;  4NHZ A;  4XS4 B;  4LA1 A;  5DAK B;  1W89 A;  2H74 A;  4O92 A;  3TGZ A;  4ECI A;  1NHO A;  2GSR A;  5ECM B;  3IE3 A;  4Q5N A;  1F3A A;  4OWY A;  2DKH A;  4QQ7 A;  3C1S A;  2A2S A;  1VF1 A;  1ILO A;  2FCH A;  3BCI A;  1M7T A;  2BTO T;  2AYT A;  3O3T A;  1OKT A;  3PR8 A;  1GLP A;  2XPD A;  1CQG A;  3QAG A;  1AC1 A;  1XOA A;  2LKU A;  4KSM A;  1YF0 A;  2F9S A;  5C00 A;  3QMX A;  10GS A;  1YJ6 A;  3F9U A;  3JCM L;  4EUY A;  4IS0 A;  4HS1 A;  1GUM A;  1M9B A;  3OR5 A;  3KTB A;  3I6A A;  2FA8 A;  3IHQ A;  4K0N A;  2F8A A;  3Q74 A;  1AQV A;  2B5X A;  3V1W A;  1GNE A;  4TXV A;  3E9J B;  2PN8 A;  3HHV A;  2FGX A;  2NTO A;  4RI6 A;  2HSY A;  4KE3 A;  4D73 A;  2IFQ A;  2V6O A;  3ERW A;  3LJR A;  4GQC A;  2GLR A;  2IMK A;  5LD0 A;  5IMZ A;  3H4K A;  5ECP B;  5CNW A;  4ILF A;  4OCF A;  3UOM A;  2PU9 C;  3MIX A;  4JE1 A;  2IIY A;  1VF3 A;  1NSW A;  2WRT A;  3QCP A;  4JU5 A;  1A8L A;  2GT6 A;  2TIR A;  5KOW A;  1OYJ A;  3RHB A;  2KHP A;  3UVT A;  3W6G A;  5JWO B;  3VPT A;  4TXO B;  1A24 A;  2EIO A;  4BVY B;  1AAZ A;  4KND A;  3A2W A;  5KOX A;  2RUF A;  4IVF A;  3FRC A;  5ECI B;  2ON5 A;  1ON4 A;  5F0G A;  1UC7 A;  2PUK C;  1SL1 B;  3IPZ A;  3I69 A;  5IO0 A;  4GWR A;  2MYG A;  3GNJ A;  5ECK B;  1GH2 A;  5AIV A;  1HYU A;  2RII A;  3F4R A;  2DMM A;  4PQI A;  5BMU A;  1SK0 A;  2N5A A;  4FH8 A;  2FLS A;  4ZL7 A;  3F0I A;  1AIU A;  5ECN B;  4L5O A;  2O8V B;  2WB9 A;  5D8I A;  1O6J A;  5G5F A;  5A5K A;  5JWR B;  1SL2 B;  4KDY A;  3G7Y A;  2LTK A;  3W8J A;  1N8J A;  2VCQ A;  3FHK A;  1GSS A;  3VWU A;  5F06 A;  4HZ2 A;  3TKP A;  2DIZ A;  3VI7 A;  5HR0 A;  1PKW A;  2LRC A;  3FR9 A;  2REM A;  2LJA A;  1WP0 A;  5G2Z A;  1KTE A;  2VD0 A;  4K7I A;  4E8H A;  3J7Y k;  3FK8 A;  18GS A;  3F8U A;  1TKD B;  5J9C A;  4N0Z A;  2R37 A;  2OE0 A;  2PVO C;  5CRH A;  1F9M A;  3GKX A;  1QUW A;  2QA1 A;  3WD6 A;  4MH2 A;  1THX A;  1PFO A;  1PD2 1;  1QFN A;  2I4A A;  5KN3 A;  1FW1 A;  5EY6 A;  1SU9 A;  3VWX A;  1G7O A;  3MSZ A;  3TDG A;  1GUK A;  2B5Y A;  1EOG A;  3D0Z A;  3SWL A;  3FYG A;  1S3R A;  4CY8 A;  2N5F A;  2GVP A;  3ME8 A;  1MDJ A;  5G1K A;  1ERW A;  3LQ7 A;  4XHM A;  1GTB A;  4WR5 A;  2WDU A;  3RBT A;  3IK7 A;  2H75 A;  4DSR A;  4WET A;  4WBR D;  2QA2 A;  3F4T A;  2DBC A;  9GSS A;  1WIK A;  1T4Z A;  1Z6M A;  3TUE A;  4YKG A;  1AXD A;  2HZE B;  4RQR A;  3ZYW A;  2VIM A;  3L78 A;  4JR6 A;  2MBS A;  2XPE A;  4RI7 A;  4F0C A;  4ZB6 A;  2K9F A;  4IP6 A;  2TRC P;  2B3S A;  3GUS A;  2ALB A;  2GGT A;  3EPT A;  1ZYQ B;  1SJZ A;  3L0H A;  1PGT A;  2IL3 A;  1YZX A;  1YEP A;  3KIJ A;  1HNA A;  1XPV A;  3MWH A;  3TB2 A;  3BD2 A;  4Q5F A;  1TDI A;  2L5O A;  3VK9 A;  2PWJ A;  4BL7 A;  2VL2 A;  6GSX A;  4ECB A;  2C0E A;  5CRW A;  4DSS B;  1FHE A;  2F51 A;  2ZCT A;  4ZL8 A;  2L4C A;  4IQA A;  2DJ2 A;  2H73 A;  1C72 A;  3VUR A;  1B8X A;  1T8E B;  4IHU A;  5F05 A;  4NHW A;  1W4V A;  5ID2 A;  2VL9 A;  2X8C A;  1DUG A;  2H1A A;  4G9H A;  4K2D A;  2FUG 2;  5IM9 A;  1XXU A;  2HRA A;  3KXO A;  1V57 A;  4QL9 A;  2HRF A;  2P0G A;  1Z6N A;  2RM6 A;  4MJC A;  3Q6O A;  2JAC A;  4BIK A;  2CVD A;  1PSQ A;  2R0G A;  2PGT A;  1VGL A;  3QD9 A;  1OVN A;  3GX0 A;  1M3J A;  2HRN A;  1VF2 A;  1DBY A;  2H66 A;  2J9H A;  2C3Q A;  3VFI A;  2IMI A;  3HYP A;  3M3M A;  3VPQ A;  3H93 A;  2GQL A;  1V58 A;  2O85 A;  3FW2 A;  3QAW A;  5IMC A;  5DJM A;  3IV4 A;  1WPI A;  4GF0 A;  3KP8 A;  2VO4 A;  2DJ3 A;  1XFL A;  1F6M C;  3E0U A;  4PNF A;  3I43 A;  4ID0 A;  4KW6 A;  2CX4 A;  1NM3 A;  2K8S A;  3ERF A;  3ZRE A;  4MPG A;  3GH9 A;  1ML6 A;  2IMD A;  3EUR A;  2GDR A;  2O89 A;  3FR6 A;  5DAL A;  1ABA A;  4GCI A;  2GS3 A;  2FD3 A;  1TRW A;  1FVJ A;  3KGK A;  3FZA A;  20GS A;  5D9V A;  4XS1 A;  4PUR A;  2H76 A;  19GS A;  1R4W A;  4JRR A;  4HU7 A;  5A4W A;  1DE2 A;  3IK9 A;  4TVE A;  4V1A p;  4PGT A;  2I3Y A;  3TJJ A;  4TR3 A;  3GV1 A;  3RDW A;  4HJM A;  5EL8 A;  1A23 A;  1ERT A;  4F03 A;  1TK5 B;  2F3M A;  1CQH A;  4L5L A;  1U3I A;  3US3 A;  3DRN A;  4P3Y B;  3Q19 A;  3P2A A;  4POK A;  2DJJ A;  1GUL A;  7GSS A;  4TR1 B;  4ZBB A;  4MZC A;  1SKR B;  1OKD A;  1AQX A;  3UL3 A;  4IQ1 A;  1M3I A;  1V40 A;  5A4U A;  4MF7 A;  2CT6 A;  1F3B A;  5CO3 A;  3VLN A;  2LJK A;  3UMA A;  1BG5 A;  1EV9 A;  4KCA A;  3WT2 A;  2L59 A;  1TTZ A;  4ZB9 A;  2HE3 A;  2WCI A;  1PL2 A;  1ST9 A;  2CZ3 A;  4YKF A;  3ISO A;  4Z2R A;  2X4A A;  3GMF A;  5G1L A;  2VCX A;  4J56 E;  1GTA A;  5FWG A;  1J08 A;  2VD1 A;  4WKW A;  5G31 A;  2R3X A;  4X4J A;  5KN2 A;  2B7K A;  2H71 A;  5F07 A;  2WGR A;  4KDX A;  2CVK A;  1U87 A;  4FO5 A;  2DIY A;  2H6Y A;  3HA9 A;  1RW1 A;  1K0O A;  4NXI A;  1IYI A;  4AJ8 A;  1UVZ A;  1JZR A;  2CZ2 A;  1OC3 A;  5HR2 A;  4ACS A;  4KCE A;  4EF0 A;  4HU9 A;  3KTL A;  4XS6 A;  2V6K A;  1Z3E A;  1EGO A;  4MCU A;  2VLV A;  3FMW A;  4ZXG A;  1G6W A;  4HUA A;  2I1U A;  3AY8 A;  1T3B A;  2LST A;  2YWI A;  5CP1 A;  2EC4 A;  2H70 A;  3LWA A;  4EXJ A;  2E7P A;  6GSY A;  5JCW A;  4EC0 A;  3HZ4 A;  1G0T A;  1JZW A;  4TOP A;  1K3O A;  1EEM A;  3GA4 A;  5EVO A;  2P5Q A;  1SL0 B;  2B6M A;  1BAY A;  4WR4 A;  5A4V A;  2GST A;  1E2Y A;  4OFT A;  2JZR A;  3GTU B;  3GRX A;  1XBS A;  2XHF A;  3RPP A;  1T4Y A;  4KUN A;  4BVX B;  1YKC A;  5DQS A;  4MF5 A;  4EVM A;  4I2U A;  2C80 A;  3ERG A;  4YH2 A;  1SKS B;  1GSF A;  5IPH A;  5FHI A;  3DXB A;  3H1N A;  1R26 A;  3P8W A;  2B7J A;  4GTU A;  1AW9 A;  3L9V A;  2QSI A;  3HXS A;  4I6X A;  1TI3 A;  4ZBD A;  2O87 A;  4X0X A;  4MF6 A;  5DJL A;  4I2T A;  5ECR B;  3M9J A;  2LRN A;  3ZZX A;  3CQF A;  4CW9 A;  2NVL A;  2C0G A;  1GNW A;  1SK1 A;  4AF2 A;  4MZB A;  3E3E A;  1S3C A;  3EE2 A;  2H72 A;  1B4P A;  5AGY A;  4O5Q A;  1OE7 A;  4K1F A;  5KN1 A;  5KN0 A;  1B9X C;  3A3T A;  3RPN A;  2YV7 A;  4F82 A;  2L6C A;  5H5Q A;  1GSU A;  2AB6 A;  2H1G A;  1T00 A;  3A5W A;  3ZVJ A;  3HJM A;  1ZYE A;  2YZH A;  3PGT A;  2CX3 A;  5J41 A;  5ECH B;  3TJK A;  1K3Y A;  3IC4 A;  3BBY A;  4GST A;  3PPU A;  1QGV A;  2YPM A;  3HJP A;  11GS A;  2V32 A;  4IP1 A;  4WBJ A;  2HSH A;  3W8S A;  1WRY A;  1H4O A;  2H1B A;  1O8X A;  4K0G A;  1TW9 A;  4MJA A;  4O32 A;  2X99 A;  5GSS A;  2M46 A;  3IAS 2;  4G0K A;  4V2N A;  2DML A;  4EIQ A;  3TOT A;  4I8B A;  1N2A A;  1TK0 B;  2YWN A;  4YQV A;  4PX1 A;  2RUE A;  2IPA A;  4DVC A;  4ICY A;  3PIN A;  2LQO A;  1KEB A;  1V9W A;  3NIV A;  2O7K A;  1MEK A;  3LXZ A;  2YJH A;  1LJR A;  1SKW B;  1J0F A;  4E8E A;  4K7O A;  4KAE A;  1MD3 A;  2HNL A;  1GSE A;  4V1A g;  5GZZ B;  2G0F A;  1A8Y A;  3ZIJ A;  3M9K A;  1B4Q A;  2C3T A;  2KP1 A;  2QKE A;  2DJ0 A;  4WF5 A;  5HR1 A;  17GS A;  3H79 A;  3RAZ A;  3QAV A;  1FAA A;  5IOX A;  3DVX A;  3HZ8 A;  2FNO A;  3EVI A;  3NZN A;  4J57 E;  2QGV A;  3K8N A;  3UBL A;  1ZOF A;  22GS A;  3D6I A;  3HDC A;  4RQX A;  3HD5 A;  3G7J A;  3VWW A;  2YAN A;  4KX4 A;  2KUC A;  1EGR A;  3ZFB A;  3A2V A;  3CXG A;  4F0B A;  3R3E A;  5DVB A;  4D73 B;  1TI1 A;  3CTG A;  5LNK e;  2IFQ B;  1PL1 A;  1FO5 A;  1ERV A;  3CBU A;  5AN1 A;  1OE8 A;  1M9A A;  2EIQ A;  3F3Q A;  3GH6 A;  3UJ1 A;  2HI7 A;  5ECS A;  4L8E A;  5C04 A;  2K18 A;  2AUV A;  2B5E A;  13GS A;  2AJQ B;  1MDK A;  6GSV A;  1MD4 A;  3DD3 A;  4EL1 A;  1V2A A;  2H6X A;  2D2Z A;  4K9Z A;  4MPF A;  5F8B A;  1TRS A;  1ZYN A;  4K5S A;  1V98 A;  1MDI A;  1B9Y C;  1XG8 A;  2AHE A;  4IEL A;  4LLR A;  5HFK A;  4TW5 A;  1O8W A;  2HT9 A;  1ZL9 A;  2DC5 A;  5D73 A;  1URM A;  1UN2 A;  2CV4 A;  5COH A;  2H8L A;  2FWG A;  2R5G A;  5B6N A;  3R2Q A;  3EMX A;  3QPM A;  5DCG A;  3QR6 A;  3ZIT A;  2BMX A;  4OMV A;  5G5E A;  3GSS A;  6GST A;  1K0N A;  3FEU A;  3IAM 2;  5B6M A;  5CAX A;  2C0D A;  1OC9 A;  3UBK A;  4JBB A;  1NW2 A;  2KOK A;  5IMD A;  3EIN A;  5IMV A;  4BA7 A;  1O73 A;  4GSN A;  2LEG A;  2C3N A;  4GXZ A;  2OE1 A;  1I5G A;  1HD2 A;  4Q5R A;  4XRD A;  3CSJ A;  1VF4 A;  1TU7 A;  3KH9 A;  1EWX A;  3FZ9 A;  3DYR A;  4ML6 A;  1YF1 A;  5DCH A;  4NV5 A;  1JFU A;  3APS A;  1YY7 A;  4J2F A;  4IGJ A;  4ISD A;  3ZML A;  1ZCP A;  1NHY A;  1PRX A;  1XWG A;  1M2A A;  1SYR A;  3N9J A;  1H75 A;  5B8B A;  3LFL A;  1TK8 B;  5GAN D;  4CY6 A;  4TKY A;  3GYK A;  3CRT A;  1YEX A;  2VCV A;  2R0P A;  1FOH A;  2H01 A;  2DLX A;  2GZP A;  1XWC A;  2H30 A;  4K2X A;  1X5E A;  3EU3 A;  1TXX A;  2I81 A;  2LJR A;  2RLI A;  4PUA A;  1G7E A;  2DKI A;  2Z9S A;  2K8V A;  2R6K A;  5FT3 A;  1QK8 A;  3F63 A;  1XVW A;  2I9H A;  3APO A;  3LG6 A;  4HOJ A;  2DSA A;  4MLY A;  4RUV A;  4IJI A;  1A2J A;  2GT5 A;  3C73 A;  4OO4 A;  1TP9 A;  5CRD A;  2H0H A;  5IOW A;  1XW6 A;  3KD0 A;  2XBI A;  4TR0 A;  3DKS A;  2GQK A;  5IQY A; 
#chains in the Genus database with same CATH homology
 2DJK A;  2OBI A;  2P31 A;  3KP9 A;  3LOR A;  1PN0 A;  2P5R A;  3M0F A;  2OAD A;  4AJ7 A;  2MMA A;  4ZIJ A;  5D96 A;  5ELA A;  3VI5 A;  1GSY A;  5LCZ A;  5JWQ B;  4XS4 A;  5DAK A;  4XCS A;  4MDC A;  1O7U A;  2H0G A;  4F9Z A;  4ULX A;  1Z5Y E;  2CA8 A;  4LMV A;  3D4T A;  1FVK A;  1O85 A;  1Q4J A;  2YCD A;  2GZY A;  2FHE A;  3CMI A;  3KEB A;  3M8N A;  5JCU A;  3GKK A;  1JLW A;  2GSS A;  2C8U A;  3L9S A;  2YOI A;  4BL7 B;  4X43 A;  5B7C A;  5D93 A;  2KP2 A;  1WWJ A;  3IBH A;  2A4V A;  4NWY A;  3WYW A;  2WUL A;  4JR4 A;  3DEX A;  1UA5 A;  1FOV A;  4ECC A;  5ECQ B;  4EO3 A;  4O5R A;  5ID2 B;  4JZQ A;  4EKZ A;  3G9B A;  2C1Y A;  5JCG A;  2LNT A;  3DIE A;  1M2B A;  4OFM A;  3TKS E;  3UAP A;  4L0W A;  1XIY A;  4K8M A;  1ZMA A;  2YN1 A;  2GTU A;  4G19 A;  3UVH A;  1Z7P A;  4A5P A;  1GP1 A;  4PQ1 A;  1YDK A;  1XOB A;  2NBS A;  2IMF A;  2OJL A;  3FZ5 A;  1SJ6 A;  1TRV A;  2OE3 A;  4YAV A;  5DBQ A;  4TXO A;  1PMT A;  4V2M A;  3IA1 A;  1PX6 A;  1PN9 A;  4BVY A;  1WJK A;  4OCE A;  3N5O A;  3HKR A;  3MNG A;  1TU8 A;  3P90 A;  2BJX A;  2PVQ A;  1VRS D;  2E2G A;  1HNC A;  4CDO A;  1WMJ A;  3LSZ A;  2YJ7 A;  5H5R A;  1DSB A;  1GUH A;  3TKR A;  1EP7 A;  3P7X A;  2A2P A;  3TOU A;  2WZ9 A;  2PBJ A;  1WOU A;  4G0L A;  4BWQ A;  4GLT A;  4POB A;  4Z7X A;  5DAL B;  2V1M A;  4KA0 A;  1S3A A;  3BOA A;  1AUC A;  1I9D A;  1YQ1 A;  1PX7 A;  4TN8 A;  2WS2 A;  2OKA A;  1AQW A;  1M2D A;  3CRU A;  2XBQ A;  5IPG A;  4POM A;  3GST A;  2MMN A;  2L5L A;  1BJX A;  2HRK A;  5DQY A;  4ZB8 A;  1K3L A;  1HNB A;  1YKA A;  3IOS A;  2JU5 A;  2JAD A;  2L57 A;  2GQM A;  4WF4 A;  4NMU A;  2HZF A;  1XW5 A;  2ON7 A;  3DWV A;  1KNG A;  4WXT A;  1ZZY A;  3C7M A;  1THO A;  1BYE A;  2AV4 A;  2LQQ A;  1QMV A;  3NOF A;  1Y25 A;  3H8Q A;  4MJB A;  5GAP D;  4PTS A;  3D22 A;  2JL4 A;  2GSQ A;  4LMW A;  2LNS A;  3DVW A;  1B48 A;  2A2R A;  6GSW A;  3IDV A;  1TRU A;  1O81 A;  2JSY A;  2H19 A;  1A2M A;  3F3R A;  1T1V A;  3IHG A;  3KH7 A;  4DSQ A;  4FYU A;  4GQF A;  1XWB A;  2FA4 A;  4EDZ A;  2HZE A;  4KGI A;  4KH7 A;  3ME7 A;  3QFB C;  3WT1 A;  3QFA C;  5CYY A;  1BED A;  4H86 A;  5BRT A;  2F8F A;  3HJO A;  4PQH A;  1K0A A;  2A4H A;  1FB0 A;  4I97 A;  4MNN A;  4ML1 A;  1R7H A;  3SBC A;  4HEA 2;  5ECL B;  2MBT A;  5G30 A;  2X8G A;  1RK4 A;  1Y6E A;  4TR4 A;  3GX8 A;  1A0F A;  4PNG A;  5IIZ A;  4F2I A;  2LRT A;  3U5R E;  2VCW A;  4USS A;  1Q98 A;  2R2J A;  4EDY A;  4MA9 A;  3GUR A;  1TOF A;  4DSS A;  4V2L A;  1GTI A;  3ZLP A;  4POL A;  4WEY A;  2VCZ A;  3O76 A;  2ZUP A;  1K0M A;  4I5Q A;  4L0U A;  2X64 A;  3FKF A;  2L4Q A;  2MMO A;  4IW9 A;  4ZIL A;  4AJ6 A;  1EZK A;  1RQM A;  1Z7R A;  2VLT A;  3WGD A;  4MK3 A;  3EU4 A;  3HY2 A;  4KSO A;  4MJE A;  3FZ4 A;  3GL3 A;  3Q18 A;  2IJY A;  3ZMK A;  4N0V A;  3EC3 A;  3DML A;  5H5S A;  3EMP A;  1X9W B;  3HVS A;  2IN3 A;  2LUS A;  2X8H A;  2H0I A;  3GL5 A;  2YP6 A;  4IN0 A;  1TJD A;  2E0Q A;  1FB6 A;  1XWA A;  5J4U A;  4KDU A;  1J9B A;  3C8E A;  1X0R A;  4Z2U A;  2WFC A;  4MAB A;  4PXO A;  3DGQ A;  3FR3 A;  5IO2 A;  3O6T A;  2HFD A;  1FG4 A;  3ZRD A;  1GRX A;  4GRF A;  2YWO A;  1QXH A;  3TJG A;  1KBN A;  3APQ A;  4GSS A;  4G10 A;  2ES7 A;  5E59 A;  1X9S B;  3UIW A;  3LGC A;  3EWL A;  1GWC A;  2M72 A;  3KM6 A;  1PKZ A;  2VCT A;  1GTU A;  4IJ3 A;  1G6Y A;  3PH9 A;  6GSS A;  2LS5 A;  3GHA A;  3HVX A;  4HJ2 A;  2VLU A;  4NPB A;  1QQ2 A;  1HQO A;  1SYX A;  5J3R A;  5CRG A;  3TKS A;  3QOU A;  4BWS A;  1Z9H A;  3VWV A;  3MAK A;  3KZQ A;  5HQP A;  5ENU A;  4HZ4 A;  1ACV A;  3ZL5 A;  1GSD A;  1EOH A;  1U3A A;  5GST A;  5E4W A;  3GIX A;  2CVB A;  1X5D A;  3ZVJ D;  2VUP A;  3TRX A;  3GKN A;  5AIS A;  4LL1 B;  2PPT A;  3TRQ A;  1R5A A;  1SK2 A;  1GL8 A;  1ZGN A;  3KJY A;  3C1R A;  1JLV A;  3D4M A;  2FWF A;  1U88 A;  3J7Y b;  2E2M A;  1SD8 A;  4HDE A;  1OC8 A;  2N5B A;  2CAI A;  4TR1 A;  1XCC A;  3LYK A;  4NV2 A;  3RHC A;  4G0I A;  4NAX A;  3HVV A;  4AGS A;  2FY6 A;  2DJ1 A;  2JZT A;  1XW9 A;  1SJI A;  1PA3 A;  3TKQ A;  1T7P B;  2YWM A;  2J23 A;  2KLX A;  3F6F A;  4YQM A;  2IME A;  4XRA A;  2X49 A;  5CRE A;  3L4N A;  4K7N A;  4ZBA A;  1F37 A;  1M0U A;  5HFG A;  4PUF C;  3BCK A;  5ELG A;  3TJF A;  4IKH A;  1BX9 A;  2HXK A;  4HI7 A;  5B8A A;  1F2E A;  5D9T A;  1SEN A;  5L71 A;  2C0F A;  3UEM A;  1BQ7 A;  1JZD A;  1XWK A;  4KB3 A;  2JSZ A;  4ECJ A;  4ZL9 A;  8GSS A;  2VL3 A;  3LYP A;  3F6D A;  5DDL A;  4FIW A;  6GSU A;  1X9M B;  3CTF A;  3TJB A;  2V41 A;  3CSI A;  1GLQ A;  3IC8 A;  4FYC A;  3QDN A;  4G2E A;  2HSM A;  3HCZ A;  2VM1 A;  4MP4 A;  2G2Q A;  5D9W A;  2LV3 A;  1LU4 A;  3C71 A;  4N30 A;  2NPB A;  4N10 A;  2MZC A;  3WGE A;  1IYH A;  2B1L A;  4X1U A;  1USB A;  2C4J A;  2R4V A;  3GFK A;  4Z2T A;  2JZS A;  1M99 A;  2ZNM A;  3D5J A;  5ECO B;  2UZ8 A;  5HFI A;  5IMF A;  3LEF A;  1OAZ A;  3UAR A;  2V2G A;  3GTU A;  1PQN A;  2M80 A;  1EEJ A;  2NDO A;  4FQU A;  3TKS C;  5J5N A;  3TCO A;  3IXR A;  4BVX A;  2YNX A;  1ZYP A;  3ED3 A;  3ZTL A;  4HQS A;  3I9V 2;  1R5P A;  3LXT A;  3G7I A;  2IWT A;  3MDK A;  2YZU A;  5ABR A;  2L6D A;  5KEJ A;  2FWE A;  2VAF A;  4QL7 A;  3D21 A;  1OC9 B;  3MYD A;  2PER A;  3EYT A;  4BPY A;  3CSH A;  5J9B A;  3WGX A;  3TRP A;  2XC2 A;  3CYN A;  3IRA A;  3KMO A;  3L9U A;  1S3D A;  4IBP A;  3U6V A;  2VM2 A;  2TRX A;  3ZIV A;  2CAQ A;  2H6Z A;  2HLS A;  4K5R A;  4OD7 A;  5IMA A;  3GN3 A;  4KF9 A;  3BJ5 A;  4MMM A;  1X5C A;  2OA7 A;  4K6X A;  3LW9 A;  2FWH A;  2RM5 A;  1MTC A;  2H1D A;  5AIX A;  1XVQ A;  1JZO A;  4MH3 A;  4O5U A;  4OO5 A;  4TRX A;  3IR4 A;  3KCM A;  2YV9 A;  1K0C A;  2VL2 C;  2PMT A;  3A5I A;  2OBK A;  4CHS A;  4YAP A;  2HYX A;  2OAC A;  3GKM A;  1LBK A;  4FYB A;  1JHB A;  4EE0 A;  4OFN A;  5D9X A;  4LL4 B;  2GZZ A;  2R0C A;  2QC7 A;  1EV4 A;  1WE0 A;  2B1K A;  1K0D A;  3FY7 A;  4N11 A;  12GS A;  4XTS A;  2K6V A;  1A2L A;  1XZO A;  4O7H A;  5HR3 A;  2VOC A;  3M1G A;  3ZFL A;  4JED A;  4DEJ A;  5INY A;  1A0R P;  2WJU A;  4MZW A;  4XIH A;  2MMZ A;  4HQZ A;  1SD9 A;  1U6T A;  4EIP A;  3S9F A;  3F4S A;  4Q5Q A;  1EP8 A;  1GSQ A;  1K0B A;  2EIR A;  16GS A;  2AAW A;  1ERU A;  3A2X A;  2CQ9 A;  14GS A;  5EPF A;  1E6B A;  3KMN A;  4YQU A;  1DE1 A;  4NHZ A;  4XS4 B;  4LA1 A;  5DAK B;  1W89 A;  2H74 A;  4O92 A;  3TGZ A;  4ECI A;  1NHO A;  2GSR A;  5ECM B;  3IE3 A;  4Q5N A;  1F3A A;  4OWY A;  2DKH A;  4QQ7 A;  3C1S A;  2A2S A;  1VF1 A;  1ILO A;  2FCH A;  3BCI A;  1M7T A;  2BTO T;  2AYT A;  3O3T A;  1OKT A;  3PR8 A;  1GLP A;  2XPD A;  1CQG A;  3QAG A;  1AC1 A;  1XOA A;  2LKU A;  4KSM A;  1YF0 A;  2F9S A;  5C00 A;  3QMX A;  10GS A;  1YJ6 A;  3F9U A;  3JCM L;  4EUY A;  4IS0 A;  4HS1 A;  1GUM A;  1M9B A;  3OR5 A;  3KTB A;  3I6A A;  2FA8 A;  3IHQ A;  4K0N A;  2F8A A;  3Q74 A;  1AQV A;  2B5X A;  3V1W A;  1GNE A;  4TXV A;  3E9J B;  2PN8 A;  3HHV A;  2FGX A;  2NTO A;  4RI6 A;  2HSY A;  4KE3 A;  4D73 A;  2IFQ A;  2V6O A;  3ERW A;  3LJR A;  4GQC A;  2GLR A;  2IMK A;  5LD0 A;  5IMZ A;  3H4K A;  5ECP B;  5CNW A;  4ILF A;  4OCF A;  3UOM A;  2PU9 C;  3MIX A;  4JE1 A;  2IIY A;  1VF3 A;  1NSW A;  2WRT A;  3QCP A;  4JU5 A;  1A8L A;  2GT6 A;  2TIR A;  5KOW A;  1OYJ A;  3RHB A;  2KHP A;  3UVT A;  3W6G A;  5JWO B;  3VPT A;  4TXO B;  1A24 A;  2EIO A;  4BVY B;  1AAZ A;  4KND A;  3A2W A;  5KOX A;  2RUF A;  4IVF A;  3FRC A;  5ECI B;  2ON5 A;  1ON4 A;  5F0G A;  1UC7 A;  2PUK C;  1SL1 B;  3IPZ A;  3I69 A;  5IO0 A;  4GWR A;  2MYG A;  3GNJ A;  5ECK B;  1GH2 A;  5AIV A;  1HYU A;  2RII A;  3F4R A;  2DMM A;  4PQI A;  5BMU A;  1SK0 A;  2N5A A;  4FH8 A;  2FLS A;  4ZL7 A;  3F0I A;  1AIU A;  5ECN B;  4L5O A;  2O8V B;  2WB9 A;  5D8I A;  1O6J A;  5G5F A;  5A5K A;  5JWR B;  1SL2 B;  4KDY A;  3G7Y A;  2LTK A;  3W8J A;  1N8J A;  2VCQ A;  3FHK A;  1GSS A;  3VWU A;  5F06 A;  4HZ2 A;  3TKP A;  2DIZ A;  3VI7 A;  5HR0 A;  1PKW A;  2LRC A;  3FR9 A;  2REM A;  2LJA A;  1WP0 A;  5G2Z A;  1KTE A;  2VD0 A;  4K7I A;  4E8H A;  3J7Y k;  3FK8 A;  18GS A;  3F8U A;  1TKD B;  5J9C A;  4N0Z A;  2R37 A;  2OE0 A;  2PVO C;  5CRH A;  1F9M A;  3GKX A;  1QUW A;  2QA1 A;  3WD6 A;  4MH2 A;  1THX A;  1PD2 1;  1QFN A;  2I4A A;  5KN3 A;  1FW1 A;  5EY6 A;  1SU9 A;  3VWX A;  1G7O A;  3MSZ A;  3TDG A;  1GUK A;  2B5Y A;  1EOG A;  3D0Z A;  3SWL A;  3FYG A;  4CY8 A;  2N5F A;  2GVP A;  3ME8 A;  1MDJ A;  5G1K A;  1ERW A;  3LQ7 A;  4XHM A;  1GTB A;  4WR5 A;  2WDU A;  3RBT A;  3IK7 A;  2H75 A;  4DSR A;  4WET A;  4WBR D;  2QA2 A;  3F4T A;  2DBC A;  9GSS A;  1WIK A;  1T4Z A;  1Z6M A;  3TUE A;  4YKG A;  1AXD A;  2HZE B;  4RQR A;  3ZYW A;  2VIM A;  3L78 A;  4JR6 A;  2MBS A;  2XPE A;  4RI7 A;  4F0C A;  4ZB6 A;  2K9F A;  4IP6 A;  2TRC P;  2B3S A;  3GUS A;  2ALB A;  2GGT A;  3EPT A;  1ZYQ B;  1SJZ A;  3L0H A;  1PGT A;  2IL3 A;  1YZX A;  1YEP A;  3KIJ A;  1HNA A;  1XPV A;  3MWH A;  3TB2 A;  3BD2 A;  4Q5F A;  1TDI A;  2L5O A;  3VK9 A;  2PWJ A;  4BL7 A;  2VL2 A;  6GSX A;  4ECB A;  2C0E A;  5CRW A;  4DSS B;  1FHE A;  2F51 A;  2ZCT A;  4ZL8 A;  2L4C A;  4IQA A;  2DJ2 A;  2H73 A;  1C72 A;  3VUR A;  1B8X A;  1T8E B;  4IHU A;  5F05 A;  4NHW A;  1W4V A;  5ID2 A;  2VL9 A;  2X8C A;  1DUG A;  2H1A A;  4G9H A;  4K2D A;  2FUG 2;  5IM9 A;  1XXU A;  2HRA A;  3KXO A;  1V57 A;  4QL9 A;  2HRF A;  2P0G A;  1Z6N A;  2RM6 A;  4MJC A;  3Q6O A;  2JAC A;  2CVD A;  1PSQ A;  2R0G A;  2PGT A;  1VGL A;  3QD9 A;  1OVN A;  3GX0 A;  2HRN A;  1VF2 A;  1DBY A;  2H66 A;  2J9H A;  2C3Q A;  3VFI A;  2IMI A;  3HYP A;  3M3M A;  3VPQ A;  3H93 A;  2GQL A;  1V58 A;  2O85 A;  3FW2 A;  3QAW A;  5IMC A;  5DJM A;  3IV4 A;  1WPI A;  4GF0 A;  3KP8 A;  2VO4 A;  2DJ3 A;  1XFL A;  1F6M C;  3E0U A;  4PNF A;  3I43 A;  4ID0 A;  4KW6 A;  2CX4 A;  1NM3 A;  2K8S A;  3ERF A;  3ZRE A;  4MPG A;  3GH9 A;  1ML6 A;  2IMD A;  3EUR A;  2GDR A;  2O89 A;  3FR6 A;  5DAL A;  1ABA A;  4GCI A;  2GS3 A;  2FD3 A;  1TRW A;  1FVJ A;  3KGK A;  3FZA A;  20GS A;  5D9V A;  4XS1 A;  4PUR A;  2H76 A;  19GS A;  1R4W A;  4JRR A;  4HU7 A;  5A4W A;  1DE2 A;  3IK9 A;  4TVE A;  4V1A p;  4PGT A;  2I3Y A;  3TJJ A;  4TR3 A;  3GV1 A;  3RDW A;  4HJM A;  5EL8 A;  1A23 A;  1ERT A;  4F03 A;  1TK5 B;  2F3M A;  1CQH A;  4L5L A;  1U3I A;  3US3 A;  3DRN A;  4P3Y B;  3Q19 A;  3P2A A;  4POK A;  2DJJ A;  1GUL A;  7GSS A;  4TR1 B;  4ZBB A;  4MZC A;  1SKR B;  1OKD A;  1AQX A;  3UL3 A;  4IQ1 A;  1V40 A;  5A4U A;  4MF7 A;  2CT6 A;  1F3B A;  5CO3 A;  3VLN A;  2LJK A;  3UMA A;  1BG5 A;  1EV9 A;  4KCA A;  3WT2 A;  2L59 A;  1TTZ A;  4ZB9 A;  2HE3 A;  2WCI A;  1PL2 A;  1ST9 A;  2CZ3 A;  4YKF A;  3ISO A;  4Z2R A;  2X4A A;  3GMF A;  5G1L A;  2VCX A;  4J56 E;  1GTA A;  5FWG A;  1J08 A;  2VD1 A;  4WKW A;  5G31 A;  2R3X A;  4X4J A;  5KN2 A;  2B7K A;  2H71 A;  5F07 A;  2WGR A;  4KDX A;  2CVK A;  1U87 A;  4FO5 A;  2DIY A;  2H6Y A;  3HA9 A;  1RW1 A;  1K0O A;  4NXI A;  1IYI A;  4AJ8 A;  1UVZ A;  1JZR A;  2CZ2 A;  1OC3 A;  5HR2 A;  4ACS A;  4KCE A;  4EF0 A;  4HU9 A;  3KTL A;  4XS6 A;  2V6K A;  1Z3E A;  1EGO A;  4MCU A;  2VLV A;  3FMW A;  4ZXG A;  1G6W A;  4HUA A;  2I1U A;  3AY8 A;  1T3B A;  2LST A;  2YWI A;  5CP1 A;  2EC4 A;  2H70 A;  3LWA A;  4EXJ A;  2E7P A;  6GSY A;  5JCW A;  4EC0 A;  3HZ4 A;  1G0T A;  1JZW A;  4TOP A;  1K3O A;  1EEM A;  3GA4 A;  5EVO A;  2P5Q A;  1SL0 B;  2B6M A;  1BAY A;  4WR4 A;  5A4V A;  2GST A;  1E2Y A;  4OFT A;  2JZR A;  3GTU B;  3GRX A;  1XBS A;  2XHF A;  3RPP A;  1T4Y A;  4KUN A;  4BVX B;  1YKC A;  5DQS A;  4MF5 A;  4EVM A;  4I2U A;  2C80 A;  3ERG A;  4YH2 A;  1SKS B;  1GSF A;  5IPH A;  5FHI A;  3DXB A;  3H1N A;  1R26 A;  3P8W A;  2B7J A;  4GTU A;  1AW9 A;  3L9V A;  2QSI A;  3HXS A;  4I6X A;  1TI3 A;  4ZBD A;  2O87 A;  4X0X A;  4MF6 A;  5DJL A;  4I2T A;  5ECR B;  3M9J A;  2LRN A;  3ZZX A;  4CW9 A;  2NVL A;  2C0G A;  1GNW A;  1SK1 A;  4AF2 A;  4MZB A;  3E3E A;  1S3C A;  3EE2 A;  2H72 A;  1B4P A;  5AGY A;  4O5Q A;  1OE7 A;  4K1F A;  5KN1 A;  5KN0 A;  1B9X C;  3A3T A;  3RPN A;  2YV7 A;  4F82 A;  2L6C A;  5H5Q A;  1GSU A;  2AB6 A;  2H1G A;  1T00 A;  3A5W A;  3ZVJ A;  3HJM A;  1ZYE A;  2YZH A;  3PGT A;  2CX3 A;  5J41 A;  5ECH B;  3TJK A;  1K3Y A;  3IC4 A;  3BBY A;  4GST A;  3PPU A;  1QGV A;  2YPM A;  3HJP A;  11GS A;  2V32 A;  4IP1 A;  4WBJ A;  2HSH A;  3W8S A;  1WRY A;  1H4O A;  2H1B A;  1O8X A;  4K0G A;  1TW9 A;  4MJA A;  4O32 A;  2X99 A;  5GSS A;  2M46 A;  3IAS 2;  4G0K A;  4V2N A;  2DML A;  4EIQ A;  3TOT A;  4I8B A;  1N2A A;  1TK0 B;  2YWN A;  4YQV A;  4PX1 A;  2RUE A;  2IPA A;  4DVC A;  4ICY A;  3PIN A;  2LQO A;  1KEB A;  1V9W A;  3NIV A;  2O7K A;  1MEK A;  3LXZ A;  2YJH A;  1LJR A;  1SKW B;  1J0F A;  4E8E A;  4K7O A;  4KAE A;  1MD3 A;  2HNL A;  1GSE A;  4V1A g;  5GZZ B;  2G0F A;  1A8Y A;  3ZIJ A;  3M9K A;  1B4Q A;  2C3T A;  2KP1 A;  2QKE A;  2DJ0 A;  4WF5 A;  5HR1 A;  17GS A;  3H79 A;  3RAZ A;  3QAV A;  1FAA A;  5IOX A;  3DVX A;  3HZ8 A;  2FNO A;  3EVI A;  3NZN A;  4J57 E;  2QGV A;  3K8N A;  3UBL A;  1ZOF A;  22GS A;  3D6I A;  3HDC A;  4RQX A;  3HD5 A;  3G7J A;  3VWW A;  2YAN A;  4KX4 A;  2KUC A;  1EGR A;  3ZFB A;  3A2V A;  3CXG A;  4F0B A;  3R3E A;  5DVB A;  4D73 B;  1TI1 A;  3CTG A;  5LNK e;  2IFQ B;  1PL1 A;  1FO5 A;  1ERV A;  3CBU A;  5AN1 A;  1OE8 A;  1M9A A;  2EIQ A;  3F3Q A;  3GH6 A;  3UJ1 A;  2HI7 A;  5ECS A;  4L8E A;  5C04 A;  2K18 A;  2AUV A;  2B5E A;  13GS A;  2AJQ B;  1MDK A;  6GSV A;  1MD4 A;  3DD3 A;  4EL1 A;  1V2A A;  2H6X A;  2D2Z A;  4K9Z A;  4MPF A;  5F8B A;  1TRS A;  1ZYN A;  4K5S A;  1V98 A;  1MDI A;  1B9Y C;  2AHE A;  4IEL A;  4LLR A;  5HFK A;  4TW5 A;  1O8W A;  2HT9 A;  1ZL9 A;  2DC5 A;  5D73 A;  1URM A;  1UN2 A;  2CV4 A;  5COH A;  2H8L A;  2FWG A;  2R5G A;  5B6N A;  3R2Q A;  3EMX A;  3QPM A;  5DCG A;  3QR6 A;  3ZIT A;  2BMX A;  4OMV A;  5G5E A;  3GSS A;  6GST A;  1K0N A;  3FEU A;  3IAM 2;  5B6M A;  5CAX A;  2C0D A;  1OC9 A;  3UBK A;  4JBB A;  1NW2 A;  2KOK A;  5IMD A;  3EIN A;  5IMV A;  4BA7 A;  1O73 A;  4GSN A;  2LEG A;  2C3N A;  4GXZ A;  2OE1 A;  1I5G A;  1HD2 A;  4Q5R A;  4XRD A;  3CSJ A;  1VF4 A;  1TU7 A;  3KH9 A;  1EWX A;  3FZ9 A;  3DYR A;  4ML6 A;  1YF1 A;  5DCH A;  4NV5 A;  1JFU A;  3APS A;  1YY7 A;  4J2F A;  4IGJ A;  4ISD A;  3ZML A;  1ZCP A;  1NHY A;  1PRX A;  1XWG A;  1M2A A;  1SYR A;  3N9J A;  1H75 A;  5B8B A;  3LFL A;  1TK8 B;  5GAN D;  4CY6 A;  4TKY A;  3GYK A;  3CRT A;  1YEX A;  2VCV A;  2R0P A;  1FOH A;  2H01 A;  2DLX A;  2GZP A;  1XWC A;  2H30 A;  4K2X A;  1X5E A;  3EU3 A;  1TXX A;  2I81 A;  2LJR A;  2RLI A;  4PUA A;  1G7E A;  2DKI A;  2Z9S A;  2K8V A;  2R6K A;  5FT3 A;  1QK8 A;  3F63 A;  1XVW A;  2I9H A;  3APO A;  3LG6 A;  4HOJ A;  2DSA A;  4MLY A;  4RUV A;  4IJI A;  1A2J A;  2GT5 A;  3C73 A;  4OO4 A;  1TP9 A;  5CRD A;  2H0H A;  5IOW A;  1XW6 A;  3KD0 A;  2XBI A;  4TR0 A;  3DKS A;  2GQK A;  5IQY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...