4I2XA

Crystal structure of signal regulatory protein gamma (sirp-gamma) in complex with fabox117
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
214
structure length
214
Chain Sequence
DIVITQSPKFMSTSVGDRVSITCKASQDVSTAVAWFQQKPGQSPKLLIYSASYRYTGVPDRFTGSGSGTDFTFTISSVQAEDLAVYYCQQHYSTPWTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of signal regulatory protein gamma (SIRP gamma) in complex with an antibody Fab fragment.
pubmed doi rcsb
molecule tags Immune system
molecule keywords FabOX117 light chain
total genus 47
structure length 214
sequence length 214
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-11-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4i2xA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4i2xA01
4M5ZL 4KRMB 4ALAH 1HCVA 4JFZH 4X7DC 4YDKH 3P9MA 4E42A 4OZ4B 4PD4J 3AS3A 4KUCD 3MR9A 3SKMA 2IADB 5EC1B 4HXAH 2DBJA 1P2CA 3IB4A 2G2RA 1QO3A 3WN5B 3OR7A 4PP1C 4JG1H 2NQCA 3T3ME 1R5VB 1A6VL 2FX7H 4RBPH 1BQLH 3BP7A 3LZFH 3FO0L 1E28B 3IDGB 5D7SL 3V5KB 3STZA 1FJ1A 1DBMH 1I1FA 1ZANL 2X09A 5MENA 1W72B 3SE9L 1T1WA 4XPBH 3Q2CA 5HY9A 2BNRD 4ZD3L 4QXWA 3UAJD 2FGWL 4FQHA 5KTEH 1CLYL 5T3XL 2DM4A 3S5LA 1U8PA 4GS7C 1FFPB 2YEZB 4CVXB 5C9JB 3HG1D 5I19L 3ELAT 1WJ3A 3V5HB 1LD9B 1BLNA 2CKNA 2FB4H 4HUUA 5EZIL 4DGIH 1G7QB 2KUTA 4NQVB 3CPLB 3CXHJ 3ARBC 5TF1H 1OAKH 2MFNA 3G5ZB 3O8XD 1GJIA 4G8GB 3NABH 4P9MH 1KPRA 5IT2L 4KKBC 3S5LG 4PTUA 1I4FB 5GHWH 4OCWL 2YUVA 2GY5A 2VLRE 1YMMA 4MDIB 3D0VA 2FLBT 1FDLL 2B1HL 1AGBB 2A6DB 3D9AL 5SWQA 3IDYC 2KH2B 2CK0L 3FOLB 1WT5A 1NAMH 4HS8L 5FA4A 5E1HB 1CDUA 4WEUD 1NANI 4FP8L 4RA3A 3HI1B 4NDMA 3GSWB 5L88H 3QDJB 4FA8A 2YD8A 3LKOA 3SKJH 2X89A 4M7ZB 5GGSA 4NM4H 3ZTNH 2YWZA 2CMRL 5LQBL 3QCTH 2JELL 4ZTPH 5IMOA 3SO5A 4QT5A 1HILB 1XF3B 3PJSB 3RVVD 4LMQE 4OD2A 4H1LB 1D5ZB 5CMAA 4Y1AD 1NBQA 2ZG1A 1OD9A 3MRDB 4YHIB 3EZ8A 2E3VA 4RMWA 4OM1L 1D5ZA 4KJPD 1YMHB 3IS0X 3MOBH 5KTEL 2BNUB 1A7NL 3QB7C 2IPUG 3NIDF 3DOSA 3IRPX 3FKUS 3P0VL 4K7PH 4ODHH 2APTA 5SV4A 2GEEA 1HEZB 1KF9B 5CILL 2FR4B 1QSEB 3U9PH 2NY7L 1G9EA 5LXGH 3JUZA 3BIBX 1T5XB 3O9WB 4OI9A 1W8OA 2GT9B 3HC0B 4R4BA 3FO9B 3F58L 2FH6A 2VZ3A 4K7PL 4ODHL 1A6WL 3WXWH 2FO4B 4NFCA 4PR5A 5K9QG 1SEQL 3KYKH 1CDGA 3E6FB 3QWRA 3HMWL 5K9QI 3KPRE 5DR5H 4EDXB 1VEMA 2EH8H 2P5WE 3DX9B 2D03L 4PG9A 1J1PL 3QQ9C 2Z8WC 1OY3B 3S4SB 4Z6AT 2PYEB 3W9DA 4KJWC 1MJ7L 5FYLD 1ZGLB 5CJOL 3QFJA 1YN7B 4HWBL 3GZKA 4E5XB 4PJ7F 1ZSDA 3IDNA 3AAZB 3RWHA 5DO2C 4G7YH 1YNTB 1BZ9B 1VADB 3BP6B 1DBJH 3KJ6H 1IEBB 3FFCB 4JQIH 1XF3A 2AK4D 3PJSA 1T7VA 3S5LB 3HUJF 5D7JA 2F9BT 4UUJA 2LVCA 1G0DA 2IQ9L 1AFVH 5IVZA 3D48R 6FABL 4LSRH 4KKCC 2VJXA 1OHQA 2DLTA 1LD9A 5E2TH 1U3HB 5D7IB 1VGKA 1OTTD 5C07B 2J7LA 3HMXL 3QAZC 1HILA 4PREB 3RWDB 1XZ0A 1TJHH 3GNMH 4LVHC 2QQNH 1ZT1B 2BVQA 1X5ZA 4XC1H 3KLDA 3T0XA 2Z31B 2R23A 2OR9H 1IM9D 3G5VA 2QADD 2E27H 1LNUA 2UVEA 3CZFB 2X9XA 2E6QA 4I18A 3QWRD 4MZ2A 4I48B 3PV6B 2BMKB 1YA5A 4XNMA 5B39B 1AD9A 2MSPA 1W8NA 4JPIB 4OF5A 4WWID 2NYYC 2DN7A 2A77H 3QJHA 3UBXG 4KJYB 4XPFL 1ZLSH 5B38A 5C0CA 4PRHA 1BMGA 2V7HA 3NCJH 2XQYK 2CLRB 4MA8H 3GMRA 4WNQB 1ZT7B 1JYXA 4M7LH 3VFMA 1IAKA 3TA3C 1YEDA 4XMLL 4OM0H 1A4JA 1VEOA 3HE6C 3JWOL 4DWHA 2ED8A 3U9UB 5HHMB 5T3XD 3RPKA 1XCQB 1RJYB 3EFFA 4NZUL 3RIFK 4ONOA 4KHTH 3LOWA 1DBJL 4DEPB 2UUDK 3D39B 5I9QC 3PGCB 1PSKH 4OM0L 4HFWA 4NQUA 4O51B 1NKRA 4U33A 1TMCB 4G42A 4WHTA 3O4LE 3EO0B 1UKTA 1U8HB 4MQ7B 2VISA 2XFXB 5IFHL 3VWKD 4UINH 3ZE2E 4GKOA 4K3EL 4R96B 4CU6A 5HGGS 1J8KA 2BY3A 3CZJA 3DMMA 1MVUA 2RFXA 3M07A 4LVNB 2FL5A 5F7EL 4YHYC 4LRIA 2OR9L 5IB5B 1DQTA 3EUUA 5IHUL 4MJ4A 4PV9A 1GXEA 2G2RB 2OYPA 4FXGB 1FHGA 2EDJA 3LQAC 4HXBL 3NFNA 2L7UA 4FQXC 1TPXB 4BYHA 3LKPB 2B5IB 4HKXB 5FFLA 5I1KH 2A74B 2IPKA 5GS2H 5IG7B 2D7OA 3MRKB 2JIXD 5IVNA 1RUKL 3PIQA 4GKZA 5T3ZD 4UIMB 5JXEC 3ULVE 2VR9A 3RWIB 5L6YL 5JIPA 4F58H 4MD0A 4YGVB 5CD3A 4X0KB 5H2BA 4MQTB 1AC0A 5BZWB 5ADPL 1GZPA 4WFEE 4EBQL 4JY6B 4LEOA 4P2QD 1A5FH 1KJVB 4LFHG 5DD3H 3G6DL 3C9NA 3BP5B 3AMLA 1FPTL 2E7BA 3A0OA 4MX7A 1X5HA 2ZSWA 3WL9B 2EDNA 4KHTL 4OCSH 5DMIL 1OF2B 1F4XH 1ZHKB 3O2DH 5KSVA 3GMRB 4WNQA 1U3HA 2F15A 2G60L 2VSCA 5C8JA 3LMJH 2H8PA 4ZDHA 4DW2L 1MF2L 1KELH 3CFCL 4U6VH 5DGRA 1AJ7L 3MYJA 2DWEB 5B8CB 1S5HA 5EU7E 1G7JB 5CJBA 4PUBH 1TZGL 1FL6B 3UC0L 3MRMB 4ZS7H 1YJDC 4P2CG 1Q9OA 3FB5A 2YPLE 2PXYA 4K3EH 4RIRA 1H5BA 4BFBD 4NQDE 4ODSH 4OGXL 4OQTH 1ULVA 2D7MA 2AQ1A 2BJML 3PGFL 3PV6A 2EIBA 1JPTL 2FX9H 2XG5A 2DBLL 2VWEC 1Z9LA 1JGEB 1Y6MR 1OGAB 2NY3D 5I15L 1C5DA 3EJYC 3ULUE 4ALAL 1B88A 4H88L 4NC1C 3U83A 4XWGH 4ORZC 1N6QH 3ALWA 1OLLA 3MV7E 5DJ0B 3S36L 5KVGL 4V2BA 1L7IH 2DB8A 1HSAA 5ITBH 3HZMA 3QIWD 1F13A 4KJPC 4ETQA 1XGYH 1WWCA 3MMEA 4GG6E 4Z0XA 1ONQA 2V2XA 3E3QC 4OGAC 3DX8A 4QRSA 3VD4A 4GUPB 1IC5H 4E5XA 1BQLL 3QDGB 3FO2A 1AGDB 1V7ML 5FECA 3QEHB 3CK0L 3O2VL 4UNVA 4P23A 3SJVB 4NQTA 1KOAA 2FYYB 5FGBA 4HSQA 2EXYD 5DDHA 3WIHH 1HHKB 3REVA 4F80A 1FG9C 3RU8L 2VIRA 3GSRA 1AGFB 3OKKB 3QXDA 4NIKB 3BISA 1R5WB 2C5DC 1JUFA 5SWSE 5DUBB 5DGQA 3ARED 2OQJB 4PRHE 4PRPA 3ECBB 3HCVB 4JO1L 5F3HB 1GCFA 4MA3B 3DHMA 3QT2A 1UZ6F 3RZCD 4L8BB 1NUGA 1HXYA 2Z92A 4KU1A 2QSQA 1KULA 4X7SL 4XI5C 5TH2B 5C0RH 4GKSA 5E9DE 4X99A 4UV7L 3Q6FA 1EUTA 2QSTA 4Y5YA 1YNKL 1DSFH 2FHFA 4NJ9H 5EBMB 1J0ZA 1UEYA 4RMQA 4GAYA 4L3EB 3QEGL 4PRDA 3MRMA 5HVHC 1PX4A 4NO2A 2R1XA 2AJUH 2EE3A 5JXEA 4X7SH 4R8WL 5HI4D 3DI3B 1KYOK 3UTPE 1LK3L 3OAZK 4N0UA 1FN4B 5HDQH 3BRGC 4NT6A 1DSFL 3KYMB 4NJ9L 5EBWB 4WTWA 5I1GL 5EU5B 1S7UA 4Y4HB 2F19H 1QBMH 3FT4B 4LGPB 5F21B 1DDHB 2XIDA 4WEBH 4YHNA 1VFAA 3VFPA 5KANG 3SDAC 3KXFB 3MROA 4M61A 2V2XB 5JXED 1JMXA 2WLZA 5GRVL 3ESUF 4GUPA 1RUML 5K33A 4P46A 3O2VH 2AK4E 5CBAA 2XTJB 2GI7A 3VRJA 4UDUB 2QKIA 4FQPA 3AM8A 4U1LB 3DIFA 5D5ME 1FRGL 3GSVB 4CNIB 1QNZL 1RZ7H 3WXVL 1YEHH 3WYRA 2BVPB 5DS8A 5C0CE 4AYFA 4U1IB 3AU1B 3OPZL 1YEKH 3LRSB 1WWAX 4OM1H 1NC4A 2HKHL 3FJTA 1FL3B 5CSZA 3TF7C 3FT3A 4NKDB 1FL6A 2FIKA 3GSOA 1VPOH 2EC9T 1G0XA 1G7HB 5TE4H 2X4PB 4MNGA 1YYLL 3FT2A 3FO0H 4KJYA 3PDGA 3OPZH 3U1SL 2ATPA 5FYKU 4DFIA 4XVTL 4J3SA 5DD5H 4YDVB 5I66A 1URLA 4EUPH 1OSZA 5D71L 4OLZH 2NY5C 3RFZC 4PRIB 4YR6B 1NEUA 4X7FC 4XVUD 1HH6A 3SE9H 2DQGL 4R8WH 5TE6L 3EYQD 5AZEL 2CKBL 4JFQA 5D6DC 1L0XA 4HLZG 1U41A 2MQCA 3MCLL 2M1KA 3GI9H 4XPTL 5ID1A 2V2TB 2ADIA 4YGVA 5KS9B 2PNDA 4WEBL 1FZKA 3FO1B 5KSVB 1RSFA 4PGEA 3IJSA 4PJ8B 1GZPB 3GDBA 1P6FA 2Q6WA 4HF5L 2B0SH 3C9NB 3O6FD 3TFKC 1W72A 4JO2L 3BP7B 1H3XA 3NABL 1NFIB 2VAJA 3SBWA 3MLTB 4XRCB 3ALPA 2ZUWA 4PGBB 3STZB 3B9KC 4RCAA 2OJZH 3RX8A 2YPVH 4C56D 3FQWB 5A3ID 3QUXB 4KDTA 4POYA 4MXWH 3HZKA 4OLXL 1XT5A 4P59L 5I18H 4DKDC 3GIZH 4JFED 4P2QB 3BOVA 3HG1E 1EXUB 3G08B 1FO0B 4Z5RB 2F54B 2CD0A 3H2WA 3ULVL 3CDFA 5GGTA 1UYWL 3IAGC 4XPBL 3DX7B 4RFEB 4ODXA 1RHFA 1YYML 4IRZL 3S37H 3VG0H 4XH2B 1QFWL 4KVNH 4K3GA 4BFIB 4F57L 4AT6A 5MI0B 3MBEA 5E08H 1UC6A 5AD0A 3DUUA 2XACC 3L3IB 3VWJA 1IM3B 3W0WB 5CEYA 3FAWA 5IP4A 2EH7L 2AEPH 4MGXA 3W81A 1OARH 3O11A 4Y4KB 4RAUB 4FXKB 5C0CD 3PG2A 3L3HB 4S2SA 2FCBA 2J5LC 2F74A 2VQTA 5JQ6H 2CKBB 3P0VH 4LCWD 3ZE2F 1E0OB 4L4VB 4OBSA 1ZHLB 4ZPVB 3MO1A 2V2TA 5IW6A 1BBDL 3L5JA 5DD0L 4GMSL 5E5MB 1K8DA 2WIIB 3L3OB 2P8MB 2EXWC 1MCIA 5FM4A 5KVFH 3VXQA 1AHWA 2E7CA 4YWGL 3WO4B 1DEEA 1KCSH 5D7JB 2YA0A 2C1OA 2OJZL 4JQXC 1UQSA 4Q2ZA 4FQLL 4OD2B 2IQAA 3I75B 5E00A 5JPMB 2DYPA 3AMKA 2YS4A 1AQKL 3P4NB 4J8RA 5M7QA 3QCTL 1G9MH 3IDYB 3FOMA 3WEXA 1X6LA 2X4PA 4LHUD 4MNGB 3ZL4L 1TQBB 5JA8B 5ESQB 1CTOA 2F54A 1SYSB 2IFGA 5LGKA 3A67H 2CPCA 4F8TA 2IANE 1MJ8H 1HHGA 4XCYB 4F7PB 2Y4SA 1A14L 2J5LB 4I77L 4JKKA 5F9WB 3PF2A 5ETUB 3SN6N 4P5MB 1PKQE 3CFJA 5IVXB 4BH8A 3FCTB 2GITA 3KR3L 1HIML 3RBSA 2BSRB 1BBJA 5SX4I 3C8KA 4PTUB 5D6DA 4KRPD 4CRPA 1X9QA 4LLWB 3MCG1 5C3TA 3IJSB 3MROB 1B0GB 4DVBB 1RUKH 4WW2A 3UTTB 2RJMA 4XP5H 2PW1A 3REVB 2WLYA 5FM5O 2GAZA 1F90H 2ID5A 4WW2B 1HHJB 1CE1H 4ELKA 1U3JA 4EUPB 2RBLA 1F00I 3FFDB 1HHKA 5I73B 1NEZG 1G6RA 3MLYL 4RMUA 2P43B 1D6EA 4JEGB 5D1QB 1F90L 1A8JH 3O6FC 5CEXA 1DN0A 3QQ4B 2XA8L 5E70A 5GS3A 1AXTH 2HMID 4YE4H 3MRJB 5AYUH 1OOAA 3PQYA 1X5AA 1CFSB 3NCJL 3OG6B 5D1QA 3FT3B 1ZA6B 5ANMA 3IKCA 1U8LA 4TVPH 2B5IC 2KQMA 3FB8A 1CU4L 1UVQA 3T0EA 5F7LB 1P7HL 1P84J 4G6KH 4F15C 4MA7L 3RVXC 2OK0L 3MUZ1 4Q9CA 3QUYC 1MCOH 4J8RB 5B39G 3WCYA 3M8OL 3GM8A 2QEJA 4XNUH 3K46A 4HW6A 4U6YA 5AUMA 3DGGA 4PBWD 2X70A 3T3PF 3U30B 1LDPL 5JTWA 3I50H 1R24A 3LKRA 4GQPH 3MGTB 1JF1A 3O9WD 5DJCA 3SE4C 3CAFA 3QH3A 1T3FA 4XZUA 2Z9TA 4MA7H 2OK0H 1QSED 2UWEA 5I73C 3C60B 2RB8A 3B8SA 2APWA 3THML 1DFBL 5E5MA 2NTFB 1JYVA 3KPSD 3QDJE 1KCRH 3O4LA 2V6HA 3MC0A 1BVZA 3BESR 4LSSH 3WJLC 3BWUC 3VRLF 3ARDC 3VRIB 2CIKB 4WRLA 1CXFA 4X6DA 3AY4C 5HHNB 1MREH 2A77L 1HOCA 1UWXK 5FK9A 5BQ7A 5GGSB 1T20A 4PJ9A 4ODUA 3CD4A 1OCWL 4YHKL 2P46B 2GJZA 2PCPA 4BH7B 1I3GL 1RZ8B 3K8MA 4JRXA 4LSSL 3BQUD 3RRQA 4K2UL 1F4YL 1UACH 1MEXH 5F6IC 2FSEB 2QQQA 1NFDF 1UXSA 5TFSL 5L0QC 4AENA 4NNYA 5TDOA 4GAGL 3MV8D 3CFEA 5D96C 1H8NA 3FHQA 3EFDH 4J3WA 1OP5K 5JHDB 2OSLA 3TN0A 3C87A 5K59F 2V17L 2GFBB 2YZ8A 4K07A 4EQ2A 4GRMA 2A0LC 3RWFA 1CFVL 5MEND 1PQZA 1SMAA 4N0FA 4Z7QF 5F7YC 4NHUB 4EKXA 1I9EA 4PY7A 2XYCA 4KY1H 5E8NB 3RWJB 5IEKB 1HNFA 4M8QB 3J7HA 3P9LB 1N8ZA 2EDYA 4OCSL 4PJGE 4N8VB 1D5IH 4QXTA 4JDTH 2VH5L 5CCKH 1M71A 3B9KD 3VU2A 2AJVH 1BBJB 3NN8A 5ALCL 5IHBA 3RTQC 5DVKA 3MLVL 2FEEL 1J7VR 1KJ2H 3HLAA 4Z0XB 5FYLL 2F8XC 4POUB 3MV9B 3FB7A 1IVLA 4O5LH 2ZUYA 3E6HB 1INQB 2R9HC 5SX5H 3P3YA 5CAYB 3ZYOA 4AH2A 4Y16C 5D93C 3PHOA 3KPPB 1MHCB 3SE3C 5SWZA 4ORGB 2FJGA 1TZHA 1DBBH 1I9RL 2DKMA 3ZDXF 5HI3C 3WSQL 5DQJB 2NXZD 2D31B 4OLYH 1XR9A 3O4LD 5CZVL 4JHBA 2NXYD 3RGVC 4OFYD 1TPXC 3SDXF 5CKAA 5CBEA 2XWTB 3DV6A 4AY0A 4HC1A 2FX7L 4Z5RA 1U92B 1WTGT 3G6DH 3ULUL 3MNZB 4XPGL 4LEXH 1YEFL 5C9KA 1S9WA 3BO8A 5I8OL 5LKNA 1UXSB 1A6UH 1LO4L 5ISZE 1SJXA 1A7PL 5CIPB 1NBZA 4BSWB 3O2DL 4PLJC 3H9SE 4YHPA 5F7DB 1LEKA 5J6HA 4WFHD 5DEZA 4K3JH 5JHDA 1T83C 1CFVH 3MPCA 3F7YB 4NUJB 5T1MA 4RNRB 1BOGB 4DW2H 3OKLA 1FFNB 2W0FA 4TOYH 4BA8A 1IGIH 4L9DA 1QQDB 1IAOA 1DVFC 1H3PH 2X5PA 3SQBA 3KWWA 3IU4H 3CK0H 4RAHA 3FQRA 4RWYL 5FEBA 3I3EA 4YO0A 1QQDA 1QYGH 4IRSD 5D6CB 3O4LB 2FB4L 1ADQL 1BX2A 3UJJH 3DXAA 3MV7B 4POZD 5BJTA 4RGOL 4NHUA 4GRWH 2YWYA 2X40A 5IT2H 2UYLB 1QPPA 5IHZA 4QRRA 5DT1L 4QHMB 3D18A 2Q76A 4O58L 2DI8A 4HIJA 3H3BC 2VDNH 3TEUA 3V6FA 3U46A 3PWUB 3I02A 1EVUA 5TF0A 5JOFB 3QFJE 1DBKL 3KYAA 3SE3A 1OTTC 1AGCB 4JJ5A 2CK0H 3HFMH 2Z8RA 4WW1B 2X4QB 4LLDB 4HIIB 1Q0XH 3UJTL 4HS3B 4DAGL 4PJ7A 4XC3L 2GJZB 4BH7A 3N06B 1JGDA 4ODVL 5IB1B 1UJ3B 3ULUH 4FNLH 1RMFH 1EGJH 5C7XH 5LQBH 1V7MH 2P47B 3VXSB 5I1JL 2YPLD 1OQXA 4YXKL 5MEPB 3ARGD 1RPQA 5J0BA 3BEVB 5BCAA 3TPKA 5EWIL 4MB4A 5EBLB 3BUYA 1EK3A 3R0MA 3CFIC 4G5ZL 3QPXH 1RMFL 4C83A 1GZQB 1LO3H 2K7QA 2EICA 1QFUL 43CAA 2AJXL 5I1AA 3ZKMD 3RL1A 4M8QA 1AKJD 3FRPG 5D7LA 5DQ9A 5KG9B 2A73B 3HE6D 3LN5A 1RIHL 4LCYB 3V8CA 1X5FA 1I7TA 3C60C 4RGOH 4JM2B 1XGRA 4R4ND 1UFUA 4GRLD 4NKQB 1IARB 3U9PL 1XFPA 4LCYA 4NWUL 4U1GC 4XNQA 4P49A 4HAGA 2QR0A 5DJ6A 4JFDE 3QEGH 2F5BL 5LBSH 3Q5YA 5ALBH 35C8H 3DGCR 3S37X 4RGNC 3RWGA 3WIFB 3KPSB 1QUNA 3MBXL 3KYKL 4NP4H 1A6TA 3V4UL 4CDGC 5GS0D 1GOFA 1ONQB 1B4JH 4WI3A 4PTTA 1Q0XL 2VLJD 3UJTH 2BK8A 2F5BH 5LBSL 3DPBA 4Y16D 2FX8L 3T0EB 4D9LL 4ZOCA 4JHZA 1DANU 4OV5B 3WNLA 3MJ7A 5L0QB 2HJKA 3T8XA 4UQ3B 4BSVA 5A2FA 3CH1B 5AZEH 2PYFB 1YPZB 4KV5E 2YRZA 3MUHL 4KHXH 2ADGA 2WWKT 4XAWH 4F37K 3EDDA 4NNPH 1U93A 4JKMA 1FVCB 2KBGA 1SEBA 2O5ZL 4Y4HC 1EEZB 2VWEE 4C4KT 1F58L 1GOGA 1BM3H 3A67L 1C16A 2BSED 1XGUB 3QUYD 2ZCHL 3NFPA 4HZLA 4Z8FL 3MLZL 3GIVA 4UUJB 3QPXL 5HDBE 5IMLB 1KB5L 1FLTX 5E2TL 1QFUH 5FO7B 3N0PB 3UPRA 2ED7A 3O9WC 2RCSL 5E95B 5EU7C 4YFLF 3V6OE 4PB9L 3ULUF 5I8KL 1AR2A 4U2YA 3BQUC 1TJGH 4D8PA 1JHLH 1JPGB 1NCWH 4LLMB 3ME0A 4H25B 3O45B 4N0YL 2J8HA 4OLZL 5CJQL 3UTZB 4OIBA 5I1DB 3OXSA 2HT2C 4OD1H 4P3DA 5E9DA 4POZC 1HZHL 2CUMA 5E4IA 4B7LA 3MACL 4LLVB 3V5KA 3RKDD 4TNWK 2I07B 2MKLC 3V7MA 5FHAH 2VXUH 4ZUVB 1VFBA 4BZ2L 5IEHA 3PE9A 4JO4H 1UJ3A 1MAMH 3G5XB 2IQAB 3I75A 1J8HD 5JORB 2OL3B 1YUHB 2D2OA 2ZUSA 1AQDA 2IBZX 3IJHA 4AEIH 4HS3A 4MJ5A 5JW5A 4XMKL 3OHXB 1U95A 5IB4B 1KGCE 1G7PB 4XMLH 3SDDB 1OARL 5IK3B 1YJDH 3BQUA 4CU7A 3OAYK 3BRFA 4QXUH 4KHXL 2VXUL 1AXTL 4ISVB 1IT9L 4OZIE 4XAWL 2EIDA 1QHPA 3ARGA 4G6JH 4NZUH 4YGAB 2D03H 2XI9A 4QRRE 4XNYH 3WKMH 1QOKA 4WTXA 4G8GA 4YDJB 4M9PA 2WNGA 4LSVL 5C09B 5C6WH 1NGZB 3SQOH 1V05A 1M05A 2ADFH 4ONFH 3QIWC 1XGUA 4D9QE 4QXUL 5KS9F 2P5EA 3ROOB 3WS6C 4NHCL 3OR6A 4AL8H 3C6SA 2YUXA 1MCHA 4BUHA 4LCIL 4MQ7A 5IHZB 2WSKA 5HHOE 2MWCA 4CU8A 4EI5A 3PP3K 5BV7B 5GS0L 1BJ1H 5ENWA 2AJSL 3PWLA 1CD1A 1MOEA 5GGVH 5DURD 2AV7A 5EO9A 1TXKA 3BHBB 4QRRD 3CLFL 1HHIA 4IMKC 1RFDL 1VESA 3EOAB 3G6JA 3ZDZE 1OW0A 3MV8A 3JV5A 3TO4D 4X6CF 4NM8H 1SM3L 1RUPH 5JNYA 3I02B 3CMOL 3LS5H 4K9EC 4E41B 3N1FC 3U9UA 3VG9B 5C0CB 2NXZC 1KGCD 1T22A 5C0FB 1I8IB 2FEEI 5GGQH 1JBJA 3BN9D 3WNKA 1X5JA 2GJ6E 2HFTA 4F9PA 1P7QD 3O3AA 5E56A 3VXRB 4UTBL 1LEKB 3DV6B 5FYKH 3QXAB 5E24E 3GSNH 5IOPB 1LVEA 1GSMA 4LHUG 4PRBA 1JFQH 3FQUB 1EVTC 4FFYL 1BD2E 3PXHA 5CZXC 3MRGA 5D7IE 2GHWB 3SDDA 2UVFA 3QAZB 3B4NA 4I9WD 3BGFC 1L0YA 3CH8A 1ZT1A 5JR1L 2ICWB 4FQLH 3LVEA 2DLIA 2A1WH 2VUOA 2M26A 1IEHA 1QA9B 3IKKA 2OBGA 4G8FB 3PWJB 3SDYL 1MF2H 2DF3A 1I3RA 4J3UA 3I3DA 1ED3B 2L4OA 5BZDB 3CVHH 2HJFA 3IXAB 1NGZA 2CRMA 4P99A 3GO1L 2R15A 1I8MB 3BGMA 1ZVSA 3OGOE 4ZS7L 3EHBC 5KSAC 3C6SB 1CXHA 2A2QT 4ZFGH 3HRPA 2A74A 2IPKB 5B38B 2Z93B 3MA9L 1PEWA 4NYLA 2O5YH 4U7KA 4XAKD 1CE6B 4IOFC 1JPTH 3BT2L 3HKFA 2PO6A 4R7NB 3VXOB 3V6BR 4JFDB 2YD9A 3DRTA 2X41A 3QHTC 3T2PA 4XBEH 2HFGL 3T09A 1KEML 5HGHB 4P46C 5DJXA 3TH2T 3ZKSD 2VXVL 1I1YA 1PG7L 4XP1L 3L1OH 4E42B 3TVMB 1UWEL 1TDQA 1KC5H 3TBSA 3W9DB 5L8JB 1U95B 3QEUA 2HRLA 3D85B 2PTTA 2MQ3A 4X5XB 1SEBB 2A6IB 1JFQL 3VD7A 2X9YA 5E2WH 2BFVL 4F3FB 1PG7H 4LNRA 4YX2L 5ITFA 1U58A 3MRCA 4GRLA 4ZAKC 4V2CB 2XQBH 2V9RA 3OKKA 3QXDB 1DFBH 3DVNB 3VXRE 5IF0A 1C12A 3QHZL 2ESVA 2X7LA 1LO2H 1NL0H 1NDGB 2BRQA 2PETA 4HPOH 1B2WL 2HFFB 5IR1A 4RGND 2VUYA 4EBQH 5C09A 3KYOB 5FGSA 4U49A 4YNYB 3MZGB 3ARFB 4OZHE 5EOCL 2V9QA 2Y5TA 4OKVB 4N8CL 2YC1B 4WI8A 1MWAB 3MGAA 2NTFA 3BMVA 4K55A 4ZFGL 4Z77A 4G9DB 2NX5B 4F7EB 2R1YA 4KVCH 4W68A 4QNPE 1B90A 1T3FB 4PJHF 1NCAH 2EDLA 4ZNEE 1UM5H 1LK2A 3K2UH 1ZEAL 4IDJH 2ITDB 1IZKA 4RFOH 1TZGH 5A3IC 1GRWA 2APBA 3QUML 4QRTB 2D7PA 4J7RA 5DT1H 5JOPD 4PRDB 4LASH 1MUJB 4ZXBD 4KK6C 4Y4HD 2ICWI 4TULL 4MNQA 1JIBA 2NLJB 4NQDA 2AKRA 4IDLA 3NFSH 2FJFB 4XBPA 1MLBB 2CIKA 3D25B 4ODSL 2OL3L 4AMKL 3X14B 3TPUB 5IFJA 3QWOB 4UU9B 1PVHA 5DRWB 4R3SA 2DQEL 3NTCL 5J12C 3NA9H 4G7VH 1MIEH 3W2DH 1C5CL 4DAGH 1VERA 2R2HB 4L3ED 1LQSR 4ELMB 2ORBL 1WTLA 1RVFH 3B2UD 1AGFA 1AR1C 5E2UH 2DYPB 3ARPA 3RGHA 2Q87A 4HV8B 4WHYH 3X3GL 4HBCH 5DC0A 4OCNC 2EEAA 2IPUK 3SOBH 1EX0A 3RWJA 3SGDI 1A6VH 1NCNA 2BHUA 1BJMA 1FVEB 5GZOD 4ZO6A 1RVFL 4D9RE 2AJZB 2JJSC 4I4WA 5FYKE 3U0PA 3NH7H 4K3DL 1A22B 3EFDL 3C5ZC 1T89C 3FB8B 4MXVE 3DO7A 3ROLB 1NLDL 1NFDB 1A3RL 3DV4B 4L5FH 4GT7A 3L3DB 2GK2A 1MCEA 5E4EB 2JCCA 4PJIB 2LU3A 2EXWD 4WI2A 4UIMA 5EOTB 5ICYA 1S8DA 1BFOB 3C6LA 2IEPA 3QDGD 1BHGA 5I1DA 2EIEA 5F1SA 5T3ZL 3K80A 3P4MB 4TNVK 1TETL 4HWBA 5HI5C 4C54A 4L5FL 5I1LA 1JP5A 1NC2B 5BXFA 5EZIH 1KIUA 4GG8A 1ZK9A 4L9LA 2GTZB 2PN5A 4CDHA 5DK3A 2B2XH 4M93C 1OTUC 1MI5B 4OT1H 4XNXL 3NTCH 4N9OB 4XPTH 1SHMA 4G7VL 2GSGA 4L4TA 1YC8A 1J87A 1YMHA 3VFWA 4F7CB 1WAAF 3ABZA 3EGSA 2YKLL 3C5ZB 4XP9L 5IESL 1I9RH 4HF5H 5I16A 5J1SC 1IEAA 1MFCL 1JPFA 2H8PB 4M6NL 4ELMA 4P9HH 3KVQA 5T1KB 5T1LB 3X3GH 3S9DB 3T65A 4XGZB 5HHPA 4KC3B 4R3SB 4OF0A 4WGVB 4YBHA 5GRYA 1KNOA 3MX0A 5FOJA 1RIVL 1XIWB 2XG4A 4MDJB 1Q0YH 3Q0HA 2YKLH 2VABA 5F72S 1MCFA 3P4OB 3IGAA 1KEGH 4NO0B 8CGTA 3TO2A 1ORSB 4PJXA 1N4XH 4P2OA 4NPYB 1INDH 1NCBH 1UH2A 4P2RD 5AEAA 3WD5L 3NIGE 1IGJA 5E6IB 3RL2B 1OTSC 3E2HC 1GGBH 3WXVH 1TCRB 2CGRL 4BM7A 43C9B 3EYVA 1NCWL 4BFIA 2DQHL 2IFFL 4EDWL 3TBWB 5E08L 3FQTA 1M71B 3TO4C 5F1NA 4PRIA 1TQCB 4YIQB 1ZANH 2HVKA 1IM3A 5KS9A 5CJQH 1WBYB 3M1BA 1NGWA 4OD1L 1JI2A 2OTWA 1VPOL 4MNGE 4XCNA 1ADQH 5H94B 3TVMC 5GXBB 4Q6IB 5DFTA 2X4RA 4HH9B 3V6FB 3NBNA 2JIXB 32C2B 2WP3T 1NMCC 1EV2E 3GSQA 3MCKA 5BOPA 2YEZA 3L5IA 1ZV5A 4KPHH 4PGBA 8FABA 4D0BB 4XHQA 3WO3B 4JM4L 4WIQA 5GJTH 4R2GC 5F88B 3RVXD 3RIFF 2LU4A 3HUJE 2ICEA 5KSAD 2XWJB 5CUSL 3ARDB 4DTGL 4UV4L 1GPOL 1KV3A 1TNNA 2CKBH 3FRUA 5T3ZE 1MRFH 3ZTJG 1IT9H 1SQ2N 3L9RA 2CLZB 2GIYA 3S4SG 4Z7OF 3ZDYF 4PREA 3OJDA 3NIGF 3WKML 2IH1B 5CJOH 2M8XA 3VFSB 1P4IH 1WQVT 1FDLH 4LPUA 1BQSA 4IM8A 4UV4H 2VABB 1N4XL 1HSBA 1NAML 2WBJB 4QOKE 3ZKQD 4P3CH 2N1KA 3D0LA 3D39D 5I8CB 3L3IA 3X12A 1TENA 4I18B 2H26B 1OSPL 2N7AA 2RGSA 5HHMD 3QJHB 5D7JC 1X44A 1HH6B 1LHZA 5KS9E 5CD5D 2HLFC 3CLFH 4NPYA 4KI5F 3DVIA 3SGJA 3RWCB 2CQVA 4UB0H 3TNNB 1HXMB 3H0TA 3OMZA 2BVUA 5TDPB 2AI0L 3KPPA 1G84A 2OZ4A 4P57B 4DVRL 4JGMA 4JM2F 3BGFB 1EAPB 1A1MA 4M03A 2OQJA 4GXUM 4PRPB 2HFEA 1NFIA 5CBAB 3LRSA 1M7IB 5IVZB 3DBXB 1AO7A 1T66D 1FNAA 5CHNB 2Z31D 5J13B 3GMOA 2AJYH 4I18C 1K5NA 3CSPA 3CX2A 3VDCA 1J1XL 2RQ8A 4ZUUB 4M6AA 1WZMA 2NY6B 2A1WL 1VA9A 3VJ6A 5CFHA 4WCYL 3RTQD 1LEIA 1DLFH 2XZAH 4ZXBC 3ZHDA 3G6AB 2DJ4A 5E6IA 3RL2A 4NCC2 3BD3A 4ONGL 4GAFB 2O5ZH 4LOUD 2AK4B 3I6GA 3MV01 5GRUH 3FFCD 2WUBH 2GSIA 1BM3L 2W38A 4U6YB 3S36X 4WW2C 2WW8A 1OSPH 1NANH 1T0PB 1QLEL 3IFNL 1DLFL 2XZAL 4X83A 3DX9A 1MFBL 2XXCB 3LRHA 3TZVD 4FMKA 3QDJA 1FO0L 1YN6B 4ONGH 2PYED 3FCTA 1TVBA 5A2JH 4XNYL 1LDPH 2VLJE 3PP4L 1CS6A 2I9TA 5CLTA 5DEGB 1QLEH 4MCYA 5C0AB 5I1HL 2X42A 3CXDL 4PJ8A 1DZBA 1N5AB 2H45A 4X5LA 3MRDA 4R7DB 5KN5B 3THMH 5KSUB 3L7FB 1PKQA 3BH9B 1WEJL 1YECH 4PJHA 3GSUA 4U1KA 2MCG1 3O4OB 1SYVA 1AO7E 3NPZB 4K94H 3VRIA 2X4SB 1G7PA 1MHHA 1QR1A 3OSKA 3MZTA 4QHLB 2VIRB 2VERN 4GO6B 1WWWX 2DQDL 2EKJA 3U30C 4Z9KB 1C5BH 3KPMB 3HAEA 3SJVA 5D7LD 5IBTL 2WWMD 4DZBA 1L7TH 5DZOA 3CDGB 4OUOA 4YZFF 1UZ6E 2FSEA 3UDWA 3ARSA 4YXLL 3HZVA 3LY6A 4JZJC 4MVBD 5E8PB 3WIHA 5FF6A 5J9PB 4PJGA 5EC2A 3R06B 1ITBB 5C71A 1BVKB 3E8UH 1G1CA 5AG9A 2ZG3A 4NRXA 5IBTH 3V2AR 1A02N 4HGMA 4LSVH 3WNPA 2C3WA 1AJ7H 1V3KA 4OZIF 1R5VA 3MR9B 5DRZA 3JWDL 4MAYB 1IL1A 4ZOEA 3E8UL 4P23C 3BZFA 2O93L 4XNQB 5SWZE 2MNUA 5E6YA 4ZPTA 3UZEA 5GS0H 3L3GB 4XCEA 2YA1A 1A7RH 3L3KB 4GBXD 2Z91A 3CXDH 2YMXH 4ETYA 1UCBH 4FN0A 4YBQD 1FYTD 4QOKA 4NBYB 1HQRA 4ZTOH 3P4LA 1BQHA 5EU5A 1IC7H 4P23B 3KPNB 5IMMA 4XWGL 5KN5A 1QSFB 5I8EA 5IQ9B 2VLRA 4HUXA 3OF6A 4KROD 1DR9A 4G8GD 1KLUA 3O3EA 3D39E 3DBXA 1MCPH 3MJ7B 3O8XB 1RZKH 5GGQL 1JK8A 5CGTA 1QA9A 2R8SH 1QHOA 1NCCL 4JN1H 1JNHA 3H9SA 4IJ3B 2V5TA 3QUXC 1CGTA 3HG1B 2ENYA 3IDXL 1KEMH 4IOIA 4UIKH 1CQKA 5MEOB 3QG7L 3ARBA 3QULA 3TT1H 5DJ0A 1EFXA 3PIQB 1KC5L 3PWJA 5T1MB 3NH7L 4JREC 2NW2B 4IRJC 4H8WL 1GVIA 4NZDA 4BQ9A 4YBLB 3ZKXB 4N8VA 4QXTB 3U36A 1RZJL 3S34L 3EJJX 2E9IA 4K8RL 4KKLD 4HQQL 3QCUL 2AXFA 4OJFH 4RMTA 3SKNB 4Y4FA 3IFPA 4NFDA 4DGYH 2B4CL 1IAMA 1FZJB 1NGWB 1AD0B 1CICA 5ACZA 2GCYA 1FNHA 4ODTH 5CWSB 1KN2H 1O7SA 2UYLA 3QO1A 4X6CA 3ZKND 3KPLB 1A9BA 1U8MA 2NR6C 2VN4A 1E6OH 4S1RL 4TVPE 2Q76B 5LWYH 1BX2B 1I75A 4XP6L 1EJOL 3UYPA 1XF5B 2YD4A 1FH5H 1DTUA 1KG0B 4LCWA 5HHOB 3OWEA 2CLZA 5D2NA 2P4AB 4M8VA 4XNXH 4IMKA 2VLKA 3QJFA 1EHAA 5F93C 5BRZA 2VH5H 3K8LA 1W0VB 4OCLC 5BQ7B 1UM6L 4WTZA 3H6JA 4QEGA 4UOJA 1ZAGA 2VLRB 3C09B 4R9HA 4Z7WE 5HJ3B 2HA1A 1DQMH 4N1HB 3INUH 4MNHB 2FD6H 3PL6B 1HNGA 1RK1B 5IHLB 2MPAH 5JZ7D 3GFUA 5C08B 3OGCA 4PY7B 5IVXF 5E6ID 4JPKH 5EORL 4YPGB 1OAYL 3UTQA 5DLMH 1L7IL 1NGQL 3GBMH 5ICZA 1NBZB 4BSWA 3MGTA 2DQEH 5CZVH 2R0ZH 4MMXC 3HI5L 5EFIA 3HC4L 4OI8A 3N9GH 4P2QE 4WO4D 1QNZH 4O4YH 2CJUL 4QGTA 2BDNL 2EKSA 5ILTL 1FN4A 2BNQE 1QKZL 3HE7D 2DIAA 5HDLA 3ARBB 3EYUH 4EI5B 3F6LA 4DGYL 2JB5H 4PB0H 3MOAH 2B4CH 4HC1L 1VGEH 4BQBA 4QRPB 4HBCL 4PBXA 4TUOB 1CD9B 4PRHD 4DN4L 2NY2C 2FJGB 3MLWH 7FABL 2H32B 3QZWG 3ARWA 4J2XA 2BDNH 4TPRH 4D94A 1INQA 1IILE 4JB9H 2NNAB 5AG8A 4NWUH 4RWYH 5JO5A 1OQOA 2HTKD 4G6AD 4DN4H 4M9OA 1EMTH 5ICXA 4H26A 3WLWD 5D1XB 2FR4A 1GPOH 3LPWA 3L6FB 1F3RB 2AXHA 3TWCH 3DWTA 4EVNB 5I2IA 2YPLA 1HDMA 4HLJA 3VFRB 2ADJA 2OP4H 1NBVH 4APQC 1T89A 2NMSA 2J6EH 4M6OH 4N0UB 5EBMA 4HD9A 3SDAA 4I13B 4AEEA 2YOCA 4XNMB 1L6ZA 3U7YL 3Q1SH 4NO2B 2DMBA 3WJLA 1UWGL 2DQUL 2X1QA 2ILLA 5GGUB 3TBVA 3R0NA 3N9GL 4GS7B 3BGAA 4LSUH 4NJAL 4YFEA 1G7IB 4U6TA 2NY0B 3QFJD 4JCMA 1WITA 3BN9C 2W60A 4U1NA 4L9LB 5EOTA 1KB5H 5DJAB 3ILPB 4Z76B 4LQFH 4PJ5E 2W0KA 1BZ9A 3I9GH 1I85C 5DJ6B 1YMMD 1HYSC 4GOSA 1E4JA 2DI7A 4M1CD 1VKXB 1NEZB 1U8KA 2WWMC 2DDQH 4NOFA 2E6JA 1N6UA 2ZJSL 4JB9L 4WW2F 2GJ6D 1HQRB 4U1KB 1BVLA 2FJHB 4XWOC 3QZWB 2EH7H 1FE8L 4H5SA 1N3NA 3QUZC 4HGWB 2EC9U 4ENED 1A7OH 1T4KA 1WFTA 4ZAKB 3IJYB 1EEUA 3HNVL 4JRXB 1WCBB 3ULSA 4UT7L 2DQHH 2IFFH 1AGEA 1PY9A 4EDWH 5E7FA 2HP4A 2BX5A 1EEZA 4MJ6B 5IBUB 1CFSA 1KENH 1J0HA 1R3IH 4PJGF 1S9VA 1GZQA 1T03H 1ES0A 4F7PA 1HHGB 1KACB 2ARJA 4MJ6A 2Z35A 4YWGH 1BOGA 3V0WH 2EYSA 1U3ZA 3DMMD 4UT9L 4F37F 4OQ1A 4YBQC 1V3JA 2HT3D 1CR9L 2Y7QB 3B9AA 5JZ7C 3MRBB 1AP2A 3RWIA 2ICES 4KZDL 4OD3H 1YMME 5KOMC 2ZNXA 1J9CT 4Y5XC 1ZLWK 4DTGH 5IG7A 4J3VA 4Q9RL 5FM5M 4LQFL 1QP1A 5FO9B 3BPLC 1UH4A 4PJ9D 4QTIL 3TBYA 3MRFA 3MXVL 5D7IF 2V2WA 3WD5H 2D31A 1G6RL 1MY5A 4OD3L 1OF2A 3S96A 4A6YH 1FAIH 1B6UA 4TN9A 2LAAA 4K71B 1HINH 2FYYA 2BHYA 1QSZA 1G9NL 3ILPA 5AZ2L 1ZHBA 4XAKE 2NNAA 3VW3H 2FH8A 3RX7A 2IH3A 1WAAA 2P8LA 1MCSA 4KROC 3L9RB 2J8UB 1G6RH 4M3KB 4NQSB 5D2LA 2OS7A 3RPIA 4LF3B 3DARA 5CEXB 4LSPH 4U0RB 4MJIE 5K59E 5J89A 3IDGA 4NUJA 4JZOB 1JV5A 4XX1E 5JPNB 5JA9A 3A6OA 4LU5L 4RFEA 1YY8B 1ETZA 2AABL 5DHYA 4EVNA 1S7QB 4GG6A 1UCTA 3BO8B 2FWOA 4WEMB 1UKSA 1BD2B 4C4KO 1CBVH 2NY7H 5EO1B 5ERWA 1Z9MA 4GAJL 1R6VA 3VMOA 4I9WE 3FN9A 4N5UA 4KKLC 3RX5A 5CKGA 1DQDL 4BFEA 4KZDH 1BF8A 5GIRB 2VXSL 2FDBP 7CGTA 1ZS8A 5CP3H 4ZFZB 2IAMA 4GMSH 2BVTA 3EJZC 4Q0XL 3VDBA 4QHMA 4I1NB 4GAJH 4Q9RH 2QQLL 3CU7A 3GKZA 2NW3A 3MLXL 5H35B 2XN9B 4G6JL 5BRZB 2WUCL 4MD4A 2CO6B 3MLTA 4XRCA 1IFHH 4M4RA 2XV6B 2B39A 4P5TD 4RDQG 2NX5E 4M4PA 1BGXL 5FYJH 1AQKH 3AY4A 1Q9LA 1QO3B 3DIFB 3VXRD 1P7QB 2G5BA 3GKWH 2QL1A 4JQIL 1BIHA 3KLAA 1IC7L 4M1CC 3GMMB 4B50A 1SBSH 3HE7A 1JJUA 1S7XB 1AFVL 3GSQB 2HKFL 1RULL 3WUWG 3ES6A 3GMLB 1LE9B 1BF2A 2UWEE 3DRQA 1QBAA 3DX7A 4LCCC 3SE4A 3VXRA 4KK8D 3BZDA 4M1GH 3U0WH 4U6XB 5JW4M 1TJHL 1EIBA 4O2EA 4AT6B 1H3GA 2UZIL 3O4OC 3HC3L 4CW1B 4JY5H 5E6IC 4WU7B 2XWTA 5ICZB 3W82A 3IFOA 1RULH 1CDIA 5IIEA 3MJ9H 4WY7L 4GG6B 2HJLB 4ZOAA 1QZ1A 3SCMB 5J6GB 3T0EC 5C9JA 1JGVH 3KNBB 3QPQC 1DQLL 2EE9A 4LVHB 4Y2DC 3ZZ1A 4GAYB 3L3HA 2UZIH 4OB5L 2J4WL 2J2ZA 3DXAE 1AI1L 1PKOA 3BZ4A 3LB6C 2HTKC 3GMPA 3BWAB 5DQDH 3OKLB 1BD2A 4XPFH 4KQ4H 3MNWB 5DXWA 5LG1A 4RMSA 5ANME 1H9VA 3T0AA 1KYOJ 5DJDB 1ZLVK 4MA8L 4XXCA 1CCZA 1KLGA 1DQLH 4PGCB 3HPLB 5K93A 2R4SL 1DDHA 4YK4B 5DC4B 1E28A 4TTDD 1KTDB 4KY1L 3KXFA 1OP3H 1WIUA 2OTUA 3B3IB 2J8UA 5AYUL 4L3CA 1R3JA 2ARWA 4N5ED 5D2LF 2ITCB 4PPTA 4G9FA 1GGTA 3QDMD 4R2GB 3HZYA 3PHQB 3S4SA 1PSKL 2GKIA 3WFEL 3PNWA 1WZKA 4L1DA 2HKFH 1NFKA 1PQZB 1DUYB 5MI0C 5E1AB 2EE6A 1U92A 1YN7A 3K3QA 1G7HA 3Q6FB 3WHE1 3I3BA 2PUQT 4IOIB 3RVUC 1UVQB 5C08E 1INEH 1WC7B 4N8VG 5JPNA 4JPVL 5EBGA 4GRMB 3V52L 1R24B 5C0EB 1WEJH 1YECL 2E7LA 1YY8A 3HC3H 4FQCH 4RFNC 5ETUA 4HHAB 1OGTA 1PD6A 4FRWA 5DYOB 4OF8A 3NIFF 4N1EA 1NC4D 4PRNB 2BY1A 3L1OL 2NZ9C 5DC9B 5BS0B 1NH6A 3BIKB 2XWBB 1IZJA 1S9YB 4L8SC 4X4MA 4ZUWA 1U8OB 1CXEA 2LFGA 1TITA 3RWDA 5B22A 5L2KB 4LLMA 5C3LD 2HVJB 3P73B 4H25A 4RX4A 3VXPB 2APXA 4O4YL 2QHLA 2BCKB 4YXLH 4YX2H 2AJZA 3N1PC 2R1YB 4P3DB 3MGOB 1PYWB 2ZSVB 5D5MB 3SCMC 3MODH 1B0WA 1J10A 1YMMB 4MDIA 3GUTA 4XHJD 2AK1L 4NQCD 5C6TH 4FFVD 4GKNA 4XTRD 5CP7B 4QOKB 1H3VA 4YHLL 3TJHC 3EJZD 4QCIA 1I3VA 4ZPTB 5E03A 1D9KC 3QFJB 5TFSH 1XGRB 2AEWA 2OMBA 3P2TA 5DMKA 4GKNB 5CP7A 2BRRL 1CF8L 4G6FB 4M43H 4U7SA 5EOCH 3TO4A 5BV7L 3MJ8A 4GRWF 2XRAL 1JGLL 2AQ2A 1ZGLA 4YHLH 1S9VB 3B5GA 3OZ9H 5EU3A 2X1XR 4JFHD 2MOVA 2YD3A 4UQ3A 4UI2A 5H37G 4BSVB 2JLLA 4PJ5B 1IJ9A 1I1AB 1M6OA 2AXGB 4M43L 4TSCH 2XNAB 1Y0LA 2OP4L 4HJ0C 1CL7I 3OTTA 3PP3H 4JFEA 1H0DB 2DAVA 1DBKH 3RHWF 4ZUTB 3KHOA 3NFSL 2VDOH 3HFML 4PRAB 5E94B 1HE7A 2A9ML 4MA1B 1WC7A 3EDFA 4MAUL 1RU9H 3TIDA 4F7TA 2VZTA 4ODVH 3C8HA 2Y06L 5TE7L 3S36H 5B3JE 3MRFB 3QPQD 4JDVB 3SDCD 3G5YB 3G9AB 3HUJB 4JRYA 1QRNA 1I7RA 1H15B 2AK1H 5D2NC 3AS2A 3DJ9A 3S34H 5L2KA 4PGCA 1RU9L 2BNRA 5MHSE 1S7VB 5MEQA 4LHUA 4ZFFB 4X4YB 4ZD3H 3WE6A 5C1MB 3GBML 3VXTB 3SPVB 4CVUA 3VXSA 1F97A 4MWFB 3DROB 4UMGA 2ADGB 3BKYH 4PTTB 2HLAB 2XTLA 3HC4H 1A9EA 1EEYB 3D85A 2D7QA 3VMNA 3UX9B 3MRJA 1ND0B 1MNUL 4ZSOA 4LBEA 5GS1B 1EO8L 1G9NC 4HH9A 1ADQA 3QHFH 5C0BB 1U8NA 5JLZB 1ZHNA 5C92A 3UBXI 1T80A 4PJDE 3KNBA 4KPHL 4D0CA 4PGZA 1O7VA 1N2RB 4OBRA 4HULB 1A6ZB 4P4KC 4WV1B 2ERJB 1V7NL 3KYOA 4LLQA 4NZTH 1R3IL 4IHOB 3SDCB 4NP4L 2R0LH 3IXTB 4DQOH 4JFOA 5EU4B 4WHTB 5JW3H 4KDWA 1P7KB 1HKFA 2Y5TB 3ULVF 4HS8H 3TV3L 5HBBA 2VZ1A 1EDQA 25C8L 4YUEL 4JVPA 1H3UA 4HWEL 1YNLL 1T7WA 3D3VD 3ARTA 3UTSB 1G7MA 2BNQB 3PV7A 3MQIA 4I0CC 5D1ZA 2UV3A 2I9LB 4M6NH 5SWZB 3MTRA 1KLGB 4NQXA 3TWCL 3MRIA 3T2OA 3RGVA 4PFEA 1EZVX 1TJIL 4NN7B 5GGRA 2VLJA 3LDBC 4LRNL 1KCLA 1MIML 1T21A 4HWEH 4ESKA 3MRKA 5ILTH 4AG4H 5I1CH 2A6IA 1K3ZA 3VFUA 1A7NH 3MRQA 5DJXB 2OX5A 1MCRA 3DECA 1JPSL 1XF4A 1U8MB 2E7MA 3B2VL 1EHNA 4HEME 3TJHD 3D3VE 4Y2DD 1RZ7L 3LZFL 4G6FD 3MRQB 1BFSA 5T1DL 1EO8H 3U2SB 3C6LD 4GBXA 5C0GA 4LBEB 3RZCA 3EKCA 3JWNC 5EIVA 4G8EA 4K94C 4U1HB 1P4LA 5KVDL 5C2BL 2AABH 3GNML 5D72H 3U6RB 1HZHH 1CFQA 5GRZA 1V7NH 1VEPA 4QRUB 1UGNA 4RZCB 2EDHA 2OZ4L 1JWSA 1CDJA 2LABA 4M7ZC 3ZE1E 1QSFD 1UA6H 2NY1D 3VA2C 1WGOA 4P23D 3P0YL 1R3LB 1RK0B 1C7SA 2HJFB 2JF1A 3EOTH 1OGAE 2WANA 1AH1A 4MA3A 5ALBL 5D72L 5D7KE 3ZE0E 4GBXC 5HYJB 3HUJA 2EC8A 1OT2A 1OAKL 3HLAB 4Y4FC 1ZGLP 5SX4H 4KTEL 1FYHB 2R2EB 4JFOB 3FZUC 5BS0D 5INCB 1S7VA 1IGTB 1NDMA 1RZGA 4NO5B 1BWMA 1BOYA 4F2MA 3ZO0A 3BDBA 4DKAA 3MBED 4A6YB 5JHDD 1FL5B 4PY8I 4P2OC 5T33H 3TT3L 1TNMA 2WUBL 2ZZUT 4JFYB 1FZJA 1JMZA 1BECA 1D9KB 2A6JA 3L5WB 1NGPL 4FQ1H 4LSRL 3V4PH 3QDGA 5IOPA 2IANB 3BQUB 4Y16A 4NGHL 4ZSOB 3HMXH 5C70A 4H0GA 1OP5H 2CSPA 3HS0B 3FB6B 2XTJC 1Z9SA 3CNKA 3WFHA 2AXGA 1NMBL 2IPTL 5IK3A 3IVKA 4WWKB 4XVSH 3FHAA 4IMLA 5I71C 1A64A 4MQXC 4TUJA 1FFRA 1F4HA 2Q8AH 3CFDA 4LAQL 2J88H 5F70A 4CN6A 3CC5B 5KSBB 2OSLB 4X7CC 1A3LL 5E8OA 3VGDA 5FYLE 4UB0L 1MLCA 3TO2B 3SKOA 1M05B 2D0GA 5I8KH 3IYLW 4WI6A 5A1AA 5C86A 3MOBL 4JVWA 3I84A 3MRRB 3V95A 5MP6H 3G5YA 5F7NC 2ZCLH 4P4KD 1DLHA 4JG0L 3SKUD 3OKMB 5CGYD 3ARFA 3NIFE 1NFDA 3SCMD 5C0IA 2Y07H 2WM0A 4I48A 4K23L 3OKMA 3B5TA 4BQ6A 3QDAA 5JQ6L 4NKIH 3T77B 4I3RH 1E4WL 4UILH 3PWVA 5F7MC 2EDDA 3K7UA 1VFBB 3LDBB 3LRGA 5C07E 4Y4KC 4FQ1L 2CR6A 1CGYA 2COQA 3KXFE 5BXFB 2AKRB 1YUHA 2HJKB 2NYYD 5A40E 1T2QL 3DX8B 1I1AA 1M6OB 4Z7QE 3RDTB 5DMGC 1CGSH 3MLSH 4WHCA 2G60H 1YDPA 3IU3A 4LSQL 3U82B 4P5TA 2Y5EA 3LMJL 5GS1C 4LSTL 4M61B 3TA3D 4CMMB 1A6PA 2NLJA 4NQDB 4NQSA 5D2LB 3RI5F 2BVPA 4Q0XH 1WBZB 2EZ0D 4JZJB 5DS8B 3RTQB 3RUGA 1RURH 4KDTC 2NY6D 4JRYE 4P5TB 1KJMA 3KJ6L 2P5WA 4E0RA 3BPLB 1P9MA 1VADA 4XBEL 3PQYB 4LCIH 5J4MA 1YPZF 4RISH 1KTKE 4NZJA 1U8JA 3FAXA 1HHHB 2IQ9H 5D93B 4ZO9A 3W11D 2DMCA 4IS6B 1UWEH 4HZAA 3VGGA 4E9LA 2Z93A 5GRJH 1FNGA 4HK0B 1GHFL 4LIQH 4JN1L 3KPQB 4LU5H 4PYGA 1GL4B 1HIMH 1F2QA 4FFWD 1RHHB 3VWKC 4M7LT 1CL7L 2X4TA 2NZIA 3LS4H 5DJDA 1FAKT 4K3HA 1CBVL 1MLCB 4KI1A 3SDCC 4KGJA 4RA0C 4ZO8A 4OZGE 4MNQB 1BFTA 5ISZA 1U9KA 3DXAD 3MODL 1I9IH 2ATKB 1HQ4A 3EYFB 3SJVE 4MJID 1G9MC 4OF3A 2BZDA 1KIRB 1VSCA 3GSNL 3VI4E 2ZSWB 1CL7H 1IC5L 2J1KA 3QUZB 4F3FA 1V3LA 4J12A 4X8XA 3TNNA 2GUOA 4Y4KA 1IGCL 3JV0A 4XCFH 5E8EB 4L9LC 1FNSH 3F8UB 3VFTB 2ZCKH 2YN3A 2FIRT 3LKSB 3LKNB 1J8HE 4P57A 3FB6A 5EA0H 1LEGA 4JRXE 2ZOKB 3QNXB 4S1QL 3G5ZA 5JHLL 3PGFH 2BJMH 2PXYB 2W07A 3KS0J 3SDYH 5A16A 3GMLA 3F5WB 1ZEAH 3HAEB 4CGTA 1IAIM 5HGAA 4HKZA 4YNYA 1HK6A 5DA4A 4JKPL 1W0WA 5CHNA 1PEZA 3FMGH 1QR1B 3J8F7 1E4KC 1S5HB 1MHEA 4Y19B 4RAVA 4UNUA 4B5EA 3V79C 1C08A 3F7QA 4PLNC 3G08A 4UV7H 1Z0MA 3LN5B 4LPCA 15C8L 2H26A 2R2EA 2VKWA 2VYRE 1N0XL 1N64H 1MPAL 4WFFD 3BPCB 2J8UE 3W0WD 2VXQH 1OW0C 2DQCL 5I1IH 4P5KB 4A6YA 3W5NA 1AY1H 1JI1A 3HZMB 5D1ZC 1MRCL 2LU7A 4JFFB 3H42L 4LLYB 2XQYG 2CR3A 4XCYA 1NSNL 3RWCA 3CIQA 5TGBA 1OAYH 3FN3A 1NGQH 2IALB 1MJJA 2DQCH 2XTJE 1ZT7A 2F54D 2NY4D 3QR2A 2MCPL 3HI5H 5EZLB 2Z8VC 4DGVL 4ENEC 1S7TB 4N0RA 3GBLA 3WFCL 2CRYA 3O11B 4CJ1A 3U2SA 3QEUB 2J12B 3GSNA 5J1TC 4CKVX 4Y4FB 4WWKA 4JRXD 1RAMA 2W65B 1FV1B 5J1AA 4C56B 5IB3B 3UBXA 2E9JA 4M93B 2DI9A 4OZFA 3T2NH 1HKLH 3I2CH 3RHWK 1D7FA 3VXSE 1DBAH 1JNJA 1I3GH 3T1WA 4L3CB 2VLLA 3L3JB 5EUOB 2XPGB 4NUGL 3MCKB 2LV4A 1QFHA 1F4YH 4NO0D 4NQEA 2I60H 5C0GB 3C2SA 1EXUA 5CBEB 4HWUA 1XIWD 4PRPE 5EU6A 2R4RH 4Z7VE 5HVGB 4O02H 3OJ2C 5KSBE 4EN3D 3NGBC 2VISB 3MBEC 4O51A 1UG9A 2CDEA 1EFXB 4O9HL 3UMTA 3EYOB 2R0LL 4OV6F 1CQYA 1SY6A 3ARDA 2HH0H 3IGAB 4PRID 3TC9A 5FHBL 4UTAH 5EZJA 4PV8A 2EDTA 3AREC 4ODBD 2GK0B 3TYFB 4FXGA 3VGBA 4QHUA 3EYOA 3VWJD 4U4BA 2XKNA 3MRPB 3FZUD 5IB5A 5ALCH 2EDXA 2YZ1A 1C08B 4KZEH 5GIRA 2BOCB 4PGJA 3VH8B 5DJ2B 3MCLH 1QPXA 3HS0A 4OUUA 2UY7A 3GMQA 2IGFH 1MAKA 3O6MH 2BOCA 3G5XA 2DWDA 2IANA 4PP1D 4D0DB 4G80A 5FCSH 2HAZA 4U1JA 4L1HA 1F3DH 1OAUH 2FO1A 3EW3B 4CVWA 2VDMH 1E4KA 3LN9A 5E2UL 4HEPG 5DLML 3T2NL 2XTJD 5CP3A 4FQQA 1JPSH 5HYSA 5CINH 2YPVL 4OCYL 1I8KA 2I60L 5CSZB 3MREA 3MJ9A 3OJVC 3V0VA 1JRHH 4PD4K 3T08A 3F7PC 1JPST 3RTQA 3RUGB 4UDTB 1YEFH 2FBOJ 2JB6B 1A6UL 1VKXA 1H0DA 4JREB 3HG1A 1XMWA 3K81A 1U91A 1OD7A 2D7TH 5EIIA 1A3RH 2R1WA 3ROOA 5K9KB 2MMXA 2VXTH 1AGEB 3DVGA 3RU8H 4MB3A 2MHAB 5GZND 3JVGA 3ROLA 5DI8A 4NKMA 1H3PL 4D8PB 4TQEL 3ARBD 4KRLB 4UTAL 5HYJE 2JCCB 3TBTB 5CGYC 5TQ0L 3UYRH 3AB0C 4X9BA 3V5DB 1NGYA 3JV6A 3MFFB 4BJLA 1KBGL 4M7JH 5F9JA 1YY9D 4XCNB 5H94A 2PKDA 4JO2H 1O5DT 1M1SA 1S3KH 2W1NA 3GSWA 2A9MH 4XT1C 2BSRA 4XB8A 5EO0A 3OV6A 2G5RA 5GISL 2IGFL 3VFTA 4NT6B 3PL6D 3QWOA 2OL3A 1WSST 4QNPF 5TE7H 5DTFB 4R26H 2V5MA 1DL7L 3PDDA 4PLKC 1IMHC 1WBZA 4TSBL 2J6EL 4M6OL 5FUCC 4KK8C 1Q72H 3O3BB 1FNEA 4ZNCD 3L7EA 4QXGH 1MQKH 1YDPB 4P2RE 5SV3A 1IGMH 3H9HA 4HIEA 4N9GB 1I7UB 4BKLB 3ARFD 5D2NE 2Q7NA 1UYWH 4HKJB 1CDHA 3MRLB 4JANA 4P46B 4TVPD 1WT5C 5H37H 1WZLA 4RGNB 4EXPX 1QFWH 1N3NB 1TTFA 4KVNL 1MHEB 3HN3A 4TSBH 4Y19A 3S97C 4XVSL 4YJZL 1Q72L 2FHBA 1KEGL 4PS4L 2BOBB 3UTPD 3VFRA 3CXHK 4MSWB 3HCVA 5DDHB 2VTFA 4H5SB 1FFPA 2VXTL 3BH9A 3DO7B 3SHSA 3GHEH 1CYGA 1CI5A 2X4TB 5EIIB 1FNFA 1MNUH 1QFWM 2CDGB 1NMAL 2QTEA 5K9JL 3QRGL 4HGKC 2EO1A 3TZVA 3FN0L 1Y6NR 4LLQB 4TTGA 4LSPL 4XCCL 4UDTA 1XR8B 2XNAA 5J57B 3GIVB 1BAFH 4EN3C 4KMTH 3S35X 1DJSA 4YHMH 3ILQC 2XZQH 3WFDL 4L3EA 5C0DB 1S9YA 2GK0A 1W72H 1EFXD 3ZSSA 1IGTA 2KZ1B 4E41E 4NDMB 1EZVY 2O5XH 2I9TB 3OJMB 4FMFA 2AJYL 3JXAA 3LKOB 3N1QC 4O2FA 4AEHL 3OAUL 4HLZH 5H2BB 1JL8A 1X7QA 3R06A 4YPJA 1MCDA 3X17A 4B41A 1PG7X 4IRJA 5EUOE 3Q5OA 1ORQA 1DVFA 3OXRB 1XAUA 4NSKB 2ZOLB 4QLRA 3TVMA 4HUVA 3GI9L 3UAJC 1FYTE 2QQLH 1I85A 3P0YH 2Q8BL 3MLXH 2XPGA 5JXAL 2HG5A 5F89A 4LKCA 3RWEB 1C1EL 3JV4B 2DWEA 2KQNA 2NZ9D 5KBNC 1IC4L 3FTGB 5EDXA 1NDGA 4WFGD 1S7XA 3OX8A 2WZPD 2DKUA 1AC6A 5IFAH 2P5WD 4KUZL 1J18A 3I6KB 4YQXL 3BGMB 5K9JH 1T1XB 1R3LA 2NY4C 3EO0A 2C4FT 2GITB 3V4PL 1FAIL 1QD0A 2ENSA 1KJ2B 4NOBA 2QHRH 5C6PB 1GHFH 4XX1G 5IFAL 3VFVB 3JTTA 4JG1L 4LIQL 4NQDD 5D1ZD 3TA3B 3HRZA 5AZ2H 3QQNA 3VW3L 3JBG7 4OFYA 1WUNT 5GZNC 3S88H 2H2SC 5CILH 2Z4QA 5GRWA 1PFCA 1IAOB 4Y89A 4Z7VA 5IB3A 4XH2A 1MUJA 4JM2C 5F9WC 5D7SH 1IRAY 4FQJL 2AI0H 5T5NG 4Q6IA 3OAUH 2QHRL 4Z7UB 2F5AH 1CDCA 5EUOA 2PXYD 3D5OF 4QRRB 4I0PB 3RVVC 2Q86A 1ZTXL 3RZWA 2AEPL 3DHJA 3DSFH 1P2CB 1DE4B 5DURB 5TDNA 4U1JB 1KUMA 4GRWE 2PO6D 4XC1L 2WK2A 1A6AB 5BMFH 3WFHB 3G9VA 5I30L 4HX1B 4YE4L 3O41A 4X6EA 5DR5L 5LJYH 4ZDHB 1ACZA 1JGUL 3OKOB 1TFHA 1WIPA 3NCBB 5TDNB 3QO0B 3D18B 4LP5A 4NKDA 5HHQB 5BS0E 1C7TA 2JCCE 4P4KB 4WV1C 3U4EA 2AS5M 5DQJA 3H3PH 3HZKB 3VCLB 1KTDA 3ES6B 2PR4H 3TH3T 4GAGH 2PTVA 1NJ9A 3ARQA 4MXQC 4ZUSB 4OCWH 4HJGA 4NN6B 4Y2DA 1XGTB 3WNOA 3EO1A 3QJFB 3CSYA 4MMZC 1JV5B 1GIGH 2B1HH 4HUMB 3GMNB 1K4DB 3NCYP 4BQ8A 3X3FH 3SDDD 4XPAH 4ODXB 4HHAA 4OTXL 2WQ8A 2P7TB 3AS0A 2P45B 2O61B 5FDWA 1I8LC 3LKPA 4O2EB 3F7YA 3DUUB 4QRQB 1FGVL 3QQ9D 5CSBA 4LSQH 4L4TE 3BVNB 4LCCA 1CICB 4YDLC 3VE0B 4M3JA 3RNKA 3QI9C 3LV3B 2DMKA 1IAKB 4PJEB 2R2CA 4ZYKA 3KPOB 2G9HB 3Q3GA 1TZIA 1IL1B 2R0KL 4O5LL 1ZTXH 3GHBH 3IDXH 4FTVD 4N9GA 4BKLA 1P6AB 4J6RH 4JDZA 3MV9A 1NC2A 4ODUB 1R0AH 5DHVH 4X6FB 4HT1L 4OAWA 4OLWL 3OL2A 4HBQA 4K94L 1CN4A 3C5JB 2DQJL 1PW3A 2Y07L 2R0WL 1W0VA 1BZ7B 4LPWA 2AW2A 3R8QA 2WV3A 3SDXB 4U1LA 3ZMRA 3MLUL 2R0KH 3O45A 5D2NB 4FQ2L 2IMMA 5IMMB 5D7LE 4M7LL 5HYJD 1WCBA 3ULSB 3BJ91 1F3JB 4XGZA 5HHPB 1ZHBB 2YPKB 1L7TL 4HUXB 3MXWH 4LLVA 1XIWA 5SWSA 2Y9RT 1YY9C 4I4WB 1F11A 3BZEA 1AO7D 3D69A 3MLYH 4IS6A 4PJIE 5EULV 1K2DA 4O02L 3OX8B 1KPVA 3MLUH 4JDTL 3DV4A 3GJFH 3L5XH 4S0SD 2AERT 5BV7H 5CS7A 4NC2B 2AJVL 3PL6C 2OMNA 3G04A 1F6FB 1XGQB 4XP6H 5ESAA 1FP5A 4MLIA 3MRNB 4DFHA 5F6HJ 2NPLX 1M4KA 3P40A 4UT6L 5FHBH 1FGVH 3CFKB 5EPMB 3EO9L 1IQWH 2AVGA 3T0BA 1QYGL 4JPIA 4JRYD 1J05A 3QI9A 1AE6L 2X89D 3NPSC 2GTZA 4N68A 4OLVH 4U6VL 4XB7A 4NSKA 1GH7A 3LEYL 3EYSH 4WFED 3PDOA 4FQXA 4RBPK 3WHXA 4RGMC 4AQ1B 4JKPH 4QHNB 5FUCE 4YAQA 3MLRH 1JF6A 4RRPA 4XP1H 3ET9F 2EYTB 4JM2D 4JPKL 3JV4A 4RMRA 3IAPA 1QR4A 3NAAL 3NVQA 5J56B 3EJYD 2BNQD 4YHNB 5L6YH 1A7PH 1AKJB 3KPSA 4MQSB 2VXQL 1IGFL 5LCVL 1Z2KA 5T1LA 4LPTA 1G7LB 5E2WL 1T6WA 3VGEA 1ZA3A 4EIGB 2R9HD 3QZWA 4OCYH 5DK2B 4AEFA 3KPMA 5HVHB 1OAZH 5MEQB 1Z5LA 3GMOB 5BO1H 1A5FL 1DQQB 5JDSB 1CLZL 3RY6C 1G7LA 1JYNA 4KFZC 3V6ZA 2OI9B 4HUUB 2AGJH 1DBML 1WBXB 3RNQA 1U42A 4JPWH 1NL0L 2H32H 1U8LB 3DETC 2YPLB 1U8NB 1F3DJ 2DM7A 1GAFH 2R29H 4PJBB 1K2DB 3OKNB 3EOBB 1J0YA 3STLB 3CC5A 1PZ5A 1CGWA 1LO5A 3C8KB 4G5ZH 4FXKA 4EQ3A 2DLHA 1DUZA 4MYWB 1NMCB 1J5OH 1T04B 3Q6GL 3WUZA 3BE1H 4QRPA 1YQVH 5K9OA 1OGAA 1LP9E 4PLJD 2FLRT 1I1CA 3HPJA 3SDDC 4OGXH 2A83B 2DLGA 3K1DA 1WIOA 4S1RH 5LWYL 3QI9B 5D9SA 5FO8B 5B8CC 4HIHB 4M48H 1U36A 4I0PC 5FV1L 3NA4A 4JO1H 4NNXB 3RDTC 4Q2ZB 5DJZB 1GC1C 2E9BA 5GQBA 2X4UB 3CFKA 3B9EA 4XI5D 1EUUA 3QEHA 4Y8AA 1N6QL 2GYSA 5DRXA 4OGYL 1E4XH 2H1PL 5B21A 3RAJL 4FNLL 1PLGH 5EC1A 5ICXB 2VNCA 1EGJL 3WIFA 5D1XA 1YNKH 3I6LE 5KW9H 2DIBA 4YXKH 5JPMA 1G7JA 2FJHA 3H8NA 5SWSB 5I2IB 1AKJA 1SBBA 3D69B 4K9EH 4G6ML 3WFCH 2VR4A 4XPHL 4DK3A 4LARH 1P84K 4BELD 4NZRH 4TRPH 3VFSA 4JKWA 1ZLUH 2XA3A 3CFJB 3K4DA 3HNTH 1PGRB 1U8PB 4NC1E 1BFVH 2Q1EA 3V0AC 5F3BA 1MRDL 2EDFA 2EYSB 2ZKHL 2ZNWA 3O6ML 3MV9E 5I1KL 1I1AD 5KAQG 4Z7NF 3QRGH 4XPGH 3FN0H 5I8OH 1N6VA 4N90E 3Q6GH 1JGEA 1VGEL 5BS0A 2XZQL 1P4LB 5CINL 1CIDA 5DJ2A 5IROA 7FABH 4XVUC 5AD0B 1IGIL 2IADA 2B4CC 2W0FB 2AAVA 2WWKO 4Y8DC 4AIZB 2HH0L 4L8CA 3QIBC 3WJJA 4M6ML 4XXDA 3WN5A 1Z6JT 4R7NA 1L9NA 3GGWB 4ONHB 3REWB 1RZGB 3TBWA 1J12A 1RJCA 1RUAL 5JIHA 2EXYC 4OGYH 3MACH 4F33B 2VZSA 1EMTL 4ORGA 1MHCA 4KZEL 2I9LA 3BN3B 3U1SH 4AM0A 5BJTB 5BZWA 5L9DH 4JR9H 2IAMD 3TFKD 5IW6B 1S7TA 3BZEB 2HLAA 2QLVB 1ZT4B 3BPOC 3KS0H 4O58H 3EYQC 5IVXE 2OR7A 3TT3H 5CLWA 3RZCC 5T33L 5HDOA 4PJDF 3ULVC 2DQGH 1VGKB 3W39B 1C1EH 4FG6C 3S3JA 1A3QA 3SY0A 4N1CA 4HUNB 1XGTA 4G7YL 3BSZH 1BFVL 3MXVH 3QEQD 3T0VA 1MCKA 2X1PA 1RIVH 5EU6B 5HGBA 1DL7H 5JLZA 3LV3A 2DLFH 4RNRA 4DN3H 3MFGB 3D9AH 5F96L 4WU7A 5ERWB 2IBGA 3QNZB 4GMTH 4G8EB 1TZIB 2AEQL 2NX5D 1XEDA 4WUUA 3TBYB 5DEFA 2VLMD 5L88L 2F8VA 1T0MA 4MXWL 3DX6A 3C5SA 4MD5A 3GIZL 5FHAL 3QCVH 5IB2B 2VRAA 3L3GA 4XCEB 4I3GA 4HPYH 1XR9B 4FZEL 2C4FU 4HMDA 5GS2D 2R2BB 2CXGA 4EJ1C 4JRYB 4AENB 3GJFA 5DF0A 4Z7UF 3GMMA 1MSPA 5BMFL 1QSFA 1VHPA 1S3KL 4HK3J 1ZLSL 1JGUH 4MB5A 3WMSA 1KTLB 2UWEF 5FYKL 4U3CA 4UDUA 5DWUL 5GJTL 4M1DH 3FTGA 4X80H 1J8HA 5DSCB 5KOVC 5DMKB 5I6XC 4GW1A 3D85D 3HR5B 5KZCB 1LGVA 4PRBB 1T03L 5F9OH 2D3VA 2PR4L 4CW1A 4OFVA 3WIIL 3KJ4B 1IGML 3OHXA 5DVMA 3N85L 1QEWA 1XGPA 3Q5TA 4YPGA 1FVCA 3UTQB 2F58H 5AUMB 4JFDD 3QYCA 1N2RA 2ATPB 2PTUA 2Z31A 5F96H 4CMMA 5L2KD 2A83A 2DTML 5TJWK 1IKNA 2E7LC 1MY7A 5E5RB 3MRBA 1J1PH 3GO1H 3UP1A 4MAYA 2BY2A 1RJLA 5HXMA 4NM8L 4Z7VB 4Z76A 2DTSA 1JZ4A 3UZVB 1YYMH 1W0YT 4IRZH 5CEZD 1NMBH 2IPTH 3WDIA 1JF5A 4EI6A 5ESVA 1ORQB 1U6AL 2Y23A 1QFWI 4XBGA 4F7MB 4X6DB 5GRJL 3KYNA 2Q8AL 3QFDA 4O2FB 1EPFA 4C57C 3UTTD 2P48B 4I0KA 3B9VA 3E0GA 1I8LA 1YEHL 1R0AL 1ZSDB 3IDNB 2XN9D 3KLSA 5IQ9A 1FZOB 3O6LL 3WNNA 3WHE0 3E1F1 4JFYA 5E9DD 2C1PB 3PWVB 1K4CB 4JFHE 5DWUH 4KK9D 4M1DL 2J4WH 5F7HA 2QQNL 2B20A 4KRPC 4U1SB 4P4RB 3VXNB 3GB7A 3BFOA 4LKCB 3RWEA 4LCUA 2IAMC 1YPZA 4N8PA 4W70A 2PYFA 5FCUL 3DETD 3O3DB 4LNRB 4K23H 3GSXA 3T4AA 5E8OB 3VWJC 1U93B 5JXAH 1F4XL 1JZ5A 2O26U 1U91B 5AYQA 5JHLH 4DZBB 1G9ML 1QLFB 3BWAA 4KJWD 5DYOA 4O2CA 3NIDE 5CZXD 3F12B 5KJRH 3KPQA 4IIQC 5JIIA 4X6BB 3UTTE 1XR8A 2PO6B 2HMIC 1NGXA 4PJEA 1MFBH 4ONFL 2X44D 4JJ5B 1U6AH 2FGZA 3X11B 4I0PD 4Z18A 4EXKA 4Z77B 4AL8L 1YEJH 1F2XK 4L4VD 4F7EA 3TH4T 1P1ZB 1CFNA 2F53B 4FQXD 3MUJA 5IBLD 1JHTA 3D0LB 4GQ9H 3ARRA 1CVSC 4KDVA 3VRLE 1BQUA 4NO5A 5GPRA 3S88L 4QT5B 4HKBA 4R90L 1NUFA 1K8DB 2WIIA 1AGDA 3L3OA 1NQBA 5FKAB 1JN6A 5DO2D 4M62H 4GXVH 4AMKH 3HR6A 2IF7A 4Q9BA 2BVYA 4GW1B 1F3JA 2QADC 1NPUA 5ITBL 3M17B 3KYNB 2C1OB 3BDYL 3B5HA 4IOFD 1P9MC 2A6KA 5HJ3A 1A1NA 1D5XB 4R90H 4RRPG 3DVNA 1U2HA 1JVKA 5EU3B 3LS4L 5BRZD 4ERSH 1T1WB 3TYGL 4QRUA 2ICCA 1D5MB 3FQUA 4JFXA 1AXIB 1HKLL 3I2CL 1JGVL 4P5MA 1MCBA 3BKJH 1NAMA 1I1AC 5FKPA 5EFIB 3MRNA 2HJLA 2XZZA 2XA8H 2FRGP 3NZ8A 3H3PL 4AIZA 2XOTA 4ERSL 5EPMA 4IHOA 1NCAL 2I25N 2BRRH 3NFNB 4RDQF 3VFGL 4ZAKD 5KJRL 4GFTB 4QRPE 2QBWA 2GJ6A 5DEFB 1BD2D 4QRQA 1NDMB 4QKXB 5IQ7L 4N90D 4X9HA 3QIBA 3WJJC 4K2UH 4G6KL 1F4AA 3O6FB 5C0RL 2YD1A 4LCCB 4KWUA 4QY8B 1ZMYA 1GC1L 3GJFB 3ULVD 5HGDB 1JNLL 3QEQA 3C08H 3ARFC 4UQ2A 1ZGLM 3FL7A 3NZHL 1MCLA 4X0KA 3PHOB 5IWLA 4GQ9L 3TYFA 3SDXA 3SPVA 1I9JL 3ZKXC 4MCZB 5IQ7H 5TPWL 3CX5K 5DRNA 2DQIH 1CD0A 3VA6A 5IHUH 5KZCD 3RJQB 3TM6A 15C8H 4KTDL 2P8LB 2ZP0T 1WV7T 5F88A 4OGAD 5FUZL 3EFFB 3WFBH 1J86A 4Y16B 3FRUB 5L7XH 2DQIL 4ISVA 2H3NA 1CWVA 4YEFA 4JQXA 4KK9C 1GGUA 5IEKA 3T65B 2H2PC 2VLKD 4X6DE 3IT8D 4YDVA 1A47A 5DJ8B 5IM7A 4OZGF 5EU4A 2BMKA 3IXTA 1UXWA 2VDQH 4OIIH 2NXYC 3DMMB 3NZ8B 5FDYA 3X12B 3JWOC 3QDME 3K1KC 3GI8L 2ESVD 1ORSA 4PJXB 5ID0A 3UO1H 1X4YA 2P42B 4LLYA 1F42A 3RBGA 4ACPA 1X5GA 3DNKA 3BKCH 1CD1B 1T7XA 4RZCA 4X9IA 3QA3B 4IRSC 1HI6B 3TNMA 1A4JB 3OXSB 1X3DA 1CTNA 2X1WL 4LL9A 4M6MH 1U3HC 4ODTL 3MJ8B 3QEQB 2KDGA 1BVKA 4PRIE 3MRIB 2X6MA 5TQ0H 2VDRL 1E6OL 4PRHB 1UEMA 1RUAH 4S11A 3S8WA 5JW3L 1EJOH 5TE6H 5HD8D 3MLVH 3M1BB 3HAEH 2Q20A 1JTOA 1KJ2L 4LAJH 4F7CA 4Q74A 1MELA 1HH9A 2EYRA 4MJ5B 5JW5B 3U7AA 4OF6A 1YNTA 1S9WB 4H1LA 5HI5D 3GJFK 2NY3C 1Q0YL 4YC2C 4OLEA 3F5WA 2OL3H 3RI5K 2X4SA 5DFWH 1CZ8H 2X2YA 1MRFL 3BKMH 2ZOKA 2WBJC 4RWHA 1IKFH 3B9KA 1TJIH 4JFXB 1SVZA 4ZNEA 4D0CB 4DEPC 5C08D 2H3NB 3LIZL 4TSAH 4ZQKA 3IETA 4RQQB 4ZUWB 4BUGA 4C55A 5JUEL 3PWLB 3FT2B 5I18L 4Y5YB 2VN7A 4O2CB 1QSEA 2W92A 4GH7B 2CUIA 2A6DA 4WI7A 5HPMA 2PXYC 1XH3B 1UT9A 1B9ZA 3RVTD 5I1GH 2AEQH 4JZNA 5DHVA 3ARUA 4NQXB 1Q9KA 2PO6C 1NFDE 2CJUH 1JWUB 4XPHH 3GHEL 1I7ZA 2BC4B 1MFNA 1NMAH 3U0TA 3ZDYE 4PJBF 4TRPL 1FFOA 4PJIA 1I7RB 2UZYB 3QCVL 1NLDH 4KXZH 4LDOB 5HHOD 3U0PB 5EN2A 1Q38A 5KVDH 3HNTL 4OKVA 1TTUA 3LSOB 4YHML 2D7TL 1YQVL 4NNXA 2HT4C 3JZ7A 4GG6F 5C0JA 1VB9A 4JFQB 1V3MA 5EN2B 1SVCP 3E6FA 5LGHH 3L3KA 1BREA 1WZ1H 4WU5A 3QBTB 4AIXA 3IJHB 3ZKMC 4W6XB 1DVFB 1LEGB 1WBYA 3GJEB 3T0WA 3DSNA 2MJWA 3P4MA 2BVOB 5SWSD 3RQ3A 1S78D 1X7QB 5FECB 4PJEE 3HMXA 4GRLC 3D25A 5TE4L 3RUGE 2XY1A 3IU3B 2JK5B 2Q3AA 3VXMA 4EN3B 1UZ8A 1VDGA 5F1IA 1FLRH 1I7UA 2F19L 2LAGB 3O9WA 5FYJU 5CCKL 1NBVL 1J1XH 1PY4A 1Q8MA 4LKXA 4P3WA 5TQ2H 3S7GA 5KSBA 4J3XA 2HTLC 4EN3A 1CK0H 2BSTA 3SDXE 1QLFA 4PJ8C 3QI9D 4K7PX 1KPRB 4JFEE 1MCWM 3B83A 3FOLA 3JWDC 2E8ZA 3UZQA 1I7TB 2Q7YB 3BD5A 4LHQB 1H5BB 4XNZB 4NN5B 1Z3GL 4GXUN 3MNVB 3B9KB 2Z8SA 1NBYA 5HI4C 1MWAA 4FP8H 4GLRH 4U3HA 4JDVA 4YQXH 1DQJB 3MGOA 1YEEL 3ZSTA 1NCDL 2FATL 3U46B 2J8UF 1E27B 2KKQA 2DS4A 3I9GL 3MA7A 4KGLA 5DD6A 5J11C 5CMAB 5L2KE 5I9QB 5DHVB 2HWZL 2CKBA 2ARJQ 4HFUH 1QACA 1P5VA 3H7LA 1I1FB 3MSPA 3KR3H 2IG2L 1EAPA 2FJFA 4XBPB 4CADB 1NAKL 3QIWA 1LE5B 1I7ZB 2BC4A 5GGTL 4OV5A 3KJ4C 4HCRH 4S1SH 3WLBA 1LP9B 4JY6A 4LEOB 4XCCH 5MP6L 3JUYA 5HY9B 4HXAL 5F1OB 3OKEA 1C12B 2X7LB 3RDTA 1J11A 4Y5VA 5CD3B 4HFUL 2HWZH 4D9RD 3ARGC 3BEVA 1W72L 3IVKB 1IQDA 1WISA 1FJ1B 3SO3B 1MHPH 3PQYE 1YPZE 2SEBB 1I8KB 5BV7C 4LDEB 1HXYB 3IETB 4RQQA 3ZDXE 2FECL 2ICEB 2O5XL 3IU4L 1UB5A 4YFLI 1N5YH 4RX4D 5F44A 3VI3E 3T0EE 8FABB 1VFUA 2CH8A 1A1OA 5HYFA 1XF2B 2V5YA 3QDGE 5CUSH 1WFNA 4H26B 5B38G 3JTSA 4RIRB 3P73A 3C60D 2FWOB 4GRWB 3MRPA 4F2MB 2YC1A 5F8QC 3N1MC 1Z3GH 5FM8A 3MLSL 3CDCA 3NCFB 5EOQH 3HRZB 3F6IA 4XMPL 4NN7C 3VD3A 4Q6IC 3FQRB 2ZCHH 4OZIB 5HHXH 1KPUA 1TVHB 2DLFL 4DN3L 1ZE3C 1XCTB 4JHWL 5H8DA 1TCRA 2GY7B 2EDWA 2KPNA 5F9OL 1OAQL 3DXAB 2CO7B 4MCZA 4XC3H 1HSAB 4KUZH 4MD0B 1K85A 3DI2B 4FXLA 3X14A 3PWPE 4DOHE 1EFQA 3TIEB 2H2PD 1RJYA 3VE0A 1HXMA 3H0TB 1Q1JL 2JIXA 5I1JH 3MUGB 5E7BA 1G9NH 1T0NA 1C5BL 3LD8B 2EEBA 2HT4D 4UOW0 4OZHB 2J6EA 4GBXB 5DMJB 2I26N 1A3LH 3CFBA 2AEIT 4HWNA 5HGAB 4NQEB 3NCEB 3PQYD 2PW2A 1PBYA 1HWHB 4QYOB 5DUPH 1GGCL 4S10A 1U8QA 2FEDC 2W9DH 1U3HD 4U6XA 1I3RB 1SM3H 2YXMA 5LAXB 1FL3A 3UDWC 1A0QL 1JHKL 2BY0A 4LNVA 4NO0A 4NQED 2B8OT 5I30H 3H3KA 5MEOA 5HYJA 3RDTD 4HJGB 3WIIH 3TA3A 3K4AA 1HSBB 3HI6L