4I2XA

Crystal structure of signal regulatory protein gamma (sirp-gamma) in complex with fabox117
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
214
structure length
214
Chain Sequence
DIVITQSPKFMSTSVGDRVSITCKASQDVSTAVAWFQQKPGQSPKLLIYSASYRYTGVPDRFTGSGSGTDFTFTISSVQAEDLAVYYCQQHYSTPWTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of signal regulatory protein gamma (SIRP gamma) in complex with an antibody Fab fragment.
pubmed doi rcsb
molecule tags Immune system
molecule keywords FabOX117 light chain
total genus 47
structure length 214
sequence length 214
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-11-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4i2xA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4i2xA01
3CH1B 1BLNB 4WUKH 3P3YA 5J57B 4YHZH 4RMRA 4I8DA 2Q1EA 2XQBL 2YD4A 5KVFL 1ES0B 1CK0L 3MXWL 4NN7C 3K2UL 4NKQB 3FRPA 1IGFL 1BF2A 1WBZA 1TCRB 3EJJX 4FFWC 3GM8A 3ZTJG 1R24B 4UILL 5DVMA 1KXQE 4KTEH 2UYLB 3VGAB 5FOBB 1M1SA 4ZUTB 5J56B 2A0LD 2XTLA 1KIPB 2F58L 1G7LA 1ZA6B 1NGZA 2E7BA 4NNXB 2NY2C 5HD8C 1YEHH 2GJ6B 4Y0GA 5EU3A 4L29B 4LSRL 4F15B 1JPSH 1Q0YL 4Y4KC 3U6RB 5E8EB 4MJ5B 4KWUA 3HI5H 4PJ9A 5EU5B 2QR0B 3BXNA 4KTDH 2DQCH 4LCYA 4B50A 4KK8C 1TPXB 4PJEA 3WKML 4U1LA 4NQDE 4J1UB 1FORL 4IS6B 1ZHLA 3CU1A 1HH6B 4AY0A 1I9EA 4QY8B 5HYFA 5F7KC 4HEME 1BX2B 4XAWH 4P59H 1TFHA 3VRJB 3O4OC 4U1GB 1JNNL 1JWMB 3EOAA 4ZMAT 4BFIA 4YLQT 2I07A 4OGZA 3U36B 1YEIL 3QHFL 5CEYA 2KUTA 2ESVD 1I8IB 4YR6B 5EZIL 3ULUC 1B0GB 3VRJA 3I75B 5DQDL 1QVOA 4R8WH 3D39B 1JTTA 3RL2B 1NBVL 2B8OT 2GW5A 4PR5A 2VXQH 1RZIA 5CCKL 1DCLA 4TQEL 5E2WH 2DS4A 1XGQA 5EO0A 5DWUL 1PLGH 5GJTH 3HAEB 1FFPB 2DIBA 3QPQD 3D39A 4R4NC 4Y1AB 1CFTB 1NAMA 1A4KA 3I50H 1A7OL 1F4YL 2V2TB 4ZXBD 5CEZE 4DN4H 2ZUWA 2IAMC 4F37F 3LEXB 4OZIA 1E28B 4HIIA 4P23D 3FN3A 1SYSA 2N4IA 5AG8A 2VQTA 3G5YA 1YNTB 1CLOH 3QXWA 4NKMA 5JOPE 4FFYL 1H3WM 4KZEH 4CDGC 1QSVA 3IDUA 3ME0A 5DK0B 2XKSA 4WFED 3Q6GH 4M8VA 1X5XA 1MCJA 4JZOB 4XNMA 2OTWB 3LS5H 4OZFG 3LD8B 1RIVH 1KXTB 2XA3A 4FTVE 2VR5A 3VGHA 2F54D 2BSRB 3RFZC 4YR6A 4I3SH 4I0PB 1KULA 1IE5A 4AL8L 4TPRH 3KPMB 3O81A 4JZOA 3EYSL 1A7RH 4HX1A 4WTWA 2BVTA 3QQ4A 3OF6A 5I6XB 1MCEA 4N0YH 1VESA 3RGVD 3QDJA 3GMPA 4IOIB 2A6JB 5FGRA 4PJAE 5C71A 1JPGB 3SGDI 1L0QA 2R69L 3OKKB 3C6LA 4WO4D 5DJ8A 3SBWA 2MTPA 3QFJE 4UTAH 3D0VB 4L5FH 3O0RH 4X5WA 4Y16A 4WNQB 4X6FA 4KRMB 8FABA 3EYQD 4C56E 3SGKC 4GJTB 3QUKB 5C6TH 1NC2A 1M71A 4BA8A 3CVHA 3VGEA 3FT3A 3HNVL 1MFCH 5D1XB 3O6LL 3L5IA 2ZUQB 4GAGL 2YPLA 4Y19D 2VE6A 5DUBA 4EN3C 3BEWA 4QOKA 1XF5B 4HK0B 5EUOE 1R6VA 2BMKB 2PKDA 2YD6A 4HC1L 1IAIH 2E7LC 4PLJD 4OCLC 4ODSH 5C2UB 1SQ2N 2DQEH 1T2JA 3VFSB 4X7EC 4HFWA 4X80H 3ZKSD 5FGCB 4U7SA 2IPKA 4NT6B 1G0YR 4TVPL 3GGWB 4LNRB 4P3WA 1TETH 2W0KA 3WEXA 4R97B 4I3SL 1OGAE 4IIQC 4R7DB 4HV8B 2ZOKA 5D7LA 4YE4H 1RZGB 3OKYA 5DHVH 2J8UF 3ULSB 1PKOA 5D1QD 1JFQH 2VLJE 5IWLA 1INDH 5IGXH 5C0DA 3CLFL 1WTGT 4PJ7F 3UZQA 4ZDHA 4P5KB 1CLYH 5IT2L 5DD6B 4DVRH 3LKOA 1KEMH 3PDOB 2VDPL 3V5DB 5L8JB 1CLOL 3MRNA 5DJZA 1PKQE 4YK4B 4ZTOL 4JO2L 3O9WD 2JB6B 5D1XA 3C5ZD 4FZEL 3TO2B 3MRPA 1I3RA 2IF7A 3NZHH 1UACH 3QFJB 4DTGL 1FL6A 2DYPB 4WI7A 4Y2OA 3UO1L 3ALWA 4UV7H 1KJMA 1RI8A 2F74B 1AKJD 1U58B 3BSZH 3NCYP 4ODXA 5K9OB 4RISL 2B0SH 3LIZH 5ENWB 3D25B 1CLZH 2ZOKB 3THMH 5HI5C 2RIKA 3I3DA 4GLRH 4HCRL 2IBBA 4YDKH 1CVSC 4ODXB 5HVGB 4ZPVA 3JZ7A 3N1PC 1ZE3C 1VKXB 1H5BA 4XBEH 3QPQC 4QRUA 1S5IH 4P99A 1QLFB 3CU7A 1TNMA 2C3XA 4Z7QF 1LGVA 4F2MA 3MLYH 1N5YL 2VYRE 1OAXH 3DX8A 3RNKA 1YN6B 2IBGA 5EIQA 3F6LA 3HHRB 3QFDB 2XZAL 4PJ8B 1KYOK 3CFJA 3OB8A 3T3PF 2EDJA 2V5SA 4XPTH 3RA7H 5MEND 1CGYA 2XQYG 4O51A 2DD8H 1DEEB 4QHNA 3QO0B 2QQQA 1NANH 5BW7C 4JHAL 5GRJH 2ID5A 5J12C 3MNWB 1A22B 4HXAH 5L7XH 3P4NA 1JZ2A 3E1F1 4MYWB 2B2XH 4M6OL 2X42A 4BELD 5H37G 4ZYKA 4GRLD 1JPST 3MJ7B 5GRVK 2D7TL 4ZUSA 3QEGH 3VFVA 4J6RL 5T1LD 5E8DL 3DV4B 1D5ZB 2HKHH 3QH3B 4GG6E 1MVUA 3ARGA 1UWGL 5CZXD 4IIQA 5BMFH 4O58H 1FYTD 1EA9C 5DHYB 2QKIA 1IQDA 1MLCB 1N2RA 2P5WB 2CJUH 4ZAKA 4KKBD 1HIML 4I4WA 1KPUA 3TIDB 4Y4FA 4AT6A 3BP6A 3I6GB 3RIAF 3CXDH 5EC1B 5T3XL 6CGTA 2DLEA 3G6JB 4UINH 4ZFGL 4ZQKB 4Q0XH 4DN4L 5FUOL 2CRIA 1QA9A 1MIML 5I1AB 1A7OH 4OZGB 4Y1AD 3ARSA 4PJBE 5TDPA 5F3BB 5LG1A 1BEYL 3NACH 1AD0A 4MX7B 3GRWA 4HJGA 4I18A 4GS7C 3BZFA 4OZIE 1A1NB 4FXGB 5E24E 4R8WL 1VPOL 3C5JB 3KDMA 4LCWE 3MLVL 4L3EB 1T5XB 2DQIH 4I2XB 2I24N 5LCVL 1U3HD 1MVUB 4LPWA 3RZWA 4I18B 3P4OA 2NY0D 5C0FB 3UJIL 3NCEB 5F7MC 1EEYA 5DRZA 5L9DH 1T20B 5HDBE 4N8VG 5ADOL 1K3ZA 3ARFD 4P59L 4XP5L 1PBYA 3NIGF 4CVUA 4N90D 1IKNC 5DRXA 1NDGB 4DN3H 1GZQB 4PRAB 5D96B 3EW3B 3VXUA 3W0WD 1L0YA 4U33A 2NTFA 5E6ID 2ZKHL 1DQQB 3ZL4H 1CZ8L 4J23A 2A38A 4ELMF 1VEPA 1MREL 4PRHD 4HXBL 2A9NH 1DQLH 5TE4H 5FEBA 4WTZA 1QRNA 3CUPA 4PGCA 1DANU 3MBED 3O3DA 2V2WA 3PIQB 5T1KA 3QNYB 5FK9A 1IBGH 4XX1G 1HSBA 3TO4A 3LS5L 3P11H 4YDKL 2IALA 1OSZB 4LLUB 3VWJA 5T1KB 4NWTL 3VG9C 2IADB 5F1NA 4MDJA 3OKNA 1G7JB 1XH3A 4QHKJ 5BVPH 1LDSA 4IDLA 4ZNEA 3RVXC 3HZMA 2NY5H 1UM5H 4RDQF 5JPNA 4NO0B 2J6EA 1H15A 5E9DE 5JUEL 1Q38A 1X5LA 3BZ4B 3VG0L 4R9HA 3HZMB 3OKEB 3VGAC 3MACL 3BJLA 1P4IH 3L3GB 1OWWA 1WT5C 4M1GH 1NFDE 2Y6SD 4L3ED 1IC7H 5IIEB 1D7FA 3IRZA 4XCEB 4ZOBA 1OSZA 1T6VN 2XOTA 5I8OH 3TO4B 4K3EH 2HLAA 2ZOLA 5HHMB 2JLLA 4G3YH 1U3YA 2H2SD 3RWCB 2ZSWB 2APVA 2IC2A 4ONGL 3OPZL 4X0KA 2Z4QA 2HJKB 2W59A 4Z7UB 2X44D 3OSKA 3KPOA 4LCIL 4XPFL 1DLFL 1GAFH 3MROB 1FVCA 3V0WH 3WFCH 4HH8A 5IB5B 3H9SD 3B3IB 1PW3A 2GJ6A 3LH2L 2D9CA 4D8PB 2P42B 3CH1A 5BQ7B 4YHML 5E7BA 4PJXA 1DE4A 3WFDH 5E2VH 4P3CH 3HE6C 4V1DD 4MSWA 4G9FD 1WF5A 1IRAY 1D5MA 2ZPKH 1ORQB 4HUVB 4BYHA 1ORSA 5IBUG 3OKMB 2Q7NA 5CEXA 4M1CC 2HG5B 3EYVA 2VDQH 3P30L 3UTZA 4MA8L 3NCJL 3SJVA 1I85C 5I16B 1HHIB 2ZUTA 4QEGA 2VNCA 5ANMB 1KB9J 2XXMB 1T2QL 5A16B 3Q3GB 1LK2B 4PJCE 3UAJC 4DN3L 2LU4A 2ZNWA 3HPJB 4AEFA 4KVNH 1A8JH 4JDVB 3MBEA 1WBYA 3TWCH 4X6EB 4Z95H 3A6BL 3O2VL 4R96A 5SWZB 1KIQB 3T1WA 4F7TA 3PQYB 1A3LL 2PW2A 3T77A 4XVSL 1K4DB 5I74B 2E27L 1PY4A 4D0DA 4G42B 4Y4HD 3T0AA 1H8SA 4O9HL 5L7XL 3LB6D 4Y2DB 1FFOA 3BP4B 4JFQB 5JW3L 1Z3GL 1BD2A 3OXSA 5IG7B 3WXWL 4X8JA 5CEXB 4NWUH 5FO9B 1MQ8A 2E6PA 3PJSB 3W39A 3H6JA 1DBMH 4WW2C 4HKBA 1KBGL 5GS2D 3EZJB 5AZEL 4D9QD 5KSVA 4WFFE 2MPAH 5T1LB 3FT3B 4HG4K 4OGYH 5T5NG 1T1YA 4G43A 1WGOA 2Z31D 5HHXL 4WFHE 1OAXL 3D6GA 3HNSH 1HHKA 2DKUA 1T4KB 1Y6KR 2BOCB 3U4EB 5DJ2B 1CT8A 1HKLH 4IJ3B 3F7QA 4LLYA 4Y1AA 3W81A 2DLTA 4JDZA 2X89D 3VFSA 3RWEB 1WITA 4P4KD 1QSZA 4DAGL 3PGFL 4AENA 4JG1H 3MJGX 2I60L 4M8QB 3GMPB 4IOIA 5HI4D 3TBSB 3WKNA 4OFPA 4PV9B 4KHTL 5C07B 5JIPA 4F7PB 1IBGL 2DQJH 2D03L 4X8JB 4UV7L 4GKOA 4WI2A 4I18C 3LSOA 4M5YL 4GSDH 4HK3J 1OAKL 3FO2A 3ZO0A 3V52H 2YMXH 3S4SB 3HI5L 4G6JL 3W82A 1F3DH 4OLUH 4YFLI 5AAWA 2WBKA 1M4KA 5KVMC 4LSRH 1FZJA 2NX5E 3GFUA 1TITA 4W4NA 5HDOA 1UM4L 4MZ3A 2XACC 2HH0H 3AB0B 4HUMB 1ZAGA 4YHLH 3ALPA 5DUML 1F13A 2F74A 3RDTD 3QDJB 4YX2L 4HK0A 5DUPL 3SGJC 3GSWB 4Z77B 2ICCA 3QP3A 4QXUH 3HFML 3LS4H 4Z7VF 1P2CB 2DBLL 4GO6B 2BC4A 4PV9A 3FB5A 1ZWIA 1B6DA 1BZ9B 2H9GB 5JXED 3JWOH 2V6HA 4X4ME 1HK6A 2CDEA 4X7SH 1CXLA 3T3PE 4KJQD 2CO6B 2DICA 5F7NC 8FABB 1JWUA 1LDPH 4ZS7H 5IQ7L 1UKQA 1FLTX 4JPWL 2B0SL 3WDIA 1NCAL 3L3DA 5JMRA 1KCUL 1KC5L 3HG1A 4YIQB 1OWRM 2EDRA 3SKMB 3GI8L 3WO4B 4HH9A 4YDIH 1OCWL 3RGHA 5BW7A 4PFEA 3PV6B 5HVHC 2BHYA 4OLEA 3U4BH 4QRRE 1CD9B 2W9DH 3U0WL 4C56D 4DEPB 1MCPH 3S3PA 5CGYC 4N8CL 1IGIH 1F3JA 5DEGB 5F93C 3BN9C 3FT2A 3C2AL 3GNML 3UTPE 3BP7B 5D7IE 5KAQF 2YUZA 4Y19E 3TVMB 3VE0B 1NGWA 1UWGH 2OJEB 2C1PA 4U1HB 3BUYB 3SGDH 3IFOA 3L1OL 4J4PD 2Q76A 2VXVL 1WZLA 3DTXA 4A6YL 5DO2C 4OI9A 4KUZL 1CFBA 2C9AA 4K3JH 1OARL 5C6PB 4A2MA 3GMNB 4NZTH 3WIHL 3ESUF 4LRNL 4DOHE 2XT1B 2IFFH 4CN1A 2IAMD 5TE7H 3X3FL 2NXZD 3K8MA 1BAFH 4KK6C 2XTJB 4PRIB 4PB9L 4GRLC 3HZVA 1OQOA 5ADPH 4I3RL 1YEFH 3V5KA 4S1RH 1HHGB 3KPPA 3B4NA 4JFDA 1XGYH 5HDQH 5CSZB 4ZAKB 4M4RA 2FGWL 2FEDD 1NSNH 1YN7B 3CMGA 3QIWD 2VLLA 3QWRD 4Y4FB 5F7YC 3TCLB 1FDLH 3T0BA 1LE5A 5IJKA 4XHJC 3WIHA 3UJJH 1I7ZB 3DX9B 3WS3A 4BZ2L 4PY7A 4GBXA 3QA3A 1KPVA 1TQBB 1C5DA 4A6YA 5D1XC 4JHWH 5K9KB 4DZBB 3GSUB 3P73A 2AV7A 2YUWA 2CO7B 1R5VB 5KTEH 3SGEI 5DQJB 3UCRA 2XZZA 4F2MB 2ZJSH 4WUUA 5A40E 2YA1A 4OD1L 4K2UL 2PR4L 2A6IB 3EOTL 5ITBL 5CHNA 2DI9A 4IMKC 4QTIL 1B0WA 3OX8A 2R1WA 4NUJA 3RUGB 3BMVA 1MI5A 5ILTH 5DQDH 4XHJD 4W6YB 4AEHH 5EZIH 4C56B 4O2CA 1YEEH 4UV4H 5E8DH 4NRYA 2W9EH 3FB6B 3BKYL 2NY0C 4X6CF 5SV3A 3LKQB 4HKJA 5L2JB 1LK3L 5HHQA 1GZQA 4PRAA 3TT1L 4H0GA 3GRWH 1WTLA 2B1AL 1TZIA 3FQNA 1N0XH 4Z76B 1ZHBB 1N6QL 1XIWA 5CZKA 5I73B 4M93B 2B5IB 3VRLE 5SX4H 1FCCA 4EDXA 1S3KL 1A14L 1XR9A 2J3SA 4O2FA 5CD5D 3PGCA 5F9DC 3OG4B 5JW4N 1P5UA 5D1ZB 1MRFH 1RZKC 5C0EB 1KTLB 3S5LA 1JYNA 2EDOA 2DIAA 3MRMB 3FZUD 4JM4L 1D5ZA 2BVQB 2DB8A 5KJRH 4NRYB 4LF3B 5GPRA 2MMXA 1A7BA 4GRWF 5AZ2H 3U4AA 1IZKA 4LVOC 3VDBA 4U1SA 1KEGH 1GGBH 3EYOA 1JGVL 1FRGL 4ODHL 5AYUH 2JF1A 4MLSA 2Y7QB 3TP4A 2A83B 2PCPA 1HKLL 1R3LA 2JJWA 3O6KL 2Q7YA 1ZMYA 4XAWL 1REIA 4MQ7A 4Z7UF 4EDXB 1KTDB 4LMQE 2VDKL 4KK8D 3QIWA 3QWRA 4O2FB 2C3VB 4KDTC 4HUUA 5IW1B 4OM0L 3EYFB 5FUZH 1CGSH 3O0RL 4N1CA 5C09A 3UXFA 1FC1A 4JFPB 3U30B 4UNTA 3MRLA 2R69H 4HIHA 4JFDE 1WZKA 2QSCL 3MLSL 1J12A 1WISA 5SWZD 2ZCKH 2Y6SC 5IMLA 3HE6A 1NGQL 4JN1H 3X13B 3GIVA 2YRZA 1UWEH 3CFBB 1MLBA 3MRHA 5ABDE 4U6XB 5D5MB 5EU6E 2X40A 5L8KB 1X5FA 4EI6A 1NDGA 5TDNA 3ULUL 1GC1L 1A3RH 3ZYIA 1S7QB 4Y4KB 3IDYB 1QNZH 1FVCB 4DK3A 2FX7H 3WUWB 4OD3L 4JZJC 5DYOB 5F7FA 1KF9B 3VWKA 1AXTL 4OCMC 3IDIA 3IVKA 4LLVB 4P46D 4RFEA 3L3OB 5ALBL 3VXSE 4LSPL 1N7ML 3VWKB 2HKHL 2AJXL 1GXEA 2DWDB 2I9LB 5KBNC 1NBYA 1ORQA 3D3VD 4RA3A 1DVFA 4B7IA 4PJCF 4F33B 2HWZL 5IIEA 1T80A 4U1GC 1P4LB 3MO1A 5FECA 2EC9T 3OV6A 4QTHB 5T1DL 1IKFL 1J18A 3VXMB 1RJYB 5E5MB 3D85D 1GC1H 6FABH 3VWKD 1MLBB 5DZOA 5CJ5A 1WIPA 4RIRA 4NO0A 5I1KH 3M17A 1D5BA 5GGRA 1A02N 1BM3H 1HILB 1NL0L 2CKNA 5EU7E 4KZDH 2EEBA 4AIZA 2GTZB 4P5MA 5EB9A 3REWA 2D31A 3FFCB 3OAUL 4F15C 3NGBC 1MHPH 4WCYL 1JF6A 1IAKB 1UXSB 1FIEA 3BPCA 3CZFA 4RAVA 5I1JH 3GHEL 2NY2B 1AP2A 2GSIA 4PJHF 4X9IA 3L3OA 4LHUD 2YD9A 4RX4D 1IGML 1RJZB 2APXA 3BT2H 1SY6H 4EDWL 1RMFL 4L4VE 2XA8L 4RAHA 2OTUA 2AABL 2HLFC 3SKUD 4LASH 3UBXB 5EOQL 2AXFB 1TJGL 5FOBA 2IFFL 3IB4A 1S5IL 5DZNA 2JIXD 1BJ1J 3BESR 1OHQA 4GW4B 5F9AC 3GSVA 3FAXA 1CR9L 4YXLH 3WKMH 1GYAA 4N8PA 5KN5A 4YJZL 12E8L 1FZMA 4Z7UA 3SDDB 3E3QC 4NO2A 4X0KB 2HT4C 5CUSH 2O61B 1Q9OB 3LIZL 1IEAB 5J6GB 3MYJB 4GAYA 5I8KL 3WMSA 3GNMH 2PYEE 2ARJQ 4ODWB 4FXKA 4D2NA 2M8XA 4YHYB 3CH8A 1C16A 1OSPL 3O4LD 1TQCB 4RWYL 4NPYA 1FIGL 2FR4A 3WBDA 2EYSA 4RAVB 2MHAB 1YC7A 3QHZL 1C16B 3EYVB 4Y2DA 3WCYA 4KAQL 1SJHA 2Z8SA 3OJMB 1PZUB 1PVHA 3IGAA 4Y5XC 4IHOB 3BQUC 3EYQC 5BS0A 4JQVA 4WEBH 3QCUH 1N3NA 2XY2A 4HZLA 5KN5B 4AEEA 1UCTA 3PWUB 1FZMB 2FRGP 2GJZA 3EFDL 1OY3B 1YEEL 3MRQB 2BNUB 1D5IL 3BGAA 3VFTA 3QNZA 1J7VR 5D70L 3EO0B 3HNTL 5E0QA 1Z0NA 4JN1L 1RMFH 2NY3B 4PJGF 1ZA6A 1FG2A 2QQNL 2DLIA 1AQKH 5GISL 2J88L 4PBVC 4HX1B 3HUJF 7FABL 3RL1B 3QUZB 2EDDA 2B20A 4G7VL 3SPVB 4JQIL 1Q72H 5FV2A 3UZEA 4BFGA 4RDQG 2W38A 1MFCL 4YWGL 4MQXD 1N5AB 4CN6A 4NHUB 4LNVA 2GEEA 1HSAA 1AR1C 2WWMC 3E2HB 5I76B 2CDEB 4YH6A 3CVHH 4RGNC 4UDUA 1JPGA 3P0YH 1KB5A 4U3CA 1MRCL 4OBRA 1UH4A 1A3QA 4LHUG 4N90E 6FABL 5I66A 3KYNA 5D7KE 2DQIL 3DMMC 4KHTH 1JNJA 3B9VA 5LGJA 3DO7B 3T3ME 1EPFA 4GBXD 2YWZA 1I8KB 5F6IB 5D2NE 4CMHB 2D0FA 3C60D 4MB4A 2B5IC 2P5WE 4Z6AT 3MV7D 3BGFC 3PL6A 3MJ9A 5DFVC 4G7YH 1T3FA 1RVFH 1BPVA 4JEGB 2VWEC 1EJOH 2A9ML 2AXJA 2C1OB 1FZOA 1OT2A 3O3EA 4LPXA 2H8PB 5MEPA 3O11A 3V6FA 4Z7WB 4TSBL 5EO9B 2R4RH 3KJ4B 1F58H 4JM2F 5FDWA 4C59B 3DSFL 3IFOB 4ZD3L 4AG4H 4RMQA 1JVKA 5HVFB 2I5YH 2VITB 3CLEH 2H1PH 2ADFH 4M9PA 4F7PA 2YXMA 4I1NB 3SEPA 2BC4B 1U0QA 1JMXA 5DC4B 3U9UA 2PXYD 4B0MM 1F3DJ 3DVFA 3TJEL 2VDOH 2CSPA 5B38G 2JCCE 1OAZH 1NGXA 5DD6A 5JOFB 4G80A 3QG6A 3QDGB 3IAQA 3QISA 4OFIA 1YPZA 1NCBH 3O8XB 3O2DH 2NY3D 3MUZ1 4MWFA 3OL2A 4MA1C 1A6TB 2DQDL 3MFFB 4JR9L 2F8XC 2ENYA 2NY4C 5IBLC 1QSFD 4MD4B 4S2SA 2VXQL 2H8PA 3JWOC 5GS0C 3IKCB 4G9DB 4MAYA 1I7ZA 2XFXA 5EIIA 1LWRA 3H3PL 4JRYA 3GSNB 3PHQA 2GK0A 4APQD 4ZO6A 2NW3A 2PYEB 1RHFA 5I19H 1K5NA 5E9DA 5JZ7C 4PJ7E 1JNNH 3GMMB 3SDAC 2JJTA 1IGYA 4U1JB 4L5FL 2ARJA 1S9YB 1TZHA 1YQ2A 4BKLA 3GSOA 5I1DA 2OMNA 5EA0H 4Y16B 4I0CC 4WHYH 5JXAH 3VXSA 1NJ9A 3OZ9H 1UH2A 2DJ4A 2R2BA 3SGJA 5BOPA 5BXFB 4KRNA 5E2VL 3HPLA 5JHLH 1DBJH 2CUIA 1HXMB 3L6FA 3EDEA 2NX5B 4WIQA 4P9ML 3V5KB 2OZ4H 4UQ2B 1QFUL 2P5EE 3QAZC 4PV8B 1IM9D 4JFEB 3V0WL 3H7BA 3HC3H 3QDGE 4LOUC 4JFFE 4M4PA 5E6IC 2GK0B 3L7FB 4OTXH 3VXRD 2BNQE 3MCG1 1P9MA 5IROC 5HVHB 4ZPVB 3OJ2C 2OYPA 4OFYA 5EUOF 4M48L 3QDMB 3DJ9A 3RHWF 2FHFA 1Y6MR 4QRTB 2F8VA 1IGFH 4LAJH 3ARFA 2E7CA 1RY7B 5FUCC 43CAB 4W6XB 3W5NA 4UT9L 3B8SA 1EFXD 5B3JF 1BBDH 1KG0B 2R1YA 4Y88A 2H45A 3MMEA 4YUEL 3STBA 4U2YA 3QG7H 3LQZA 4LKXA 5MERA 3HZVB 1M05A 3N1MC 4PGZA 1DBJL 3HA0A 5CHNB 1S7XA 4OD1H 1J05B 2IANE 1HHGA 5TPWL 4LEXH 4G6FD 5HD8D 2CDFB 5FUZL 1L9NA 1XF2B 1A47A 2XWJB 4X6DE 2EO1A 4R90L 3E6FA 1GZPB 1FBIL 5CILL 3SDCA 5AG9A 5IQ7H 3E6HB 4K8RH 3IJYA 4RQQA 4MCZB 1UZ8B 4MNGB 1FC2D 2PYFB 5E9DD 2RGSA 4TTDC 1UVQA 5ID1B 2PO6B 1CR9H 4ZYKB 1P1ZB 5TDOB 4G8GA 3BPOC 4QGTA 3A6OA 1ZT7B 5IMMB 2F53D 4WFFD 2WUBH 2Q8BL 4PJFE 4OZFA 5C07E 3LDBC 1RJLB 3D3VA 1QSFA 3HCVA 4JM2D 2WAHA 1RZJL 1QFWI 2ZUXA 3OX8B 5HY9B 3CAFA 2X4SB 3RVUD 3GBML 3N0PB 3A6BH 3OKLA 3MMEB 4HWUA 2V5YA 1P7KB 3LKPB 5E99H 1D6EA 4ZUWA 4OD2A 4QRSB 5AD0A 1OD9A 2P5WA 1CE6A 2A73A 2W91A 4NM4L 5F3HA 5SV4A 3D69B 3PGDB 5BOZG 3LQAH 2ITDA 3DUSB 1ZHBA 2IPTH 3AS0A 1A14H 3UTSD 3SDCB 2PYFA 4DGYH 4OV6F 1CFNA 4DKEH 1F4WH 5BVJB 2IAND 4PTTB 2MOVA 1CLYL 5C0BD 4UOW0 4JJHA 3RY6C 1F58L 3KYKL 1FN4B 1B4JH 4NZUH 3G08A 3N9GL 5AUMB 2AJUH 2NY4D 1Q1JH 3MLZL 2XG4A 1C1EL 2CIKA 5C6WH 4Z5RA 2P46B 4RWHA 5ID0B 2X4TA 2X4SA 5AUMA 4GG6B 2AK1H 3HCVB 2R4SH 1CN4A 3HMXA 4G5ZH 2GSGA 4CJ1A 2VLKB 5FYKL 4X9GA 1I75A 5JZ7D 5I9QB 1N4XH 2EE3A 1KJVB 2BSSB 1FVEA 2VAJA 3IS0X 4ZSOA 1MJJB 2GTZA 4WENB 3SE3A 2X4OA 5I8OL 3HAEG 1S7SA 5JW4Q 5HPMB 3EDJA 4KUCF 4S1QL 1EGJA 5L88L 3BE1H 2EYTA 4TQEH 5E2WL 2VZTA 5HGDB 3CUPB 1WCBB 5DMYA 3RKDD 1L9MA 2H6PA 3CC5B 1CTOA 3AC0A 5INDA 5C8JA 3IDXL 4JO4L 5IMLB 3IYLW 4QRRD 1TCRA 3WN5C 3QQ3A 4B7LA 3BKMH 3CFBA 3JWDC 2GSGB 4ELMB 3CC5A 5IW6B 4M48H 1NBQA 3EFFA 4XPAL 1J5OH 2DQHH 4PRHE 3BWUC 4KDTA 1MJ7L 2GAZA 4ZFFB 4GRWB 1DBBL 4Q2ZB 5LGHH 3DWTA 4M7ZC 4XH2B 1S5HA 3QCTH 1SY6A 1DL7L 2VLJA 4AZ8A 3MRBB 4P4KB 4OV5A 1OGAB 2WINB 3V4UL 3L3GA 3S9DB 4QRRA 3GSQB 1T83A 3UTTA 3LKSB 3KAAA 1U3HB 3BIKA 5EZJA 1JGEA 4NGHH 4XXDB 5HTSA 2YSSB 3GUTA 1IVLA 1FLRH 5JR1H 1T22B 3O4LA 2A74B 1RULH 1KCVH 2X70B 3HN3A 3DHJA 1QRND 3CDCA 4PRHA 3UROR 1DBBH 5HHOA 1MWAH 3DX6A 3TA3B 3VXMA 3UTQA 4LU5L 4PUBH 1KIPA 5I1KL 4I13B 4KI5E 4HLZG 1U2HA 4NNXA 1U8JB 1MIEL 1VFUA 2M2DA 2B4CH 4HPOH 4R4FH 1FH5H 4MHHI 1F6LL 4Z0BH 1XIWC 3AUVA 3GO1L 5EO0B 3RWHB 2WANA 5DQ9A 2IGFL 3TCXA 4MDIB 2B7DT 2RB8A 3QIBC 1GIGL 4WV1A 5F7EL 3LMJL 1IGMH 2VZUA 2ED7A 2KZWA 4MSWB 5I1CH 2E9JA 3KS0H 4OZIF 2VLRB 3VG9B 2VZ3A 4ZSOE 5ISZD 4GW4A 3P4MB 4J7RA 4K9EL 4NOFA 5KOVC 4IMKA 4XMKL 1JNHB 3MRRA 1WFUA 1LK2A 2X70A 1TJHL 3ARPA 3T4AB 3EJZC 2P8MB 1LO5B 4NO0D 2R9HD 4UU9A 4HUWA 1MFBL 4Q6IC 1RZIB 4Q9CA 3MRJB 2PETA 1BBJA 1U95B 3LQMA 1YC8A 5I1HL 2VR9A 1INQB 1CL7H 1UWEL 3HB3D 4GBXC 4OKVB 1RIUL 4P5TC 4U49A 3GB7A 4LDLB 1FFOB 1MAML 3BP4A 3ZDZF 1FG2B 4G42A 4ONHB 4MXQD 1A6PA 3UTPD 5E70A 3KS0J 1DQJB 1G7MA 1ZANH 4ESKA 5TE7L 3X3FH 4ZFZB 1FH5L 4PJ5D 1MCOH 3P0VH 1VA9A 1KXVC 4LLAA 1BWMA 4GRLA 2R8SH 4QY8A 3FQTB 2AEQH 3LKRB 1ZT1A 1DQJA 3NN8A 3AAZA 3S35X 4NZRL 4XNQB 4YHPA 1G1CA 3S3SA 1RURL 3G04A 3ILPB 3MPCA 5JXEA 1MNUL 2RCSL 4NKOB 1AR2A 1F4AA 3H7LA 3LS4L 5CGMA 2CRYA 3MLRH 1QFPA 1U95A 3VD3A 1PQZA 1BFOA 4D9LL 3WXVH 5JORA 2L0DA 4NKOA 1ITBB 1QSFE 3RL1A 2HVJB 5IHUH 4L8BB 3D2UD 2ZCKL 1KENL 4KQ4H 2YN3A 1QG3A 1T7XA 4PJBF 4RGMC 4V1DB 3TPUA 2NY6C 4UMGA 1NDMB 3QUZA 1MY7A 4S0SD 4G6AD 4F7TB 1JGUH 2QHRH 3IKCA 4G9DA 3TBSA 4QNPE 3FO9B 3HRZB 3FB7A 1G7MB 1E4XL 4UNUA 4TN9A 4IS6A 2VDKH 5IFJA 4PGBA 4WRLA 3P9LB 1FV1A 4OFYD 4L3EE 3ES6B 3ARDB 4Z95L 2DRUA 3K74B 3MV9A 1EO8H 4JPVL 4N68A 4YHPB 5E8OB 4FFYH 1MWAL 5DEFA 1IM9A 4YGVA 1OAUH 4HWZB 5EOCJ 5TPWH 5HYQB 1LMKA 4R0LA 3RJQB 3I75A 4CKVX 1OTSD 2XPGA 4X99B 3TO2A 1H3XA 1G7QB 4HWBH 1FAKT 3RDTC 3PL6B 1I3GL 2DL2A 1EHAA 5DD0L 2X89A 4HFUL 3VGGA 3BAEH 3TN0C 3AS2A 2XWBA 3I02B 3BUTA 4P9HL 3SDXA 3SKNA 1KTKE 2G60L 3EHBD 3FO0L 4QHUA 2EXWC 4ISVB 4HWEL 4Q9RH 2AK4B 2FYYB 1K6QH 3A67L 2C5DC 2K7PA 1K8IA 3BE1L 2N56A 2C1OA 4S1QH 4D0DB 1Z9SA 2E7HA 5CBEB 1UXWA 1Z9MA 2EKJA 3H9SB 1YY8A 3TVMA 3VE0A 4XMKH 5IUSA 5ICZA 4APQA 1R3KA 1DLFH 3CXHJ 1MAKA 1EO8L 4GMTL 2BNRE 3CMOL 5JOFA 4JANA 5D1QA 2BNQB 2GY7B 3R8QA 3QDAA 3T2QA 4E42B 1UQSB 2ZP0T 3MRPB 4PJCB 2YA0A 3O3AB 3RY6A 3L5XH 3PV6A 5E2TL 3IKKA 3C6LC 5I1GH 4Y5YA 4ODTH 1AY1H 1RZJC 1S9WB 5GGTA 4FNLL 4J3SA 4HPOL 4KH2A 4R26L 5IESL 4CVZA 2CGRL 3U0PB 4K2UH 3JXAA 1CGUA 2AI0L 1MHPL 2BY1A 3GBNL 5K59F 5D2LF 4NBZB 2X10A 3MRDB 4ZPTA 4GAFB 3GGWA 1L6ZA 2YD3A 3CFDA 4YBHA 1T1WB 3SCMA 3GSOB 1FAIL 5FYKH 3VFUB 2YC1B 1RUAL 3EJYD 4WW2A 3UPRB 4XP4H 1KPRA 5D7IA 1JHLL 3NPZB 5J9PB 1S7WB 2VB5A 3V5DA 3PL6D 1A2YA 3T2OA 4OQTH 1CXEA 3G6AB 3QI9C 5JA9A 3L6FB 1FNGB 4IIQB 2D7TH 3C60A 2VSDA 3O9WB 2GJ6D 1CE6B 5DXWA 3VDAA 3I3BA 3RPIB 3RAJH 4M7JL 1UZ6F 2Q8AL 4PY7B 1BF8A 5KS9A 5F88B 2NCMA 1EXUB 5BZWA 1TVHA 5CEZL 1XF2A 4UNVA 4AG4L 3C60C 4HSQA 1MFDH 3FN0L 3R06A 5EBWA 1EX0A 3N06B 1QA9B 5I1AA 3MBEC 4CU6A 1DTUA 4D0BB 4EVNA 4UOW1 3KVQA 4YO0B 4NP4H 1FN4A 4D9QE 3CDYA 4BFEA 4QXUL 1SM3L 1ZEAL 3IXAA 4G7VH 1I85A 1U8PA 1BQHB 3AREC 1ITCA 1QFOA 4OCWL 4BUGA 4P23A 3SY0A 1NQBA 4PB0H 4L3EA 5D4QA 5A2FA 4C56A 2ZCHL 4UT7H 1UGNA 1MI5B 1PYWA 5D1QC 1EDQA 3QFJA 2BDNH 3O6KH 5HHNA 4OIIL 1X7QA 3VW3H 2LFGA 3WD5H 1G9NL 2C4XA 3FO1A 2V9TA 1H3PL 4NUGH 2F19H 2NY6B 2DQTH 2EIEA 4GMTH 3KLHC 5LXGL 3C6SB 4NN5B 1E4WH 3PDGA 4Y5YC 5DLML 1CE1H 1MHEB 4H1LH 4YWGH 3EZ8A 3TNMA 3MR9B 3P4LA 4BUHA 4XCNB 5DMJB 4NO3B 2DQGL 3BFOA 1ZHNB 2CMRH 3FQRA 4G8FB 1JZ6A 2FB4L 5DUPH 2Y06L 5HYEA 3TO4D 5DMIL 5D6DA 3P9MA 2MSPA 5JDJA 1Z2KA 2ADJB 4OCRL 4XWGH 1YN6A 5C09B 3PP3H 3DI3B 5L2KA 1CL7L 1KIRB 1ACYH 3SDDD 2JTDA 1S7RB 4ZUWB 3VFPA 4MJID 3SE9L 5A43C 3MUGA 1A9BB 4PJ9C 3RWFA 4NP4L 3GJEA 3DBXA 1A6VL 1IARB 3LAFA 4BFBD 4ZFFA 4OGYL 2HAZA 1PG7H 2Y7QA 5IJVB 1F2QA 4Q2ZA 4O4YH 3ZTNL 1IGTB 3O3UN 1HKFA 2ORBL 5ERWB 1E6OL 4HKJB 3V4VL 1XZ0A 4D94A 2Z8RA 1F45A 1GRWA 1I3VA 4MAUL 3E8UH 5TFSH 2M1KA 4NWUL 5TF0A 5GRVL 3JV0A 5C0AD 4CVWA 2BSTA 1UA6L 1QFUH 1SJXA 4XCNA 3TZVC 4R0LC 3OAYH 4WY7H 4U0QB 1MHEA 4JREC 3BKYH 1AHWB 4XP1H 2I60H 1QP1A 1M7XA 3U82B 4R2GB 2VN4A 2QADC 3O8XD 2AXHA 3RUGE 4IEFB 4X9BA 3S5LB 3NCFB 4HS8L 4K3HA 2YD5A 3P4OB 4L9DA 1KIRA 3RWFB 2Z31A 1BQLL 4X7TB 5DTFA 3CSGA 4HJ0D 5A2JH 3NFPB 5I1EH 1V7ML 1VGKA 3MRKB 1GGUA 2BVPB 5IB1A 4OFVA 4OZGF 1RZ8A 1HINL 1WBXB 1T7WA 3DURB 1Y6NR 1KJVA 1MNUH 4PJ5A 1UJ3A 4YFLF 4DFHA 5EOQH 4J3UA 1Y0LB 3MSPA 1X5GA 2CRMA 4GKSB 4LSSL 5T3XE 4U6YB 1DSFL 4NM8H 2GFBA 1BQUA 1U3JA 4X4XB 5DJ6B 2ZZUT 3VXUB 3VD9A 3GKZA 4NQVB 1CD0A 1YEDB 1QBML 5FUCE 1LEIB 4ELKA 2XQYK 3AGVA 3DMMA 1MFEL 4H0HB 1L6XA 3T2NH 4PPTA 5C0FA 1EGJH 1T22A 3O4LB 4WVRA 1A6WL 4TTDD 3QQ9C 4M6NH 1OP9A 5HDBF 5M95B 2UWEB 3O6FC 3RWDB 3UTZB 5DRNA 4NZJA 2VDPH 5IB1B 2QSTA 3IT8D 5LJYH 3NFPA 3AROA 1GOFA 1D5BB 1YMHB 5IW3A 2VLJB 1G9NC 5IHBA 3EJYC 1UKTA 5EUOA 1O7VA 3VD5A 2R0LL 3ARDD 4QOKE 1IGIL 1Q9KA 3DIFB 5SWZA 1MCKA 1AO7B 3QZWB 4P4KC 3CFKA 3LRSB 4FXKB 4PG9A 4Z0XA 3CPLB 4FQLL 4P9HH 4TSAL 3CK0H 1FNFA 1BQLH 1RJZA 1KSRA 4P5TD 1R5WA 3QO1B 3EDFA 5DSCB 5EZLB 2J6EH 1CDBA 2QQKH 4JQVC 5IBTH 3B2UC 2ESVE 4H8WL 3QXAA 1W2KT 2I9LA 3D18A 1KCUH 1KC5H 4PRNB 5H2BA 2NXZC 2GY5A 4RGOL 5I8CB 2ITCB 5DRNB 2X4NB 3W11C 1TMCB 2HLAB 5GGRY 2DBLH 4P2OC 1TVBA 1K2DB 1PEZA 4L4TE 3OPZH 2H32H 2F8OA 4PJ7A 1T1XB 1NGQH 3HAEH 1M7IA 1QR1A 1DEDA 3MLSH 1ZK9A 1T0PB 4FQIH 3TBYA 1DUZA 3U2SB 3AS3A 3VCLB 1Q9WB 1VFOA 1JK8A 1Q94A 4F57H 4LBEA 4HIJB 1CT8B 1OOAA 1CGSL 3U48A 4I2XE 2UV3A 4FTVA 4CNIA 1NCWH 3GDBA 4JDZB 3FTGA 1AQKL 5GISH 2HP4A 1HDMB 3T2PA 3VCLA 4LCYB 4OLUL 2FGZA 1FL5A 3C5ZA 4QRPB 3RVVD 3ULUD 3UX9B 3T0VA 2QR0A 1C08A 3KPRD 5DI8B 4DFIA 4OJFL 3CFCL 1IT9H 4OI8A 4XVUC 4Z7NF 5EBMA 1D5MB 3VI3E 5JA8B 4DZ8B 4HKBB 1P4BH 3BPNC 1MEXH 3GBLA 4HUWB 5D5ME 2HFTA 3UJTL 2JCCA 4NNYA 5D7JC 2YUXA 1J11A 3LV3A 4PJAB 1EGJL 2ITCA 5CMAB 4KTEL 1JP5A 3U36A 3LCYA 1WK0A 5I16A 4TVPH 4QO1A 2XPGB 1X5JA 2Y5EA 3HC4H 3T09A 2ERJC 1K3IA 1DLHB 1QOKA 2AABH 3EO0A 3NFSH 3SOBL 4LLYB 1GHFH 1H3PH 4KQ3L 3MYJA 4GAYB 1HQRA 2H32B 5E94A 5KSBB 1JPTH 3KYMA 5LCVH 4PJDB 2DBJA 5T1KD 3SO3C 3KNBB 1W0VA 1IAII 3HAEA 3B9EA 4R96B 1PDKA 4RGND 4WI5A 5KTEL 3HNSL 1V3LA 2FJHA 3GMOA 4F7CB 3WO3B 4NBXB 4ZFZA 3ZHKA 2VLKD 2OTUB 3W2DL 3MV9D 2P7TA 3WN5A 1H3UA 4BFIB 3UYPA 5IMOB 3MYZA 1YJDL 3U7YL 5B8CA 5FYJL 4P57B 3RX5A 1H8OA 3VFWA 2DL9A 4X4YB 5D93B 1M7DA 1CIDA 5IM7A 4EIGB 2R2HA 1LO3L 3GMLA 3QUML 2VXSH 1WWWX 4GW5B 1U93A 1ZS8B 3NTCH 4FQXB 2AK4D 1MY5A 3KHOA 3CDFA 1QSEA 3U6RA 4PLOB 5C0BA 4FQ2L 4LRNH 5C7XL 5L8LB 4RAUB 3HNVH 1E6OH 1C1EH 4R4FL 5HHME 4JY5L 4XVJL 3RBSA 3EYUL 1URLA 3HRZA 1HEZB 1FFNB 5HYSB 3NIFF 2G75A 1AKJB 1F8TH 4NHCH 4KDWA 5D2LB 3FJTA 4J1UA 4KK6D 3ZSSA 1ZSDB 3MJ8B 4XPHL 5I18H 1NEZA 2Q86A 2VITA 1IM3B 2MFNA 3KPRE 4UTAL 2NYYC 2IWGA 4JLRA 3Q1SH 3V0VB 3MTRA 1S9XB 2D7QA 3MLTA 3BO8B 4E41D 5C07D 4X5WB 4Z7VA 3QIWC 1QR4A 4EUPB 1OW0C 4JM2A 2Y06H 3BMWA 1YPZB 4LPTA 1B0GA 3VXOB 1WFOA 2B1HL 1MCQA 1IGCH 3IFLH 4ZO8A 4Z9KB 5AYQA 2A6KA 5I2IA 5IB2B 3O3AA 5IFAL 3T0DA 2H26B 3WUZA 2H2SC 3EYSH 1U36A 2OL3L 4JY5H 2FLRT 5C0BB 3C8KA 1YY8B 1II4E 1DBAH 4JRYB 2X4QB 3BGMB 3RP1A 2P24A 1P5VA 3IETB 4R7DA 2CLRA 1ND0A 1L4IA 5F9OH 3NCCB 3V6FB 3NA9H 2HN7B 4XCCH 3ARQA 3P73B 1F90H 1IC4L 2XKNB 3F7RA 5I1EL 2ZUSA 5GS3A 2VLRE 3B6SB 4YNYA 4UIMA 5CILH 4ZUUA 5JTWA 1I9IH 1LP9B 2ICWJ 3BX7C 3MRNB 4QRPE 2DI8A 3U9PH 3WLBB 3QULB 2VIRB 5DD1L 3L7EB 2VL4A 5GGSA 4JRYE 5HJ3A 5ALCH 1FSKB 4G80B 1I8MA 2FIRT 3G5XA 2F53B 2J8HA 5FO8A 4JFYB 2VOTA 3I50L 4OM0H 4YUEH 4N8VB 1T7VA 3AXLB 2MWCA 3BPLB 5J11B 1S7XB 1OB1A 4ZOAA 1KJ2B 2ADIA 1UYWH 4UT9H 3QYCA 1EVTC 4X6CE 5IROA 5I30L 3GJFB 4QXGL 4NT6A 3ZMRA 1VFAB 4W70A 3MRDA 4ZPTB 5EBGA 3VXMD 3JTTA 1U8NA 4QCIA 4HV8A 4PBWD 1KJ2A 4R3SA 1YPZE 1YEIH 3QDMA 5K93A 4G8IB 4E5XA 2Q8AH 1WIOA 2FX9L 1VDGA 3TT1H 1C12B 2OJZH 2J6EL 3WNKA 3BUYA 1R3JB 4JKKA 4OZHA 3R0NA 2ICEB 1KFAL 2Q6WA 2A6IA 4OQTL 3F7YA 4LDEB 3VFUA 3WJJA 5EN2B 3ULVD 4F3FB 3N85L 1AXIB 4HC1H 1A6ZB 3P77B 3T8XB 2NY7L 1EK3A 3INUL 4P23B 3SY0B 2VDLH 1GL4B 5CJXA 3BHBA 2C3GA 2YRLA 1B4JL 4MD5A 4EJ1C 2JJTC 4JFZH 2Z92A 1FVDB 5GGVL 1LO0L 5CD3B 4M5ZH 4LSTH 5CUSL 1U8OB 1UENA 2UY6A 4JRYD 1QPXA 1JGDB 4FQPA 4MAYC 5CSZA 2NW2B 5LBSL 5IGXL 4TTGA 4D9RD 3EO1A 4ORZC 3Q6FA 4FQXC 4LLQB 5E1AB 2WIIA 3WD5L 4NM4H 4OLWH 1NCDH 2GT9A 4NQCB 5ITFB 1AJ7H 4O9HH 2YBRB 2ICEA 2BRRH 4WWKA 4ETQA 4MD0B 1VADB 3VRIA 5CP3H 4P3DB 3ZE0E 4YHNA 4OF0A 5IR1B 2HKFH 3BQUD 3K3QA 4JAMB 3UBXG 4MJ6B 3FCTA 4BSWA 43C9B 1EUTA 1R5VA 4N0CD 4ONOA 2X5PA 3B9KB 2VC2H 4JR9H 4L3CB 2PR4H 1UB5A 3EOTH 3GI9H 5ITBH 2CLVA 2WV3A 4YHNB 1VPOH 4WUUD 4GAGH 2Z31B 2PXYA 1D6EB 1TIUA 5B22A 3RX7A 2ZSVA 4PRBB 2Z92B 3BKCL 3DXAA 5CD3A 1A7QH 4JPIB 4FP8H 4JY4B 2CLZB 4MXVF 1YEKH 2XYCA 4HC1A 4X9FA 5F9JB 1WVZA 5JQ6L 2A83A 4GFTB 1DEEA 4QHNB 2AJZB 5EC1A 2CK0H 3O2WL 1BMGA 4NKIL 1Y0LA 5KANG 4JPKH 2HYMA 4LPCA 3DYOA 3H9HB 4ORGB 4L1DA 4JFDD 1I3GH 4Z7NE 1TJHH 1ZXQA 3P9MB 1SJVA 2X6MA 3TC9A 4WJ5B 1K4CB 3B9KA 3WIIL 4PB9H 4FABH 5IHZB 2VQ1A 3WIFA 4LDOB 4J6RH 5C0EA 2YA2A 4FFVC 5IEKB 4HIEB 4DW2H 3C5SA 3IDGA 4K94H 4O2CB 4R26H 5IESH 1OARH 1V5JA 4KRPD 1MEXL 4MXWH 3JWOL 1SVZA 5F6HI 2P5ED 3H42H 5JMOC 1TZIB 2NYYD 3KYOA 2CPCA 4OF6A 1OPGH 1TJGH 1LEGA 5MENE 5HYJD 5ANME 5KS9F 1NEZG 3RA7L 4DUXA 4EI5A 3G9VA 1YNLH 1KLUB 3QXUA 5GIRB 1AY1L 5TE6H 2HFEA 2W9DL 1O7SA 4N1EA 2V2XB 3DVNA 4FFZL 1FL3B 1YQVH 3SDYH 4TOYL 1NH6A 2P8LB 3F12A 4FQIL 1X5KA 2FIKB 3RVXD 4OLXL 1AGEB 5GZNC 1CU4H 4L4VA 1YY9D 1S9KC 1PLGL 2FO4A 4JPWH 1KT2B 5LXGH 2X4TB 1EEQA 5BS0D 2DM2A 3ZYOA 3AMLA 1RUPH 4WUUE 4Z7OF 4DK6A 1MFNA 2OL3B 3S35L 5KVGH 3CSYA 2LVCA 4HWNA 2BVOB 4UBDC 2D31B 3G9AB 1ONQB 1MCBA 1YNKL 3V6BR 3PP4H 3PWLB 1L0XA 4OLVH 3VWJD 4WV1C 5D9SA 1EAJA 4FG6C 3UTTB 4KI5F 1X5HA 5C0CD 2BCKB 4G9FE 4LBEB 2MQCA 3JWDH 1GGCL 5I71B 3MRGA 3FONA 3MOBL 5IKCA 1WC7B 9CGTA 4HT1H 4LLVA 3GM0A 4RFEB 5TH2B 1R5IA 2F5BL 5ALBH 4PGEA 1T89C 2JB5L 1FL3A 1OP5H 3HI6L 4TULL 1I1YB 2V17L 5KSAC 4WGVB 1NBYB 4KK9D 3C5JA 3KDMB 2Z93B 4MJ4A 1R24A 2Z9TA 1OAYL 3DMMD 4FQXD 2X4UA 5DS8B 3VXUD 2GYSA 4JFFA 4LLWA 3DGCR 3U9PL 2UWEA 3RWDA 5B38B 3TF7C 4JREB 2W65A 2CXGA 2P1YA 4LVEA 3DSFH 4L8SB 4X98B 1JYXA 1IEAA 3DRQB 3HTLX 2P5EB 2B4CC 1DUYB 1BECA 3LVEA 3MLUL 1GGTA 1G9EA 5B38A 1UH3A 3PP4L 2BY3A 4ODSL 4MDIA 5HBBA 4O2EB 4P48A 1KYOJ 1Q9KB 2WWMD 4LOUD 3HMWH 3LRSA 3UDWA 5CEZD 4NZRH 4YHIA 3X17A 5EU6A 4QRRB 1Y18A 2DOCA 3V6ZB 1AO7E 1AP2B 1IL1B 5GSVA 5TH2A 2AKRA 3D2UB 2R4SL 4Y5VB 1PGRB 4N0UA 4M7KH 3BVNA 3O6LH 2R0ZH 4GMSH 3MUY1 3SE4C 4HUVA 5FAAA 4IBLT 1PEWA 5DVOA 4XBPA 4PRNA 3G6DH 1F4HA 4N0UB 5F8RC 3MOQA 5FHBH 5SX5K 2P8MA 3EFFB 3MZTA 4YHKL 4HGMA 1JF1A 3ZDXE 2QADB 5SX5H 1NAMH 1BD2D 4K71B 3WV0A 2XRAH 5J3HC 5IBLD 1G0XA 3TZVB 2MKLC 2X9XA 2FL5A 4MXQC 3L3JA 4FQXA 4HS3A 3MRBA 3BH8A 1QSEB 3GB7B 4P46A 4DGIL 1UEMA 2C3WA 2VLMD 2GSIB 2WMPA 1HQRB 2H32A 5IOPB 4HQQH 3J8F7 1OAKH 3N85H 4LSUL 4UAOB 5C08A 3LEYL 5L2KD 4U6HA 5I1CL 1C08B 3HE7C 4U1IA 3N1FC 1J1PH 1WZ1H 5FOJA 3G04B 3BD5A 4NM8L 5DD3L 4IRSA 3KR3H 3QUYA 3HKFA 3LV3B 5CMAA 1Q9LA 5C3TA 2WUBL 1GVIA 3ILPA 4PRHB 4JO3H 4LPUA 1MVFA 2VTFA 1WT5A 2XICA 4U0RC 5JNYB 3MBEB 5HYQA 5JPMA 3BRGC 4HT1L 3KPOB 3VH8A 1CICD 3GIZL 1I9JL 1NFIA 4O5LL 1WSST 4NN5C 5CCKH 5GS2H 1F4YH 3WJLA 4WV1B 3O41A 4N9OB 4C58B 4CAGA 4Z0BL 4HIXL 2XKUA 4X9HA 1OGAD 3M8OH 1YNLL 3AY4C 4EKXA 5FGBC 3WDJA 4C4KO 4WY7L 3VWJC 2NW3B 3QUMA 1WEJL 5HYJA 2P7TB 4HF5H 3TFKC 5FA3B 1R0AH 4K55A 3IFNL 1NBZB 1BIHA 4OGXH 1RHHA 3ZYZA 1N0LA 4JO3L 3C08L 4FN0A 35C8H 5JNYA 1KN2L 1EBAA 1HZHL 4W4OC 5CKGA 3QI9D 1QACA 5F1IB 4LSQH 4ZG1A 1J1PL 5IM7B 1MH5A 3BKJL 3LEYH 2HH0L 1E4KA 3X3GL 3V79C 4WCYH 3LOWA 1A4KB 3BYYA 3PQYA 3BRFA 4XAKE 1XF5A 3SO5A 5GXBB 4KY1H 4H88H 2AQ3A 3GSNH 4XC1H 3TGXA 1N5AA 2YS4A 3VRLF 1AC0A 2FB4H 1FO0A 2ATKB 5FYLH 2F54B 1ZSDA 3MJ8A 3MXVH 5B3JE 3ARRA 1P2CA 2R1XB 4OCYH 5DC0A 5HYJB 2UZIL 5GSRB 4L8CA 4NQTA 4XZUB 4K3GA 2KZ1B 4WO4C 2E3VA 3AFLA 4MVBC 1JHKL 2GUOB 5DJYA 3LB6C 3RVUC 1YDPB 1IJ9A 5E4EB 3SJVE 3X11B 3D85B 2VKWA 5INCA 4QOKD 4XMLL 3OB0K 5J9PA 4S1DD 5D7IF 2FX8L 5KVGL 5KOMC 1KCKA 1PKQA 1OCWH 4CVZB 2R15A 5C0JB 1AGCB 3PWVA 4XWOD 3QDGD 1G6RL 4HUNB 4N0UE 2CDGB 4PJXE 2XWBB 3UAJD 1GJIA 2GIYA 4PB0L 3HMWL 1FO0B 2ATKA 5D7SH 4EXKA 3TNNA 3DV6A 4B41A 1AGFB 2JJSC 5IJKC 4YC2C 1C5CH 3FT4B 2WIIB 4S2SB 3UYOD 2OX5A 2XKNA 5JLZA 4BK5A 1MHCB 3OR7B 1UCBL 2HT2D 4JKWA 2Q76B 3ARGC 3LKOB 1BWWA 4APQB 4NYLA 1FE8H 3ARFB 2IG2H 3MOAL 4MA7L 5DEFB 3CFEA 5INCB 1WLHA 1S7WA 5FGSA 1HOCA 3KPNA 4ONFL 2UWEE 3EOBB 1OAYH 1CYGA 4U1MA 2OBGA 4U1JA 3RTQA 3U1SL 4E42A 1YEFL 1A1MB 1T1ZB 1F3JB 1JPTL 4XB8A 4OSUL 4QRQA 2A77L 3VFRA 3SDXB 1CDUA 2FH8A 3RTQB 5MEOA 2BMKA 4QRPD 2F5BH 4GSDL 4CGTA 5FHAL 3KGRA 4GAJH 4KC3B 2NLJA 4MAYB 1KJ3L 3HC3L 2GHWB 5C86A 2NX5A 2Y07L 4EZMA 2EYRA 5CBEA 2JELL 4LHQB 3GJFH 1CFNB 2OJZL 1AGFA 1HIMH 3PWPE 3F65A 4RWYH 4NQSA 4XXCA 4Z7QE 2EYRB 5D7LB 5KJRL 3TNMB 4NCC2 2GT9B 5ITFA 3MJ7A 4Q74A 4M6MH 1I1AB 1U8PB 3ZKND 5J13C 4ZXBA 1DP0A 2VR4A 1FNEA 2CK0L 4Z5RB 1MCPL 5LWYH 1H3GA 3OKLB 1SBBA 2QV2A 2W9LA 4JRXB 3BIAX 4PLKD 3PV7A 4PP1C 5HSFA 1X5IA 5DO2D 4GW1A 5FGBA 2MPAL 3AM8A 4LEXL 3LHPH 1U8OA 1QO3B 2A6DB 3STLA 1QRNE 1CF8L 2ATPB 5GGSY 3MOBH 1KN4H 4XHQA 1EERB 1XCQA 4AEIH 2BZDA 4ZFOL 3FOMB 2G5RA 4OB5H 3SO3B 3BT2L 3T3MF 3BH9A 3QSKB 4RQQB 2OR9H 4PJHB 5MENA 1U3ZA 5KG9A 3L5JA 3MGTB 1CDYA 4U1HA 4JFXA 1D9KA 2ADJA 32C2B 4PJHA 1XR9B 5EULV 4F7MA 5MENB 3BJ91 3KPRB 4YHLL 4RFOL 3BEVB 3OG6B 5J1AB 3QQ3B 4NQCD 1RUML 5DEZA 4H1LB 4IRSC 3R1GH 3T65A 1NUGA 1V7NH 3VFNB 5J7CC 5IVXA 1J87A 4PD4K 4LPYA 1JPFA 4Z7WF 5DRXB 1KACB 2EDQA 3MRKA 4PJXF 1XGPA 3MV8D 2WIMA 1WFTA 1IGTA 3ZTJH 4OTXL 1CI5A 5IV2A 3MNVB 1KCRH 2HLFD 1C7SA 1F3RB 4JPKL 4P4KA 4OV5B 3EIFA 3DUUB 3P4NB 3MV8B 2NX5D 1JIBA 2WLYA 4NZUL 1H0DB 4LIQH 1ZLUH 5D1XD 1CQKA 4ODVH 3U1SH 4RZCA 4H1LA 2A9NL 3GEWB 1RUMH 1ZLUK 4GG6A 4LCIH 4HIHB 4RMSA 2XRAL 3FB8A 2VXSL 5GS1B 3CVIH 4JO4H 3DROB 2GJ6E 1UWXH 4GXVL 4YBLB 4UILH 2DMCA 1FHGA 4YDLB 3BP6B 3I6GA 3VMNA 2EXWD 5T33H 3ULVL 1T83C 1Q0XL 3O45B 4PGDB 5BVJA 1MJJA 3ZKMD 3V5HA 1YEGL 1XIWB 1UM6L 4HMDA 4FQHB 5KVFH 1P7QB 4NQDB 3ROLB 3SKJL 4YDLC 5DJ0A 2YPLD 1D5IH 2A74A 5F3BA 4DGVH 4PY8J 1JUFB 1F00I 4WU7B 1RAMA 2NY1D 1XF4B 1MOEA 2XWTB 5E7FA 4Y7MA 4X6DB 1EH9A 2Q3ZA 3PWPB 3TWCL 4X5XB 2OL3A 4XTRD 1MQKL 5MEQB 5IMKB 2XWTA 4MAUH 3FZUC 1MJ8L 3PDDA 5FYKE 5EORH 4OZHE 1JN6B 4PLJC 4G9FA 2R23B 2YD1A 25C8H 3BDXA 4OCNC 1BZ7B 2GAZB 3NZHL 3RJDA 5FYLL 4MNQE 2QL1A 3MRGB 5IKCB 4HS6A 2AEWA 3BISA 3DNKA 1HYRC 2R23A 2HFFA 5E00A 3PQYD 3GBNH 4FQHA 2ZG3A 1LNUA 4WDIB 5GGVH 1ZTXL 3H9ZA 1I1YA 4M00A 2DKMA 2VDNH 4WI9A 5C8JB 5T3ZE 3SDXF 1MCDA 1Y18B 4WHCA 5IEHB 3RWJA 2XZCL 1HSBB 1CXKA 4C4KT 4H5SB 1NLBL 2D7OA 3B2VL 2ZNXA 1JZ4A 1NCCL 2NTSP 4OQ1A 4MNQB 5GS1C 2J5LB 3UBXA 1XR8A 1V3MA 4JN2A 2J88H 5CP7A 1T7ZA 4Z7WE 5D6DC 3E0GA 1DVFC 5DD5L 1J0KA 1ZHKA 3RWIA 3I3EA 3VXRE 5ANMA 4EUPG 3EHBC 3VFOB 1BFOB 3L3KB 5DA4A 5F9WC 2J8UA 1D5XA 1OGAA 4X6CB 3O3BB 1ZKAA 5H37H 2M26A 2YEZA 3LZFL 3MNZB 5DJXB 4ZUTA 3STZB 5D2NB 1NDMA 1AGDB 1LVEA 4YHIB 3BH8B 5J8OA 2CIIB 5DWUH 5GJTL 2DQFB 4POZC 1CICA 3MNZA 4OBSA 2CR6A 3HI1A 2AW2A 5HDLA 4YXHH 2HT3D 2YPLE 4D8PA 3G5YB 4XGZA 4FMFA 1SM3H 4PJEB 3PWNA 1T2XA 2K1MA 5DJDB 1UG9A 3VXTB 5A16A 2IFGA 4EBQH 2J5LC 4PJIA 4PG2A 4IRSB 5BCAA 3BPOB 4BH7B 1UA6H 1OP3K 3MV8E 1I1AC 4S1RL 4K8RC 5GS0D 5LGHL 3KR3L 1F90L 1IC4H 5F1IA 3NA9L 3UTSA 1T0MA 3VFWB 4X4YA 3DARA 3HZKA 3DVIA 1GC1C 2D7PA 2W0FB 1EZVX 5EU3B 3NZ8B 4XCYA 3GHBL 3CSBA 1IGJB 4IRSD 2E6QA 3ARYA 2EDNA 3GZKA 3FQXB 2WQ8A 4DJMA 1Q0YH 1HWGB 2DJUA 5DJXA 1BD2B 4YBLC 3HR5B 4DGVL 4OKVA 4LKCB 4M61A 1IEBB 1HYSD 4UBDD 5EBLB 1QSEE 3KLAA 3D48R 4U1LB 4AYFA 1MSPA 2D0HA 1A0QH 1DBKH 2BY2A 4KROC 4M3KB 3CIQA 3GHEH 3K80A 1LO2H 4HLJA 3GMQB 4PYGA 5D71H 3AU1A 5MI0B 4QXTB 5CSBA 3AAZB 2L7UA 3WNPA 3GSVB 4ACPA 3VXTA 1FGNH 3S4SA 3KWWB 2VDRH 4Y1AE 4KZDL 3IFNH 3HPJA 4JHWL 2AQ2A 1QFWH 4UOJA 2XA8H 1I8IA 3K2UH 3Q5OA 4WWID 4NSKB 3ROOB 3UJIH 3T0EA 2X4PB 2W0FA 3HS0B 4F58H 4L8BA 3HLAB 3Q48A 4JQXA 2BDNL 5DMKA 3ZHDA 4N9GB 4ONFH 4NIKB 3ARBA 3MJ9L 1QZ1A 3KNBA 3V0VA 1G9MH 1EFXA 3ZKXC 1RIUH 1BZ9A 3ARZA 4ONGH 5K9JH 1BAFL 3K81A 3P9LA 1QLRA 1E6JL 2AXGB 3HC4L 5EUKB 3SQBA 1B3JA 3NAAH 3WFHA 1FV1B 4QHLB 3VXQB 1N64L 3TH2T 5D7SL 4LLMB 1VB9A 1JF5A 5T1LA 1S8DB 3BP5B 4U1MB 3VXRA 1BFTA 1MFDL 3FN0H 2JB6A 1A7PH 2QQNH 5LQBH 3MLXL 5EOTA 2R0KL 4NC1C 4G6JH 5DURD 4APQC 5TJWK 1HXYA 2BSRA 3QQ4B 5CFHA 4R0LB 4LP5A 1F2XK 4ZS6C 2F5AH 4TPRL 1KEML 4YFDB 3SDAD 5DMKB 4OZ4B 4PREB 2RAMA 1TTFA 3IETA 1EFQA 2AGJL 3IAPA 1ED3A 3T08A 4QHUB 3MRFB 4KQ3H 2OK0L 2WSKA 5JW5A 3V0AC 3K4AA 4OUUB 3VFGL 3TN0A 1JHKH 4HFWB 4D3CL 3QIUB 2IH3B 3AMKA 4MNHA 3L7EA 2VSCA 3NFNA 2A1WH 3S5LG 5D7LE 1NJ9B 5C9JB 4KU1A 4M3JA 1M71B 3LPWA 2IH1B 3QFJD 3LRHA 2R0ZL 4ZXBC 4PRPE 4HMEA 4WGWB 1K8DA 1HXYB 4EI5D 3STLB 4L4VD 1AGBA 1MUJA 4Q58C 3M45A 2OTPA 5E8NB 5FM5M 2W0LA 2OQJB 4Y5YB 1FGVL 4KXZH 2C1PB 1I3RB 5FA4B 4PP2A 2VXUH 3VW3L 3BH9B 1AKJA 3BRDA 3QNXA 3EO1B 1UKSA 3ISWA 5E1HB 4LFHD 3T4YA 3TN0B 4LVNB 3KPTA 3SQOH 3CFDB 2JELH 3IU3B 4PRDA 2YZ8A 4JZNB 3K8LA 3KJ6H 4N0YL 2BFVL 1YJDC 4GKNA 4MCYB 1GOGA 2BVEA 4MS8C 43C9A 4JFDB 4O5LH 3KLHD 1D6VH 3QULA 2YXFA 5FYLD 3NCJH 2BXZA 2H26A 2HRLA 4XCFH 3P30H 4PRIA 3S88H 2YPVH 4LVNC 5C0BE 1E27B 5I1HH 2VLKE 5E8NA 3NMEA 1D3CA 1C5DB 1BQSA 4DCQB 4KMQA 4HWBL 1IC5H 4ZOEA 1OP5K 2D0GA 4LLQA 5E1AA 1X9QA 3SCMD 1NEUA 3JTTB 3D25A 1G6RA 3DRTB 2APTA 2Z91B 2HN7A 5ESQB 4LPVA 4E5XB 2OJEA 5TF1H 4XNZC 3M1BB 4MS8D 2X05A 5I15L 4Q6IA 3T4YB 3MGAA 1J86A 1A6AA 4L3CA 5FM8A 4PRDB 2EDLA 1N4XL 2Z91A 1PAMA 3FRPG 3MRMA 3QJFB 4YO0A 4I0KA 3RWGB 5GJSL 5IWLC 3WXWH 5GQBA 4MMXC 5MHSD 4WO4B 1DANT 1FDLL 4PBXA 5EN2A 3T04D 5GHWL 3BQUA 3GJEB 2FGWH 1I8MB 4XNYL 1O5DT 3MA9H 5IVXE 2CDFA 5JHDB 1QYGH 4O00A 5JQHC 3KXFE 4WO4A 3ARGB 3MCKB 1FNSL 1PZ5B 1JZ8A 4XBGA 1BIIA 4FXLA 3QIUC 1XCQB 1U2CA 4NNPL 5IHUL 2VKXA 3DURA 4YC2B 3G5VB 4CMMA 1FE8L 5B39B 1MELA 2XN9D 5FKAB 1QBBA 5TGBA 1XGPB 1PZ5A 2VUOA 3TCLA 4I48A 3LEVL 4ZODA 5I1IH 2NZ9C 1XGTB 1DZBA 2Z35B 5HHQB 4ODBD 2CKBL 3ZTNH 3HUJA 1LD9A 1XGRA 4ZS6D 5CD5C 2DQCL 5I17B 2SEBA 1E4KC 2R4RL 1T03H 2ICES 1QSFB 1QBAA 2YN5A 1IC1A 2L7JA 4F7MB 5I8EB 4Y2DD 1OAQL 2HFGH 4KRPC 5DFWH 4V1DE 4ERSH 1ACYL 2G5BA 3HMXL 2FIKA 4XNUL 4BSJA 3X13A 2YD7A 4OCRH 1I4FA 4RMUA 4XPBL 1BVKB 3PXHA 2EDTA 2QKIB 3KLSA 4K9EC 1CIUA 1KFAH 2CLVB 1BIIB 4MA3A 1QD0A 3T0XA 4I2XA 3G5VA 5J3HD 1F5WA 3UJTH 5AZ2L 3TJHC 1UC6A 3P40A 2Q7YB 3WUWA 4LCUA 4RISH 5EG6C 4MQ7B 5DHXB 4YPJA 4E0RA 1U8IB 3Q6FB 1WEJH 4NQVA 4CJ0A 4NQCA 2LE9A 4IOSD 4OZGA 4QT5A 1QTYT 1WC7A 1CZ8H 5F7WC 4TUOB 2FJFB 3NA4A 1XGRB 4OUOA 1FP5A 4K3EL 3BKCH 1LILA 2XY1A 1MCCA 4F33A 2ESVA 1G7HA 5I1IL 3OAZK 3MREA 4U6TA 5JHDD 3RIFF 5IHZA 4NN7B 4R7NA 4XP9L 1UM4H 5C0IB 1D9KD 5MI0C 5ADOH 4UIKL 1UCBH 1RZ7H 2RFXA 1RK0A 1KCSH 2UVFA 1WFNA 1HILA 1OP3H 4FQQA 3V5HB 3IVKB 4LLUA 4RIRB 4JZJB 3VGBA 4E41B 2NY5L 1YMMA 3JV4A 3KPQB 4PG9B 4HUKB 1X4XA 2VUYA 4K94L 3SE3C 3ZE2E 3S6CA 4H20L 4PYHA 4KK9C 5DVKA 4K71C 1I7UA 3TM6A 1W0WB 5KS9E 4L9LA 2FATH 1JGEB 1G1YA 3RGVC 4NQUA 4UT7L 1OSPH 1ZTXH 2DDQL 3FQUA 1L7TH 3MRLB 3OKOA 4X7TA 5DTFB 2MKWA 4UTBL 1EEUA 4XP4L 4YXKL 3UJJL 1NKOA 4FOMA 4MDJB 4M7LL 1I1CA 1A9EB 2JCCB 3VJ6B 4ERSL 1NGYB 2CQVA 2RBLA 5FKPA 2WP3T 2BNRD 1A6UL 1FYTE 4MB3A 5C0IA 3DSNA 1T0MB 4XWOC 4UAOC 3QUXD 1NGYA 2G9HA 5FHBL 4I3RH 2UYLA 3BPCB 3CZFB 2IEPA 3GMRB 4P2YA 4U05A 1MHHA 4KK5C 5GGRB 1FL5B 3C5ZB 4QRPA 5D7JD 2BSED 4WUKL 4LQFH 1X5ZA 4DOHB 4X7FC 5I9QC 2IQ9L 4TUKH 3IGAB 4U2ZA 2CKBH 5DD1H 3FN9A 3B9KC 4NNYB 3MO1B 4M1DL 4MXVE 4EXPX 5FECB 4GUPB 1WAAF 4Z7OE 1RUKL 1UM6H 1G7LB 3H9SE 1FGVH 1GH7A 4EQ2A 3OB0H 1SEBA 2OI9C 5FKPB 1ERNA 1ORSB 5KSAA 1MIMH 4HMCA 4XNZB 4BZ1L 3M8OL 2GJZB 5I71C 3TH3T 5DQ9B 2RJMA 4K94C 3QJHA 1EUUA 5EO1B 3NIGE 1FFQA 3FKUS 3BIBX 2RHEA 3SDCC 1NC2D 1QFWM 1T66D 1IC5L 1QLEL 4CNIB 3EDKA 4ODVL 3PWJB 4XGZB 1BX2A 4OM1L 1QKZL 2IMMA 4CADA 1RFDH 2V2TA 1E28A 5TF1L 4NFBA 1KB5B 1AJ7L 4C54A 3QUYB 2OS7A 1XMWA 4WW2F 2VLJD 1NC4B 3RIFK 3RKDC 1I7TA 3S34H 1TVBB 2AGJH 3GK8H 4M62H 1I7RA 3RL2A 5TQ0H 2C4FU 1BBJB 3RGVA 2BFVH 5DK0A 1INQA 1I7TB 1Q9OA 1X3DA 5EOTB 2OR8A 2Y36L 1JGLH 1DQLL 5TE4L 5AWNH 1CD1B 5FB8A 4KPHH 4PJEF 1F6AB 3HC0B 5I73C 4HIJA 2AAVA 1JL8A 4XPTL 3BKML 1CDCA 3V6OA 4K9EH 4G6KH 4BH8A 2DQGH 1AXSA 1S7VB 1CDIA 4JQIH 3O9WC 4YE4L 1GAFL 3OR6B 3JUZA 3LN5B 4MNGE 3KYMB 3KJ6L 2NY0B 2R2EB 3RU8L 3RWEA 4U4BA 4RA0C 4WTZG 1UJTA 5CS7A 3S34L 3FOLB 3LPFA 1E4XI 4U1IB 3MLPA 4YNYB 3EFDH 3LKNA 4P23C 2OTWA 4FFVD 5FYJH 2GUOA 5DJYB 3UC0L 3FFDB 3U7YH 2B4CL 5C0NC 2LU3A 4AQOA 4P2CG 4LIQE 1PX3A 2KPNA 3LSOB 4H8WH 4OT1H 5GGSB 5EOCH 3V7AE 2X4PA 4LLMA 2APBA 3IXTB 1SEQH 4NSKA 2PUQT 3UBXI 2R9HC 3CVHB 2ADGA 3OQ3B 1LE9A 3L3IA 4YX2H 1U93B 1ZS8A 1QBLH 4PJDF 3TIEA 5BJTA 2BNQD 2CLRB 3ARDA 2ICWA 1BBDL 1I1RA 1GHFL 2GITB 3L3IB 1MFAH 1RZKH 3QUYD 2LABA 1NGPL 3RUGF 3AM8C 4LAQH 3Q1SL 4Q9QL 3X11A 4GRLB 1MHCA 3OR7A 1K5NB 1S9YA 3MLWL 2H1PL 4NKIH 1KTRL 5B8CB 4JJ5B 1ZVSA 3GMMA 5CJQL 5K9QI 2H9GA 2OCFD 5GGTH 1IM3A 3LN4A 4MXWL 3DETD 1G7QA 4M6NL 4M5YH 2XN9B 3W9DA 1CCZA 4NRXB 3U7WL 1JWSA 4JJ5A 5GZOD 1MCOL 3P0VL 1U8KB 2CDGA 3QEQE 3LN4B 3ZE1E 4FQCL 1XF3A 5DF0A 4EIZC 3PDOA 3TBVA 4JB9H 1QFHA 2GI7A 3WIHH 3W11D 5FIEA 1JHLH 3I9GL 1ZGLB 5C92A 4FG6D 2QHLA 4JG1L 3QRGL 2XIDA 4HAGA 1YN7A 3V95A 4HH9B 4NN6C 4MA8H 2Q8BH 3IAGC 5DURB 4N0CC 3WHE0 3FAWA 4QWWD 3QIUA 2NZ9D 3OAUH 3PXJA 1UADC 1KJMB 3MBXL 1NUFA 2EECA 4M03A 5IVNA 5FA3A 1RIHL 1CFSB 4P3CL 4MB5A 3K4ZA 1TXKA 1QUNA 3GSNA 4LFHG 2WZPD 3Q0HA 5ACZA 1NUDA 3UMTA 1U91A 3ARBD 4EOWL 3SKMA 3VXME 2P43B 3JV6B 3B6SA 1HXMA 3DTXB 3G6AA 5M7QA 1B4RA 3WFEL 1A6TA 4JDTH 2O5YH 2NLJB 5T1MB 3QRGH 1CL7I 3MCKA 1G6RH 3LN9A 2ZG1A 3I9GH 3O4LE 2R39A 5EU6D 2AJXH 4RNRB 3E6FB 3JWNC 3OXRA 4AMKH 2EDWA 1AD9B 3CK0L 4KJYA 2JJSA 2J7LA 5FUOH 5DEGA 5ESAB 1K8IB 3FT2B 4JVPA 3NBNA 3BSZL 3IFPB 3R06B 1BOYA 2PTTA 1A3LH 4KJYB 1TVHB 4HEPG 1LO2L 5D71L 3B2VH 2AERT 2FX9H 4G8GB 1IC7L 4G6AC 3MGTA 3K7UA 4QKXB 1RJCA 43CAA 5C0CE 3TYFB 4DVBB 1OQXA 1TJIH 1B6UA 4ZUUB 4DKEL 2IQAA 3CFCH 5D7JB 4JY6B 3WNMA 3UEZA 4ZTOH 4A6YB 2X1WL 3SGKA 2HTKD 3QEGL 3DX8B 3BAEL 4IRZH 3VH8G 1U91B 3NH7L 2IQAB 1BVKA 1A6ZA 3HI6H 4HLZH 4TULH 4YBQC 5DA0B 3MUHL 1U8MB 4U1NB 2R2BB 4F3FA 2AS5M 1L7IH 4ZUSB 5F3HB 2VDMH 2A6DA 2ARWA 3H2WA 4I9WD 2XZAH 2FZ3B 2H2PC 3IDJA 5JXAL 4LKXB 1J05A 2KKQA 1CWVA 5D2NC 4LSQL 3VD7A 2HVKA 1KPUB 4CVXA 2BXYA 4IJ3C 2FZ3A 1J88A 2V7HA 4LEOA 3QAZB 4HHAA 5IF0B 2QLVB 4Q6IB 2O5YL 3G08B 5DQJA 1E4XH 3BPLC 1Z0MA 4OAWB 2F9BT 1QKZH 2FDBP 1SJEB 1KELH 2R56H 2CUMA 2DJSA 1UZ8A 1CG9B 1IEHA 4NYLB 2V9RA 3HZYB 1DQTA 4FQJL 2O5XL 5D1ZA 5DUMH 1FG9C 1G7HB 1JZ5A 3DV4A 4J12A 1BFSA 4FZ8L 1A2YB 3BDYH 3DXAE 3BQUB 3PGDA 3D69A 2VZSA 5EDXA 3RVWD 5D2LE 5L2KB 3MUGB 2WNGA 1A4JA 1ZOXA 1Q8MA 5MERB 4U1KA 5MEOB 5HVWA 4M1CD 1P69B 3ILQC 3T0EE 3MUJA 4KPHL 2CLZA 5CWSA 1ADQH 3LKQA 1JGLL 3MACH 4MMZC 3L5WB 1GGIL 1GPOH 4JPIA 5D72H 4G6MH 1YYLH 3WJLC 4RCAA 5FM4A 1LD9B 4XCCL 4LGRB 3ZE1F 2MNUA 1AE6H 1BZQK 2PO6A 3V4PL 1N6QH 1XGTA 4GRMA 4RMWA 4TUKL 3WS6A 1DR9A 2J12B 4D0BA 3RAJL 4EVNB 4CRPA 3JVGC 3UPAA 1ZLWH 1ZT4A 5T3ZL 4P3DA 5DJ0B 3JSSA 1WCBA 5E56A 1U92A 1FNEB 4TRPL 5H94A 5CJQH 2EDKA 3WIIH 5DJAA 1JHTB 3EGSA 4Q7DA 3HRPA 1YEJL 1U92B 1A7PL 1OM3L 3MJ6A 3QUYC 3PWPA 3VFMA 2EDFA 1FO0L 3U0TA 3V7MA 5IFHL 4K3DH 3ZDYE 1DJSA 1FQ9C 5IVXB 2WM0A 2ZJSL 3GIVB 5JDSB 3PWLA 5IQ9B 1FPTL 3UYRH 2GK2A 3M17B 2FHCA 1KNOB 1A3RL 1JRHI 4ZOCA 4P0DA 3ULUH 1G7JA 1XH3B 5CWSB 4PJ5B 1YYLL 2UY7A 1KGCD 4B5EA 5K9JL 5SX4I 1S7QA 4Y4KA 3G6JA 1MHHB 1VHPA 4TUOA 2ERJB 1YMMB 3GSQA 1KV3A 1DQML 5SWQA 4ZFOA 2CKBB 5SWSE 4QT5B 4OSUH 4JFXB 3MBXH 2W60A 4X6DA 32C2A 3H3PH 2BRQA 1S78C 1MFEH 2IPUG 5C1MB 3UC0H 1LQSR 7CGTA 5H94B 5L9DL 4FXGA 4BM7A 1IQWL 4KV5F 1CD8A 4FQJH 1T5XA 3QT2A 4PTUA 3O2VH 1JN6A 3E2HC 4QNPF 4YDJB 3S36L 4JRXD 4NO2B 2HJFB 4JG0L 5JPNB 1CDJA 1JI2A 2OMBA 3GSXB 3TVMD 3ESVF 5DDHB 2YPKA 3HE7B 5LBSH 4Q97A 3NIDE 3C5ZC 4WFHD 1AO7A 3MODL 3QZWA 4CW1B 3KPQA 4DQOH 1AI1L 1NGZB 5HI3C 4K7FB 3WSQL 5GGQL 3CDGA 5HGDA 3RWJB 1YECL 3MROA 5L6YL 3DX7A 2HT2C 2H2PD 2V2XA 1IKNA 1NLDH 3BKJH 3DVNB 2DDQH 4HFUH 3WFDL 1DVFB 1NCWL 4PJ9B 5EU5A 3MGOB 4XMLH 2C26A 2DWDA 4PGCB 3LKSA 3QXAB 1SJHB 2BHZA 3Q6GL 3THML 2OI9B 1FNLA 1ZHKB 3MGOA 1A7NH 4IM8A 3T4AA 3VMPA 1HQ4B 3CSYB 2ORBH 3W0WB 3ZDZE 4UU9B 5MEQA 1IAOA 3TZVA 1OGTA 2BNUA 1BVZA 4F7EA 2A77H 4X4ZA 1IILE 3C8DA 3BOVA 3B3IA 4CW1A 1TQCC 2JIXA 2D9QB 1V7NL 4O2EA 4NJ9H 3G5ZB 4UV4L 1NCTA 5L6YH 4MJIB 4GKSA 4W68A 1NAMB 1HN1A 3FTGB 4BQBA 5BRZA 1MCFA 4RX4A 3GIZH 4JFED 5KANI 3ILQD 2YSSA 5CGYD 2CR3A 1U3HA 3BIKB 2EXYC 4XVTL 5EZJB 2X4RB 1BLNA 2HG5A 2VZVA 3WFEH 1Q72L 1KCLA 3FOLA 3OKMA 1ACZA 3F58H 3NIDF 2AXFA 1X6LA 2AKRB 3D2UA 4FQ1H 4GXVH 2EYSB 1ZT1B 1I8LC 3NOIA 1P84J 3O6FA 4HUXB 2MJWA 1ZLWK 4AIXA 2DQEL 4DKFL 3T1FB 4XCYB 5DD3H 2NY5C 4X6EA 1HH6A 5FF6B 4L9LC 1B2WH 3DX6B 3TA3A 4G8EB 3MJ9H 3UTSB 2HMIC 2V5MA 1P6FA 1W8OA 4KV5E 3KG5A 1XGUA 1KLGB 5J6GA 2HJKA 1ETZA 1GGBL 3QEUA 5EO1A 2EDEA 4OCSH 4YFEA 1JYWA 4DGIH 1HHKB 1U8QA 3G5ZA 4LKCA 2PTVA 4S1SH 3HLAA 3O3EB 1RFDL 1BJ8A 4OM1H 4Y5VA 3KPLA 5DK2B 3TH4T 1A6UH 1ZEAH 2R1XA 4PJFB 5IEHA 5J89A 3ULUF 4ZFGH 4L8CB 3I6KB 5IB4A 5BZDB 1RPQA 3KPLB 5DK2A 2HWZH 3MXVL 2AEIT 5C07A 2FX7L 4PJFA 4YGVB 4B53A 5HHVH 1NMAH 3WFHB 3ZDYF 4BZYA 3WHE1 4KRPB 3D0VA 3UPCA 1TJIL 4ENED 5IP4A 4HWZA 4HGKC 2C7UB 4DQOL 2BERA 3MRJA 1MI5E 4XNQA 3VFOA 3QQ9D 4K07A 2BOCA 1P6AB 3GMLB 1VFMA 1ZLVH 4AL8H 4YPGA 3QEUB 1VACB 3PUCA 5E8PA 2WP3O 3DLQR 4YZFF 4BH8B 1WBYB 4FQ2H 1SHMA 1JK8B 1Q94B 2KL6A 2ZUUA 3ET9F 4PGBB 1QNZL 1KIQA 5ETUA 5DUBB 3V4PH 2GJJA 2AK4A 2FYYA 3VXPB 5KSBF 1ED3B 5HHPB 3KPMA 4ONHA 1MCIA 4J2XA 4PJ8C 5DC9B 1TDQA 4K7PL 4UDUB 3ZKNC 1JRHL 4P2QE 2VL5A 2VXTH 2WW8A 3MLRL 2PXYC 1S9XA 3D87B 4R4BB 5HHOD 3FFDA 3O11B 3DYMA 4R90H 5LVEA 3CGTA 2VAAB 3N1GC 4BH7A 3ECBB 1NL0H 2IJ0C 4JCLA 3VXRB 1ULVA 2O5ZH 2VO5A 1B0RB 1HHJA 2I9TB 4ZO9A 3OKKA 3V7AG 4WWKC 3K2MC 1F11A 3QDGA 3UTTD 2DN7A 1KB5L 2A6KB 4M6ML 2ADGB 1WUNT 4NQEE 3FQXA 1LE9B 3L5XL 5DHVA 1G84A 3RZCC 5DMIH 3GSNL 3MRFA 4XC1L 1W0VB 3KLDA 2LV4A 4H88L 1F6FB 2MQ3A 5B39G 5FDWB 4R6UA 3F6IA 1DL7H 5FA4A 2E7LA 1RU9L 1RV6X 2J2ZA 3QXDB 5ELIA 2AEPL 3V8CA 4EN3A 4PLKC 4MD4A 5EIIB 1VERA 2VISB 3QEQD 2D03H 4OCYL 4R4BA 3BO8A 2BNRB 4XPBH 1ND0B 2EIZA 1B2WL 5CJXC 5TQ0L 3CNKA 2P44B 3A6CH 4NO5A 3C6LB 5DJ8B 4S10A 4WEBL 4XPAH 5GSRA 4BSVA 5BV7C 4NRXA 1CFSA 2R29L 5J13B 4DUWA 4QRUB 2LVEA 4HBCH 1KPRB 5D7IB 4RSVA 1AQDA 1TZHB 4BKLB 5I1DB 3MV01 4X99A 4JRXA 3AREA 3LQZB 4Q9RL 3F58L 2YWYA 5B3NA 2DIJA 3PG2A 1MFAL 1MI5D 1DQDL 1PKQB 1RZKL 4V2CB 4QGYA 2YHGA 1DSFH 1F11B 2BJML 5BXFA 1HCFX 5HXMA 4E41E 1U58A 4MLIA 5T1MA 2E8ZA 1EXUA 5BZWB 1JNLL 4PJ8A 2O5ZL 4PJGA 1JI1A 3QDME 3DECA 2W9EL 4EN3B 3B5GA 2FWOB 3IDMA 4F9PC 2BVYA 2DYPA 1Z6JT 4EUPH 4CU8A 3QI9B 2GCYA 3SGEH 1JE6A 3MA9L 1NEZB 2Q86B