4I36A

Crystal structure of the bacillus stearothermophilus phosphofructokinase mutant d12a
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
318
structure length
318
Chain Sequence
MKRIGVLTSGGASPGMNAAIRSVVRKAIYHGVEVYGVYHGYAGLIAGNIKKLEVGDVGDIIHRGGTILYTARCPEFKTEEGQKKGIEQLKKHGIEGLVVIGGDGSYQGAKKLTEHGFPCVGVPGTIDNDIPGTDFTIGFDTALNTVIDAIDKIRDTATSHERTYVIEVMGRHAGDIALWSGLAGGAETILIPEADYDMNDVIARLKRGHERGKKHSIIIVAEGVGSGVDFGRQIQEATGFETRVTVLGHVQRGGSPTAFDRVLASRLGARAVELLLEGKGGRCVGIQNNQLVDHDIAEALANKHTIDQRMYALSKELS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Redefining the Role of the Quaternary Shift in Bacillus stearothermophilus Phosphofructokinase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase
molecule keywords 6-phosphofructokinase
total genus 117
structure length 318
sequence length 318
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.11: 6-phosphofructokinase.
pdb deposition date 2012-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00365 PFK Phosphofructokinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.450 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4i36A01
3.40.50.460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4i36A02
1S2LA 2F2TA 4I7EA 2KHZA 1T35A 2Q4DA 1S3FA 3K2QA 2F67A 2PMBA 3UQZA 4JELA 1S2DA 4KXNA 3U39A 4PFKA 1F8YA 3HNOA 4MCJA 4FYIA 3EHDA 4U1RA 4I36A 2KLHA 2A0KA 1F8XA 5AJUA 2A33A 2PFKA 4JENA 2IZ5A 1ZXXA 3QUAA 4JEMA 3OPYB 4FYKA 4MEJA 4OHRA 4HX9A 3IMKA 3BQ9A 4LJLA 1WEHA 5AJTA 6PFKA 3O8OA 4KXLA 2F62A 2HIGA 3SBXA 2IZ6A 3O8NA 4P5DA 4FYHA 3PFKA 1S2IA 4OHBA 2NX2A 1KZHA 2IZ7A 4A3SA 3GH1A 1MTOA 1WEKA 4P5EA 1S2GA 3O8LA 1RCUA 4KXMA 2F48A 4RH3A 2F64A 3O8OB 4NPAA 3MAJA 2Q4OA 3OPYA 1YDHA 4LJKA 5ITSA 4I4IA 4WL0A 1PFKA 3F5MA 4LJRA
chains in the Genus database with same CATH superfamily
4ZTBA 4PO3X 3ZWVA 1JMYA 2NTNA 2R8XA 3LT1A 2BEUA 3MTBA 2P3QA 2QLFA 4JD5A 1KO1A 2WM8A 5B57C 5CEFA 1LTHR 4CBVA 1KFCB 1MVNA 1SMKA 2ST1A 3E0XA 4NNOA 4CKCB 2NOAA 4BIIA 3ZLJA 4IX9A 4YACA 3RREA 3GN1A 3QELA 1VRCA 3HYCA 3WQQA 4F5DA 2Q8QA 3CXRA 3QLUA 3TL2A 2YMPA 4ARUA 2C97A 3AJAA 5BN3B 5ULLA 2XUPA 5KC9A 2A0WA 1JYEA 4BX9A 5LLSA 3AUKA 4KN8A 3LGSA 3PC2A 1CZNA 2D0IA 1RJGA 4G5RA 5CTAA 2WQ6A 1VPVA 2YOHA 3JTMA 4LX8A 1X9IA 3OD5A 2H4XA 1E79A 2EP8A 4OH1A 1ORDA 4ZZ1A 5KQGA 2ZJFA 1Y37A 1G7TA 3LECA 1U7WA 3CRVA 1NP7A 2BGKA 3IIJA 2OWEA 1BX3A 2PG3A 3ICPA 1J09A 1V9LA 1EFVA 1BEZA 2QTCA 2QY9A 3L8YA 2IIQA 1N8SA 1QTNA 2Q0XA 2J46A 3H2IA 1OXSC 2WMYA 4JNCA 5BYJA 5EP3A 3U3DA 1JYSA 3GDFA 2AG1A 1BGWA 3ADOA 3HHEA 1UR5A 2GJ4A 3KUXA 2J67A 3KVOA 2R6ZA 3LCCA 1FFGA 3NAQA 3ND7A 4MUFA 4A0RA 4UTXA 5IYZB 2LXNA 4ER3A 3GPLA 4HDSB 4IXDA 1KI9A 3HN2A 1ZD3A 5JE8A 5ITZB 1KQGA 4K9SA 4YS6A 5AJWA 4ND4A 4HB3A 2GN1A 2WAOA 2O8CA 1JQBA 1Z5UA 2O7QA 3FTPA 3NOXA 5K51A 3KWLA 5I4IA 4C06A 3IESA 4N6OA 1S7CA 1XQ9A 1WBJB 3AFNA 1SBYA 1BHSA 4N39A 5JPCA 3SHQA 4B1FA 5BUZA 3O2QB 4A5OA 4KQIA 2DE0X 3GRCA 1SHUX 5C1PA 5IWCA 2C4MA 4HV4A 3GXBA 4M0EA 5KQRA 5BSKA 5KNCH 3RUDA 5MDHA 2YRXA 3F6CA 3VU8A 3G9ZA 4MRRA 1PVDA 1RJWA 3ONEA 4N5HX 4RPIA 2VTBB 5F9MA 4MHTA 2NVOA 3M6IA 1NQXA 4BL5A 4NBRA 3EEBA 3THXA 3AVTA 2FPOA 3E3AA 3EGVA 2FEKA 3OE4A 2OZPA 4J1SA 2GRJA 2J0UA 1KI2A 3Q85A 2RH4A 2GN4A 1EGAA 3OZCA 4F46A 2K87A 3VJMA 4HAUA 4CQJA 4O2LA 1GZVA 3S2EA 1L4KA 3HPRA 1P1KA 1EIZA 3KYCB 1P45A 1K0UA 2MSKA 4ZEVA 3ROZA 1Q7TA 2FEAA 2FWPA 2JC3A 2Y71A 3C3BA 1U5BA 2AEEA 4P34A 1N32B 1B8OA 2AN3A 2F3SA 4ZYLA 4DNOA 3LG2A 3IA7A 4UNIA 4U0KA 3EW9A 5DNAA 4JLWA 4GD3Q 4K3UA 3ENWA 4E46A 3D8BA 3P9XA 1XK6A 1LX6A 2E5FA 1P1JA 4KZKA 3SYMA 4V0NA 1XDWA 4R6XA 1RZRD 3GAAA 5JHHB 2PH5A 3Q3VA 2PRJA 3GFSA 4IYRA 4TKZA 2B94A 5BNTA 1QIHA 5T8KC 1O96B 3SHWA 2HSDA 4P3PA 5D86A 2Z1NA 1GIAA 1NRXA 1K5PA 5CLJA 2P3OA 3QPCA 2GLUA 2HJSA 4TPKA 1RXYA 2IT1A 2V7GA 3I6QA 4XJTA 4KPFC 3RIGA 3OT5A 3IFSA 4U0JA 2NXWA 5LKAA 1O9HA 2FFAA 3STTA 3V4VB 2F00A 1E9FA 4LJAA 3QEKA 2ZUBA 3GELA 1IN6A 1G8JA 3HWRA 4G8JA 4UPDA 1WW3A 3W5HA 4C89A 1PSZA 3RTCA 4LECA 4YRMA 2OFXA 1GFIA 3OUUA 3SE0A 2H9AA 2XVXA 3ED1A 4HI0E 5LR6A 3GHYA 3VJRA 2HU8A 5EE9A 1A7KA 3ANXA 4HQKA 1BROA 3LRPA 4DLKA 1HYGA 1P2SA 3I42A 4Q7EA 3PCRB 3WVNA 2P6UA 3OU6A 3T3DA 4WZAA 4TYPA 1U7PA 1YVDA 4RM2A 5IG2A 5K8JB 2GMWA 3L8ZA 4HLCA 2VXOA 3R6TA 3TZBA 1O1YA 3FY4A 4CYMA 3A2KA 2GK3A 1V2GA 2YMMA 2H1SA 3A1DA 4BXOB 1QJ4A 4Q00A 1Y1LA 1Z62A 3PE4A 3KHKA 4Y2RA 1JHPA 3GEHA 1PJZA 4LJ5A 3P5SA 5HNKA 2ZB2A 4UKDA 1YZQA 3UXYA 2O1SA 3L6OO 3T1QA 3ZZNA 1KJNA 4CT4B 3BDVA 3I8SA 4E6EA 2O06A 2ZAMA 4IOMA 1U2SA 5FLKA 4JUCA 4UJ5A 4WI1A 5DPMA 1ETUA 1J0XO 4M1ZA 4YQYA 4EYGA 2BJVA 1VHLA 3BSWA 2P62A 2BE7A 4FFSA 1DXQA 2V6FA 3F7MA 4XDGA 1JJVA 4CKEA 1KWGA 1N1GA 1JEJA 1JZTA 4G84A 4D3YA 4R81A 4ZJYA 3U7FB 2APJA 1T4CB 4RY8A 3TMKA 1SUBA 1TCBA 4GUAA 2CK3D 4G2TA 1WP9A 3A9UA 1YJCA 4J6FA 2R6R1 3RSHA 4BNDB 4PGGA 4D6PA 4Z7JA 5JARA 1UBKS 1CE8A 1W1WA 1BX0A 2W7TA 3BK1A 3AJEA 1G38A 1LX7A 4R7ZA 4KAFA 1Q0UA 3KZOA 3ZTTA 5KYVA 4LE2A 4FUTA 4JUIA 4N5IX 3MGCA 2C9ZA 1GTSA 2GX6A 3OIDA 3QMMA 1EXMA 3WWYA 5L3SA 2Q1YA 2RJ3A 1SUIA 1SXPA 3ETCA 1YFZA 2Z08A 2FXIA 4BO0A 3W5DA 1I3CA 2FPGA 4R2LA 3LLUA 2M32A 4LYAA 3WSVA 1LLFA 1YZLA 4H35A 3I62A 4OP2A 2GM5A 4NS1A 5AI0A 4O4JA 2VUSA 4ZOAA 3OZAA 1H8ED 2V7BA 2YJ4A 4QREA 5E6UB 3ULKA 3MD0A 3HFGA 4GKAA 3SVTA 3UUEA 3O1LA 4MYUA 4B83A 2BJWA 4IYJA 4L5YA 5BURA 5AVTA 1YU9A 1CQIB 2DFVA 2IUEA 2XRMA 3C41J 1Z4MA 3KJHA 3RYFA 1PX2A 4EB3A 5BR4A 4O2BA 2FSHA 3PHJA 3DBHA 3I4FA 4EKDA 3DDHA 1B43A 3NRCA 7GPBA 1E7MA 3E9QA 1QIJA 2FH5B 4C0BA 5A0VA 2Q9BA 1W36C 4RNDB 3PYXA 5K8LA 3CBQA 4GZMA 1E1DA 3TVDA 3VUEA 3OUTA 2UZ3A 3NCTA 1LJ8A 2VPWA 4JJ6A 1BJTA 4IDQA 5C4IA 1VG1A 3WBFA 1E3WB 4QDUA 2WT4A 1A9XA 3TNLA 2WJZB 4ND3A 2O8NA 5ALLA 1QG2A 2YASA 1UEXC 3UKDA 2Q8NA 3F46A 5F5LA 3UGQA 3WLRA 3TIFA 2IYEA 4H2DA 1XBTA 4D8UA 3ZCUA 3UQZA 1KSFX 2PX2A 4NOLA 1ZM2A 4M9RA 3HZRA 1JQLB 1AQ6A 1NZDA 1Y4SA 3KOZA 1PWZA 3ZIAD 1OJ7A 4UCWA 1M1NB 2DKFA 4MA5A 4EF5A 2EFDB 1QQ7A 1A4XA 3ISTA 3QY9A 4GT1A 2I22A 3MJEA 1CQZA 1TD1A 2EQBA 4O29A 3INYA 4OI2A 1M2EA 3QFTA 1X1RA 2OV4A 3QK7A 2XTJA 1WDWB 3ONNA 1YASA 3FHOA 1HFKA 4RY0A 3ZDQA 4ZI3A 5JAMA 1YO6A 2JJ1A 5WRFA 1ZK0A 1PHRA 3STVA 5MFPA 1K2VN 3TOXA 3OPXA 2PV7A 2QQFA 1H1DA 1CWUA 3OTQA 1WY5A 1TLLA 2Q1WA 2UVDA 3NS7A 2B5OA 3NPAA 4F1KA 3ZGVA 4V03A 4HXEB 4LJLA 4IVRA 4KTTE 4NONA 4RPHA 4TKVB 4RBNA 1CVIA 1Y4UA 3GEEA 2O7NA 1KP3A 4QPJC 1FX0A 3PNQA 4ND1A 4U7GA 3T1VA 3UUFA 3V8BA 5FUBA 4HADA 3HA5A 2R7LA 4PIMA 2X77A 3W3AH 5DFAA 2J0VA 4AB1A 4LRXA 3AHDA 1KEUA 2GFHA 1CY6A 2HO4A 3IUEA 4E5NA 4D44A 4DDWA 3ADBA 1OX5A 3I6ZA 3ZU2A 1GM5A 1CQJB 2AWOA 4MV7A 1NRWA 4JI4B 1AZTA 2HU7A 4NQRA 3OE1A 4J16C 5K4GA 5EUBA 1NI4B 1YULA 1AHHA 2ZT7A 3MJ4A 4I9UA 2JK0A 3ABZA 4ALIA 4JVOA 4CCYA 3AINA 1YKSA 3JPWA 4PRKA 3T7AA 3N58A 1K3UB 4R2HA 1NL3A 3FCXA 3QHPA 4X9XA 3ZK7A 1E3EA 1CJSA 1M0WA 1SVLA 3IMFA 1JR3D 3F3SA 4H1HA 1L5LA 4EAAA 1PNTA 3A1NA 2FPPA 3AR3A 4GECA 1T6ZA 4IDCA 1RI4A 2AK2A 3FIUA 4IZOA 3UAOA 3LAWA 4LCEA 5IAJA 2HV8A 3I6MA 3NT5A 1YBHA 4K6CA 1N8TA 3HPQA 3R5FA 4QOHA 4X93A 4P92A 3HI6A 2FF7A 4O8ZA 2C0QA 3WI7A 3ZGLA 3N2GB 1WBDA 2ZZMA 4IDOA 5AOVA 4P84A 1RACA 2JJ1D 3RUFA 4EWLA 1Y6QA 4EELA 1U9CA 1ZD5A 2V6GA 1VJ1A 3BSSA 3QUCA 2PSSA 4Q4HB 3JQ9A 2P68A 3VDXA 1GDTA 1ZGJA 4HUTA 2GVNA 3PD1A 1PO7A 1A2KC 5DNDA 1LU9A 2O3JA 4RZIA 4PG7A 4O59O 1OFIA 1ZI9A 1XZ8A 2BKVA 3NBKA 3PHHA 2RBEA 4HDOB 3FZYA 1YZHA 3I0ZA 2H2FA 1XMXA 3PUYA 1OLOA 3SEZA 2GCEA 3BCSA 1JMKC 4RJLA 1XL0A 1DBIA 1I4LD 1C9DB 1GGJA 1NNEA 3SJAA 1GPDG 1KDPA 3BL6A 3TSYA 3PVZA 5J1TB 2JFFA 2FPMA 1F48A 3RROA 1N7IA 1SC4A 1QONA 1RCFA 3WR5A 5HK8A 2OCPA 3GPBA 2QROA 2GN0A 3GB9A 4RH1A 1HR0B 1XNJA 2IJGX 3PE6A 4ZP1A 3NEAA 2CJFA 1TAHA 1WMSA 4GOKA 1NJ8A 4C4RA 1JEQA 2VI5A 1G8FA 1JPJA 1J90A 1W5SA 4S1WA 2XIJA 5F7XA 5I5EA 1EXVA 1JS1X 5JJ5A 5K6TA 1QTQA 1NE2A 2JLSA 4RENA 1MAHA 2DBVO 1QH8B 2PMBA 3AR7A 5DM2A 2WNIA 5C4MA 1G8GA 2Q7XA 1P2DA 2EZ9A 2YY6A 3HU3A 4OKSA 5C5IA 2Y1GA 1WCYA 1O94A 1N0VC 1XLVA 1PR3A 4QBFA 1G19A 1P3DA 2GCGA 2JJ2A 1JQKA 1KJZA 3BD6A 3D59A 3R0VA 4EZEA 4OK3A 4BGVA 3E5NA 1Y89A 2IY8A 3IQZA 3DTVD 4TV8A 4DA6A 3PDIB 4DG9A 2E37A 2HA2A 3HB4X 4DIBA 2WOOA 2V7QD 2I4RA 2VJMA 3ANNA 5T4BA 4QM6A 2ZR8A 5JWRA 3KQTA 5DM70 1Y42X 2ZJ0A 1TYEB 4KREA 1S8AA 1Q6YA 4RC9A 5EJ4A 2WAXA 4US2R 2Q9CA 2OQRA 4FT2A 1Z0SA 2F1OA 2YJ3A 3EZFA 3LT2A 5DU2A 4LY3A 4HTFA 5ECYA 2I6FA 3KQNA 3RVQA 2BEWB 4U02A 1PUIA 4X66B 1OZAA 4PYKA 2JIBA 5A1TA 1JEQB 4OP3A 1J5EB 4V1CB 2FEPA 3HY6A 4WFJA 5KI6A 5IVKA 3OE5A 2POCA 4RIEA 1UH5A 4D98A 3I5YA 3ET5A 4I5IA 2WHPA 3IVAA 3T7KA 3CRW1 4BP8A 3TW4A 3O4JA 4GL2A 1Q21A 1SQ0A 1YCHA 2ZWAA 4EFDA 3U26A 1SXHA 1R4NA 1E2PA 2D0PB 2VXCA 4ZYZA 1JJBA 5HKKA 5LFAA 3U2QA 4UNNA 4EBBA 1O8CA 1ECLA 1ABEA 1UK8A 1ZK3A 3VU9B 3IAM6 2C7VA 3ENQA 3LSTA 4MLZA 3TLZA 1F2TA 1LQTA 3COPA 1AURA 1G9TA 2QY6A 2RD2A 4PTLA 2E3JA 1YB7A 4BBJA 1G5FA 1U6KA 1F38A 3W9SA 4RVGA 3T9FA 4LZZA 4CIAA 3GPDG 1BMTA 3V1NA 1Z9BA 5D3MB 2YHUA 1D8AA 3AF0A 4M9CA 4YMGA 3CCBA 3N74A 1SCIA 2A92A 3M89A 4PRYA 3T94A 3TOSA 3TTXA 2CNBA 3HL4A 1Z5OA 5JEEA 1YQ9A 3P9NA 1H2FA 4MTCA 3PICA 3L7JA 1JQ3A 4XZ3A 3OJXA 3EUWA 3SSMA 2PY6A 3Q9UA 2BWJA 2QIOA 1M5UA 1E6MA 4HNAA 1YE3A 2VNJA 2VSFA 4LNAA 1H1LB 3PLRA 2XGJA 3ESQA 4TX1A 3R76A 1HE5A 1PJCA 4E14A 1XAIA 2BJHA 1VKOA 3CG0A 5A5DA 5FUMA 5LQKA 3ZN2A 5L7TA 1HDXA 2BRUC 2OGUA 3PJDA 2HA7A 4OJKA 1QOQB 5EE5B 2EAUA 2QMUA 2R11A 3F7NA 3M6LA 4KO2S 4MKIA 1GAQA 2LIVA 4G36A 3N9IA 2CHFA 2EYQA 4UM9D 4UU1A 3UWDA 5B7PA 3F78A 2QTWB 1WCXA 2X4LA 4DCGA 4XOUA 1M7GA 4KN6A 5K6RA 2J5XA 3Q10A 1F20A 3TQOA 5AK0A 2EL9A 3LUCA 3OQHA 4EK9A 2FMIA 4OL0A 4PPFA 4P32A 3EULA 5KS2A 2IX9A 1YL6A 4XGIA 1W2GA 1VJTA 4OI4A 4G0WA 4KE7A 5DCYA 1W19A 2LGJA 2QLMA 3MWEA 2I2BA 3NI2A 4XIYA 5KX5B 2G72A 4ENRA 1LF5A 1X1BA 1ONPA 3BMCA 4ZT7A 1JR2A 1C9NA 2MDTA 3LI2A 3OIFA 4K6HA 5I8ZA 4NLLA 4F3RA 4BMZA 1VKZA 5HTOA 1TUIA 1ZD1A 1UDAA 5LOVA 4QU8A 1H5NA 2J85A 4GRDA 1UEJA 3PIDA 2B3DA 1YS6A 1AT1A 5IK2A 3WRWA 4D0NA 2ZYTX 1X92A 1C3VA 4Q19A 1F7UA 2A1UB 3BXGA 1E1QD 2E4VA 4NC9A 1K1EA 2E6UX 4DL9A 1W581 4B3BA 3IR6A 1Q7RA 2HMSA 3I9V1 4FK8A 5F2KA 2LTAA 3BRWA 4IRUB 4ZU1X 4C2AA 2LCFA 4OQMA 4P3YA 3TRIA 4GI7A 4BEVA 5D87A 2BN4A 2PGXA 2OFOA 3E1KA 1V3TA 3RFCA 3ERCA 1DQSA 1OY1A 4QSHA 5CU7A 1ORWA 2C94A 4YVFA 5FPHA 2JG3A 3L92A 2R8OA 1PWHA 2VPXA 4I55B 2E4XA 4A16A 2OBFA 2RE8A 2WFAA 3SR3A 5IS2A 1FBNA 1QYRA 4DMKA 4BCBA 2YWEA 2DUWA 1SRQA 1ZLYA 1OZGA 2JVKA 2XWBF 4HRVA 3A6JA 4LNHA 3TLBA 1ZJ6A 4N3NA 4YEDA 3DL7A 4KQJA 4AO6A 2XKKA 3VDQA 5LD2C 3D4PA 2V5AA 1N7GA 1OUMA 1T9BA 2BSAA 4IHJB 1IUPA 1G3QA 5EPEA 3RE1A 2VBCA 4ZYYA 3A1EA 2VIIA 1W5EA 4P54A 5FWNA 3VVCA 2P2LA 4IAOA 3RBAA 3VSEA 1XJ5A 3KT3A 1YTUA 2HBYA 1S3IA 2V8BA 4F4IA 2CFCA 5JW6A 1I9CA 2IH4A 4I9GA 1XTJA 3F47A 4LV5B 3O1IC 3V2UA 1RWNA 1I2ZA 5CLLA 4RKYA 4EMTA 5H3CA 1V8PA 1V1RB 4BLQA 1II9A 2IU6A 4QYIA 4JLDA 4RMGA 3UJAA 1Y1SA 2O8FA 1N3YA 4K5QA 4MQMA 4RYDA 4S1TA 1VKHA 1Z34A 2GZAA 5A9SA 3DV9A 1CQIA 4DBVO 3E23A 5A3QA 3R3VA 1EA7A 1QVVA 4FI3C 3JQGB 2XB8A 3ZOKA 4OY3A 3H4MA 1I3MA 4YBZA 1V47A 5LXTF 3AP3A 4GW3A 2BFPA 3EC1A 4O0MA 1O94C 1SOAA 3UWPA 2JRCA 3PQ3A 3VOTA 4FFNA 1GN9A 3QLVA 4HLUC 4WESB 4C0XA 1SHZA 2AC4A 4KQKA 3TZQA 3U4IA 4RA6B 4EW2A 3TF5A 3TZEA 4RTOA 1P61B 2ZXFA 2PR7A 3H8VA 3Q2IA 4UUBA 3WDLA 2ACWA 2PGLA 1SKMA 1IIBA 1T2DA 1K4YA 2GDJA 4HHEA 1E3MA 1S8OA 2SNIE 5LMCA 4G97A 2QRGA 4X54A 4LXXA 2IYXA 3O84A 3ZWYA 1G98A 2XD9A 3K96A 4P4GA 4FZJA 2WKSA 5AICA 3D8NA 1KFBB 4MVJA 4Y0VA 4F4CA 4CUJA 3DB2A 3L05A 5AOAA 4TL8A 4C0LA 3ABSB 3SP1A 2PM8A 3EUAA 2N46A 3GRFA 2OHJA 1C4XA 3KUUA 1QE0A 1NBEA 3BMOB 1Q77A 1PNVA 3KKEA 2KQUA 4X8MA 3SC3A 2LZ0A 4CIBA 4O1MA 3F4BA 1R64A 2ZSBA 1KE1A 2HJHA 5KWEA 4U6NA 3GARA 4K9PA 3G2NA 4IQ4A 2GTIA 1H05A 1ARZA 3G0DA 2AZDA 4P7FA 1Y3CE 1RS0A 5GJCA 2DECA 5F3WB 1VMEA 4J9UE 4LN1A 3PXGA 2DWCA 1AUXA 1OLXB 1SG9A 4EABA 2BKLA 4U6QA 5C8XA 4DCCA 3ZHQA 3CONA 1TRHA 3PNMA 2WC1A 1UK9A 2XCOA 4Y9UA 4X94A 1Z18A 3LKZA 3ESBA 1SA0B 2R1UA 2R5WA 5TV2A 2EERA 1EH5A 3EBPA 4IEIA 2RI0A 1YIAA 5C7IO 1E62A 3BXPA 3CLRD 3GCWA 1GA6A 1YAJA 1O03A 2AL7A 2QE7D 1P18A 3WQHA 1OPXA 4Z4QA 2ZSJA 3OZ7A 3HB9A 4NE9A 5DBHX 1NLUA 2CVOA 1PJ2A 5A9TA 2DFPA 4EY7A 3K9WA 3OTHA 3FYDA 3I2HA 4JLNA 5CM8B 5C0OE 4MWGA 4E4RA 1D07A 3CCFA 4E4TA 1AHNA 3FOFC 3K73O 3KDSE 3JQRA 3NH9A 3CF6R 1NWHA 1P2TA 4REQB 1HC7A 1OFVA 3HHPA 2I6SA 3MNFA 5KKAA 3IP3A 1CDZA 4IPTA 1FFXB 3R7BA 4MYHA 1NMSA 4N0QA 2O59A 2E0IA 1DIAA 1UIMA 1XU9A 3TJMA 4I14A 1NDQA 2GI4A 3NFRA 1K6EA 2RGXA 5DTIA 2GVDC 3CVJA 3CRRA 2BKAA 2PSDA 3H6KA 2ZJ8A 2Z4RA 3KHTA 3NRBA 4IKPA 5EXTA 4JXXA 1N2CE 1ODTC 1QUFA 3OX2A 1HE2A 3H7AA 5DHUA 3VTZA 1RJFA 1ACJA 2PZKA 1CJUC 4EUNA 1XZFA 1G9SA 4BRUA 3H2SA 3R3XA 1IOLA 4ZZ2A 1ZISA 2SECE 3BMQB 3PFKA 3VR3D 4CCSA 4EQZA 4U7DA 4EHIA 3IAHA 4FQ7A 3PNYA 4EFKA 2IS2A 3D6HA 2YTZA 3NYWA 5FCDA 1E4OA 3CRQA 1J8DA 1PSWA 1PZGA 1XTRA 1E3IA 1Q95A 4M1QA 4UNPA 2DGDA 2C9BA 4A36A 4N0PA 1ADCA 2RG7A 1SUSA 1FDVA 1A9QA 1U0JA 1WXWA 4WXPA 4E15A 3ZV3A 1UBEA 4JV5B 1KOGA 3EQZA 2ZK7A 4GXNA 4JJ7A 5FOSA 2JCBA 2TYSB 1I3KA 1CUIA 4NNPA 1OH7A 1LEHA 2BKXA 1N2JA 1F12A 1P6UA 2VBGA 2WIKA 3D7MA 4GX0A 1HMYA 4R05A 1T5HX 1AA9A 2RB4A 4RESA 4CFYA 4UAVA 1PTJC 4J3FA 3FJ1A 2OXRA 4PSUA 4RXUA 3CIFA 3RC3A 1QZUA 4UFPA 4DBLE 4WFQA 5JNVA 2I1LA 4EATA 3NVDA 4FXOA 1ZL0A 3R5KA 4RTJA 1GDDA 3SHVA 3D8RA 3IPLA 4LOHA 4RVSA 5ALRA 1KS9A 2QZPA 4LSWA 3AHJA 3HYNA 3NTOA 1H9BA 1Q84A 1KE2A 2DT8A 2P2NA 4DJTA 1Y1PA 4HAXA 1HQYE 3MUEA 2DQ4A 4MS1A 3UCFA 1TMGE 3WBJA 5ITVA 3D4OA 3F3KA 1KHHA 3LO5A 3N0VA 4ZT2A 3WB9A 2YWDA 3M9WA 3IAS6 1D03A 4NYIQ 3TOCA 4EYKA 2V6MA 2C2HA 3DZHA 5I8WA 3K71B 4ONEA 3PJFA 4WW0A 2XECA 2DTDA 4KQFA 1X7WA 3WGHA 1IUKA 2VR1A 4I1RA 1YJXA 3FUTA 4YIHA 1DAEA 1ECJA 1MGPA 3AEUA 4GPTA 3WMEA 4AJ1A 5JCZA 3DLHA 3L0DA 5K1ZA 1XEXB 3WO0A 1EFTA 1CQJA 5DEIA 4CEJB 4O2BB 3ROTA 4D5EA 2OM6A 3EF0A 3H1EA 4RGBA 4KXFB 1M2WA 2X8AA 2YN4A 2NG1A 5IKXA 1UMBB 4OHOA 2MTBA 1LC3A 2YJZA 3D3WB 3E5RA 1PGPA 2X3YA 1P4JA 1QXSA 3OFVA 3I6BA 1DRVA 3ONFA 3QTLA 4UMDA 5ESXA 4LE0A 2FKNA 2R2AA 5EWMB 4XRGA 3UXEA 1USWA 1OGYA 3JATA 5KVQA 3COYA 3V4OA 4HNTA 4LPSA 3W1EA 2HGSA 3BMXA 1YQXA 1BVUA 2WIDA 4I36A 1EPUA 4QUIA 16PKA 3I76A 3UK7A 4H3VA 1CJKC 1XU7A 3TXXA 4GNRA 4LY9A 2QA5A 2VNIA 4FFMA 5COAA 2XXAB 1L5NA 5EUQB 3MOGA 4ENWA 2QRUA 4DMCA 4HLDA 5C8VA 5KPJA 4OL9A 2D8AA 1FW8A 5DDIP 5MGNA 1PFWA 2I9PA 2FSVA 1LK5A 5F76A 5KB3A 1U04A 2QTLA 4TYMA 2A1TS 5A1JA 4ZA2A 5BSRA 2P2YA 2F3PA 2RHDA 1NW4A 3AJ8A 3EXFB 4FW8A 2AKYA 3NPMA 3NTLA 1SBNE 3GLIA 2YIMA 3E35A 3DAFA 4FLFA 2KBEA 3IMKA 5K3FA 1M74A 5JEDA 4N01A 4WKNA 1FTSA 3BDAA 4HEQA 2C3MA 3RODA 1EINA 2XB6A 2VP2A 4HWGA 1IWPB 2D7JA 2YXDA 3A58B 3JRNA 3VSAA 1UJ5A 1HTTA 4X1OA 5BWMA 3O8NA 1DL5A 1E2GA 1Z73A 5KDOA 1N6NA 4DCJA 1V8DA 5E9AA 3GYBA 4JXKA 5E95A 3HY4A 3BWEA 3RVDA 1WZUA 4OJYA 5KNDA 1GITA 1PUXA 4JXJA 2FOXA 1RI3A 5F1KA 1QO0A 2WHRA 4Q9IA 1X7GA 3DR3A 1OBOA 4ALLA 3V48A 4YUAA 1C2TA 3OFKA 3X2SA 2PGDA 3FNGA 4FYVA 3H75A 4UQLA 8MHTA 4MX8A 1DKUA 3F9RA 4ML3A 4QTYA 1PKXA 4NCIA 4CTMA 1AXGA 2A7QA 2X5KO 3RAFC 4ZCQA 2GZDA 1MAUA 1ZHHA 4GKVA 4B34A 721PA 3T35A 2WM9B 1AF7A 1N6KA 2PH3A 2Z5VA 2ZBUA 4IINA 4QSMA 3EDMA 4D99A 1FL9A 4AM8A 1L5KA 2LBPA 3KUKA 4JL5A 2ZU6A 2ZAGA 3B1YA 3MJTA 1V25A 1YR2A 1RDFA 3PCXA 3R41A 4G0XA 3LP6A 1XALA 4GOND 1A97A 2Q1TA 4KMSA 5JMOA 3CVOA 1ANKA 2R87A 3QPVA 1AQYA 3CYFA 1RHQA 4DA0A 4ER5A 5FEUA 4FZ3A 2HK8A 1L4LA 3JQ8A 4BGUA 4LZLA 1HSZA 2ZYDA 2QKYA 3PXXA 2D3WA 4D4JA 5HGXA 4G5FA 3PLAE 1Z26A 1EI9A 1ZUHA 3A6EA 3QJGA 5JISA 3VU0A 3RUIA 2PUAA 4BY9E 1NNSA 3PUVA 1UT8A 2R66A 2PZ8A 1Z0AA 4E5DA 3GT7A 4QASA 2C20A 1X7HA 2X0JA 3I30X 4D4GA 4X1YB 3ZHOA 3QFSA 4DJ5X 4GX2A 4LUCA 1TO1E 3L7NA 2ZZKA 3EISA 4NOMA 4ROTA 1KDOA 1Y0BA 3OLCX 2QD3A 2I3ZA 4KQCA 1KEPA 1M54A 3F5FA 4EJ2A 3EXEB 4KX3A 3B8EA 1R0KA 4KGVA 1QO0D 2WUFA 2WF5A 3DGEC 4Q7MB 4Q3OA 2ISCA 4PU0A 3BKXA 2O2IA 2PXAA 1Z74A 2D2IA 3Q87B 3NASA 1L7MA 2H06A 3EWNA 4XCXA 3TLJA 3UT0A 1JEOA 3JD4A 4DSTA 1WQ3A 2XYVA 1RAGA 5FKJA 2C82A 2XXBA 5G4KA 1FUYB 4FJ2A 1BFDA 5JZOA 4RULA 1O4VA 4YFYA 1Y4DE 5L3QB 4IDNA 4CLEA 4OHPA 2NSDA 4GBJA 4HWRA 1THZA 4TMTA 1RHMA 2LRHA 3ENNA 3FHCB 4XVRA 2OT3B 4LKOA 3FSEA 3B9PA 3C5WP 3SM3A 4YXWD 4QNNA 1E4VA 5FBRB 4CIXA 2GUGA 2F8SA 1Y7PA 5LQMA 1YC2A 2QPAA 3OG9A 3TNDA 3RADC 3MTGA 1EK6A 1N8KA 4YDRA 3QW2A 4GMDA 4YP0A 2YC2C 4KUHA 4UD2A 3WNDA 3HXKA 1PBTA 1KP2A 4Z53A 1DJQA 1IHOA 1XLTA 4RD0A 4DABA 4ZO4A 2VN8A 2O8BB 4PSKA 2Q29A 2GEFA 1K9VF 1MXHA 3V4RA 2FB9A 3AXSA 5K99A 2YWGA 5H1YA 3V7FA 4URXR 4P2GA 1CEQA 3MUNA 3A3PA 4G1CA 6PFKA 5HX7A 5JQWA 4BMXA 1XKLA 1EVKA 2F43A 4NMLA 3A14A 3JARB 1RC8A 4OVKA 1QYXA 2I03A 2I3BA 1L9XA 2QD4A 3PSAA 3EY9A 3PR2B 1B6GA 4NYMR 3T34A 3JASA 3UC9A 3M8KA 4BPBA 2Z0MA 5CK4A 2B21A 3C5CA 1Z7BA 4OGWA 4P58A 3UNXA 1ULTA 1E0DA 3KOYA 4EI2A 4UHCA 1WHTB 4Z8XA 1T8PA 2Q5HA 4RLQA 4IQ0A 1YR6A 3H4VA 4CQNA 3Q9NA 4WEQA 4CLRB 2QJRA 3G2OA 3AEQA 3OQ6A 5MN5A 1YQDA 1MTOA 1GYQA 3AI7A 3IDZA 4HH0A 4ZGWA 4MDEA 4CMJA 4IDPA 2ZBQA 1ZRMA 1DX6A 4JK3A 1P4HA 4G09A 4HSGA 1ECGA 2IF0A 1XJ0A 1Y9JA 2PTGA 1T3GA 4RM3A 2YVQA 1C1XA 2PTHA 4LVUA 1NVBA 5E8RA 3CPHA 2PO5A 4N48A 2EGGA 4C0WA 1Z33A 5B37A 3K2BA 1XWWA 1PV2A 1KERA 1HG0A 2IW3A 3I53A 3S7TA 4XCQA 1XZHA 3EODA 2JKYA 1M1YE 3UGTA 3F7OA 2NZ2A 4NPAA 4BZZA 2B0CA 2V7XA 2PDAA 3Q1LA 3DM9B 4JWTA 4Q02A 1QK3A 3FCCA 4DWVA 5A5VA 5K6AC 3C5VA 1EWQA 2DT5A 2K6GA 1M76A 2QTVA 4QAQA 1U8EA 1Z2AA 2OUIA 4Q4AA 4TS9A 1EFRA 3AVVA 1P5ZB 5GVRA 3IHLA 4KVZA 1DEAA 1UDWA 4BE7B 1CDEA 1IFXA 3KZVA 5GIOE 1J21A 1T3TA 2DB3A 2EQ5A 1JDTA 4U3JB 1D6SA 1ZKDA 2HSJA 1HURA 3UPTA 5DI9A 5HJEA 4A2CA 1GRCA 1UPBA 3EAGA 1XOIA 2X0KA 5C46F 4GGPA 5TMPA 1UJBA 2IXTA 1RR6A 2VDQB 3L77A 1MJNA 1LF0A 2RKWA 3QENA 4E12A 1R8JA 2XTAA 1V8OA 3KRTA 1AZLA 4BQQA 1IG3A 1T8YA 2OFPA 3D8UA 3QKUA 2WFLB 4IIUA 1YIDA 5L95A 4MH0R 2Q4DA 3HXMA 2EDAA 1ZI6A 1KY4A 1PUJA 2F67A 1L4EA 4TKVA 1Z8HA 2L0XA 1QR2A 3PC8C 5DIZA 2R7KA 4YUVA 3GXOA 2OECA 4LC9A 3ROFA 2D7DA 1LPNA 2NV2B 3HR7A 3OZSA 3GU3A 3SMQA 2C8JA 3BJRA 4H3SA 5CXXA 4ZD6A 5BMOA 5FUVA 5TQ2B 1GGKA 2X8WA 4EUFA 3P0JA 2EKZA 5AP9A 5IJ9B 4FWTA 1M6WA 1IDN1 1QCCA 1SU8A 3NT2A 4HDKA 4OB8A 2F8LA 1ZU5A 6AT1A 4F93B 1XWIA 5KZMB 4C0JA 1W59A 4C4SA 2HH9A 4R8VA 2FGJA 2PUCA 3IQWA 4S35A 3RGWS 2W71A 5IT5A 5CA1A 2OC9A 1JHUA 1JAIA 1GNSA 1ODSA 1VA4A 2G5PA 2GZRA 3L7YA 2FPRA 2OAGA 4ARZB 1Q0HA 4XASA 1BD3A 1YDFA 3ESRA 5DBGA 2F9LA 5FJJA 1AMOA 1QPZA 4I8IA 3OZBA 1JJFA 1QVAA 2ZJAA 3VR5D 2HTEA 1UZUA 4MVJP 3LYUA 1XYGA 3KTAB 3O8BA 4CM1A 5AW8A 4QPCA 3SQNA 4ZVUA 3O8OA 5KOJB 3AONB 3K31A 3AR6A 1FRFS 4C05A 3W6OA 4XD7D 4DCNA 2XQIA 1P9LA 1XIVA 4COKA 4KLAA 2ZDQA 1N5JA 4IRMA 4CDNA 5FBZA 3B48A 2NVBA 2BSQA 4IWYA 2JJMA 1ZOIA 1LA2A 2W4MA 4LFAB 4YCMA 5LP6C 4RHEA 1OF1A 4D96A 5I7SA 3NC1C 3P7MA 4KPYA 2XB2A 1NQ5A 4MHSA 2PD6A 2VSQA 1PFYA 3TQHA 3NUGA 4XX0A 3K15A 4Y1FA 1ZWKA 1KOFA 3UT5B 4AS3A 3O7MA 1TU4A 2EFHB 4JGBA 2MJLA 1CB0A 4H17A 3EASA 4DLBA 2JLXA 2YN2A 1VLLA 2Z2JA 2LUOA 1SB9A 4CN9A 1CIPA 1ZUWA 3KX2A 3MT0A 2B99A 4IX1A 2NVUB 1E77A 3CKYA 2HA4A 1PZXA 4LWOA 1UT6A 2IHTA 5C37A 5A9SB 3TD2A 3PWZA 4MB2A 2TMDA 3RUPA 5JH7F 1RBMA 2QT9A 1XQ6A 4RZHA 3SC2B 1AKMA 1M2VB 3CUKA 3HP1A 5BVGA 4FCCA 3O90A 3G2HA 2AYYA 1IY8A 1E7SA 3FHLA 4MJ3A 1GXSA 3RT1A 4KR7A 2HT6A 3DQQA 4YIKA 1UFVA 2XHEA 3A3OA 1A04A 3WWZA 1JVSA 3AESB 5CGZA 2XNDD 2GN6A 1N4AA 1U0TA 4F91B 5CFPA 2JCSA 1IJKA 1QDUA 4TM8A 4ZVNA 2WVGA 2G76A 1JG4A 2OTCA 4MRVA 1E5XA 4XLZA 5CPFA 5TS3A 1QH9A 3JXEA 4KRXA 5E9QA 1XDDA 1YOVA 2VT6A 4I4IA 5HA5A 5LXTA 2EJVA 3PZRA 5KYYB 2E5WA 2EKPA 2ZQYA 2OESA 1EUCA 4GP7A 3ZJ5A 4QARA 4QXRA 5FUQA 1QG4A 3C3PA 1VE6A 2O2XA 2I66A 4PQGA 3H9JA 1R4ZA 4BNGA 3OCJA 1CJTC 3O6VA 2ZRFA 3H2ZA 5AUNB 1Z83A 1SCJA 1CY1A 3B5JA 5CDSA 2XNKA 2HDOA 4GDMA 2VH5R 2VRCD 4LRQA 1N1MA 4PLCA 3UC5A 3AB8A 2JGDB 5DN6A 1GFWA 1YZ3A 3F6EX 3GLGE 2OCKA 4R2IA 3THYB 2BDEA 2IU4A 3TOZA 4ZYXA 4RK4A 4Y2SA 2V98A 3FTFA 4BN4A 1ADFA 2VCYA 3WGIA 3OY2A 2ZSIA 2DR0A 2BGNA 4ND6A 3JVDA 4PHHA 2D5BA 4FMCF 2J31A 3EVZA 1CF9A 1QLJA 4LIPD 4ALMA 2UKDA 1NONA 3EA5A 4NH4A 1OWNA 3FCEA 3TW6A 1E6LA 1JIXA 4IHQA 5LBIA 2VG8A 1J39A 2WSSD 1LCIA 4RQUA 1RHKA 2C0CA 5KWJA 3H9GA 1EUCB 2Z8YA 4ZI2A 2YS6A 4IFEA 2WHXA 4CR6A 2BCJQ 3ICOA 3R77A 1HLFA 1DSSG 1H6BA 1W0KA 1OPRA 3FPSA 3MTQA 2OORA 1L5VA 3U3ZA 1DQZA 5E7JA 4KJXA 5K3CA 1ADGA 2DP4E 5FYDA 1U0SY 2P4HX 4YCLA 2AOXA 4BBPA 2QB5A 1U2DC 5IJ0A 1E59A 8OHMA 3Q3IA 1XP5A 4MIKA 3V1MA 5HSGA 3GFVA 3VPCA 4U7TB 4FKMA 3KKZA 4IQ8A 4WY2A 1N3LA 1R3UA 4Q4DA 4K26A 1H1LA 3SEQA 2RGYA 5HKBA 1UBOS 2HIGA 5CM9C 1OXBB 3SXUB 5DM60 4H4EA 4BVJA 2WEKA 3SR4A 4B6RA 4GWLA 1XYYA 1SVIA 1IPFA 3DFFA 5LYJB 1EMDA 3MSXA 2QRNA 1L8XA 3N7UA 1ILWA 5LQUA 4J2TA 2UUOA 3O31A 4N0DA 3GYGA 3HBFA 3P2MA 1JAZA 2WFMA 4DNQA 1OTYA 4Q9JA 3KZCA 4LRYA 3SCZA 4KVAA 3ZGOA 4JQYA 1EBBA 1DCTA 2DEUA 3GQVA 1SCDA 1D7AA 1K7CA 2J9RA 3P96A 5KWIA 3U7GA 1I3NA 5JDCA 3ZNNA 1E3JA 1KK3A 5FEMA 3BHJA 2GESA 1TEHA 3KPYA 1G1AA 2VF7A 3FRHA 3RIEA 3ZGZA 4Q1DA 4F2DA 1OAKA 3IKVA 1O8BA 2Z8XA 2W37A 4IILA 5C5DA 2VT7A 4DV5B 4EHNA 4JUDX 5HZMA 2J09A 1TIPA 3T52A 3PFCA 3DOFA 4MCHA 5C8DA 2D06A 1ZKMA 2DY1A 2VJNA 2JASA 1QWOA 3HWWA 1X7ZB 1FNMA 2P0EA 4B6PA 3OIYA 3ONDA 4RK0A 2RC5A 5ER6A 1EJ2A 2BUAA 2H6EA 2C2KA 3ABRB 3RAPR 3IBSA 3RYCA 3C3KA 3EGCA 2P40A 4ZOLA 3ROEA 4B3MB 5GOTA 1FTNA 1TJ3A 1C1DA 4NBSA 4AF6A 4WKOA 5DW3A 4KQ9A 1X0VA 1E1KA 5EGSA 4C7OB 2B37A 4FD2A 4WBXC 4UCFA 3Q7RA 3E4DA 4MEBA 3SEAA 4UM7A 4GM4A 3RYIA 2QE6A 1LQ2A 4LRSB 5E7IA 4JI2B 4YT8A 2CXNA 1HOTA 2FMFA 3MWDB 2WLSA 4HX2A 3IE1A 1DBWA 5KJFA 1H8EA 2OBMA 4DPMA 4AN0A 1OD6A 3S28A 3BTUA 1NR1A 5AI6A 3RHFA 2K2QB 1YR7A 2D1RA 4NRDA 1HH4A 4MW2A 5CJPA 1TYCA 3ZS8A 2GDZA 1EBUA 1UP7A 1Y5NA 2HMWA 2XE8A 2XW6A 4H16A 4XKJA 4E88A 1VI2A 1OZFA 3TIXB 4ZAXA 1J4AA 4FGLA 2HF9A 1GZHB 4X95A 1U1GA 4N5LA 4ENTA 3KZMA 5THKA 1RRKA 4ZQHA 3RYCB 1QYWA 4E08A 3FGPA 5EHXA 2HBQA 5IWAB 5HRUA 2W42A 4TSFA 1XRNA 2XODA 1WDLA 3K8OE 4JBYA 5B12A 1BYIA 4CU5A 1QF7A 1QQ6A 2EX1A 1X8KA 2GF9A 3SYNA 1Y5MA 3QOXA 2NAFA 3H84A 5JS1A 3U1VA 4X61A 4V39A 4PICA 1ZC4A 2IYOA 4X8OA 4D25A 3KUCA 3KYCA 2Q3DA 2FW9A 2R8PA 2IBSA 4C4OA 4DZRA 4JB3A 4AY6A 2OAP1 2NSHA 2XF8A 4L2IA 3ZWXA 2FSGA 1WKCA 2BDTA 2XHZA 4GPBA 1RAAA 4IHKA 4NP6A 4RHYA 2WV9A 1TIBA 1WS6A 5L7YA 3MCUA 1OXMA 3RBZA 4C4PA 2AUNA 1EFCA 3EC2A 4D8WA 4KGDA 1TCVA 2QD2A 1JFVA 4G23A 3S1LA 5C8ZA 2XMRA 2ZI6A 4GYYA 4RA9B 3RNOA 4US1R 2W6NA 3GDHA 3IPYA 2ERCA 4E2FA 5CA0F 4JLMA 2MSNA 2C2GA 1WMBA 4PC2A 1WV1A 4JWKA 4UQPA 2ID7A 1KZ9A 4N41A 4LDPA 1R16A 1V1MB 5I01A 1AGYA 1V1JA 2C96A 4GF5A 5IJWA 5FOXA 2IGTA 2Z9BA 2JL1A 4DV3B 3MVEA 2E48A 2G9VA 1DTWB 1GNPA 4ABYA 2IA5A 2H59A 3U09A 1F3LA 4ZI7A 5CPBA 3U6BA 3BIWA 1V45E 1OCEA 5IANA 2WYVA 5FOWA 2MYNA 2R8YA 2H85A 2O6LA 2YY5A 3MTIA 4ZDWA 1UBGA 1O87A 2R79A 1Z7YA 2YWCA 3HCWA 2HLDA 4L8VA 5DISB 1OTHA 1XGKA 2VHVA 3TAHA 3ZNQA 4AYTA 1UFOA 4YCDA 2GM4A 1MOPA 1QV7A 3ZU5A 2P0AA 1C7QA 1BOOA 2J87A 3PRJA 4HJRA 2P4SA 4L5AA 4PNZA 3EVFA 1JLKA 5KYUA 3V7YA 3CVXA 1Y3IA 1XJWA 2QV7A 5K0JA 5M29A 2NO5A 2WTXA 4BDTA 1XMIA 4CL0A 4MICA 5AKIA 4J49A 3BMOA 3UAGA 3LFHA 3FPEA 5JDIA 1EFUA 1UOPA 2DHEA 5CFLA 2I2XB 5KJEA 1I1NA 4UDNA 1NBHA 4OGLA 5B3KA 3IIKA 2A5GA 2P9EA 3LYAA 5DHFA 2HU5A 5KOYA 1TAUA 2V7PA 1JR6A 1MJHA 2Q27A 2H0AA 1I24A 2C4UA 4PR0A 2HADA 5AI8A 3T41A 4ZI7F 3QVMA 3FZNA 3QSGA 2AVNA 3EVDA 4EB6A 4PGFA 3PUHA 2R8RA 4EMSA 1YJAA 2JLCA 5ESWA 3GH3A 4LGCA 4WN9B 2RHBA 3A1FA 1G18A 3HSSA 3MUOA 4NG5A 4R2XA 3RS0A 3VBEA 3K0EA 1XZQA 2DHQA 1DI0A 2WWIA 2Y0PA 3C6QA 4LSMA 4DR5B 4B6EA 3DFIA 1BYUA 1I14A 2BL4A 3K53A 3ZY6A 4BWGA 1YUBA 4DLVA 3QNUA 1KPHA 4LVOA 2XYQA 1GQOA 2PJDA 2CV0A 1XUOA 4X3OA 2JFQA 3THOA 4XOIA 5FUWA 4AZTA 3D5EA 1T4CA 1IATA 2X23A 1WMAA 4ENVA 4NZ9A 5ARBA 2YIVX 3SK0A 1O57A 4OJNA 1DFGA 3TL3A 2G67A 4CQMA 2H63A 4WZBE 3REGA 4AJJA 3QU2A 4X65B 1RHRA 1VXOA 3I4CA 4FS3A 2O2DA 3B6JA 4RZ2A 5DNCA 2FUG6 3PQCA 1JG7A 2CHEA 4FHFA 3A9SA 1YMQA 3G89A 3FTCA 4Q3AA 1O54A 4PY2A 2IELA 2D3TA 2YMQA 3SI7A 1GSHA 4QUJA 2AUTA 1KIMA 2R84A 1ZMXA 3CRMA 4HDNB 1FRQA 4DLNA 3QVXA 3CGGA 2Y2UA 4KUGA 1XDUA 5TF0A 3MHTA 2A9OA 4DIEA 1E0AA 3TE6A 1HX7A 3E9CA 3GVXA 2D5AA 2NTYC 1V35A 1W25A 1XTVA 4AN4A 4Z4FA 2YNMC 2QMQA 2QM3A 5AJYA 4XFJA 4P83A 2BFCB 4WIAA 5IC4A 3UPUA 3JAKB 4AI6A 4NZZA 1G6HA 4J9VA 3H2HA 4WH0A 1ZRSA 3TH5A 4TTTS 1AV6A 2PRSA 1JB9A 3TOVA 1O3YA 4TV9F 1QHHB 1L1EA 2NU9A 2VAPA 4CLOA 5HPYB 3M34A 2YL2A 3KKMA 1PCXA 5AOCA 4R8RA 4TMZA 3JS5A 1DKRA 5CDUA 5CB8A 4S04A 4MULA 5T6MA 5B2FA 4ZKDA 1DBPA 4RV4A 1EM8A 5DIFA 1C4OA 1FDTA 1Y4AE 2FWNA 3DBIA 3GJYA 2A3RA 2H2WA 3QKTA 2GPSA 3HB0A 2CJWA 3WGMA 5K0CA 2EZUA 2ZRCA 1K6JA 3AL2A 3NALA 1IUNA 4WV3A 5FR2A 4ZCPA 5PNTA 2CXOA 1O58A 2OYSA 3KQSA 1GZDA 3PS9A 3QEMA 3RRJA 1WP4A 1E61A 1GL3A 2WW8A 3LP5A 5REQB 1M8GA 3ZLBA 4AL4A 1X7XB 3U7QB 1N5IA 2VA8A 4P7KA 2NSLA 2PVPA 3CKMA 1XPRA 1T0HB 3PEYA 3JASB 2X1HA 4RK1A 1HYQA 5D1NA 1MG5A 1JBQA 1JQEA 4MROA 4Q47A 1TYDE 4ASUD 3I5AA 4W8GA 4DQXA 2ATEA 3WHIA 4GPAA 1OIWA 3HZZA 4PO1A 2R6JA 1G20A 5A5FA 5CVEA 4MMYB 2CC2A 4R8SA 4X92A 3MZ0A 3G2LA 5LIPA 4A1FA 1NW3A 2V74B 5AKZA 4D46A 4ENSA 1QH0A 1AY0A 4LZPA 4Q6WA 4U9UA 4DY6A 2J6CA 1QZXA 1G60A 1N2EA 5GADl 4QGHA 3ML1A 1KYQA 5A5EA 1ZIOA 1GQQA 1NW8A 3JQBA 3D0RA 1D04A 4QG7A 13PKA 2J33A 1UBUS 2ZAOA 3HA3A 2OPBA 3ELUA 5JMWA 3GZNB 2Q0HA 4FOSA 2VTVA 3ZE9A 3BAZA 1VRVA 2I3AA 2QIPA 2R5NA 1A82A 4XDYA 3CJRA 3B36A 1KZ6A 1JFTA 4UEKA 3ZCXA 2RG1A 3HU1A 1N34B 5D7NA 1X77A 2ZRQA 1SCUA 4LGMA 1M1ZA 1XL1A 5JFOA 2J4FA 4I7EA 4N7BA 4F96A 1A98A 2IXBA 2FMTA 1P9OA 4RQAA 1KPGA 5JCOC 1L4BA 3BORA 5EIBC 2FLVA 1VPTA 2QUBA 5CX1B 4XWKA 1JH8A 2EQAA 1EEXB 5TJ9A 2CXQA 3ENZA 4KDRA 5KNBA 1ZUNA 2NXEA 3EXHC 3SMVA 1DXYA 1CZKA 3OT1A 5FT9A 3VZDA 4XB1A 3BXOA 1U0HC 1WQ1R 3EHDA 3IV7A 2RCNA 4G5QA 3KSAC 4W5QA 3DZFA 3WIDA 4CI0B 3U7IA 1KTVA 1LW7A 2F1HA 3MERA 4L5CA 3ELDA 5B1DA 2O50A 7YASA 3GA0A 5JI2E 5IM4A 1YH3A 1U9IC 3BC1A 3R0XA 4IOKA 1QU3A 5COQA 4MW6A 3DF7A 4IIJB 1A4RA 4I2NA 4ZGGA 1YDWA 3AHFA 4BGDA 1CF4A 1I2BA 2VVTA 2A5LA 4XTCS 1HDZA 3D4IA 3BRWD 2C2OA 4TWJA 5DGIA 4TKUB 4CLHA 3HCPA 4DUYB 1I32A 2PS9A 3UTDA 4Q3LA 2Y27A 4CUKA 1MZPA 3LQ4A 3O2NA 4L9AA 1KZ4A 3K0HA 1UQRA 2W22A 4M0KA 4Q66C 1ZVQA 3VHLB 1Z4IA 2FDXA 3OD1A 3SLKA 4X1IB 3MFYA 4P36A 4Q9AA 4D0RA 3HFSA 1DV2A 2YFKA 1H2BA 4GRAA 4ANFA 4DV6B 2NYRA 4PFSA 2FA9A 5AHOA 1JWLA 2QN8A 4ZEWA 3KKKA 2ZKIA 2FWBA 4BLVA 2AVDA 3ZH9B 1EK0A 4HMPA 1DUSA 2FG7C 3H87A 3I64A 4QXPA 4HX5A 3DH0A 4YMUA 2FN4A 4TSRA 1XZKA 3DCNA 5LA6F 1N9GA 3EQ8A 4M3NA 1II8A 2O0HA 1RM4A 3RAGA 3ZU4A 1GZ7A 1T36B 2CLMB 2H4YA 1LPOA 2P2DA 3DOIA 5F1YA 5SYMA 3GJZA 3RS9A 3E15A 3AIOA 4A8JB 4EF6A 3DLBA 1H4SA 5HIJA 3WK6A 2JNWA 2H1OA 1LBSA 4KYIB 1EX7A 1NOKA 4QRIA 3ZHUA 4B5LA 4F1WA 1TZ2A 4FI3F 2NO1A 4E5YA 1KQOA 1XQ1A 4CG1A 1ZNZA 1DTEA 2P90A 4QHSA 3PEWA 5IKMA 1KQ3A 3ST7A 3I37X 4JIMA 2RAFA 4B79A 4POOA 4ZCMA 1L7PA 4LY6A 1OB2A 5ENZA 1H93A 2PFGA 2BGUA 2PZFA 1NVUQ 4HL6A 4S0ZA 4BFXA 1KU0A 1KXZA 1PJSA 5GOZA 1IE3A 3CXUA 1PFUA 5HIIA 1DP4A 4O25A 3VU3A 2QG9A 5EJ5A 4O0LA 3UBMA 3P26A 4F6LA 3AOGA 3BGWA 121PA 3CZCA 2CSXA 2W6QA 4KH0A 4KR3A 4R1SA 1MR3F 1IHDA 3L7BA 2R9VA 4HTFB 5HILA 4G4SP 4IJVA 3U40A 4E1BA 1VIMA 4F86A 4FBMA 3ENVA 2YHBA 5F73A 3VHXB 4YHHB 1TLFA 2I6XA 1AK9A 1DT5A 3GFBA 3NG1A 5KYNA 2Y6VA 3AIIA 2QTFA 1XVTA 5FH9A 2P2SA 4OTZA 3EF3A 3NVMB 4LVNA 5CB4F 6REQA 2QXYA 3N2YA 5J5AA 4WNIA 3ZWNA 4V3BA 2JCVA 3SJZA 5B7GA 1G5PA 1TQDA 3DWGA 4CCWA 2PSEA 1WDTA 3HR4A 3OO1A 2EJBA 5LB4A 1O9BA 1G8HA 1VE5A 2WTEA 4IHAA 1CNEA 2DR2A 3RJ9A 4EW3A 1G5HA 1O08A 1QPBA 1IBCA 3E1GA 4O6VA 4J7XA 2Y1EA 3JYNA 5FPKA 2I71A 1PU2A 4GLFA 1XTPA 3QLUC 4BQFA 3DE6X 3QPUA 1S2DA 2XZPA 5CNKA 4EI9A 4JLUA 1D6MA 2CNDA 1GUBA 2NUAB 3WLIA 4IDAA 3QWBA 4BVEA 5IVHA 3BULA 1XVAA 4M1TA 3X2FA 3HN7A 3ZWWA 3CLTC 4PS0A 1TIKA 4EUHA 3W9UA 3DE4X 4WX2B 3AKYA 4RIGA 1Z47A 3BGVA 3GD5A 2NZYA 1OHHA 1UP4A 3IPXA 5I9MA 5BN4A 1VYHA 3EPPA 4HNAB 2ZTSA 1ZN2A 4PAGA 3EVTA 4DGQA 3L6CA 3OKAA 5CW2A 4K87A 4FFWA 5JROA 2W6CX 3KVRA 1SURA 2ZB8A 5HCIA 2IZ5A 2ZRAA 3IIIA 4NESA 3QEAZ 4NAUA 3F71A 1E5VA 1OKKD 4QOSA 4L0DA 3DKPA 2WNSA 4CR8A 1J0AA 4UAJA 4G41A 5KYWA 2G5GX 1V3VA 4IDHA 3QELB 4KXLA 1U5AA 2B4YA 2G25A 4B0OA 4YDQA 1Z39A 4AZSA 4K0RA 3U61B 3AK4A 4I1UA 1C4WA 1ZW6A 2OZVA 4AP5A 3LMKA 2YWJA 3RYIB 3BEOA 5K0TA 1YI8A 1GZSA 4P86A 2EEZA 3UENA 1PI3A 1YVPA 1GZ4A 4DIKA 2GN2A 3B1ZA 3BE4A 4GC9A 1ZHFA 1KZHA 4NX2A 2ESRA 1IEXA 4MJXA 4P35A 2H29A 4L7VA 4B09A 1Y6FA 2YFHA 2JI8A 3N59A 2A1UA 4WA8A 3TUJC 1P8AA 3T3IA 4JLKA 2O5VA 3CJTA 4BASA 1D2NA 3PHIA 1V16A 2G07A 2BM0A 1X13A 2WD8A 4NATA 4Y18A 4XWOA 4PYNA 3LBFA 4MKXA 3MHPA 1TZKA 2VBIA 1F4LA 1I8TA 5HRCA 3SC4A 3L0YA 1JG6A 4KXYA 4W9MC 1ADBA 1U2RA 3WRVA 4GQIA 5IN4A 1T0JB 1VI5A 1KVUA 6YASA 1X74A 3NDRA 4EKEA 3Q8KA 4BV9A 1CZHA 4MB0A 3ZE2B 2I29A 1XZEA 2XCLA 4GXQA 4DJAA 1UAAA 3KD3A 5ICFA 4F4JA 4BQSA 4EHKA 2FFHA 4NBWA 4LZAA 4MQ6A 4P31A 3MS7A 4XGNA 3T54A 3WNBA 3CLHA 1E7YA 3FLMA 5CTJA 4Q48A 5HMMA 1C4KA 1UWCA 1H2AS 1JPUA 1A8UA 2A84A 2YCBA 1HDGO 1HQKA 3M5PA 3K1AA 3IT1A 5EP1A 4A2PA 1A7UA 2ONJA 5KCZA 1B00A 3AW9A 4XWWA 1D7OA 2WIAA 1X1AA 2C04A 4CQMD 5J4KA 4B84A 3L1JA 4IIHA 3U3RA 4F38A 2PBFA 3GEMA 1BNCA 4QAJA 3F5DA 3LBIA 1PQUA 2HNBA 3Q1KA 4X6XA 1PYOA 1KJIA 5G0UA 4F45A 1P74A 1L2TA 3WB0A 2GPAA 3BH6A 5F4ZA 4M1KA 2BP7B 4GKBA 4LX0A 1V26A 2IS6A 1L3IA 2LDBA 1PJTA 4R40A 4CDMA 3GDWA 3MMZA 3OJEA 2FX3A 2GPJA 1VL1A 4N3AA 4ZIRA 1XCOA 3EUFA 2ZBPA 4OBXA 1EFKA 4JJZA 4GX5A 3BERA 4U5XA 1N2OA 1WUKS 2A9RA 2I3DA 2IY9A 4RCVA 2O9JA 3I5UA 3IBCA 3QHQA 4AY5A 2OCIA 5BXYA 4XQCA 4JI8B 1U8TA 3LY9A 1SOWA 4XWGA 3SF0A 3X1DA 4ZO8A 4CCAA 3AM5A 1XMQB 3ITDA 1KEEB 4L9WA 2X5XA 4GS5A 4D45A 1IIRA 2OP0A 4DXDA 2CDNA 3LP8A 3FYSA 3K9QO 4R71A 3PPIA 5EKDA 3A9CA 2CD7A 3ONVA 2WYIA 4QGFA 5BMVF 5LZ9A 2XX3A 4EX7A 5IH7A 1DKLA 5J59A 1CKEA 3CLTD 2Q5LA 4JL8A 4V0MA 5T4FA 5BR1A 3F73A 4NK5A 4EVIA 1LC0A 1XTSA 2I3GA 1ZX1A 1DRKA 2IDKA 2OHVA 5EZ6B 2WA1A 4G4SO 1V96A 2G06A 1TF2A 4DLXA 5LKRA 2IC5A 5SZJA 3A1VA 2OOSA 5LZ5A 1W4BA 2WILA 4O02B 3JY6A 1GCAA 3UB4A 1NV9A 3B2QA 1E3WA 3JQCA 2ERXA 1IJBA 3DZDA 3CSDA 1JFRA 4CKWB 1DOZA 2IUYA 1HYHA 2YRFA 1I6MA 2A6PA 3L7MA 4YRRA 1RMYA 2VK8A 3GZNA 2J9XB 4R54A 2YV4A 4D4KA 2HA0A 2YZNA 2W4QA 1NVEA 4DVJA 5AR1A 5DYIA 9LDBA 1D2EA 5BSGA 3DHEA 5EJIA 2FE1A 1CUEA 3K8QA 1B8PA 4I81A 4UPVA 2O0KA 1H2WA 1QLHA 1GNQA 2EFEB 3A9VA 3OX4A 4ID3A 1DS6A 2X14A 4JBWA 4DLRA 1S2GA 3P8ZA 3H2BA 4K40A 3WDKA 4YXFA 1QNLA 2AEMA 1SELA 2ZCVA 2PUBA 1LDNA 2VZ8A 4YCNA 4RE5A 1PK8A 4FFRA 4NXNB 3FKSA 1RM3A 1C14A 2WP8J 5CRIA 3BXZA 3U7EB 3TNJA 1ACMA 1SD1A 2QHXA 3NHMA 2Y76A 3CQ9A 2ZI5A 1U2TA 2FCAA 3DEHA 1O97C 2XWJI 5HFJA 2NXNA 3ZU6A 4KRGA 4JT4A 3P4XA 1G6KA 1Q3HA 4OQEA 4RA6A 2EFJA 4PG8A 3G6KA 1ATIA 2VQDA 4P6VF 3PC7A 2OAEA 2O8DA 2ECQA 4FC7A 4PHFA 1KY2A 2PV0A 3FTDA 4M46A 4AJHA 3OP1A 3BGSA 1UF9A 3EG9A 3ZLUA 5JRDS 5KINB 1PR2A 1MX9A 4OBWA 4II7A 1LQUA 3ZLTA 4CKBB 2HCTA 4MQUA 4OXYA 1AUPA 4HN4B 3O21A 4MQEA 4XUEA 3LNTA 2X42A 4GVXA 3LL7A 4NF2A 5CUQA 3K1ZA 4X62B 1L1QA 4ID9A 3S68A 5TF4A 1E2UA 2H07A 3CW2A 2X9LA 3P9CA 2HIMA 2Y67A 1QJCA 3HEAA 4X44A 2XYPA 3G3EA 5GONA 2GXAA 2CNWA 3EGXA 2Z30A 4ZOQI 2ZE6A 1PDVA 3KK0A 4WZBA 5KVCA 2A94A 4LOIA 4F6RB 4WXRA 3PK0A 4AU1A 1QIDA 2ZPTX 5THXA 1B15A 1MO2A 1OA1A 3IQDB 4R9NA 5E4FA 3NP7A 2XITA 4ZQFA 3QIAA 1QQBA 1W44A 5CT4A 4WCDA 1TK3A 3DNPA 4PHGA 3R24A 3K0SA 3OEEA 1OX4B 1CVRA 3FIJA 3NKVA 4D9KA 4ZTUB 3WWDA 1WAMA 5TMDA 1WXIA 2PMDA 3CX8A 3FKQA 2QQEA 3KPUA 3L02A 1H8HA 3BKWA 1DGQA 1W2HA 3ZVKA 1W2WB 4UATA 2DC1A 4D0SA 5LD2B 3P2YA 2KSQA 1RYMA 3WNQA 5JQGA 4C78A 3EY4A 1CY4A 1OXUA 2FLWA 2H1LA 4DT1B 2XCRB 4K2AA 3D8HA 1UPXA 1KI1A 2WIBA 2OCLA 3CF4A 3NR2A 1PR5A 1F0KA 3CSSA 2O2HA 1KMHB 5CCXA 1C7IA 2YMLA 4Y6SA 4GLJA 4EYOA 1XNGA 2CXHA 3KBOA 5AOBA 2HHHB 2ID4A 2DJIA 5D8DA 1KMNA 3KJNA 2EXXA 2C98A 1HDYA 2ADMA 1U1CA 1RQGA 4ESEA 1V5GA 2E87A 1XCLA 2WABA 1TGYA 4ER6A 4RLSA 4F9TA 4A8PA 2A9JA 1WB6A 5TQ0A 3VH2A 5H0IA 5JYBA 4X24A 4NAHA 4QWWA 1T26A 4ZRMA 2QEQA 1O96A 2ZQZA 1MEOA 4Y0AA 3AOEA 6REQB 3SY8A 3R9XA 1UKVY 3FFBA 1BDJA 1DKPA 4L78A 2LDXA 3KQLA 1P0IA 1UQTA 3SJBA 4DR6B 3VR4D 1K92A 2QP3A 2XBLA 4YFVA 5DI3A 2QNRA 4CM4A 3I52A 1RCUA 3T1HB 2XTZA 1WZEA 1FCJA 1Q19A 1Z4QA 4EA7A 1QIIA 1Z38A 3S8YA 2QPOA 1T3SA 1NUQA 4WXMA 5D3QA 3R7LA 3VDNB 1D8TA 1BKSB 3DV0B 1KZ7B 3M83A 5JBIA 2GBIA 4FIZA 5HHTA 1R9NA 3B6IA 3C98A 3C4VA 3KM0A 3PTLA 3QBTA 1HF3A 3SU8A 3ZQUA 1I2AA 2DOKA 5IAOA 4F3KA 1WQ4A 2D1QA 3WRYC 1SVUA 2ZJ6A 1Z15A 3N39C 4HGNA 4QDTA 4KN5A 1RYDA 1YDMA 3FVWA 3TQRA 3TQTA 1WKVA 5TDHA 4LF6B 1VCHA 3JD1A 4CKXA 5EHGA 3UWSA 3THXB 3UZUA 2OHGA 1RT9A 2V6BA 3M81A 1S2OA 5JLAA 3D0QA 5FR1A 1R27A 2F3TA 4XQGA 3QY0A 3CNNA 5ERYA 3GRVA 2ZREA 3QYPA 1NXOA 3O4HA 4R8LA 1FMFA 2ZQ5A 3IQHX 2VWGA 5E1DA 3LS2A 4NVRA 4Y0NA 3UHJA 1R0XA 5DNYB 3A10A 4EARA 4GOMD 3E8XA 3RS3A 1QGYA 3A0UA 3WGNA 1I33A 4EZIA 1R5NA 1X86B 1ONBA 2NO7A 1TUGA 1YACA 5EKTA 1GQYA 2HWKA 1A3CA 3L4BA 3K32A 4Q39A 5FPYA 2R8BA 1SU7A 1M66A 3WFIA 2IITA 1KI8A 2ONCA 4R9UC 3P2OA 2I2AA 3VR6H 1QGAA 1NQWA 2D59A 2B1IA 3W3AD 4GU5A 4CPDA 2AN1A 1KO4A 2IBTA 4MQ5A 3W2EA 5IRCD 3BH7A 1ZA1A 3WSWA 3ES9A 1H2ZA 1R15A 1W0CA 1J9ZA 4I6GA 5E2AA 2OXFA 3PV0A 5L3VA 3NHFA 3OTWA 1XF1A 3BB4A 4CF5A 2HQBA 4AXXA 3UA3A 1GR1A 2XEDA 5EJEA 4O4LB 1BN6A 2OBYA 4RK5A 1WHSA 3OE7A 2QQ5A 2GXSA 1HUQA 4NDNE 4BKRA 4C1BA 4G86A 1FC0A 1WD5A 3CINA 4NR0A 1H66A 1R9JA 4S3MA 2MYPA 2Q0QA 4EO4A 3T3NA 3UYKA 2FZLA 2Q28A 1B3RA 1GG2A 3OCWA 4ACAA 1ZXXA 2AE1A 4X8LA 3UK0A 3B9RA 4IMIB 4RMIA 3V9PA 3EGDB 821PA 5G1NA 5KTTA 1HDOA 5BYBA 2P30A 3OQNA 4AKHA 3T3PB 4HX9A 4LDQA 3WMFA 3BQ9A 5A04A 5C2JB 1O77A 3USCS 3G1UA 2VJPA 2X15A 4PE5B 1ULHA 7REQB 5AW3A 1Z7WA 3MWDA 4CM3A 1XFDA 1UZLA 1R6TA 1VDZA 2B7LA 2CJXA 2TSYB 3E3NA 1LH0A 1G5TA 1E9SA 3C6KA 4Q15A 1PT5A 1UXGA 4X6YA 1U4NA 3Q12A 2PUTA 4HAOA 3VMMA 4P53A 1GL9B 1TD9A 5JBQA 1HQDA 1F6BA 1Z2EA 2F9FA 2REXB 3HKDA 4NCJA 4TMVA 1M2OB 4ND8A 3WB1A 3ZVLA 5HW0A 4KBGA 4I4TB 1FXWF 3P9QA 3A7EA 4G1FA 4X1KB 4JVNA 4XVUA 2GFQA 4IJWA 3D6MA 1X3LA 3KKNA 4UTOA 4XD7A 5DWVA 4JJAA 5JNLA 2IEGA 3L5OA 3N8IA 3CEJA 4ZO9A 3IB3A 3HU5A 4JGIA 3HXOA 3C6XA 5C8YA 1L5QA 3BJEA 5I7HA 2XDQB 1FFHA 4TT8A 4ES6A 5F64A 2XYRA 2IHKA 5CFNA 2WKPA 3GW8A 4ZHQF 5J4LA 3KOWA 1XP8A 4JUFA 5EMJA 3ZXSA 3WLOA 2P9YA 2B9VA 3GFGA 4MGKR 2P8JA 3ORQA 4MUYA 1BVRA 1PW7A 1EB8A 5IU6A 2HD4A 2A5JA 2XD4A 2COEA 3ESDA 1IZ0A 1ORIA 4WOCA 1FFAA 2HMUA 5BR7A 2PUVA 1K2WA 4IHJA 1JDZA 2G70A 5HS6A 4RHTA 3DE2X 2JD2A 1ZK1A 2Y1FA 1PQPA 3UQYS 3WO1A 4MPPA 5GJVC 2B35A 1U9ZA 2O19A 1DG9A 4MITA 2IHVA 1HM5A 1JEEA 2PO7A 4YDHB 4H6XA 1UXIA 4ZVTA 4G1UC 1P0MA 3GF4A 1YK1A 4KGXA 2IV2X 4AVYA 2VS1A 5BPHA 1KI7A 3QMWA 3RIHA 4B3FX 1OC4A 5LQDA 1ZC3A 2QZ9A 3CGWA 5HZGA 5ABPA 5K8UA 4QBHA 3EZYA 4CZ2A 2OBNA 1DTWA 3CFYA 2JGLA 4RV5A 3WP0A 1AO0A 1QE5A 3JQDA 1NPDA 3Q11A 4ZI7B 3C74A 2ADFA 4JMPA 1QRDA 2QM8A 4DQVA 4XTRA 3RCBA 2VPPA 1ESEA 1OSNA 2NADA 1B6SA 1KHTA 4GZ3A 1XMJA 3O9VA 2MYTA 5L4NA 2B98A 2IDJA 4CMEA 3BFVA 1HY3A 2CHVA 3IBGA 4K9NA 3TGPA 1X1TA 3C39A 2EEPA 2X0NA 4WOPA 3EXEA 4G9BA 2WLTA 3W6ZA 1CDOA 4AMUA 2J9GA 3ZHSA 1IOVA 1X9GA 5HIMA 2P27A 1GPAA 4GEGA 4IIVA 1VSTA 4OFBA 2JA2A 4WMLA 5ECDA 3N6VA 5KKNB 1RP1A 5TIIA 1ZIYA 2XMCA 1ZGCA 2ZWIA 1NR7A 3C3AA 1T0IA 3KLPX 4WEOA 5EESA 1FVFA 5HCNA 5A4IS 1CZRA 5BN5A 4Z4HA 5KHOC 4X6UA 4JXZA 1AIPA 1B93A 1AXRA 3ESAA 1CUVA 3LOPA 1Z0DA 4FCWA 2ZXUA 2XPCA 2ZVDA 2OENG 5DSZA 2OSVA 2Q6TA 2QE7A 2QNIA 5KTMA 5GV8A 3DDCA 4JFAA 3HUDA 3OCUA 3E61A 5DHQA 2PMEA 3WLPA 2ZRHA 1KY3A 3IGFA 4JB0A 5FHRA 1DCFA 1ZI8A 3BHIA 3CB2A 3OQIB 2RHHA 1XVIA 2PN1A 1FFCA 1RLIA 3CV3A 4RY2A 3QKIA 2QYHA 3OM8A 5L3SB 4RIFA 1H4TA 1YNSA 3EVCA 3AI1A 4NABA 4P7BA 5ALJA 2X0EA 1MHTA 2IYVA 1SC9A 3AB3A 2IODA 2JBWA 4AG5A 1WXDA 4Y2QA 4BLPA 5B5SA 3NKLA 2XWPA 2VSNA 5DCUA 1GDHA 1BHO1 1JSZA 1BN7A 1ODJA 1XVUA 2AEJA 1C8KA 3EVEA 3PQ7A 4J1NA 4NHOA 5D3ZA 3M1AA 5JCPA 2Q7OE 4EHJA 1EBFA 3FAZA 4LYDA 1Z6YA 1U6IA 5JQGF 2IYQA 3IKMB 4F1JA 3UGJA 1RMQA 3OT1B 4JASB 5FNVB 1XRQA 2VDWB 3R7WA 4BLRA 3CURA 3FPBA 4JLVA 1KVTA 3ETNA 4CODB 3PJRA 1PJAA 3OJFA 5FOTA 2QORA 2W6OA 3OO0A 1XEFA 2PEYA 4C87A 1IQUA 3NHYA 3O9ZA 4I19A 4U2CA 1S96A 4AICA 1L3CA 1PJBA 1E4EA 3EDOA 4K81B 5I4BA 4IFTA 5B3JC 1IBKB 2C5LA 4RDXA 1OIVA 4AUMA 3ZIAA 4D4IA 2VQFB 3A0RB 3VM6A 2R44A 3KS9A 3ZCVA 3KQWA 4A0HA 4OHXA 5HDQA 1WABA 2LNDA 2WYHA 4PF1A 3OQPA 2EFCB 1UMDB 1XA4A 3LJKA 4MTLA 4BMCA 5A4KA 3MIIA 3VVMA 1XZCA 1CPYA 1UMCB 3PPVA 5LQSA 3QKSB 1DIHA 2PKRA 2BFFB 3PIIA 1NY5A 2QX7A 3OIUA 1AKWA 4C7MA 4I55F 1C3XA 5CNMA 2WD7B 3HUTA 4H1TA 5EMNA 3OC6A 2AOUB 3DP9A 4XH9B 4IDFA 3PJGA 1EUQA 4O2AB 1XEXA 3S8EA 2ODAA 1Q1GA 4AURA 4NU8X 1SCKA 1IHPA 1FVXA 1VCOA 1P1RA 1O6CA 1ILEA 1CULC 3DW1X 1U7XA 1KH2A 1PFVA 4Z6KA 4YPOA 1USUA 4IR7A 1U2GC 2DQZA 1OAOC 5CT6A 1MQAA 3F49S 3NNNA 4M0UA 1WTCA 5HG0A 4J43A 3P45A 2F2TA 3COSA 1BU8A 3GMTA 4LZNA 2WD9A 3L7AA 4RDHA 1XV5A 2QLLA 3TRKA 1TVKA 4MMZB 1OFUX 3BMNA 4WZAE 5BV8A 2RIRA 2WVJA 2Z09A 2H1WA 3HC7A 3P0FA 3RIMA 1GCIA 1ADYA 2CUNA 2VAWA 2ZIAA 2IZZA 1R6UA 4N9QA 5ALOA 3A2NA 3LUKA 3VNQA 3O2JA 3WKDA 1G6Q1 2CXRA 4KMRA 4US0R 3WZ2A 2JJ2D 5H3HA 4C22A 2R7AA 1YFJA 4YWHA 1EAYA 2A30A 4OGGA 2WJ4A 1BKDR 2IY7A 2NZJA 1V71A 3K8YA 2WB2A 1NLFA 4G1MB 1H8HD 2XYHA 3EN0A 1XLUA 3A4MA 1GLVA 1JSLA 1VHQA 3HDQA 4OM8A 5CA0B 5DP1A 2N0SA 4S0XA 1Z17A 4MARA 3VV2A 1WPXA 4Z86A 1YCDA 3K0KA 2QI9F 5BRJA 4LCBA 5AVVA 2XTNA 2XLCA 1E9BA 1JKFA 3MJSA 4JROA 5HM8A 2YY7A 1RAFA 4OBEA 3ACDA 4ZYUA 2E85A 5JT1A 1ABFA 3L9WA 2ZVPX 1U9IA 1LTQA 3MCVA 2R68A 3FBWA 3WYNA 4EGAA 4QOEA 4D2IA 4ARCA 1YHNA 1TJ5A 2VHUA 2Y1DA 2ZBGA 4X60A 4GLOA 2EBWA 3LW8A 2I4IA 4RD4A 3MC1A 5ALIA 4BFWA 3I1IA 1J1UA 4EL0A 1WETA 1JIIA 3GWGA 3IP7A 3M2PA 3B12A 2CHQA 1XRJA 3QPBA 4BAGA 5B6JA 1QUEA 4AFNA 1Z0IA 4PGMA 4NL4H 4B80A 2X7JA 3QTTA 2I2DA 2QDKA 2CDAA 3O47A 4UEJA 1YVUA 4WVLA 1VSVA 4HVCA 2KW5A 5KVAA 4D0GA 3U5TA 1QIEA 3HBMA 4X20A 5DOVA 5I9SA 3FNBA 2QRPA 1T9GS 3V80A 5HVNA 4J0KA 4M89A 3W7AA 4RYLA 3ZZUA 4OHBA 1NJSA 1R18A 5E4JA 3K70D 2H5JA 3BA6A 1DLIA 2WT8A 3BD8A 4FOLA 3LK6A 5HQTA 1XPUA 4CG2A 1NW9B 2R00C 4B2IA 3MK31 4EFLA 1A1SA 1NN3A 1JAHA 5HDBB 2NUTA 3RF7A 1GAWA 3VTKA 3OSZA 2YH2A 2WAAA 5CH3A 3ZPXA 1ZJYA 3B2NA 4TVKA 4N49A 4XE5A 3L49A 3W4IA 1VJRA 4G9EA 4UDXX 1DELA 2J41A 2VRCA 2Y1KA 3PFIA 3IBYA 1MIOA 4D92A 3FNHA 5FJIA 5LWQA 4K8RB 4TTPA 2CDCA 4B5KA 4F3CA 4PC6A 4RVOA 3ASVA 2QTAA 5AVZA 3AKZA 4GZ6A 1RWXA 4B7XA 2QUHA 5ARCA 2QSZA 3EBLA 3IUPA 2IZOA 4KXQA 4UOQA 4ZQGA 1KI6A 9MHTA 1GADO 1JA0A 2C3YA 1XLWA 3IELA 4RAQA 4WZAB 3L7IA 1Y82A 4WNYA 3K0CC 5HXAA 2VHZA 1V6SA 3RO7A 4YRKA 3L04A 4R9VA 1DXOA 2W2NA 3MT7A 1Q6ZA 3LQKA 1E9VA 3PEVA 1ZGAA 1NF9A 2NPOA 3ET4A 4ZQIA 4LOJA 5E9JA 2H65A 3KOMA 3TX6A 2OGSA 2QW1A 4ZZ0A 4LYFA 3K94A 4L85A 5CVTA 3BCHA 3OETA 2B9EA 2OILA 4I5GA 1AKTA 4RNCA 4YUWA 3FLBA 4KACA 4RH0A 5K3AA 5BORA 3EIHA 2PX8A 4EP1A 4A8JC 3J80A 2WTAA 3FXAA 2PLNA 1ZOOA 1NG1A 3EQ2A 3OZTA 5BSUA 2LPMA 4DUGD 4JOCA 5FULA 1AG9A 1P72A 4BMVA 5HKKD 3DFUA 1N5RA 1CY8A 4FUQA 5GV7A 5C5EA 5K2MA 3TX2A 4Q16A 4LHYA 5HFAA 1Z16A 1KTIA 1FFBA 4DG5A 5AW0A 3K5HA 2WJAA 1ZCZA 2M6SA 1G8MA 3A25A 4FLEA 1SPXA 3SHFA 3LE8A 3NTRA 3F6RA 1ZVVA 1YQQA 4B8ZA 2QGZA 1V2HE 3ZCSA 1AHIA 5JAIA 1ODFA 3CN7A 4E51A 3RABA 1K86A 5JYEA 4MS1B 4YV0A 4KV7A 4W1PA 1VPWA 1XCJA 3CKLA 4Q4AB 8GPBA 2ZYUX 3T9DA 1CUJA 2CFOA 4NICA 4FHZA 1THTA 1C8BA 1VGVA 3H1BA 4OJTA 5T7BA 2GHIA 4DRXA 1P1CA 1YCGA 2HJGA 3LOQA 3MJFA 1L5GB 1VMAA 1L5ZA 3JALB 3LT0A 5IKPA 4OUDB 3K0AA 3PDWA 4PBTA 3SE7A 3VYVA 3K4QA 5AM5A 1Q1ZA 4KP7A 1FYEA 1FZTA 4WLOA 1BD4A 5GJBA 3GV0A 1T0PA 4YECA 3NORA 4ALJA 2GAIA 3Q4GA 4MEJA 2X1MA 4GAEA 2VRWA 3LYLA 1ZL2A 5TS2A 3KL4A 2I2WA 2ZOSA 2COKA 4RWZA 3HJFA 2DHDA 2IP2A 3G9XA 3CUWA 4IHJF 2O7VA 1L3BA 1E18A 1DAPA 2X2FA 1YHYA 4H77A 1XZMA 4IGFA 1BQ3A 4LYHA 3ZBPA 1EDZA 3K4PA 4G1EB 4QNMA 2HI0A 4N7RA 2QTNA 4P3NA 3FCYA 3HDHA 5AT1A 4NPHA 4Y3UA 3V4ZA 3ZE1B 3W4JA 1FNSA 2BKEA 3EW7A 5KOJA 1MD9A 1K4KA 4DILA 1Q1BA 2WYUA 4HNVA 1HNXB 2CV1A 4ESVA 4Q93A 3DAOA 4L5BA 1MV5A 2BPOA 2WPNA 4NENA 4Y7CA 1L4GA 1IL0A 1NN5A 2RGDA 5IK2D 1TYZA 1F3OA 2B7CA 1KPIA 2QPLA 3RSZA 1L4YA 4X8HA 3V8QA 1P7PA 4HZUA 2I6UA 2RGRA 1XTUA 5JD6A 3CR7A 4I4TF 3HXLA 1I1QB 1WXQA 1QF9A 1N6PA 2BBWA 1QHFA 1ZMTA 2YYYA 1N2HA 3AI3A 3EXFA 2XVZA 3I9JA 3IEXA 4KTVE 1IN4A 1JI0A 3PHBE 4MRSA 4PZZA 3ME5A 1YD7A 3EWIA 2Z1DA 4UHHA 1JU9A 1QYVA 5DEOA 2X1LA 3AC0A 4LQDA 1X39A 3SEFA 3RBVA 5ALKA 2IEIA 4LBWA 4W1RA 4K6MA 3B2EA 3PA6A 3VC7A 2XZDA 3L7CA 3W5UA 1E98A 1G6OA 3JQAD 3GGCA 2ZDGA 2GK4A 3NWJA 5CVJA 5ALEA 2NP7A 3KJZA 3FYHA 1NVMB 3OUZA 1HL7A 4FFLA 2AE2A 5JXGA 2VK2A 3O9MA 1B23P 2JZOA 2XUZA 1E6CA 1YQTA 4WESA 1X0XA 4DS3A 3NJ4A 3IV9A 4OMCA 2EX0A 3WRXC 3ZHTA 1ZH0A 3AIMA 5E7QA 2HRCA 1C7FA 4HQRA 1STOA 2WJPA 4HZUB 2YBDA 5DHAA 2GNOA 2H2DA 3H5LA 4JA2A 4O4IB 5K9ZA 4EGFA 5G0TA 1K98A 2AN4A 3KJQA 3WIBA 3DXYA 3EMDA 1S8NA 5C3UA 1V8FA 3Q3HA 4CXMA 2Y1CA 3JYHA 2QTRA 4OYRA 4YV1A 1XKXA 5G0SA 4JYMA 1J9EA 3UJ8A 3K1TA 3OJCA 1QAQA 2AZ4A 3AEQB 3M1YA 3R3YA 2FJPA 3NVKI 4WHMA 1YT5A 4PTZA 4J03A 4DV0B 3OLZA 3C4JA 4ZCSA 5GTDA 1HLDA 1NZJA 3LPCA 1BDIA 1IY9A 1AQJA 1LRKA 4TL6A 1R0WA 3AESA 2PUGA 4WK0B 4JR2A 1FLNA 3RFVA 2PL5A 3SX0A 4LJ8A 1C7JA 2XAUA 3E9DA 3VVLA 3JQ8B 1KQPA 2EVWX 4OQFA 2IEBA 3ZHCA 2GWHA 3HSYA 3BTSA 2NU7A 3AU8A 4BUZA 4CN8A 5CEJA 3AY3A 1NFFA 3T7CA 4P33A 4R68A 2H7XA 4Z1OA 4Y2VA 5EVJA 1ZD2P 2OCBA 4FGJA 3WMWA 1SOMA 1RWQA 1BQEA 4CVNA 1FW6A 1OXXK 2PZAA 3DBVO 3MTJA 4IJ5A 4QQNA 2AFHE 1GGMA 2NZ8A 4ED9A 4GRIA 4O4LA 1Z13A 3DBRA 4LXUA 3F6SA 3FYCA 4OHUA 4BFLA 1WVIA 4JUAA 3AO0B 3O5AA 1WCV1 5E7MA 3FM9A 4HAIA 1E7RA 1FLVA 4IF6A 2IPLA 4J0GA 2J6BA 4NMHA 3FETA 3OWHA 1P2BA 1XZBA 3D8TA 3GP8A 4FPXA 4MVJE 2FZKA 4FDAA 1PQWA 1KDZA 3HG7A 1DEXA 4ISCA 3YASA 2FDCA 4KYUA 2GBLC 3VR5A 2C1XA 4WNCA 1S4MA 2BR5A 2VUTA 1Y6JA 3K0FA 4M88A 2QM7A 3Q9LA 5BOVA 1TADA 4DCSA 1EIWA 3HUFA 1EJ6A 1O94D 5IBQA 3ACBA 3B1FA 1LRJA 2Y0CA 3MBKA 2X9QA 1TGVA 3N87A 1LJUA 2PQMA 3KWMA 3TLEA 5CFQA 1QRRA 1IM5A 3GUHA 3AMVA 3GLFA 1NW5A 1SKBA 2QV0A 1PTKA 3U81A 3UJCA 1UEIA 3N2EA 3TCKA 4AMBA 2VT2A 5YASA 1MP0A