4I3AA

Structures of pr1 and pr2 intermediates from time-resolved laue crystallography collected at 14id-b, aps
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photoactive yellow protein
publication title Volume-conserving trans-cis isomerization pathways in photoactive yellow protein visualized by picosecond X-ray crystallography
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Luminescent protein
total genus 41
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2012-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4i3aA00
4LRZE 3ULFA 3UMEA 4WLAA 4HQAA 1T1BA 4HHDA 2L1MA 1LSWA 5A8BA 3BWLA 2QWSA 5DKKA 3C2WA 3UMDA 3F1OB 4HJ4A 1N9NA 4K08A 3MQQA 1XJ6A 2V0WA 4HY8A 4L9GA 2PYRA 1S4RA 3UB7A 4F3LA 1XJ2A 2L4RA 5G4YA 5DJUA 4PKYA 4JGOA 4I39A 5TBMB 3H7WA 1S66L 2YKFA 4XT2B 4EXOA 1LT0A 4L9EA 4GS9B 1S4SA 3MQOA 4NXEA 3LI9A 1F98A 1LL8A 1OTEA 3BY8A 3PHYA 1DP9A 1OTAA 3ZQ5A 5F6AA 2CMNA 3PYPA 4LPZA 2BASA 4JGQA 1OJGA 4I3IA 2K7SA 1N9LA 1D06A 5HSQA 5HD3A 1S1YA 1UWNX 4KUKA 1N9OA 3A0RA 4DJ3A 4NXFA 1MZUA 2PR5A 1XJ4A 4HI4A 5HWTA 2P7JA 2B02A 4F3LB 3GECA 3EEHA 3D72A 1LSXA 4MN5A 1KOUA 1TS8A 3H82A 3H7WB 1OTBA 1XFNA 1TS0A 4WF0A 2PD8A 3LIFA 3CLOA 1OTIA 4I5SA 3MXQA 4GCZA 4EESA 1OJ5A 2QKPA 5HDCA 3ICYA 2JHEA 2W27A 3SW1A 2ZOIA 3LICA 1DP6A 4JGPA 3FG8A 4KUOA 3EWKA 1V9YA 3MFXA 2VEAA 4HP9A 3RTYA 4WL9A 3LUQA 1VB6A 4HNBA 1GSWA 1T1AA 4BBVA 4DJ2A 3LYXA 2WKQA 4HH3A 4HH2A 5AVEA 1OT6A 1BYWA 2VLGA 4B9OA 4NXBA 3LIBA 5F68A 2R78A 2YKHA 5HDDA 3H82B 4LLOB 3CAXA 3F1PA 2J80A 1G28A 3H9WA 2W0NA 5J3WA 5HDSA 3G6OA 4LRXC 2VV6A 3P7NA 4EETB 2HV1A 3LI8A 4EW7A 1UWPX 1TS6A 3NJAA 5G4ZA 4I3AA 3NOTC 1P97A 4WN5A 4M4XA 2V1BA 5IS1A 5J7EA 5DKLA 4H6JA 1P0ZA 2PR6A 5KIZA 2V0UA 3B33A 3IBRA 4KQDA 2QJ5A 4HIAA 3K3DA 4E04A 4EQ1A 4I3JA 4GHIA 4GS9A 1S67L 2V9AA 2A24A 2OOLA 3OLOA 2VV8A 3IS2A 1X0OA 1NWZA 3MJQA 5HWVA 3LIAA 3UB8A 2EA9A 1XFQA 1T18A 3NOPC 2KDKA 5I5LA 4I38A 2M1CA 3F1PB 1UGUA 1LSVA 4LRYC 3A0VA 1EW0A 3MR0A 4EERA 2D02A 4WUJA 3FC7A 2V1AA 4R3AA 1GSXA 1V9ZA 2H28A 2ZBBA 5DJTA 5AVFA 1ODVA 2WKRA 4EEUA 1WA9A 3VOLA 1DP8A 3LIEA 3CWFA 2PYPA 1XJ3A 5HWWA 2QHKA 2OWJA 5F69A 2Z6DA 4YWZA 4H6JB 3E4OA 2PHYA 3BY9A 1OTDA 4HOIA 4EEPA 3F1NA 4BBUA 3A0SA 2PDRA 3K3CA 5J4EA 3E4PA 5F5YA 4GHIB 2A24B 4MN6A 1D7EA 1JNUA 3IS2B 2Z6CA 3C8CA 3F1OA 3NHQA 1DRMA 4RQ9A 4JGRA 1T19A 1T1CA 3KX0X 3UE6A 1OT9A 1GSVA 1Y28A 5EFWA 3E4QA 3HJKA 4HJ6A 5IU1A 4GW9A 4NXGA 4R38A 5HD5A 3VE4A 2PD7A 3UB6A 3UB9A 3NOUC 1TS7A 5TBMA 3T50A 2I9VA 4XT2A 1F9IA 2OWHA 3LIDA 2JN7A 2WKPA 4R6LA 3VE3A 4PKYG 2KX6A 2D01A 4R70A 2QJ7A 3RH8B 3HJIA 4BBTA 5HZHA 1S1ZA 4L9FA 2INWA 2VV7A 2ZOHA 4HP4A 2L0WA 4HJ3A 3F1NB 3GDIA 2GJ3A
chains in the Genus database with same CATH superfamily
3ULFA 4B88A 5J8XA 3UMEA 2G2WA 3C7VA 1MWSA 1XKZA 1T1BA 1LSWA 5AQAA 1FCMA 1CK3A 3I7JA 4OQGA 4S2NC 4K08A 4IJGA 2JKRM 4O01A 3LR0A 2V0WA 4L9GA 1SDNA 4N9KA 1H8MA 1ONHA 1S4RA 5GHXA 4KENB 4DDYA 5JYOA 1ES3A 3NI9A 3WS2A 3O88A 4S2KA 3FYZA 5G4YA 5DJUA 1I5QA 1BLSA 1SDEA 2Y2PA 4I39A 4PPRA 2V2FF 1MC0A 4GZBA 3HLFA 1SHVA 3DW0A 5F1FA 1XP4A 2XR0A 1E4DA 3KYEA 1KDSA 5FAQA 3BFCA 3S7QA 3MZFA 3BRMA 4E6XA 2V8FA 2XK1A 4FOFA 4NXEA 3TSGA 4PM7A 3R7WA 4X68A 4QJGA 4CQHA 3IWQA 4BQMA 1PI5A 2V8CA 3P09A 3ZQ5A 4ME4A 5F6AA 4KQRA 1YLYA 3OZHA 4MEZA 3TG9A 1W8QA 1N9LA 4ZBEA 3N8RA 4PMAA 4GD6A 1M40A 5AQ9A 2JKGA 4OQHA 1PZPA 4KG2A 1N9OA 3CG5A 4NKPA 2ZC4B 1BT5A 2HJ9C 2A3UA 2P7JA 5HL1A 3T1XA 1Q2PA 1KOUA 1KVMA 4ARZA 4BL3A 2JC7A 3ZG8B 4BLMA 4P0MA 4JF5A 3OCLA 5KZHA 1NY0A 3CLOA 3VSLA 2ZL1A 3WS0A 1SKOA 1A0KA 2JCHA 3R7WB 3O5YA 4JXVA 4U0XA 4Y0TA 2WADA 5FAOA 3SS3A 2X71A 2M7UA 3SOIA 5FL3A 5IT5A 2JBFA 3DWZA 3OPHA 3IHAA 4KUOA 4S2IA 1V9YA 4Y15A 2XF3A 1K57C 5HX9A 1OMEA 4WL9A 3EQUA 3O86A 1G6AA 1GSWA 4DE3A 2Y59A 4QU3A 4NG2A 5FQ9A 4X1MA 3T4QA 2FH5A 3IX8A 4ARZB 2DRWA 1BSGA 3BM6A 5HDDA 2Y2OA 3CAXA 5GL9A 4KQOA 4ZTKA 2J80A 1QMEA 1BZAA 2W1TA 2JKTM 5J3WA 3G31A 4OOMA 3G6OA 4LRXC 2ZL1B 5EECA 1SKOB 3GTCA 2HV1A 1HD8A 5G4ZA 1KDWA 4Y5FA 3NOTC 4JXSA 2O9BA 4WN5A 5CGSA 3NULA 1FQGA 1CF0A 1F5MA 1L2SA 1P0ZA 1ESIA 5KIZA 5FEGA 3VFFA 3KYQA 5DFYA 4S2OA 4KQDA 5EM0A 4HIAA 4I3JA 3G32A 4GHIA 2V9AA 2A24A 5E2HA 5HARA 2OOLA 2EX6A 3OLOA 3E2KA 3DTKA 3UN7A 1MY8A 2XFTA 4JF6A 3NOPC 4CLCA 2Y2NA 2J8YA 1YMXA 2M1CA 3L9KA 4DE1A 4DE0A 4FH2A 1ACFA 3S7OA 4LRYC 1FR6A 2QPNA 1K6RA 3GVBA 3A0VA 3LY3A 3A3IA 2C6WB 3FKVA 2W1TB 1WYCA 4X6TA 3IF6A 4R3AA 2V1AA 3BYDA 1KGGA 1V9ZA 5DJTA 1WA9A 3VOLA 3ZVTA 3UB5P 3CWFA 1H0MA 3LEQA 5HWWA 1J9MA 2QHKA 3M6BA 2Q9NA 4O0PA 4X1LA 3E4OA 2PHYA 3IBJA 1OTDA 4S2MA 4CJNA 4OONA 4EEPA 4WZ5A 2ZQDA 4MN7A 4MBFA 4LV2A 1YT4A 5HFOA 1PWGA 4NEED 5HPIA 4OLDA 2X02A 2I72A 4B4ZA 4GHIB 5CTMA 2A24B 1EWZA 4UA6A 1D7EA 3RXXA 1JNUA 3CJMA 4OPYA 2E8IA 4F94A 1T19A 1DJBA 1RP5A 2Q9MA 1T1CA 5GLAA 3T4LA 3RJUA 2W3FA 4CLCB 3GMWA 5M19A 5EVLA 3E4QA 1IYOA 4HJ6A 5IU1A 5HAIA 1BLCA 2VZWA 4R38A 1ES5A 5HD5A 4X25A 2OLUA 1TS7A 3BECA 1FCNA 2M7VA 3T50A 1YQSA 3WWXA 1F9IA 5CX7A 2OWHA 2XRNA 1PW8A 3T4TA 5K5BA 3VV4A 4DF6A 4B93A 2DCFA 3RH8B 1JWVA 3N8LA 2B18A 2VGJA 5CERA 5HZHA 1S1ZA 1YLPA 1NRJA 4L9FA 4GN2A 3TRCA 2H0TA 5CTNA 2INWA 4LV3A 5C5KA 3KSHA 2L0WA 1BULA 5EOEA 1NLYA 2WZXA 4EWFA 4LRZE 1G6OA 4JLFA 4WLAA 4HQAA 4BENA 3KYZA 2W3HA 4R1GA 3BLMA 4KZAA 5EE8A 3W4OA 2L1MA 5A8BA 4YINA 3LGOA 4KZ6A 1JWZA 1N9NA 4IVIA 1Q2QA 3VOYA 4QHCA 3SH8A 3C7UA 1ZKJA 4HY8A 5FA7A 1W7FA 2Y2QA 2V1ZA 4O8GA 3IWIA 4E6WA 4HESA 4DDSA 5DTSA 5JYPA 3GV9A 1Y54A 3DTEA 2J3TD 4OPQA 3CMZA 3ZNTA 2WKHA 2W3GA 4DE2A 3BQ8A 1YM1A 2ZM8A 2C5WB 5EVEA 1PZOA 4FSFA 1MWTA 4GS9B 1PI4A 1FR1A 1S4SA 4O7DA 4Y7PA 1GA0A 3LI9A 3EGDC 3MQ0A 3IQAA 4LCMA 2ACGA 1OTAA 3JYIA 1JVJA 3PTEA 1JTDA 5FAPA 2VGLS 2BASA 2P9VA 4JGQA 1FIKA 4I3IA 4U0TA 2K7SA 3SH9A 3DBAA 2RL3A 5HSQA 3N4IA 5DFXA 3CZDA 4AFIA 2Y2JA 2PR5A 4H8RA 2P74A 3GECA 4K0WA 1VHMA 4LCLA 3D72A 1LSXA 4A5RA 4MDZA 4MN5A 2ZC7A 5CHUA 2VK3A 5L10A 2OAQ1 1FSYA 1GHPA 1N4OA 1ESUA 4DN0A 3AGDA 2XA7M 1TS0A 3HCYA 4DMZA 2HJEA 3FKWA 3NY4A 1NYMA 1XGJA 4WF0A 3G34A 1WE4A 1MWUA 2Y4AA 3CI6A 3M2JA 3W4PA 2A49A 3GR2A 2QMIA 3VSKA 3B42A 4S2NA 3PBOA 4QD4A 5M1AA 1IKGA 1L0EA 3SW1A 4JGPA 2ZQ7A 4BWIA 4GOGA 1K38A 3HLGA 3EWKA 3T1SA 2P9VB 2WGVA 2XH9A 3GSGA 2VEAA 4HP9A 2ZC3B 1PFLA 1DY6A 3LUQA 4Q8IA 1XXMA 1IYPA 1XGIA 4OOLA 4GLQA 1T1AA 3BQAA 3IHBA 4BBVA 1NXYA 1TF1A 1Z09A 3LEZA 2WGIA 5DF7A 3M2KA 1MXOA 1S6RA 3HBRA 3NIAA 1S0WA 4Y2FA 5AVEA 2ZLYA 1BYWA 2VLGA 3QP2A 4B9OA 5F68A 4RX3A 1W5DA 2WAEA 2R78A 2YKHA 1N9BA 4LLOB 5FQKA 3V67A 1BTLA 3H9WA 1P9WA 2B5RA 4CLCE 3A3EA 1LLBA 2W0NA 3E0YA 5GHYA 3SH7A 2UV0E 4MLLA 3UO9A 1KE4A 4EETB 2GZAA 3QP8A 3LI8A 4EW7A 4IUKA 5TFQA 3V39A 3ZG9B 4DRTA 3NJAA 2Y2LA 1JTGA 3HLCA 4WEKA 1P97A 1SCWA 4FH4A 2OV5A 1RGZA 3D3OA 3IF5A 1TDLA 5DKLA 3N6IA 5CEBA 3P01A 2V0UA 5CGWA 4C3QA 3B33A 3CPTA 2QJ5A 4KZBA 3BFGA 1RGYA 5EVIC 3PBNA 4N9LA 4WMCD 1S67L 2WYXA 3IS2A 3HUMA 5CEDA 1X0OA 1LI9A 4BD0A 4JKTA 2EA9A 1T18A 2RCXA 2Z2MB 1W63Q 1KE3A 2LB5A 4I38A 3OOVA 2HDQA 4JF4A 1F2KA 3D4FA 1EW0A 4S2PA 2XSSA 4EERA 4KG6A 1EI5A 2EFUA 2CC1A 4R23A 3N8SA 4IBXA 4Y13A 3UPOA 4EEUA 2NUTC 4UQIM 5F82A 1K57A 2J9PA 3IX3A 4HBTA 2H5SA 1HLUP 1GA9A 5AJGA 3FWLA 2WKIA 4BMWA 4MNRA 2PT7A 4UA9A 4JPMA 2O9CA 1ES4A 3S1YA 3CPTB 1L0FA 2PDRA 4HBUA 4S2JA 3UPPA 1E25A 2G7UA 3PBQA 5FDSA 3TW8A 5F83A 4EUZA 1TDGA 3HL9A 1L0DA 3IS2B 2XEPA 3JVUA 3F1OA 3NHQA 1DRMA 2HP9A 4RQ9A 4QB8A 3KX0X 3UE6A 3WRZA 1ZTUA 1YLTA 1Y28A 5EFWA 5G18A 4OVDA 1LI0A 2FFYA 5BOHA 5FQQA 1NZOA 3C38A 4GW9A 3OPRA 3PBSA 1IOUA 4PM9A 2PD7A 3UB6A 1J3WA 4P6ZM 5KSHA 2O9AA 3BLSA 2EX8A 5FI7A 5A92A 1CI9A 4XT2A 3PBRA 3IH9A 3LIDA 2WKPA 2OAP1 1TEMA 1ZG4A 4R6LA 3VE3A 1YPRA 2KX6A 2IWCA 3GQZA 3HJIA 1K55C 1BLPA 4HEFA 4S2LA 5GLBA 4PM6A 4OH0A 3FZCA 1I2WA 1G5UA 2QYBA 4IHQA 5CRFA 3B47A 5CXWA 5L09A 2J9OA 4HHDA 2QZ6A 3BWLA 1L0GA 2QWSA 1AWIA 1K56D 4KZ7A 3C2WA 4GJ4A 3UMDA 3F1OB 2VKSA 4KZ9A 4P6BA 3NC8A 5TR7A 3FV7A 3VFHA 5U47A 2PYRA 3TOIA 4OQ0A 3UY6A 5E2FA 3W8KA 2L4RA 1W79A 4EU0A 1NZUA 2Y2KA 3OBFA 5DTTA 1YLZA 5L2FA 1C3BA 4GB7A 3SZTA 3DTIA 3H7WA 1S66L 2YKFA 4XT2B 4EXOA 1LT0A 3V5MA 5A91A 4KG5A 4DXCA 4L9EA 4QY5A 1NLZA 2ZQ9A 1ONGA 4D2OA 1ES2A 5AQBA 4LV0A 1F98A 1LL8A 2JE5A 2B95A 3VP2A 2J3WA 4WM9A 2AVXA 1CI8A 3PHYA 3K2NA 4R0QA 2CMNA 4LPZA 3E2LA 3MKFA 1KGFA 4IUHA 2ZC6B 3S4XA 4GKUA 3IH8A 1D06A 3IF6B 1I2SA 5HD3A 1S1YA 4KUKA 1LHYA 2HP6A 1CJFA 3A0RA 4KZ4A 3S7NA 4C75A 2KOIA 4K91A 2GX5A 3Q81A 1XJ4A 3T1QB 5HWTA 5AQ7A 3EEHA 3T1RA 5EVID 3RXWA 3KSIA 4RYEA 4R3BA 3HUOA 3ZGAB 3EGXC 3Q7ZA 4G3WA 2K2NA 2HDSA 3H7WB 4R4SA 1OTBA 1K0KA 4OQIA 1XFNA 2OLVA 5GLCA 4Y0OA 3CUEC 4WMCA 3U2AA 2PD8A 2GDNA 3LIFA 5HAQA 4E3MA 3R4KA 2XROA 1OTIA 3G35A 2VGKA 1YKDA 4I5SA 3MXQA 4JBFA 4GCZA 1MBLA 1OJ5A 2EX2A 3ICYA 5HDCA 3A3FA 2JHEA 5FDHA 4OP8A 1YSPA 1K54C 4LENA 3LICA 4GD8A 5IHVA 3MFXA 2Y91A 3T4JA 3ZDJA 4GDBA 3V3RA 3PXPA 3N7WA 1VB6A 1LL5A 2J7VA 3WS5A 4RX2A 5KSCA 4HNBA 3LR5A 4DJ2A 2WK0A 1VM1A 1H5XA 1TVFA 4E3LA 3LYXA 2WKQA 3S22A 2PU2A 2HDUA 3VMAA 4HH3A 2VX8A 4PM8A 1K25A 5DF9A 2BG1A 1L3LA 3QHYA 4L0LA 2LB9A 2ZD8A 4P87A 3F1PA 3QP4A 4KZ5A 4XXRA 2VA0A 1PWCA 1IFQA 3HUNA 2Y55A 1XPBA 4DKIA 1K4EA 3PAEA 5HDSA 1OPXA 1Y4OA 3C30A 3BFFA 1JWPA 1UWPX 3L7HA 5M18A 4OP5A 2WZZA 4B4XA 5E2EA 4I3AA 3VP3A 4JXGA 2XLNA 3ZYTA 2V1BA 5IS1A 5J7EA 2WKEA 1FSWA 4FD8A 4H6JA 2PR6A 1MPLA 5DTKA 4X69A 4K0XA 3IBRA 3KO6A 2Y2MA 1IELA 2DMWA 3QP6A 4QPRA 3UE1A 1ZG6A 3MXSA 1FCOA 2HGVA 2ZMFA 2VV8A 4LGWA 3QP1A 1NWZA 3MJQA 3GRJA 3FPVA 3VP1A 3UB8A 2EFXA 3MKEA 2PBYA 4PHTA 2XGNA 5HAPA 3IXGA 3Q1FA 3F1PB 3EOIA 4YFMA 1UGUA 3QNCA 1EROA 3MR0A 2ZM0A 3PBTA 2D02A 4QWOA 4Y3IA 1ZC2A 2Y8HA 4WUJA 2H10A 2Y2GA 3PAGA 3IWOA 3IXDA 2E8JA 1GSXA 1K56A 4OPRA 3MF0A 3Q82A 2ZQAA 2ZBBA 4Q0JA 4R3JA 4C6YA 2WGWA 4BD1A 2WKRA 3O3VA 1DP8A 1ERQA 3MXRA 5EOOA 4XUXA 3MMHA 2JKRI 2V20A 2ZJ9A 1KGEA 1KVLA 4E3IA 4Z9QA 2OWJA 4ZAMA 3UE3A 5F69A 2Z6DA 4YWZA 4H6JB 3V3SA 4DXBA 5D3OA 2R9XA 1AXBA 2WUQA 3NBLA 3F1NA 4ZJ2A 1IYQA 4BBUA 3HVFA 3MFDA 3BFDA 3KSFA 5J4EA 3NDEA 4U3TA 3E4PA 1HVBA 5F5YA 4Y0UA 5FI2A 3NDGA 3QNBA 2Z6CA 4MMNA 4WYYA 3C8CA 1Z6FA 3MBZA 2EX9A 3ZVWA 1PWDA 1OT9A 1GSVA 4IEDA 3HJKA 4D60A 2BLSA 1E3UD 4NXGA 2ZMVA 3OPLA 2DNSA 1LL9A 2XQZA 2P08A 2PAVP 5TBMA 1QMFA 1H3QA 3MS6A 2I9VA 2WGWB 3LY4A 1XX2A 1BLHA 1FILA 1NRFA 3BEBA 3UDIA 2D01A 3O87A 4LV1A 2QJ7A 4N92A 4BBTA 1GCEA 3U4LP 1RCJA 5EM1A 5EVIA 1GHIA 5EUAA 3MZDA 2ZOHA 4HP4A 4XUZA 4HJ3A 4Q0IA 3F1NB 1M6KA 4II7A 2GJ3A 2W3EA 3WS4A 2PU4A 1MKIA 1HZOA 1SZVA 3D9YA 4NETA 5TJJA 4FCFA 4IBRA 1YAXA 3PR6A 2Z2LB 5DKKA 4HJ4A 3MQQA 1XJ6A 4NK3A 2XA7S 3E98A 1K4FA 1IKIA 2MJ6A 2XFSA 5FQMA 4E3KA 1PRQA 5FATA 4OPZA 1DJCA 3NECA 1XA1A 1DJAA 3UE0A 3UB7A 4EQIA 4F3LA 1XJ2A 4ETXA 4WEJA 4KZ8A 5EPHA 4ID4A 4WBGA 1VQQA 3A3JA 4PKYA 4JGOA 1G68A 4EBPA 1P9RA 4Q0HA 5TBMB 2K31A 3HLWA 4JXWA 4M3KA 1GHMA 3ZFZA 1FOFA 3AGFA 3AGEA 4IVKA 1ZHHB 2Q0OA 5HW3A 2J3TC 2VJWA 3M6HA 5EVIB 3MQOA 1PNEA 1WYBA 4OOYA 4UAAA 1OTEA 3BY8A 1DP9A 3DWKA 4G3VA 3T12B 2IWDA 2HZ5A 3UDFA 2XD1A 2FZ0A 4PM5A 5A90A 3ZG0A 3PYPA 1CQAA 4YOFA 3G4PA 1OJGA 3LO7A 5I94A 1MWRA 3HLDA 3DAVA 1UWNX 2EWWA 2Y2IA 2JKTI 2EXBA 3QP5A 4DJ3A 4NXFA 3G30A 4RA7A 1MZUA 3RFBA 4R4RA 3JVVA 5TGFA 3W4QA 4HI4A 2B02A 4F3LB 1O07A 4MBHA 1TS8A 3OCNA 4ZJ3A 3ISGA 3H82A 3Q07A 1K55A 3HLBA 1O7EA 5CGXA 4E3OA 4ETZA 2UWXA 2EWVA 2XD5A 3BFEA 5L07A 1YSQA 4CLCC 5DVAA 4OKPA 1KE0A 3LFVA 3ZHHA 4PAUA 5F1GA 4BJPA 2FFFB 5EV0A 5E2GA 3CITA 3VP4A 3UDXA 3BW6A 4ZDXA 4EESA 3P98A 1ERMA 2QKPA 2PBDP 2EXAA 3T4SA 1PW1A 3IF6C 2ZQCA 2W27A 3WRTA 4FTXA 2IWBA 4P85A 2ZOIA 1DP6A 5KMWA 3FG8A 4LFUA 1STZA 1NYYA 4GNUA 4KQQA 3RTYA 1CEGA 2JKFA 3IXBA 4N1XA 5FEFA 5E43A 5DF8A 2BTFP 2WAFA 2HDRA 5GHZA 1ALQA 4WZ5C 4WZ4A 1YLJA 3LR4A 3A3DA 4HH2A 5HL6A 2VGLM 1OT6A 4X55A 5GLDA 1D1JA 4NXBA 4MBKA 3LIBA 4UQIS 4ZRRA 4Y17A 3IT9A 3VP0A 3H82B 2HP5A 1MKMA 5LBRA 4BL2A 2ZQ8A 4EBNA 1PIOA 1TD5A 1G28A 1VEUA 4X56A 3MZEA 1NJ4A 3W2ZA 1BUEA 4EBLA 5L8MA 1H8ZA 3C4OA 3B3XA 3FPWA 5CHMA 3TJZC 1K6SA 2VV6A 3P7NA 1YMSA 4QY6A 3TE8A 3UPNA 1TS6A 3ITBA 1PYYA 2H0YA 4KZ3A 1IEMA 4M4XA 1IYSA 4ZJ1A 1E3UA 5FQJA 3BJNA 3LCEA 4YNRA 3SS5A 3UNWA 3K3DA 4RVAA 4E04A 3ZG7B 4EQ1A 4UEYA 5FASA 4EV4A 4GS9A 3C5AA 4UA7A 4P6ZS 2W3DA 5HWVA 3LIAA 2W1RA 1XFQA 2ZM2A 3CUEA 3IXHA 4MCWA 3S7PA 5MC7A 2KDKA 4EUVA 3IX4A 5I5LA 3NCKA 2HF6A 3ZCZA 3ZG5A 5FI6A 1LSVA 4FUWA 3C4PA 3VOZA 3DTMA 1XA7A 1VEUB 3T4KA 2Y79A 2PRFA 3FC7A 3JPUA 2HPBA 1K54A 3HLEA 1VETA 3EEAA 3WS1A 1W8YA 2H28A 2KLIA 3EQVA 2O99A 5AVFA 1ODVA 1H8YA 3Q7VA 3LIEA 2ZC5B 2PYPA 1XJ3A 2IA2A 3CHWP 2G2UA 4OLGA 3BY9A 4E3JA 4HOIA 5FQIA 3OC2A 3A0SA 3MSHA 2A2LA 4G3KA 3K3CA 2OSUA 3G2YA 4CPKA 5HPFA 2R9WA 4ESPA 3LR3A 4GDNA 4X53A 4MN6A 1W63M 5A93A 5FSRA 3ZNYA 1U60A 2ZMAA 5CECA 4JGRA 4N1HA 1HTZA 2GNXA 2XDMA 2Y2HA 4UHUA 3G2ZA 2X01A 2NUPC 2P04A 1CEFA 3HREA 3VE4A 3UB9A 5CHJA 3NOUC 1VETB 3ITAA 3OPPA 4Z1WA 4E3NA 2JN7A 3Q7VB 4PKYG 4R70A 3SS4A 1SKFA 3T4OA 4CLCD 2VV7A 3V50A 3KSGA 2O0YA 4WELA 1YLWA 3GDIA
chains in the Genus database with same CATH topology
4LRZE 2W3EA 4IHQA 1G6OA 3ULFA 3B47A 3UMEA 4WLAA 4HQAA 3KYZA 2W3HA 5TJJA 1YAXA 1T1BA 4HHDA 2L1MA 1LSWA 5A8BA 3PR6A 3BWLA 2QWSA 5DKKA 3C2WA 4GJ4A 3UMDA 3F1OB 2VKSA 4HJ4A 1N9NA 4K08A 3MQQA 1XJ6A 4IJGA 2JKRM 2XA7S 3E98A 4O01A 2MJ6A 3LR0A 2V0WA 4HY8A 4L9GA 2PYRA 1H8MA 1S4RA 3UB7A 4F3LA 4O8GA 1XJ2A 4ETXA 4WEJA 2L4RA 5G4YA 5DJUA 4PKYA 4JGOA 4EU0A 3OBFA 4I39A 1P9RA 4Q0HA 5TBMB 2K31A 1MC0A 2J3TD 3H7WA 1S66L 2YKFA 4XT2B 2W3GA 4EXOA 1LT0A 3BQ8A 1ZHHB 4FSFA 4L9EA 4GS9B 3S7QA 1NLZA 2J3TC 2VJWA 1S4SA 4FOFA 3MQOA 4NXEA 3LI9A 1F98A 1LL8A 3EGDC 3R7WA 4CQHA 3MQ0A 1OTEA 2J3WA 3BY8A 3PHYA 1DP9A 1OTAA 4G3VA 3K2NA 3ZQ5A 4ME4A 5F6AA 2FZ0A 2CMNA 2VGLS 3PYPA 4LPZA 2BASA 4YOFA 4IUHA 4JGQA 1OJGA 4I3IA 2K7SA 1N9LA 1D06A 3DBAA 5HSQA 5HD3A 1S1YA 1UWNX 4KUKA 2EWWA 5DFXA 2JKTI 3A0RA 1N9OA 3S7NA 4DJ3A 4AFIA 2KOIA 4NXFA 4NKPA 1MZUA 2GX5A 2PR5A 3RFBA 1XJ4A 3JVVA 4HI4A 5HWTA 2HJ9C 2P7JA 2B02A 4F3LB 3GECA 3EEHA 1VHMA 3D72A 3KSIA 1LSXA 4MDZA 4MN5A 3EGXC 1KOUA 4G3WA 1TS8A 3OCNA 4ARZA 2K2NA 3H82A 2OAQ1 3H7WB 4DN0A 4ETZA 1OTBA 2XA7M 2EWVA 1XFNA 1TS0A 3HCYA 4DMZA 3OCLA 2HJEA 3CUEC 1YSQA 2GJ3A 4CLCC 4WF0A 3U2AA 2PD8A 3LIFA 3R4KA 3CI6A 3LFVA 2XROA 3CLOA 1OTIA 4PAUA 4BJPA 1YKDA 3CITA 4I5SA 3R7WB 3MXQA 3BW6A 3O5YA 4GCZA 4EESA 3B42A 1OJ5A 3PBOA 2QKPA 5HDCA 3ICYA 3T4SA 2JHEA 2W27A 2M7UA 5FL3A 5IT5A 1YSPA 3SW1A 2ZOIA 3LICA 1DP6A 4JGPA 4BWIA 3FG8A 1STZA 4KUOA 3EWKA 1V9YA 3MFXA 2VEAA 4HP9A 3T4JA 3RTYA 3PXPA 4WL9A 3LUQA 1VB6A 3EQUA 4HNBA 4OOLA 1GSWA 4GLQA 1T1AA 3LR5A 3BQAA 4BBVA 4DJ2A 1TF1A 3LYXA 2WKQA 4HH3A 2VX8A 5DF9A 3LR4A 4Y2FA 4HH2A 5AVEA 5HL6A 2VGLM 1OT6A 3T4QA 1BYWA 2VLGA 2FH5A 4B9OA 4L0LA 4NXBA 3LIBA 5F68A 4ARZB 4UQIS 4ZRRA 2LB9A 2R78A 2YKHA 5HDDA 3H82B 4LLOB 3CAXA 1MKMA 3F1PA 4KQOA 3V67A 5LBRA 2J80A 2VA0A 1TD5A 1G28A 3H9WA 1P9WA 1IFQA 4CLCE 2W1TA 3W2ZA 2JKTM 2W0NA 3E0YA 5J3WA 5L8MA 4OOMA 3FPWA 3TJZC 5HDSA 3G6OA 1OPXA 3C30A 4LRXC 2VV6A 3P7NA 4EETB 3TE8A 2GZAA 2HV1A 3LI8A 4IUKA 4EW7A 1UWPX 1TS6A 3NJAA 5G4ZA 4I3AA 4Y5FA 3NOTC 4WEKA 1P97A 2O9BA 4WN5A 3ZYTA 4M4XA 2V1BA 3D3OA 5IS1A 1F5MA 5J7EA 5DKLA 4H6JA 1P0ZA 2PR6A 3BJNA 5KIZA 3P01A 2V0UA 4YNRA 3B33A 3IBRA 3KYQA 3KO6A 5DFYA 4KQDA 2QJ5A 2DMWA 4HIAA 3K3DA 4E04A 4QPRA 4EQ1A 4I3JA 4UEYA 3PBNA 4GHIA 2HGVA 4GS9A 1S67L 2V9AA 2A24A 2OOLA 2ZMFA 3OLOA 4P6ZS 2VV8A 3IS2A 1X0OA 1NWZA 2W3DA 3MJQA 5HWVA 3FPVA 3LIAA 3UB8A 2EA9A 2W1RA 1XFQA 1T18A 3CUEA 3NOPC 4MCWA 1W63Q 3S7PA 4CLCA 4PHTA 5MC7A 2KDKA 4EUVA 2LB5A 5I5LA 4I38A 2HF6A 2M1CA 3OOVA 3F1PB 3EOIA 1UGUA 1LSVA 3S7OA 4LRYC 3A0VA 1EW0A 3MR0A 2XSSA 3PBTA 4EERA 2D02A 2W1TB 4Y3IA 3T4KA 2Y79A 2Y8HA 4WUJA 3FC7A 2V1AA 4R3AA 1GSXA 3MF0A 3EEAA 1V9ZA 2H28A 2ZBBA 4Q0JA 2KLIA 3EQVA 5DJTA 2O99A 5AVFA 1ODVA 2WKRA 4EEUA 1WA9A 3VOLA 2NUTC 1DP8A 4UQIM 3LIEA 3CWFA 2PYPA 1XJ3A 3MMHA 5HWWA 2IA2A 2JKRI 2QHKA 2OWJA 5AJGA 3UE3A 5F69A 2Z6DA 4O0PA 4YWZA 4H6JB 4BMWA 3E4OA 2PHYA 3BY9A 3IBJA 2PT7A 1OTDA 2O9CA 4HOIA 4EEPA 3F1NA 4BBUA 3OC2A 3A0SA 4MN7A 2A2LA 2PDRA 4G3KA 3K3CA 3KSFA 5J4EA 5HPFA 4NEED 5HPIA 2G7UA 3PBQA 3TW8A 3E4PA 3LR3A 5F5YA 4GHIB 2A24B 1W63M 4MN6A 1D7EA 1JNUA 3IS2B 2Z6CA 4MMNA 3C8CA 3JVUA 3F1OA 3NHQA 1DRMA 4RQ9A 4JGRA 1T19A 3T4LA 1T1CA 2W3FA 3KX0X 4CLCB 3UE6A 1ZTUA 2GNXA 1OT9A 1GSVA 1Y28A 5EFWA 3E4QA 3HJKA 4HJ6A 5IU1A 3C38A 4GW9A 2VZWA 4NXGA 4R38A 2P04A 2NUPC 3PBSA 5HD5A 2ZMVA 1IOUA 3VE4A 2PD7A 3UB6A 3UB9A 2P08A 3NOUC 1TS7A 4P6ZM 2O9AA 5KSHA 5TBMA 1H3QA 2M7VA 3T50A 2I9VA 4XT2A 1F9IA 5CX7A 4Z1WA 3PBRA 2OWHA 2XRNA 3T4TA 5K5BA 3LIDA 3VV4A 2JN7A 2WKPA 2OAP1 4R6LA 3VE3A 4B93A 4PKYG 2KX6A 2D01A 4R70A 2QJ7A 3RH8B 3HJIA 4BBTA 2B18A 3T4OA 5HZHA 1S1ZA 1NRJA 4L9FA 3TRCA 4CLCD 2INWA 2VV7A 2ZOHA 5C5KA 3KSHA 4HP4A 3KSGA 2L0WA 2O0YA 4WELA 4HJ3A 1NLYA 4Q0IA 3F1NB 4II7A 3GDIA 2QYBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LRZ E;  3ULF A;  3UME A;  4WLA A;  4HQA A;  1T1B A;  4HHD A;  2L1M A;  1LSW A;  5A8B A;  3BWL A;  2QWS A;  5DKK A;  3C2W A;  3UMD A;  3F1O B;  4HJ4 A;  1N9N A;  4K08 A;  3MQQ A;  1XJ6 A;  2V0W A;  4HY8 A;  4L9G A;  2PYR A;  1S4R A;  3UB7 A;  4F3L A;  1XJ2 A;  2L4R A;  5G4Y A;  5DJU A;  4PKY A;  4JGO A;  4I39 A;  5TBM B;  3H7W A;  1S66 L;  2YKF A;  4XT2 B;  4EXO A;  1LT0 A;  4L9E A;  4GS9 B;  1S4S A;  3MQO A;  4NXE A;  3LI9 A;  1F98 A;  1LL8 A;  1OTE A;  3BY8 A;  3PHY A;  1DP9 A;  1OTA A;  3ZQ5 A;  5F6A A;  2CMN A;  3PYP A;  4LPZ A;  2BAS A;  4JGQ A;  1OJG A;  4I3I A;  2K7S A;  1N9L A;  1D06 A;  5HSQ A;  5HD3 A;  1S1Y A;  1UWN X;  4KUK A;  1N9O A;  3A0R A;  4DJ3 A;  4NXF A;  1MZU A;  2PR5 A;  1XJ4 A;  4HI4 A;  5HWT A;  2P7J A;  2B02 A;  4F3L B;  3GEC A;  3EEH A;  3D72 A;  1LSX A;  4MN5 A;  1KOU A;  1TS8 A;  3H82 A;  3H7W B;  1OTB A;  1XFN A;  1TS0 A;  4WF0 A;  2PD8 A;  3LIF A;  3CLO A;  1OTI A;  4I5S A;  3MXQ A;  4GCZ A;  4EES A;  1OJ5 A;  2QKP A;  5HDC A;  3ICY A;  2JHE A;  2W27 A;  3SW1 A;  2ZOI A;  3LIC A;  1DP6 A;  4JGP A;  3FG8 A;  4KUO A;  3EWK A;  1V9Y A;  3MFX A;  2VEA A;  4HP9 A;  3RTY A;  4WL9 A;  3LUQ A;  1VB6 A;  4HNB A;  1GSW A;  1T1A A;  4BBV A;  4DJ2 A;  3LYX A;  2WKQ A;  4HH3 A;  4HH2 A;  5AVE A;  1OT6 A;  1BYW A;  2VLG A;  4B9O A;  4NXB A;  3LIB A;  5F68 A;  2R78 A;  2YKH A;  5HDD A;  3H82 B;  4LLO B;  3CAX A;  3F1P A;  2J80 A;  1G28 A;  3H9W A;  2W0N A;  5J3W A;  5HDS A;  3G6O A;  4LRX C;  2VV6 A;  3P7N A;  4EET B;  2HV1 A;  3LI8 A;  4EW7 A;  1UWP X;  1TS6 A;  3NJA A;  5G4Z A;  4I3A A;  3NOT C;  1P97 A;  4WN5 A;  4M4X A;  2V1B A;  5IS1 A;  5J7E A;  5DKL A;  4H6J A;  1P0Z A;  2PR6 A;  5KIZ A;  2V0U A;  3B33 A;  3IBR A;  4KQD A;  2QJ5 A;  4HIA A;  3K3D A;  4E04 A;  4EQ1 A;  4I3J A;  4GHI A;  4GS9 A;  1S67 L;  2V9A A;  2A24 A;  2OOL A;  3OLO A;  2VV8 A;  3IS2 A;  1X0O A;  1NWZ A;  3MJQ A;  5HWV A;  3LIA A;  3UB8 A;  2EA9 A;  1XFQ A;  1T18 A;  3NOP C;  2KDK A;  5I5L A;  4I38 A;  2M1C A;  3F1P B;  1UGU A;  1LSV A;  4LRY C;  3A0V A;  1EW0 A;  3MR0 A;  4EER A;  2D02 A;  4WUJ A;  3FC7 A;  2V1A A;  4R3A A;  1GSX A;  1V9Z A;  2H28 A;  2ZBB A;  5DJT A;  5AVF A;  1ODV A;  2WKR A;  4EEU A;  1WA9 A;  3VOL A;  1DP8 A;  3LIE A;  3CWF A;  2PYP A;  1XJ3 A;  5HWW A;  2QHK A;  2OWJ A;  5F69 A;  2Z6D A;  4YWZ A;  4H6J B;  3E4O A;  2PHY A;  3BY9 A;  1OTD A;  4HOI A;  4EEP A;  3F1N A;  4BBU A;  3A0S A;  2PDR A;  3K3C A;  5J4E A;  3E4P A;  5F5Y A;  4GHI B;  2A24 B;  4MN6 A;  1D7E A;  1JNU A;  3IS2 B;  2Z6C A;  3C8C A;  3F1O A;  3NHQ A;  1DRM A;  4RQ9 A;  4JGR A;  1T19 A;  1T1C A;  3KX0 X;  3UE6 A;  1OT9 A;  1GSV A;  1Y28 A;  5EFW A;  3E4Q A;  3HJK A;  4HJ6 A;  5IU1 A;  4GW9 A;  4NXG A;  4R38 A;  5HD5 A;  3VE4 A;  2PD7 A;  3UB6 A;  3UB9 A;  3NOU C;  1TS7 A;  5TBM A;  3T50 A;  2I9V A;  4XT2 A;  1F9I A;  2OWH A;  3LID A;  2JN7 A;  2WKP A;  4R6L A;  3VE3 A;  4PKY G;  2KX6 A;  2D01 A;  4R70 A;  2QJ7 A;  3RH8 B;  3HJI A;  4BBT A;  5HZH A;  1S1Z A;  4L9F A;  2INW A;  2VV7 A;  2ZOH A;  4HP4 A;  2L0W A;  4HJ3 A;  3F1N B;  3GDI A;  2GJ3 A; 
#chains in the Genus database with same CATH topology
 3ULF A;  4B88 A;  5J8X A;  3UME A;  2G2W A;  3C7V A;  1MWS A;  1XKZ A;  1T1B A;  1LSW A;  5AQA A;  1FCM A;  1CK3 A;  3I7J A;  4OQG A;  4S2N C;  4K08 A;  4IJG A;  2JKR M;  4O01 A;  3LR0 A;  2V0W A;  4L9G A;  1SDN A;  4N9K A;  1H8M A;  1ONH A;  1S4R A;  5GHX A;  4KEN B;  4DDY A;  5JYO A;  1ES3 A;  3NI9 A;  3WS2 A;  3O88 A;  4S2K A;  3FYZ A;  5G4Y A;  5DJU A;  1I5Q A;  1BLS A;  1SDE A;  2Y2P A;  4I39 A;  4PPR A;  2V2F F;  1MC0 A;  4GZB A;  3HLF A;  1SHV A;  3DW0 A;  5F1F A;  1XP4 A;  2XR0 A;  1E4D A;  3KYE A;  1KDS A;  5FAQ A;  3BFC A;  3S7Q A;  3MZF A;  3BRM A;  4E6X A;  2V8F A;  2XK1 A;  4FOF A;  4NXE A;  3TSG A;  4PM7 A;  3R7W A;  4X68 A;  4QJG A;  4CQH A;  3IWQ A;  4BQM A;  1PI5 A;  2V8C A;  3P09 A;  3ZQ5 A;  4ME4 A;  5F6A A;  4KQR A;  1YLY A;  3OZH A;  4MEZ A;  3TG9 A;  1W8Q A;  1N9L A;  4ZBE A;  3N8R A;  4PMA A;  4GD6 A;  1M40 A;  5AQ9 A;  2JKG A;  4OQH A;  1PZP A;  4KG2 A;  1N9O A;  3CG5 A;  4NKP A;  2ZC4 B;  1BT5 A;  2HJ9 C;  2A3U A;  2P7J A;  5HL1 A;  3T1X A;  1Q2P A;  1KOU A;  1KVM A;  4ARZ A;  4BL3 A;  2JC7 A;  3ZG8 B;  4BLM A;  4P0M A;  4JF5 A;  3OCL A;  5KZH A;  1NY0 A;  3CLO A;  3VSL A;  2ZL1 A;  3WS0 A;  1SKO A;  1A0K A;  2JCH A;  3R7W B;  3O5Y A;  4JXV A;  4U0X A;  4Y0T A;  2WAD A;  5FAO A;  3SS3 A;  2X71 A;  2M7U A;  3SOI A;  5FL3 A;  5IT5 A;  2JBF A;  3DWZ A;  3OPH A;  3IHA A;  4KUO A;  4S2I A;  1V9Y A;  4Y15 A;  2XF3 A;  1K57 C;  5HX9 A;  1OME A;  4WL9 A;  3EQU A;  3O86 A;  1G6A A;  1GSW A;  4DE3 A;  2Y59 A;  4QU3 A;  4NG2 A;  5FQ9 A;  4X1M A;  3T4Q A;  2FH5 A;  3IX8 A;  4ARZ B;  2DRW A;  1BSG A;  3BM6 A;  5HDD A;  2Y2O A;  3CAX A;  5GL9 A;  4KQO A;  4ZTK A;  2J80 A;  1QME A;  1BZA A;  2W1T A;  2JKT M;  5J3W A;  3G31 A;  4OOM A;  3G6O A;  4LRX C;  2ZL1 B;  5EEC A;  1SKO B;  3GTC A;  2HV1 A;  1HD8 A;  5G4Z A;  1KDW A;  4Y5F A;  3NOT C;  4JXS A;  2O9B A;  4WN5 A;  5CGS A;  3NUL A;  1FQG A;  1CF0 A;  1F5M A;  1L2S A;  1P0Z A;  1ESI A;  5KIZ A;  5FEG A;  3VFF A;  3KYQ A;  5DFY A;  4S2O A;  4KQD A;  5EM0 A;  4HIA A;  4I3J A;  3G32 A;  4GHI A;  2V9A A;  2A24 A;  5E2H A;  5HAR A;  2OOL A;  2EX6 A;  3OLO A;  3E2K A;  3DTK A;  3UN7 A;  1MY8 A;  2XFT A;  4JF6 A;  3NOP C;  4CLC A;  2Y2N A;  2J8Y A;  1YMX A;  2M1C A;  3L9K A;  4DE1 A;  4DE0 A;  4FH2 A;  1ACF A;  3S7O A;  4LRY C;  1FR6 A;  2QPN A;  1K6R A;  3GVB A;  3A0V A;  3LY3 A;  3A3I A;  2C6W B;  3FKV A;  2W1T B;  1WYC A;  4X6T A;  3IF6 A;  4R3A A;  2V1A A;  3BYD A;  1KGG A;  1V9Z A;  5DJT A;  1WA9 A;  3VOL A;  3ZVT A;  3UB5 P;  3CWF A;  1H0M A;  3LEQ A;  5HWW A;  1J9M A;  2QHK A;  3M6B A;  2Q9N A;  4O0P A;  4X1L A;  3E4O A;  2PHY A;  3IBJ A;  1OTD A;  4S2M A;  4CJN A;  4OON A;  4EEP A;  4WZ5 A;  2ZQD A;  4MN7 A;  4MBF A;  4LV2 A;  1YT4 A;  5HFO A;  1PWG A;  4NEE D;  5HPI A;  4OLD A;  2X02 A;  2I72 A;  4B4Z A;  4GHI B;  5CTM A;  2A24 B;  1EWZ A;  4UA6 A;  1D7E A;  3RXX A;  1JNU A;  3CJM A;  4OPY A;  2E8I A;  4F94 A;  1T19 A;  1DJB A;  1RP5 A;  2Q9M A;  1T1C A;  5GLA A;  3T4L A;  3RJU A;  2W3F A;  4CLC B;  3GMW A;  5M19 A;  5EVL A;  3E4Q A;  1IYO A;  4HJ6 A;  5IU1 A;  5HAI A;  1BLC A;  2VZW A;  4R38 A;  1ES5 A;  5HD5 A;  4X25 A;  2OLU A;  1TS7 A;  3BEC A;  1FCN A;  2M7V A;  3T50 A;  1YQS A;  3WWX A;  1F9I A;  5CX7 A;  2OWH A;  2XRN A;  1PW8 A;  3T4T A;  5K5B A;  3VV4 A;  4DF6 A;  4B93 A;  2DCF A;  3RH8 B;  1JWV A;  3N8L A;  2B18 A;  2VGJ A;  5CER A;  5HZH A;  1S1Z A;  1YLP A;  1NRJ A;  4L9F A;  4GN2 A;  3TRC A;  2H0T A;  5CTN A;  2INW A;  4LV3 A;  5C5K A;  3KSH A;  2L0W A;  1BUL A;  5EOE A;  1NLY A;  2WZX A;  4EWF A;  4LRZ E;  1G6O A;  4JLF A;  4WLA A;  4HQA A;  4BEN A;  3KYZ A;  2W3H A;  4R1G A;  3BLM A;  4KZA A;  5EE8 A;  3W4O A;  2L1M A;  5A8B A;  4YIN A;  3LGO A;  4KZ6 A;  1JWZ A;  1N9N A;  4IVI A;  1Q2Q A;  3VOY A;  4QHC A;  3SH8 A;  3C7U A;  1ZKJ A;  4HY8 A;  5FA7 A;  1W7F A;  2Y2Q A;  2V1Z A;  4O8G A;  3IWI A;  4E6W A;  4HES A;  4DDS A;  5DTS A;  5JYP A;  3GV9 A;  1Y54 A;  3DTE A;  2J3T D;  4OPQ A;  3CMZ A;  3ZNT A;  2WKH A;  2W3G A;  4DE2 A;  3BQ8 A;  1YM1 A;  2ZM8 A;  2C5W B;  5EVE A;  1PZO A;  4FSF A;  1MWT A;  4GS9 B;  1PI4 A;  1FR1 A;  1S4S A;  4O7D A;  4Y7P A;  1GA0 A;  3LI9 A;  3EGD C;  3MQ0 A;  3IQA A;  4LCM A;  2ACG A;  1OTA A;  3JYI A;  1JVJ A;  3PTE A;  1JTD A;  5FAP A;  2VGL S;  2BAS A;  2P9V A;  4JGQ A;  1FIK A;  4I3I A;  4U0T A;  2K7S A;  3SH9 A;  3DBA A;  2RL3 A;  5HSQ A;  3N4I A;  5DFX A;  3CZD A;  4AFI A;  2Y2J A;  2PR5 A;  4H8R A;  2P74 A;  3GEC A;  4K0W A;  1VHM A;  4LCL A;  3D72 A;  1LSX A;  4A5R A;  4MDZ A;  4MN5 A;  2ZC7 A;  5CHU A;  2VK3 A;  5L10 A;  2OAQ 1;  1FSY A;  1GHP A;  1N4O A;  1ESU A;  4DN0 A;  3AGD A;  2XA7 M;  1TS0 A;  3HCY A;  4DMZ A;  2HJE A;  3FKW A;  3NY4 A;  1NYM A;  1XGJ A;  4WF0 A;  3G34 A;  1WE4 A;  1MWU A;  2Y4A A;  3CI6 A;  3M2J A;  3W4P A;  2A49 A;  3GR2 A;  2QMI A;  3VSK A;  3B42 A;  4S2N A;  3PBO A;  4QD4 A;  5M1A A;  1IKG A;  1L0E A;  3SW1 A;  4JGP A;  2ZQ7 A;  4BWI A;  4GOG A;  1K38 A;  3HLG A;  3EWK A;  3T1S A;  2P9V B;  2WGV A;  2XH9 A;  3GSG A;  2VEA A;  4HP9 A;  2ZC3 B;  1PFL A;  1DY6 A;  3LUQ A;  4Q8I A;  1XXM A;  1IYP A;  1XGI A;  4OOL A;  4GLQ A;  1T1A A;  3BQA A;  3IHB A;  4BBV A;  1NXY A;  1TF1 A;  1Z09 A;  3LEZ A;  2WGI A;  5DF7 A;  3M2K A;  1MXO A;  1S6R A;  3HBR A;  3NIA A;  1S0W A;  4Y2F A;  5AVE A;  2ZLY A;  1BYW A;  2VLG A;  3QP2 A;  4B9O A;  5F68 A;  4RX3 A;  1W5D A;  2WAE A;  2R78 A;  2YKH A;  1N9B A;  4LLO B;  5FQK A;  3V67 A;  1BTL A;  3H9W A;  1P9W A;  2B5R A;  4CLC E;  3A3E A;  1LLB A;  2W0N A;  3E0Y A;  5GHY A;  3SH7 A;  2UV0 E;  4MLL A;  3UO9 A;  1KE4 A;  4EET B;  2GZA A;  3QP8 A;  3LI8 A;  4EW7 A;  4IUK A;  5TFQ A;  3V39 A;  3ZG9 B;  4DRT A;  3NJA A;  2Y2L A;  1JTG A;  3HLC A;  4WEK A;  1P97 A;  1SCW A;  4FH4 A;  2OV5 A;  1RGZ A;  3D3O A;  3IF5 A;  1TDL A;  5DKL A;  3N6I A;  5CEB A;  3P01 A;  2V0U A;  5CGW A;  4C3Q A;  3B33 A;  3CPT A;  2QJ5 A;  4KZB A;  3BFG A;  1RGY A;  5EVI C;  3PBN A;  4N9L A;  4WMC D;  1S67 L;  2WYX A;  3IS2 A;  3HUM A;  5CED A;  1X0O A;  1LI9 A;  4BD0 A;  4JKT A;  2EA9 A;  1T18 A;  2RCX A;  2Z2M B;  1W63 Q;  1KE3 A;  2LB5 A;  4I38 A;  3OOV A;  2HDQ A;  4JF4 A;  1F2K A;  3D4F A;  1EW0 A;  4S2P A;  2XSS A;  4EER A;  4KG6 A;  1EI5 A;  2EFU A;  2CC1 A;  4R23 A;  3N8S A;  4IBX A;  4Y13 A;  3UPO A;  4EEU A;  2NUT C;  4UQI M;  5F82 A;  1K57 A;  2J9P A;  3IX3 A;  4HBT A;  2H5S A;  1HLU P;  1GA9 A;  5AJG A;  3FWL A;  2WKI A;  4BMW A;  4MNR A;  2PT7 A;  4UA9 A;  4JPM A;  2O9C A;  1ES4 A;  3S1Y A;  3CPT B;  1L0F A;  2PDR A;  4HBU A;  4S2J A;  3UPP A;  1E25 A;  2G7U A;  3PBQ A;  5FDS A;  3TW8 A;  5F83 A;  4EUZ A;  1TDG A;  3HL9 A;  1L0D A;  3IS2 B;  2XEP A;  3JVU A;  3F1O A;  3NHQ A;  1DRM A;  2HP9 A;  4RQ9 A;  4QB8 A;  3KX0 X;  3UE6 A;  3WRZ A;  1ZTU A;  1YLT A;  1Y28 A;  5EFW A;  5G18 A;  4OVD A;  1LI0 A;  2FFY A;  5BOH A;  5FQQ A;  1NZO A;  3C38 A;  4GW9 A;  3OPR A;  3PBS A;  1IOU A;  4PM9 A;  2PD7 A;  3UB6 A;  1J3W A;  4P6Z M;  5KSH A;  2O9A A;  3BLS A;  2EX8 A;  5FI7 A;  5A92 A;  1CI9 A;  4XT2 A;  3PBR A;  3IH9 A;  3LID A;  2WKP A;  2OAP 1;  1TEM A;  1ZG4 A;  4R6L A;  3VE3 A;  1YPR A;  2KX6 A;  2IWC A;  3GQZ A;  3HJI A;  1K55 C;  1BLP A;  4HEF A;  4S2L A;  5GLB A;  4PM6 A;  4OH0 A;  3FZC A;  1I2W A;  1G5U A;  2QYB A;  4IHQ A;  5CRF A;  3B47 A;  5CXW A;  5L09 A;  2J9O A;  4HHD A;  2QZ6 A;  3BWL A;  1L0G A;  2QWS A;  1AWI A;  1K56 D;  4KZ7 A;  3C2W A;  4GJ4 A;  3UMD A;  3F1O B;  2VKS A;  4KZ9 A;  4P6B A;  3NC8 A;  5TR7 A;  3FV7 A;  3VFH A;  5U47 A;  2PYR A;  3TOI A;  4OQ0 A;  3UY6 A;  5E2F A;  3W8K A;  2L4R A;  1W79 A;  4EU0 A;  1NZU A;  2Y2K A;  3OBF A;  5DTT A;  1YLZ A;  5L2F A;  1C3B A;  4GB7 A;  3SZT A;  3DTI A;  3H7W A;  1S66 L;  2YKF A;  4XT2 B;  4EXO A;  1LT0 A;  3V5M A;  5A91 A;  4KG5 A;  4DXC A;  4L9E A;  4QY5 A;  1NLZ A;  2ZQ9 A;  1ONG A;  4D2O A;  1ES2 A;  5AQB A;  4LV0 A;  1F98 A;  1LL8 A;  2JE5 A;  2B95 A;  3VP2 A;  2J3W A;  4WM9 A;  2AVX A;  1CI8 A;  3PHY A;  3K2N A;  4R0Q A;  2CMN A;  4LPZ A;  3E2L A;  3MKF A;  1KGF A;  4IUH A;  2ZC6 B;  3S4X A;  4GKU A;  3IH8 A;  1D06 A;  3IF6 B;  1I2S A;  5HD3 A;  1S1Y A;  4KUK A;  1LHY A;  2HP6 A;  1CJF A;  3A0R A;  4KZ4 A;  3S7N A;  4C75 A;  2KOI A;  4K91 A;  2GX5 A;  3Q81 A;  1XJ4 A;  3T1Q B;  5HWT A;  5AQ7 A;  3EEH A;  3T1R A;  5EVI D;  3RXW A;  3KSI A;  4RYE A;  4R3B A;  3HUO A;  3ZGA B;  3EGX C;  3Q7Z A;  4G3W A;  2K2N A;  2HDS A;  3H7W B;  4R4S A;  1OTB A;  1K0K A;  4OQI A;  1XFN A;  2OLV A;  5GLC A;  4Y0O A;  3CUE C;  4WMC A;  3U2A A;  2PD8 A;  2GDN A;  3LIF A;  5HAQ A;  4E3M A;  3R4K A;  2XRO A;  1OTI A;  3G35 A;  2VGK A;  1YKD A;  4I5S A;  3MXQ A;  4JBF A;  4GCZ A;  1MBL A;  1OJ5 A;  2EX2 A;  3ICY A;  5HDC A;  3A3F A;  2JHE A;  5FDH A;  4OP8 A;  1YSP A;  1K54 C;  4LEN A;  3LIC A;  4GD8 A;  5IHV A;  3MFX A;  2Y91 A;  3T4J A;  3ZDJ A;  4GDB A;  3V3R A;  3PXP A;  3N7W A;  1VB6 A;  1LL5 A;  2J7V A;  3WS5 A;  4RX2 A;  5KSC A;  4HNB A;  3LR5 A;  4DJ2 A;  2WK0 A;  1VM1 A;  1H5X A;  1TVF A;  4E3L A;  3LYX A;  2WKQ A;  3S22 A;  2PU2 A;  2HDU A;  3VMA A;  4HH3 A;  2VX8 A;  4PM8 A;  1K25 A;  5DF9 A;  2BG1 A;  1L3L A;  3QHY A;  4L0L A;  2LB9 A;  2ZD8 A;  4P87 A;  3F1P A;  3QP4 A;  4KZ5 A;  4XXR A;  2VA0 A;  1PWC A;  1IFQ A;  3HUN A;  2Y55 A;  1XPB A;  4DKI A;  1K4E A;  3PAE A;  5HDS A;  1OPX A;  1Y4O A;  3C30 A;  3BFF A;  1JWP A;  1UWP X;  3L7H A;  5M18 A;  4OP5 A;  2WZZ A;  4B4X A;  5E2E A;  4I3A A;  3VP3 A;  4JXG A;  2XLN A;  3ZYT A;  2V1B A;  5IS1 A;  5J7E A;  2WKE A;  1FSW A;  4FD8 A;  4H6J A;  2PR6 A;  1MPL A;  5DTK A;  4X69 A;  4K0X A;  3IBR A;  3KO6 A;  2Y2M A;  1IEL A;  2DMW A;  3QP6 A;  4QPR A;  3UE1 A;  1ZG6 A;  3MXS A;  1FCO A;  2HGV A;  2ZMF A;  2VV8 A;  4LGW A;  3QP1 A;  1NWZ A;  3MJQ A;  3GRJ A;  3FPV A;  3VP1 A;  3UB8 A;  2EFX A;  3MKE A;  2PBY A;  4PHT A;  2XGN A;  5HAP A;  3IXG A;  3Q1F A;  3F1P B;  3EOI A;  4YFM A;  1UGU A;  3QNC A;  1ERO A;  3MR0 A;  2ZM0 A;  3PBT A;  2D02 A;  4QWO A;  4Y3I A;  1ZC2 A;  2Y8H A;  4WUJ A;  2H10 A;  2Y2G A;  3PAG A;  3IWO A;  3IXD A;  2E8J A;  1GSX A;  1K56 A;  4OPR A;  3MF0 A;  3Q82 A;  2ZQA A;  2ZBB A;  4Q0J A;  4R3J A;  4C6Y A;  2WGW A;  4BD1 A;  2WKR A;  3O3V A;  1DP8 A;  1ERQ A;  3MXR A;  5EOO A;  4XUX A;  3MMH A;  2JKR I;  2V20 A;  2ZJ9 A;  1KGE A;  1KVL A;  4E3I A;  4Z9Q A;  2OWJ A;  4ZAM A;  3UE3 A;  5F69 A;  2Z6D A;  4YWZ A;  4H6J B;  3V3S A;  4DXB A;  5D3O A;  2R9X A;  1AXB A;  2WUQ A;  3NBL A;  3F1N A;  4ZJ2 A;  1IYQ A;  4BBU A;  3HVF A;  3MFD A;  3BFD A;  3KSF A;  5J4E A;  3NDE A;  4U3T A;  3E4P A;  1HVB A;  5F5Y A;  4Y0U A;  5FI2 A;  3NDG A;  3QNB A;  2Z6C A;  4MMN A;  4WYY A;  3C8C A;  1Z6F A;  3MBZ A;  2EX9 A;  3ZVW A;  1PWD A;  1OT9 A;  1GSV A;  4IED A;  3HJK A;  4D60 A;  2BLS A;  1E3U D;  4NXG A;  2ZMV A;  3OPL A;  2DNS A;  1LL9 A;  2XQZ A;  2P08 A;  2PAV P;  5TBM A;  1QMF A;  1H3Q A;  3MS6 A;  2I9V A;  2WGW B;  3LY4 A;  1XX2 A;  1BLH A;  1FIL A;  1NRF A;  3BEB A;  3UDI A;  2D01 A;  3O87 A;  4LV1 A;  2QJ7 A;  4N92 A;  4BBT A;  1GCE A;  3U4L P;  1RCJ A;  5EM1 A;  5EVI A;  1GHI A;  5EUA A;  3MZD A;  2ZOH A;  4HP4 A;  4XUZ A;  4HJ3 A;  4Q0I A;  3F1N B;  1M6K A;  4II7 A;  2GJ3 A;  2W3E A;  3WS4 A;  2PU4 A;  1MKI A;  1HZO A;  1SZV A;  3D9Y A;  4NET A;  5TJJ A;  4FCF A;  4IBR A;  1YAX A;  3PR6 A;  2Z2L B;  5DKK A;  4HJ4 A;  3MQQ A;  1XJ6 A;  4NK3 A;  2XA7 S;  3E98 A;  1K4F A;  1IKI A;  2MJ6 A;  2XFS A;  5FQM A;  4E3K A;  1PRQ A;  5FAT A;  4OPZ A;  1DJC A;  3NEC A;  1XA1 A;  1DJA A;  3UE0 A;  3UB7 A;  4EQI A;  4F3L A;  1XJ2 A;  4ETX A;  4WEJ A;  4KZ8 A;  5EPH A;  4ID4 A;  4WBG A;  1VQQ A;  3A3J A;  4PKY A;  4JGO A;  1G68 A;  4EBP A;  1P9R A;  4Q0H A;  5TBM B;  2K31 A;  3HLW A;  4JXW A;  4M3K A;  1GHM A;  3ZFZ A;  1FOF A;  3AGF A;  3AGE A;  4IVK A;  1ZHH B;  2Q0O A;  5HW3 A;  2J3T C;  2VJW A;  3M6H A;  5EVI B;  3MQO A;  1PNE A;  1WYB A;  4OOY A;  4UAA A;  1OTE A;  3BY8 A;  1DP9 A;  3DWK A;  4G3V A;  3T12 B;  2IWD A;  2HZ5 A;  3UDF A;  2XD1 A;  2FZ0 A;  4PM5 A;  5A90 A;  3ZG0 A;  3PYP A;  1CQA A;  4YOF A;  3G4P A;  1OJG A;  3LO7 A;  5I94 A;  1MWR A;  3HLD A;  3DAV A;  1UWN X;  2EWW A;  2Y2I A;  2JKT I;  2EXB A;  3QP5 A;  4DJ3 A;  4NXF A;  3G30 A;  4RA7 A;  1MZU A;  3RFB A;  4R4R A;  3JVV A;  5TGF A;  3W4Q A;  4HI4 A;  2B02 A;  4F3L B;  1O07 A;  4MBH A;  1TS8 A;  3OCN A;  4ZJ3 A;  3ISG A;  3H82 A;  3Q07 A;  1K55 A;  3HLB A;  1O7E A;  5CGX A;  4E3O A;  4ETZ A;  2UWX A;  2EWV A;  2XD5 A;  3BFE A;  5L07 A;  1YSQ A;  4CLC C;  5DVA A;  4OKP A;  1KE0 A;  3LFV A;  3ZHH A;  4PAU A;  5F1G A;  4BJP A;  2FFF B;  5EV0 A;  5E2G A;  3CIT A;  3VP4 A;  3UDX A;  3BW6 A;  4ZDX A;  4EES A;  3P98 A;  1ERM A;  2QKP A;  2PBD P;  2EXA A;  3T4S A;  1PW1 A;  3IF6 C;  2ZQC A;  2W27 A;  3WRT A;  4FTX A;  2IWB A;  4P85 A;  2ZOI A;  1DP6 A;  5KMW A;  3FG8 A;  4LFU A;  1STZ A;  1NYY A;  4GNU A;  4KQQ A;  3RTY A;  1CEG A;  2JKF A;  3IXB A;  4N1X A;  5FEF A;  5E43 A;  5DF8 A;  2BTF P;  2WAF A;  2HDR A;  5GHZ A;  1ALQ A;  4WZ5 C;  4WZ4 A;  1YLJ A;  3LR4 A;  3A3D A;  4HH2 A;  5HL6 A;  2VGL M;  1OT6 A;  4X55 A;  5GLD A;  1D1J A;  4NXB A;  4MBK A;  3LIB A;  4UQI S;  4ZRR A;  4Y17 A;  3IT9 A;  3VP0 A;  3H82 B;  2HP5 A;  1MKM A;  5LBR A;  4BL2 A;  2ZQ8 A;  4EBN A;  1PIO A;  1TD5 A;  1G28 A;  1VEU A;  4X56 A;  3MZE A;  1NJ4 A;  3W2Z A;  1BUE A;  4EBL A;  5L8M A;  1H8Z A;  3C4O A;  3B3X A;  3FPW A;  5CHM A;  3TJZ C;  1K6S A;  2VV6 A;  3P7N A;  1YMS A;  4QY6 A;  3TE8 A;  3UPN A;  1TS6 A;  3ITB A;  1PYY A;  2H0Y A;  4KZ3 A;  1IEM A;  4M4X A;  1IYS A;  4ZJ1 A;  1E3U A;  5FQJ A;  3BJN A;  3LCE A;  4YNR A;  3SS5 A;  3UNW A;  3K3D A;  4RVA A;  4E04 A;  3ZG7 B;  4EQ1 A;  4UEY A;  5FAS A;  4EV4 A;  4GS9 A;  3C5A A;  4UA7 A;  4P6Z S;  2W3D A;  5HWV A;  3LIA A;  2W1R A;  1XFQ A;  2ZM2 A;  3CUE A;  3IXH A;  4MCW A;  3S7P A;  5MC7 A;  2KDK A;  4EUV A;  3IX4 A;  5I5L A;  3NCK A;  2HF6 A;  3ZCZ A;  3ZG5 A;  5FI6 A;  1LSV A;  4FUW A;  3C4P A;  3VOZ A;  3DTM A;  1XA7 A;  1VEU B;  3T4K A;  2Y79 A;  2PRF A;  3FC7 A;  3JPU A;  2HPB A;  1K54 A;  3HLE A;  1VET A;  3EEA A;  3WS1 A;  1W8Y A;  2H28 A;  2KLI A;  3EQV A;  2O99 A;  5AVF A;  1ODV A;  1H8Y A;  3Q7V A;  3LIE A;  2ZC5 B;  2PYP A;  1XJ3 A;  2IA2 A;  3CHW P;  2G2U A;  4OLG A;  3BY9 A;  4E3J A;  4HOI A;  5FQI A;  3OC2 A;  3A0S A;  3MSH A;  2A2L A;  4G3K A;  3K3C A;  2OSU A;  3G2Y A;  4CPK A;  5HPF A;  2R9W A;  4ESP A;  3LR3 A;  4GDN A;  4X53 A;  4MN6 A;  1W63 M;  5A93 A;  5FSR A;  3ZNY A;  1U60 A;  2ZMA A;  5CEC A;  4JGR A;  4N1H A;  1HTZ A;  2GNX A;  2XDM A;  2Y2H A;  4UHU A;  3G2Z A;  2X01 A;  2NUP C;  2P04 A;  1CEF A;  3HRE A;  3VE4 A;  3UB9 A;  5CHJ A;  3NOU C;  1VET B;  3ITA A;  3OPP A;  4Z1W A;  4E3N A;  2JN7 A;  3Q7V B;  4PKY G;  4R70 A;  3SS4 A;  1SKF A;  3T4O A;  4CLC D;  2VV7 A;  3V50 A;  3KSG A;  2O0Y A;  4WEL A;  1YLW A;  3GDI A; 
#chains in the Genus database with same CATH homology
 4LRZ E;  2W3E A;  4IHQ A;  1G6O A;  3ULF A;  3B47 A;  3UME A;  4WLA A;  4HQA A;  3KYZ A;  2W3H A;  5TJJ A;  1YAX A;  1T1B A;  4HHD A;  2L1M A;  1LSW A;  5A8B A;  3PR6 A;  3BWL A;  2QWS A;  5DKK A;  3C2W A;  4GJ4 A;  3UMD A;  3F1O B;  2VKS A;  4HJ4 A;  1N9N A;  4K08 A;  3MQQ A;  1XJ6 A;  4IJG A;  2JKR M;  2XA7 S;  3E98 A;  4O01 A;  2MJ6 A;  3LR0 A;  2V0W A;  4HY8 A;  4L9G A;  2PYR A;  1H8M A;  1S4R A;  3UB7 A;  4F3L A;  4O8G A;  1XJ2 A;  4ETX A;  4WEJ A;  2L4R A;  5G4Y A;  5DJU A;  4PKY A;  4JGO A;  4EU0 A;  3OBF A;  4I39 A;  1P9R A;  4Q0H A;  5TBM B;  2K31 A;  1MC0 A;  2J3T D;  3H7W A;  1S66 L;  2YKF A;  4XT2 B;  2W3G A;  4EXO A;  1LT0 A;  3BQ8 A;  1ZHH B;  4FSF A;  4L9E A;  4GS9 B;  3S7Q A;  1NLZ A;  2J3T C;  2VJW A;  1S4S A;  4FOF A;  3MQO A;  4NXE A;  3LI9 A;  1F98 A;  1LL8 A;  3EGD C;  3R7W A;  4CQH A;  3MQ0 A;  1OTE A;  2J3W A;  3BY8 A;  3PHY A;  1DP9 A;  1OTA A;  4G3V A;  3K2N A;  3ZQ5 A;  4ME4 A;  5F6A A;  2FZ0 A;  2CMN A;  2VGL S;  3PYP A;  4LPZ A;  2BAS A;  4YOF A;  4IUH A;  4JGQ A;  1OJG A;  4I3I A;  2K7S A;  1N9L A;  1D06 A;  3DBA A;  5HSQ A;  5HD3 A;  1S1Y A;  1UWN X;  4KUK A;  2EWW A;  5DFX A;  2JKT I;  3A0R A;  1N9O A;  3S7N A;  4DJ3 A;  4AFI A;  2KOI A;  4NXF A;  4NKP A;  1MZU A;  2GX5 A;  2PR5 A;  3RFB A;  1XJ4 A;  3JVV A;  4HI4 A;  5HWT A;  2HJ9 C;  2P7J A;  2B02 A;  4F3L B;  3GEC A;  3EEH A;  1VHM A;  3D72 A;  3KSI A;  1LSX A;  4MDZ A;  4MN5 A;  3EGX C;  1KOU A;  4G3W A;  1TS8 A;  3OCN A;  4ARZ A;  2K2N A;  3H82 A;  2OAQ 1;  3H7W B;  4DN0 A;  4ETZ A;  1OTB A;  2XA7 M;  2EWV A;  1XFN A;  1TS0 A;  3HCY A;  4DMZ A;  3OCL A;  2HJE A;  3CUE C;  1YSQ A;  2GJ3 A;  4CLC C;  4WF0 A;  3U2A A;  2PD8 A;  3LIF A;  3R4K A;  3CI6 A;  3LFV A;  2XRO A;  3CLO A;  1OTI A;  4PAU A;  4BJP A;  1YKD A;  3CIT A;  4I5S A;  3R7W B;  3MXQ A;  3BW6 A;  3O5Y A;  4GCZ A;  4EES A;  3B42 A;  1OJ5 A;  3PBO A;  2QKP A;  5HDC A;  3ICY A;  3T4S A;  2JHE A;  2W27 A;  2M7U A;  5FL3 A;  5IT5 A;  1YSP A;  3SW1 A;  2ZOI A;  3LIC A;  1DP6 A;  4JGP A;  4BWI A;  3FG8 A;  1STZ A;  4KUO A;  3EWK A;  1V9Y A;  3MFX A;  2VEA A;  4HP9 A;  3T4J A;  3RTY A;  3PXP A;  4WL9 A;  3LUQ A;  1VB6 A;  3EQU A;  4HNB A;  4OOL A;  1GSW A;  4GLQ A;  1T1A A;  3LR5 A;  3BQA A;  4BBV A;  4DJ2 A;  1TF1 A;  3LYX A;  2WKQ A;  4HH3 A;  2VX8 A;  5DF9 A;  3LR4 A;  4Y2F A;  4HH2 A;  5AVE A;  5HL6 A;  2VGL M;  1OT6 A;  3T4Q A;  1BYW A;  2VLG A;  2FH5 A;  4B9O A;  4L0L A;  4NXB A;  3LIB A;  5F68 A;  4ARZ B;  4UQI S;  4ZRR A;  2LB9 A;  2R78 A;  2YKH A;  5HDD A;  3H82 B;  4LLO B;  3CAX A;  1MKM A;  3F1P A;  4KQO A;  3V67 A;  5LBR A;  2J80 A;  2VA0 A;  1TD5 A;  1G28 A;  3H9W A;  1P9W A;  1IFQ A;  4CLC E;  2W1T A;  3W2Z A;  2JKT M;  2W0N A;  3E0Y A;  5J3W A;  5L8M A;  4OOM A;  3FPW A;  3TJZ C;  5HDS A;  3G6O A;  1OPX A;  3C30 A;  4LRX C;  2VV6 A;  3P7N A;  4EET B;  3TE8 A;  2GZA A;  2HV1 A;  3LI8 A;  4IUK A;  4EW7 A;  1UWP X;  1TS6 A;  3NJA A;  5G4Z A;  4I3A A;  4Y5F A;  3NOT C;  4WEK A;  1P97 A;  2O9B A;  4WN5 A;  3ZYT A;  4M4X A;  2V1B A;  3D3O A;  5IS1 A;  1F5M A;  5J7E A;  5DKL A;  4H6J A;  1P0Z A;  2PR6 A;  3BJN A;  5KIZ A;  3P01 A;  2V0U A;  4YNR A;  3B33 A;  3IBR A;  3KYQ A;  3KO6 A;  5DFY A;  4KQD A;  2QJ5 A;  2DMW A;  4HIA A;  3K3D A;  4E04 A;  4QPR A;  4EQ1 A;  4I3J A;  4UEY A;  3PBN A;  4GHI A;  2HGV A;  4GS9 A;  1S67 L;  2V9A A;  2A24 A;  2OOL A;  2ZMF A;  3OLO A;  4P6Z S;  2VV8 A;  3IS2 A;  1X0O A;  1NWZ A;  2W3D A;  3MJQ A;  5HWV A;  3FPV A;  3LIA A;  3UB8 A;  2EA9 A;  2W1R A;  1XFQ A;  1T18 A;  3CUE A;  3NOP C;  4MCW A;  1W63 Q;  3S7P A;  4CLC A;  4PHT A;  5MC7 A;  2KDK A;  4EUV A;  2LB5 A;  5I5L A;  4I38 A;  2HF6 A;  2M1C A;  3OOV A;  3F1P B;  3EOI A;  1UGU A;  1LSV A;  3S7O A;  4LRY C;  3A0V A;  1EW0 A;  3MR0 A;  2XSS A;  3PBT A;  4EER A;  2D02 A;  2W1T B;  4Y3I A;  3T4K A;  2Y79 A;  2Y8H A;  4WUJ A;  3FC7 A;  2V1A A;  4R3A A;  1GSX A;  3MF0 A;  3EEA A;  1V9Z A;  2H28 A;  2ZBB A;  4Q0J A;  2KLI A;  3EQV A;  5DJT A;  2O99 A;  5AVF A;  1ODV A;  2WKR A;  4EEU A;  1WA9 A;  3VOL A;  2NUT C;  1DP8 A;  4UQI M;  3LIE A;  3CWF A;  2PYP A;  1XJ3 A;  3MMH A;  5HWW A;  2IA2 A;  2JKR I;  2QHK A;  2OWJ A;  5AJG A;  3UE3 A;  5F69 A;  2Z6D A;  4O0P A;  4YWZ A;  4H6J B;  4BMW A;  3E4O A;  2PHY A;  3BY9 A;  3IBJ A;  2PT7 A;  1OTD A;  2O9C A;  4HOI A;  4EEP A;  3F1N A;  4BBU A;  3OC2 A;  3A0S A;  4MN7 A;  2A2L A;  2PDR A;  4G3K A;  3K3C A;  3KSF A;  5J4E A;  5HPF A;  4NEE D;  5HPI A;  2G7U A;  3PBQ A;  3TW8 A;  3E4P A;  3LR3 A;  5F5Y A;  4GHI B;  2A24 B;  1W63 M;  4MN6 A;  1D7E A;  1JNU A;  3IS2 B;  2Z6C A;  4MMN A;  3C8C A;  3JVU A;  3F1O A;  3NHQ A;  1DRM A;  4RQ9 A;  4JGR A;  1T19 A;  3T4L A;  1T1C A;  2W3F A;  3KX0 X;  4CLC B;  3UE6 A;  1ZTU A;  2GNX A;  1OT9 A;  1GSV A;  1Y28 A;  5EFW A;  3E4Q A;  3HJK A;  4HJ6 A;  5IU1 A;  3C38 A;  4GW9 A;  2VZW A;  4NXG A;  4R38 A;  2P04 A;  2NUP C;  3PBS A;  5HD5 A;  2ZMV A;  1IOU A;  3VE4 A;  2PD7 A;  3UB6 A;  3UB9 A;  2P08 A;  3NOU C;  1TS7 A;  4P6Z M;  2O9A A;  5KSH A;  5TBM A;  1H3Q A;  2M7V A;  3T50 A;  2I9V A;  4XT2 A;  1F9I A;  5CX7 A;  4Z1W A;  3PBR A;  2OWH A;  2XRN A;  3T4T A;  5K5B A;  3LID A;  3VV4 A;  2JN7 A;  2WKP A;  2OAP 1;  4R6L A;  3VE3 A;  4B93 A;  4PKY G;  2KX6 A;  2D01 A;  4R70 A;  2QJ7 A;  3RH8 B;  3HJI A;  4BBT A;  2B18 A;  3T4O A;  5HZH A;  1S1Z A;  1NRJ A;  4L9F A;  3TRC A;  4CLC D;  2INW A;  2VV7 A;  2ZOH A;  5C5K A;  3KSH A;  4HP4 A;  3KSG A;  2L0W A;  2O0Y A;  4WEL A;  4HJ3 A;  1NLY A;  4Q0I A;  3F1N B;  4II7 A;  3GDI A;  2QYB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...