4I3AA

Structures of pr1 and pr2 intermediates from time-resolved laue crystallography collected at 14id-b, aps
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Volume-conserving trans-cis isomerization pathways in photoactive yellow protein visualized by picosecond X-ray crystallography
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Luminescent protein
molecule keywords Photoactive yellow protein
total genus 41
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2012-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4i3aA00
2QHKA 3F1OA 3LIBA 1OT9A 2OWJA 1OJ5A 3MQOA 2YKHA 3LI8A 3UMEA 4B9OA 2VV8A 5HWWA 5HZHA 1OTDA 3MQQA 3E4QA 1P0ZA 5KIZA 2KDKA 2L0WA 4WLAA 5TBMB 3FG8A 1LL8A 2HV1A 2ZOIA 3VOLA 5J4EA 1LT0A 1DRMA 1T18A 1T1AA 3NJAA 4BBVA 4BBUA 4DJ3A 4F3LA 4HP9A 1F98A 5HWTA 4GCZA 1TS0A 2OOLA 2KX6A 1KOUA 2VLGA 2VV7A 3H7WB 4HI4A 4NXFA 4R70A 2Z6CA 2INWA 1TS8A 5G4ZA 3VE3A 5F6AA 5J3WA 2QWSA 3NOUC 4R6LA 1N9OA 1D7EA 5HDSA 4HJ3A 4I38A 3UB7A 3UB8A 5HSQA 4WN5A 5HD3A 4LPZA 3PYPA 4L9FA 4DJ2A 2QJ7A 2H28A 2JHEA 2PD7A 1OTEA 3CAXA 4LRZE 3EEHA 2PYRA 4WL9A 2QJ5A 4GS9B 3ZQ5A 1T19A 1VB6A 3BWLA 4GHIA 4GS9A 3VE4A 3LYXA 4R3AA 3K3CA 2PD8A 3H82B 2L1MA 1OTIA 1UGUA 3RH8B 1Y28A 1N9NA 2EA9A 1LSXA 3MXQA 1NWZA 3H82A 3RTYA 1OJGA 2Z6DA 4LLOB 5F68A 5AVFA 5HDDA 3MJQA 5F69A 5HDCA 3A0RA 2VV6A 4HJ6A 5IS1A 5HD5A 1S66L 3LI9A 4KQDA 3ULFA 4EERA 4M4XA 3HJKA 2V1AA 3A0SA 5HWVA 1S4SA 4K08A 3CLOA 1XFNA 4L9GA 5DJTA 3SW1A 3A0VA 2V0WA 2R78A 4RQ9A 3ICYA 4WF0A 4HOIA 4I39A 1XFQA 1GSWA 3MR0A 4JGPA 5I5LA 4EQ1A 3E4OA 2V9AA 1JNUA 3NHQA 3F1PB 3C8CA 1UWPX 3LIEA 5DKKA 3UE6A 1OTAA 2ZBBA 2B02A 2PYPA 2ZOHA 3LIDA 1T1BA 3T50A 3UB6A 4KUOA 4HHDA 4HNBA 3LIFA 2L4RA 3E4PA 3PHYA 4F3LB 1UWNX 2WKQA 1WA9A 3BY9A 3LUQA 4EW7A 5G4YA 3NOPC 4HQAA 1XJ6A 3IS2A 1S1YA 4WUJA 4HP4A 3P7NA 1P97A 1GSVA 4YWZA 4LRYC 3IS2B 1XJ2A 3UB9A 4I3JA 2WKPA 1LSVA 4HY8A 3MFXA 2BASA 1D06A 1G28A 4NXEA 2D02A 1TS6A 4I5SA 1MZUA 1ODVA 1N9LA 1V9YA 3CWFA 5F5YA 1S1ZA 2WKRA 5IU1A 1XJ3A 3F1PA 1T1CA 2I9VA 4I3IA 4EXOA 3B33A 4HH2A 1DP8A 1DP6A 2A24A 3BY8A 3H9WA 4H6JA 4HH3A 4JGOA 3K3DA 4PKYA 3KX0X 4XT2A 5AVEA 5J7EA 2A24B 3G6OA 3F1NA 2PR6A 4XT2B 4BBTA 3H7WA 1GSXA 2YKFA 2V1BA 4HJ4A 5DJUA 3F1NB 4R38A 4HIAA 4MN6A 2K7SA 2W27A 4L9EA 2M1CA 3LIAA 2D01A 4GW9A 1LSWA 3LICA 2GJ3A 4JGRA 1S67L 3UMDA 2CMNA 2PR5A 4JGQA 4LRXC 5EFWA 4GHIB 3C2WA 5TBMA 2OWHA 4PKYG 2QKPA 4NXGA 2P7JA 1OTBA 4NXBA 4EESA 2V0UA 5DKLA 2W0NA 3EWKA 3NOTC 4EEPA 4EETB 3GDIA 1F9IA 1V9ZA 2JN7A 1S4RA 3D72A 1DP9A 3HJIA 3OLOA 4H6JB 4MN5A 4E04A 2J80A 1EW0A 4KUKA 5A8BA 3GECA 4I3AA 1BYWA 1OT6A 2PHYA 3IBRA 2PDRA 4EEUA 2VEAA 3F1OB 1X0OA 1XJ4A 3FC7A 1TS7A
chains in the Genus database with same CATH superfamily
2QMIA 4GDBA 3MSHA 1K55A 5BOHA 2C5WB 2FZ0A 1BULA 5J4EA 5GHXA 4NG2A 3FZCA 1TS8A 2GZAA 4EBLA 3SW1A 1N9OA 2ZQ8A 4LENA 4UAAA 1M6KA 1OMEA 1VB6A 3VP3A 3LR4A 5C5KA 3C7VA 2CC1A 1N9NA 3MXQA 4ZBEA 1GA9A 4N92A 3IX8A 4KQDA 5LBRA 3HJKA 5U47A 2J3TC 5HWVA 1GHIA 1K4EA 2J9PA 4RQ9A 5GLCA 3MXRA 3V3SA 1F2KA 1C3BA 1WE4A 4JKTA 1HD8A 2J8YA 5M19A 3BECA 3NY4A 3HCYA 3IS2A 5IHVA 5HAPA 1XJ2A 2O9BA 4E6XA 3IXHA 2VGKA 1KVLA 1CF0A 3RJUA 4JLFA 3ZVWA 3EGXC 4ARZB 2WKRA 4YOFA 5E2EA 4Q0HA 1T1CA 2ZMAA 3KSIA 3HLFA 4DE3A 2OV5A 1P9WA 1YT4A 4Y17A 2GJ3A 3LR3A 2PR5A 5CXWA 3EWKA 4Y0OA 1E25A 1MY8A 1VM1A 2QYBA 3IBJA 3HLBA 4B9OA 1YLTA 1K25A 3MQQA 1O07A 5KIZA 1ES4A 4BBVA 1T1AA 4B4XA 2VJWA 2VLGA 1H8YA 2INWA 4H8RA 2XF3A 4LPZA 4NEED 1LLBA 1VETA 1PWGA 2H0YA 3Q7VA 5L09A 1CK3A 1MC0A 4OLDA 2GNXA 3VP0A 1SDNA 3CPTB 3ZG8B 3PBRA 4X68A 4BQMA 4OP5A 3WS1A 3BFFA 1PWDA 3ICYA 1ES5A 3PXPA 5HW3A 1K54A 2Y91A 1L0GA 4N1HA 3LIFA 1CEGA 2G2WA 1W5DA 1NZOA 2Y2PA 5EE8A 2JKRM 1JTGA 1KDSA 2BASA 5K5BA 1YAXA 3HLGA 3TSGA 5KSHA 3OPRA 4S2LA 1CJFA 2B18A 2HPBA 2A24B 2PR6A 4AFIA 3H7WA 5DJUA 3R7WB 1PZOA 4MN7A 1W7FA 4ZJ1A 3C30A 2ZM2A 3KYQA 3Q1FA 5EVEA 3KO6A 2V0UA 1F9IA 4H6JB 4GNUA 3MKEA 4EEUA 1CQAA 4KZ3A 2RCXA 4M3KA 1OT9A 1Z6FA 5CHUA 3MFDA 3FPVA 3IXDA 5FQJA 1XXMA 2V8FA 1LL9A 4Y5FA 4ETZA 5EUAA 1DJCA 1FQGA 2BLSA 3N7WA 1PW1A 4P6ZS 1G68A 1I2WA 1XP4A 2ZJ9A 2G7UA 2WGWB 2WKIA 4K91A 3LCEA 4OPZA 1NZUA 2ZQDA 1OTEA 3PBOA 4X69A 1T19A 3BWLA 5JYOA 3SS4A 4R3AA 5HL6A 2EXBA 2R9WA 1SZVA 3HLDA 3AGDA 4GOGA 4BWIA 2ZL1B 3A0RA 5HARA 3S7QA 5DTTA 3LY3A 3PAGA 5FAPA 5FAQA 5D3OA 3TW8A 1XFQA 3M2KA 1BLSA 2VZWA 3IH9A 4WZ5A 3V3RA 3B42A 3G34A 3ZHHA 2PYPA 2ZOHA 4WUJA 3QHYA 4HBUA 4NKPA 1LSVA 2LB5A 1D06A 3MXSA 3CWFA 5FL3A 4PM6A 2OLUA 2XDMA 3BY8A 3UY6A 3GRJA 2PRFA 3IX4A 1ERMA 4MN6A 2A2LA 4OLGA 4UQIS 3LICA 5FQKA 4Q0JA 4JXSA 1GA0A 2ZM0A 2BG1A 3OPPA 2W0NA 4DXBA 4EEPA 2ZQ7A 1V9ZA 3DWKA 1VHMA 1Q2QA 2WGVA 2LB9A 4OVDA 3BFCA 1E3UA 1F5MA 3MQOA 4OQIA 1Y54A 2KDKA 3RXWA 2HV1A 4KZ6A 4QY5A 4GCZA 4NXFA 3ZG0A 4ZJ3A 4EBNA 4UEYA 2J3TD 5F6AA 2VGLM 4GN2A 4LV1A 1JWVA 1RGYA 5JYPA 2W1TB 3QP4A 4QHCA 3ZDJA 1NRJA 3HLWA 1ZTUA 3RTYA 3CG5A 3IWIA 2Y2HA 2VV6A 3IHAA 5L10A 4OOLA 2Y2JA 4QB8A 1ES2A 2RL3A 1N9BA 1Z09A 2ZC3B 1L0FA 3DTIA 1FSWA 3E2KA 4OH0A 2XA7M 4RVAA 1YLYA 4ZJ2A 2WKQA 1WA9A 1BT5A 2Y2KA 4OPQA 4XUZA 4KQQA 5EVIC 3IT9A 3OZHA 4KZ5A 4S2JA 1SKFA 5IU1A 4CLCC 2A3UA 4I3IA 3KYEA 2ZD8A 4LCMA 3BW6A 3WS2A 1JWPA 3ZVTA 3S4XA 4Y13A 2Y2LA 4KENB 1K55C 2GX5A 1G6OA 2VGJA 3QNBA 4KG5A 1JWZA 2XR0A 4GW9A 1XX2A 4U0TA 4JGQA 2HP6A 4MDZA 5TBMA 3TJZC 1TEMA 3FKVA 5TJJA 4EETB 3I7JA 2B95A 3FC7A 3V50A 1XGIA 2YKHA 2VV8A 1K57A 5F82A 3LY4A 4WLAA 5EVIB 3VOLA 5KSCA 1LT0A 5KMWA 4FUWA 1KOUA 3G32A 4GZBA 1I5QA 4HBTA 5HSQA 2IWCA 4WZ5C 2O9AA 5DTSA 3UO9A 4D60A 2JE5A 5HDDA 1XPBA 4JF4A 5HDCA 4HJ6A 1EWZA 1SHVA 3BLSA 2H10A 4K08A 1EROA 4OOYA 3MZFA 4P0MA 3MR0A 4JGPA 2W3EA 4WMCD 1YM1A 1MXOA 4PAUA 3LUQA 1BUEA 1PI4A 3CUEC 5G4YA 1BLHA 3RXXA 1KE4A 2HJEA 4HY8A 4IHQA 2EWWA 2UV0E 3V5MA 3B33A 4HH2A 1L0DA 4KQOA 4ME4A 3QNCA 4OOMA 2W1RA 4O01A 4UA7A 3UE0A 3F1NB 5F1GA 3C5AA 2JKGA 1NYYA 4KG2A 3W2ZA 5GHZA 3BQ8A 2VKSA 1IKIA 5AQAA 1OTBA 4KZAA 4BENA 4EESA 1IYOA 3NOTC 3G35A 4DMZA 5L8MA 3TRCA 4MN5A 3OLOA 3GECA 4CLCB 3C7UA 3A3FA 3GVBA 4PPRA 2EFUA 3MZDA 2ZOIA 1DRMA 1BZAA 4F3LA 4C3QA 5J8XA 2OAP1 4U0XA 1D7EA 4I38A 4KZBA 3PYPA 4GD6A 4RX2A 3UNWA 5KZHA 1E3UD 2L1MA 1H8ZA 1OJGA 2HDRA 3VV4A 5HD5A 3N8SA 5E43A 1ZG4A 2XROA 3MBZA 3F1PB 4Y7PA 3LIDA 2ZMVA 1FILA 4PM9A 1GHPA 1GSVA 1H3QA 2ZMFA 2HZ5A 2XK1A 1G28A 1U60A 5A90A 3UN7A 2DCFA 3HVFA 3PR6A 5CTMA 1ZKJA 4K0XA 1DP8A 2A24A 3H9WA 4ZRRA 2EWVA 4PKYA 4IBRA 3A3IA 1MWUA 5TR7A 5HX9A 3UDIA 3PTEA 2EX6A 3GQZA 5HL1A 4GHIB 4YFMA 4NXBA 2J80A 4KUKA 3Q7ZA 1SCWA 2JKTM 5FATA 3HL9A 1OJ5A 3L9KA 3BFGA 3E4QA 3P09A 5TBMB 1FR6A 1W63Q 4R4SA 3HLEA 3NULA 1F98A 2W3HA 2OOLA 3NI9A 5HDSA 5AQ9A 4HJ3A 4G3VA 4YINA 1OTIA 5EVIA 5GHYA 3PBQA 4P6ZM 4BD1A 3HREA 3MJQA 4UA9A 4NK3A 1IKGA 4Y0TA 4DDSA 3NCKA 1PFLA 3T4QA 1HZOA 1OTAA 3RFBA 4KUOA 2XH9A 3W4OA 2IWDA 3QP8A 5EPHA 4IVKA 2WKPA 3G30A 1VEUB 4O8GA 2Y8HA 1FCOA 2Y2OA 3VP2A 4S2MA 3R4KA 4X6TA 1G6AA 3N8RA 3KX0X 1FOFA 2I72A 2P04A 4U3TA 2WZZA 4EU0A 2PT7A 2W27A 4E3LA 3G31A 2WADA 4P85A 1LSWA 3O88A 1ACFA 1LI0A 1QMFA 4X1LA 5CEDA 4G3KA 2OWHA 4PKYG 2PU2A 1XGJA 2OAQ1 2JN7A 5E2FA 1EW0A 3OC2A 5A8BA 1IFQA 3IXBA 1I2SA 1X0OA 4JF5A 2V1ZA 5F1FA 3L7HA 4WEKA 2XLNA 3A3DA 3FG8A 1DJAA 2XRNA 5A92A 4YNRA 1YLJA 3WWXA 5HPIA 4B4ZA 4MLLA 3BFEA 4L9FA 5HAIA 3N6IA 2P9VB 5CGXA 5GLAA 4JF6A 3UPNA 4E3IA 3S1YA 5FEGA 4X1MA 3GTCA 5FI2A 2B5RA 4EERA 3M6BA 4Y15A 4CLCA 5DJTA 5AJGA 5A93A 5GLBA 4QU3A 3KSFA 2ZQCA 4IVIA 5CERA 3EQVA 5CEBA 1FCMA 4F3LB 4IUKA 4YWZA 1ALQA 2Y2QA 4MCWA 3M2JA 3OPLA 3T4OA 4NXEA 3S7PA 1YPRA 4G3WA 3ZG7B 1H5XA 5F5YA 1LL5A 3F1PA 4EXOA 4PMAA 3BQAA 2XA7S 4XXRA 1TD5A 3GSGA 2JC7A 4N1XA 4MBHA 3PAEA 2K7SA 3LEQA 3OBFA 1CI9A 3FPWA 2DMWA 4JGRA 1S67L 3UDXA 3UMDA 5EV0A 3HUMA 3V67A 1WYCA 2VEAA 2JKFA 3VP4A 2JBFA 3HBRA 4OP8A 5HWWA 3UDFA 2L0WA 4PM5A 2G2UA 4HEFA 2WKHA 3IWQA 4DN0A 4IJGA 3T50A 4HI4A 1MKMA 3Q82A 3UB5P 2XEPA 4MNRA 4DF6A 3T4SA 3CZDA 2XSSA 3RH8B 2XGNA 4BMWA 1LSXA 1O7EA 3H82A 3A3JA 4WM9A 4L0LA 3WS4A 2ZC7A 3T12B 4UA6A 1TDGA 2V1AA 4FSFA 4GKUA 3SS5A 2ZC6B 3KSGA 5I5LA 4MMNA 3Q81A 4LV3A 3VFFA 3MS6A 3FKWA 2B02A 1WYBA 3P01A 4HHDA 3T1RA 4HQAA 2ZC4B 1BLCA 1P97A 1TS6A 3GV9A 2X02A 4R23A 5CGSA 2EXAA 2ACGA 1P9RA 4WMCA 1MWSA 2J7VA 2ZQ9A 2Y4AA 4ETXA 1AWIA 2OLVA 2YKFA 4HJ4A 5FI6A 3K2NA 2DNSA 5M18A 1MBLA 4B88A 1YSQA 1VEUA 1Q2PA 1NY0A 1ESIA 5DF9A 3O3VA 3CITA 3S7NA 4S2IA 5CHJA 4FD8A 4QWOA 1ZG6A 3E98A 4P6BA 4WYYA 4ID4A 3LI8A 1LL8A 2BTFP 3EEAA 2WK0A 1FSYA 5FQQA 3UMEA 3H7WB 1RP5A 2GDNA 4R6LA 2V2FF 3NDGA 4WN5A 2WAFA 4RA7A 1IYQA 1ZHHB 3UPPA 2HP9A 3UB8A 1FIKA 4E3KA 2R9XA 3LEZA 1JTDA 1LI9A 2Q0OA 4UQIM 4M4XA 4EQIA 2Y2NA 3IHBA 4L9GA 2V0WA 3ZYTA 2R78A 4O7DA 1GSWA 4FH4A 4R1GA 3BEBA 1ESUA 2ZQAA 3AGEA 3LIEA 2ZBBA 4HNBA 4K0WA 1XA7A 3DTKA 2V20A 3BY9A 3SH8A 3SH9A 3SS3A 4LRYC 5EVID 4I3JA 4GDNA 3EGDC 3HUNA 4UHUA 3C4PA 3Q7VB 2JCHA 2J9OA 2Y2GA 4HH3A 3FV7A 1NLZA 3LR0A 5G18A 3G6OA 2JKTI 4FCFA 4RYEA 4GJ4A 3SOIA 2WGWA 3SZTA 4E3JA 4L9EA 3SH7A 4PM8A 4E3MA 3MZEA 1PW8A 3C2WA 3T4LA 1CEFA 3CPTA 4HESA 1KGFA 3UE3A 1N4OA 1S4RA 4X25A 5AQ7A 4JXVA 2PDRA 1XJ4A 1HVBA 3N4IA 4OPYA 4OQHA 1K0KA 4R3BA 3AGFA 4KZ8A 2NUPC 4S2PA 2V8CA 3CUEA 5G4ZA 2J3WA 3QP2A 4FH2A 1KGEA 4DJ2A 3EEHA 4Q8IA 3EQUA 2P74A 1PRQA 2W3FA 5HAQA 1Y28A 3OCNA 3KYZA 3NDEA 1YKDA 2Z6DA 5AVFA 4CPKA 5IS1A 5CTNA 2EX2A 3LGOA 5FDHA 3BJNA 3A0VA 3DWZA 4WF0A 1IEMA 4HOIA 4BJPA 2FFFB 3E4OA 2V9AA 3WRZA 4P87A 2HDQA 3BFDA 3HLCA 3HUOA 1W8YA 1VQQA 2XQZA 5GL9A 4LV0A 1S1YA 3P7NA 2W3DA 1LHYA 3UB9A 5M1AA 2ZC5B 5F83A 3O87A 3B3XA 3O5YA 2Y55A 1YMSA 3V39A 1PIOA 2P08A 3GMWA 4DDYA 2PBDP 4OKPA 4XT2B 1YLZA 2Y79A 4R38A 2PU4A 2WAEA 3DW0A 2QKPA 1DY6A 1DP9A 3JYIA 4DE1A 3NBLA 1W79A 3DBAA 3E2LA 4Z1WA 3F1OA 3D3OA 2OWJA 3VMAA 3ITBA 2P9VA 3U4LP 3ZNTA 5FQMA 1K6RA 3MQ0A 1T18A 5A91A 4HP9A 1S0WA 1XA1A 2K31A 5MC7A 2DRWA 5DF8A 5HD3A 5L07A 2E8JA 2PD7A 3QP5A 3ZGAB 1K38A 3W8KA 4GS9A 3NIAA 2EX9A 5EOEA 1ONGA 1MWTA 3W4QA 3ULFA 3JPUA 2WGIA 3BLMA 3IF6C 2PAVP 3CMZA 4I39A 1Y4OA 1JNUA 3D9YA 5EM0A 1ZC2A 5I94A 1K56D 4FOFA 5DFXA 4I5SA 3U2AA 1MZUA 3G2YA 1ODVA 4DRTA 3C4OA 5EOOA 2A49A 3IF6A 3IWOA 4N9KA 4LFUA 1HTZA 4CJNA 4O0PA 1ONHA 4A5RA 3CJMA 3OOVA 5FQIA 5CGWA 3FYZA 3CI6A 4OONA 4QPRA 1NJ4A 3T1XA 1GHMA 4EWFA 2P7JA 1PNEA 1BSGA 3VSLA 3DAVA 3JVVA 4I3AA 4EUZA 1OT6A 4DE2A 5DF7A 1J9MA 4CQHA 5CX7A 3TE8A 4MEZA 2M7VA 3G2ZA 4DXCA 5DFYA 2O9CA 3WS0A 4D2OA 3VOYA 3DTMA 1NYMA 1EI5A 3NJAA 4R0QA 4F94A 5HWTA 3UE1A 1SDEA 4MBFA 1RGZA 2KX6A 3PBSA 1QMEA 5J3WA 3P98A 2QWSA 3NOUC 3WS5A 4CLCD 4LRZE 1M40A 2Q9MA 1YLWA 3LYXA 3K3CA 3H82B 2Y2IA 1UGUA 4BD0A 3T4TA 2FFYA 3NECA 3O86A 2OSUA 3T1QB 2O0YA 4ESPA 1L0EA 4Y0UA 1YQSA 2M7UA 1IOUA 3UE6A 1T1BA 3E0YA 2WZXA 1W63M 1YLPA 3VOZA 1L2SA 1TF1A 1K56A 3IS2B 4WZ4A 4KQRA 3MFXA 2VGLS 2HGVA 5FA7A 1S1ZA 2JKRI 3N8LA 5FEFA 2Z2LB 5FI7A 3BYDA 3TG9A 5IT5A 5E2GA 3S22A 2D01A 1ERQA 3KSHA 4R3JA 2CMNA 2WUQA 4LRXC 1BLPA 2EFXA 1H0MA 3QP1A 3GDIA 2Y59A 3W4PA 4X53A 3MF0A 1BYWA 2VK3A 2KOIA 5EVLA 4E3OA 3T1SA 1PWCA 4Y3IA 2WKEA 1FR1A 1TS0A 2Z6CA 4LV2A 3A3EA 2H28A 5L2FA 4S2NC 2QJ5A 1VETB 4ZAMA 5FSRA 3ZG5A 4BL3A 4NETA 4E3NA 2EA9A 3T4JA 1L3LA 3IQAA 1SKOA 4LLOB 3GR2A 4GB7A 4IUHA 3ZCZA 2IA2A 1XKZA 3A0SA 5HPFA 1S4SA 1K54C 4Y2FA 4BLMA 3BRMA 1UWPX 5DKKA 3UB6A 1MKIA 4JBFA 2EX8A 3PHYA 4EW7A 1KE3A 2K2NA 4KZ9A 4OQ0A 4JXGA 4QD4A 5DTKA 1G5UA 3LO7A 4S2OA 2VA0A 4WELA 5FAOA 1N9LA 5GLDA 2HDUA 2X71A 2X01A 4IEDA 4Q0IA 1DP6A 3K3DA 1K6SA 5AQBA 4Z9QA 2ZM8A 4ZTKA 1NRFA 2M1CA 3LIAA 4X56A 5DVAA 3S7OA 1CI8A 2XFSA 5FASA 4WEJA 3NC8A 1ES3A 5DKLA 5CRFA 4EBPA 4WBGA 1MPLA 3IF5A 3OPHA 1J3WA 3IBRA 2QPNA 4S2KA 3ZFZA 1TS7A 4S2NA 1OTDA 3WRTA 3IF6B 1KE0A 2XD5A 4PM7A 5TFQA 5HFOA 3PBNA 1FCNA 4DJ3A 1OPXA 4N9LA 4XUXA 1TDLA 1TVFA 4R70A 3UB7A 3LR5A 4OPRA 2JHEA 2XFTA 3CAXA 1IYPA 3IX3A 4GHIA 5FDSA 2VX8A 4IBXA 3VE4A 4JPMA 2PD8A 3C38A 5F68A 1NLYA 5F69A 5EECA 1S66L 4LGWA 3G4PA 3FWLA 2WYXA 2KLIA 5TGFA 1D1JA 4ARZA 2H5SA 3JVUA 1STZA 4QJGA 1K57C 3C8CA 3D4FA 2HDSA 1KVMA 5E2HA 2HJ9C 2FH5A 3EOIA 3VE3A 5CECA 2Q9NA 2NUTC 3T4KA 4PHTA 3B47A 1PYYA 1K4FA 1GCEA 4LCLA 2IWBA 1V9YA 3TOIA 3CHWP 4QY6A 2HP5A 1XJ3A 2I9VA 3VP1A 3BM6A 5AVEA 4FTXA 5J7EA 4XT2A 3IXGA 3F1NA 4MBKA 4BBTA 1GSXA 2V1BA 3UPOA 4GD8A 4BL2A 2PBYA 4II7A 1YMXA 3ZG9B 4CLCE 3VSKA 2Y2MA 3D72A 4E04A 4C75A 2HF6A 2PHYA 4OQGA 3F1OB 2QHKA 3LIBA 3LFVA 5HZHA 1P0ZA 2AVXA 3OCLA 4BBUA 4KG6A 3IH8A 2VV7A 1JVJA 3Q07A 4C6YA 3MKFA 1MWRA 1E4DA 2QJ7A 3DTEA 2UWXA 3ITAA 2PYRA 3M6HA 3QP6A 4GS9B 4WL9A 3ZQ5A 2QZ6A 1IYSA 4R4RA 4E6WA 1NWZA 2W3GA 4RX3A 3LI9A 3R7WA 4GLQA 3CLOA 1XFNA 5EM1A 1KGGA 4X55A 1RCJA 5FQ9A 3ISGA 3PBTA 4EQ1A 1IELA 2W1TA 3NHQA 2O99A 2H0TA 2L4RA 3E4PA 1UWNX 1HLUP 4KZ4A 3MMHA 1SKOB 3NOPC 1XJ6A 4HP4A 1BTLA 1H8MA 2D02A 2ZLYA 4EV4A 1W8QA 2Z2MB 1YSPA 4JGOA 4H6JA 4DE0A 1S6RA 4B93A 2E8IA 1AXBA 4HIAA 4DKIA 1KDWA 3ZNYA 5CHMA 4JXWA 1PZPA 1A0KA 4ZDXA 1PI5A 5EFWA 4NXGA 1NXYA 3VFHA 3HJIA 2MJ6A 4EUVA 2ZL1A 1DJBA 2C6WB 4KZ7A 2XD1A
chains in the Genus database with same CATH topology
3TE8A 2M7VA 2YKHA 2VV8A 5HWWA 5DFYA 2O9CA 2FZ0A 2L0WA 4WLAA 3VOLA 5J4EA 1LT0A 3NJAA 5HWTA 4DN0A 4IJGA 2KX6A 1KOUA 4HI4A 3T50A 3PBSA 1MKMA 1TS8A 2GZAA 5J3WA 2QWSA 3NOUC 3SW1A 1N9OA 5HSQA 4CLCD 4LRZE 1VB6A 3T4SA 3LYXA 3LR4A 2O9AA 5C5KA 2XSSA 3K3CA 3H82B 3RH8B 4BMWA 1UGUA 1N9NA 1LSXA 3MXQA 3T4TA 3H82A 5HDDA 5HDCA 4L0LA 4HJ6A 4KQDA 5LBRA 3HJKA 2V1AA 2J3TC 4FSFA 5HWVA 4K08A 3KSGA 2O0YA 4RQ9A 5I5LA 3MR0A 4JGPA 4MMNA 2M7UA 1IOUA 3UE6A 2W3EA 2B02A 1T1BA 3P01A 3E0YA 4HHDA 1W63M 4PAUA 3LUQA 3HCYA 3CUEC 5G4YA 4HQAA 3IS2A 1P97A 1TF1A 3IS2B 1XJ2A 2O9BA 2HJEA 4HY8A 4IHQA 3MFXA 2VGLS 1TS6A 2EWWA 2HGVA 3EGXC 4ARZB 1S1ZA 2JKRI 2WKRA 4YOFA 4Q0HA 1P9RA 1T1CA 3KSIA 3B33A 4HH2A 4KQOA 4ME4A 4ETXA 4OOMA 2W1RA 2YKFA 4O01A 4HJ4A 5IT5A 3F1NB 3K2NA 1P9WA 1YSQA 2D01A 2GJ3A 3W2ZA 3LR3A 3KSHA 5DF9A 2CMNA 2PR5A 2VKSA 3BQ8A 4LRXC 3CITA 3S7NA 1OTBA 4EESA 3EWKA 3NOTC 3GDIA 5L8MA 3TRCA 4MN5A 3OLOA 4DMZA 3E98A 3GECA 3MF0A 1BYWA 2KOIA 4CLCB 3IBJA 2QYBA 3LI8A 4B9OA 3MQQA 5KIZA 1LL8A 2ZOIA 1DRMA 4BBVA 1T1AA 3EEAA 4Y3IA 4F3LA 2VJWA 2OAP1 1TS0A 2VLGA 3UMEA 3H7WB 2Z6CA 2INWA 4R6LA 1D7EA 4I38A 4WN5A 4LPZA 3PYPA 4NEED 2H28A 2QJ5A 1ZHHB 1MC0A 3UB8A 2GNXA 2L1MA 2EA9A 3T4JA 1OJGA 4LLOB 3VV4A 3PBRA 4IUHA 2IA2A 5HD5A 4UQIM 4M4XA 3A0SA 5HPFA 1S4SA 4L9GA 2V0WA 3ZYTA 2R78A 3ICYA 4Y2FA 2XROA 1GSWA 3F1PB 3PXPA 1UWPX 3LIEA 5DKKA 2ZBBA 3LIDA 3UB6A 4HNBA 2ZMVA 3LIFA 3PHYA 3BY9A 4EW7A 2K2NA 1GSVA 1H3QA 2ZMFA 4LRYC 2JKRM 4I3JA 3EGDC 4WELA 2VA0A 2BASA 1G28A 5K5BA 1YAXA 3PR6A 1N9LA 5KSHA 1DP8A 1DP6A 2A24A 4Q0IA 3H9WA 2B18A 2EWVA 4HH3A 3K3DA 4PKYA 4ZRRA 1NLZA 3LR0A 2A24B 3G6OA 2PR6A 4AFIA 2JKTI 3H7WA 5DJUA 4GJ4A 3R7WB 4MN7A 4L9EA 2M1CA 3LIAA 3C30A 3KYQA 3S7OA 4GHIB 3C2WA 3T4LA 3KO6A 4WEJA 4NXBA 2V0UA 5DKLA 1F9IA 4H6JB 3UE3A 1S4RA 2J80A 4KUKA 4EEUA 3IBRA 2PDRA 1XJ4A 2JKTM 1TS7A 1OT9A 1OJ5A 1OTDA 3FPVA 3E4QA 5TBMB 4Y5FA 2NUPC 4ETZA 1W63Q 3PBNA 4P6ZS 4DJ3A 3CUEA 1F98A 1OPXA 2W3HA 2OOLA 2G7UA 5G4ZA 4R70A 2J3WA 5HDSA 3UB7A 4HJ3A 4G3VA 3LR5A 4DJ2A 2JHEA 1OTEA 3CAXA 3EEHA 3EQUA 3PBOA 1T19A 3BWLA 4GHIA 2VX8A 3VE4A 4R3AA 5HL6A 2PD8A 2W3FA 1OTIA 3C38A 1Y28A 3OCNA 3KYZA 1YKDA 3PBQA 4BWIA 2Z6DA 4P6ZM 1NLYA 5F68A 5AVFA 3MJQA 5F69A 3A0RA 3S7QA 5IS1A 1S66L 2KLIA 3BJNA 3A0VA 4WF0A 4HOIA 3TW8A 1XFQA 4ARZA 3T4QA 4BJPA 2VZWA 3E4OA 2V9AA 3JVUA 1STZA 3C8CA 1OTAA 3B42A 2PYPA 2ZOHA 3RFBA 4KUOA 2HJ9C 2FH5A 3EOIA 3VE3A 1S1YA 4WUJA 3P7NA 2NUTC 2W3DA 3UB9A 4NKPA 2WKPA 1LSVA 3T4KA 2LB5A 3B47A 1D06A 4O8GA 4PHTA 2Y8HA 1V9YA 3CWFA 3O5YA 1XJ3A 2I9VA 5FL3A 3R4KA 3BY8A 5AVEA 2P08A 5J7EA 4XT2A 3KX0X 3F1NA 4XT2B 2P04A 4BBTA 1GSXA 2V1BA 2Y79A 4EU0A 4R38A 2PT7A 4MN6A 2W27A 2A2LA 4UQIS 1LSWA 3LICA 4Q0JA 4II7A 4G3KA 2OWHA 4PKYG 2QKPA 4CLCE 2W0NA 4EEPA 2OAQ1 1V9ZA 2JN7A 3D72A 1DP9A 4E04A 2HF6A 1VHMA 1EW0A 3OC2A 5A8BA 2LB9A 1IFQA 2PHYA 3DBAA 1X0OA 3F1OB 4Z1WA 2QHKA 1F5MA 3D3OA 2OWJA 3F1OA 3MQOA 3LFVA 3LIBA 5HZHA 1P0ZA 4WEKA 2KDKA 3FG8A 2HV1A 3OCLA 3MQ0A 1T18A 4BBUA 2XRNA 4HP9A 4GCZA 4NXFA 2K31A 2VV7A 4YNRA 4UEYA 5HPIA 2J3TD 5MC7A 5F6AA 2VGLM 5HD3A 4L9FA 2QJ7A 2PD7A 2PYRA 2W1TB 4WL9A 4GS9B 3ZQ5A 4GS9A 1NRJA 1NWZA 1ZTUA 3RTYA 2W3GA 2VV6A 3LI9A 3ULFA 3R7WA 4EERA 4GLQA 4CLCA 3CLOA 1XFNA 4OOLA 5DJTA 5AJGA 4I39A 3PBTA 4EQ1A 2W1TA 3KSFA 1JNUA 3NHQA 3EQVA 2O99A 2XA7M 2L4RA 3E4PA 4F3LB 1UWNX 2WKQA 1WA9A 3MMHA 3NOPC 1XJ6A 4HP4A 4IUKA 4YWZA 4MCWA 1H8MA 3T4OA 4FOFA 4NXEA 3S7PA 4G3WA 5DFXA 2D02A 4I5SA 3U2AA 1MZUA 1ODVA 5F5YA 5IU1A 4CLCC 3F1PA 4I3IA 1YSPA 4EXOA 4JGOA 4H6JA 3BQAA 3BW6A 2XA7S 4O0PA 1TD5A 4B93A 4HIAA 2GX5A 3OOVA 1G6OA 2K7SA 3OBFA 3CI6A 3FPWA 4QPRA 4GW9A 2DMWA 4JGRA 1S67L 3UMDA 4JGQA 5EFWA 4MDZA 5TBMA 3TJZC 4NXGA 2P7JA 3V67A 5TJJA 4EETB 3HJIA 3JVVA 2MJ6A 4EUVA 4I3AA 1OT6A 2VEAA 4CQHA 3FC7A 5CX7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QHK A;  3F1O A;  3LIB A;  1OT9 A;  2OWJ A;  1OJ5 A;  3MQO A;  2YKH A;  3LI8 A;  3UME A;  4B9O A;  2VV8 A;  5HWW A;  5HZH A;  1OTD A;  3MQQ A;  3E4Q A;  1P0Z A;  5KIZ A;  2KDK A;  2L0W A;  4WLA A;  5TBM B;  3FG8 A;  1LL8 A;  2HV1 A;  2ZOI A;  3VOL A;  5J4E A;  1LT0 A;  1DRM A;  1T18 A;  1T1A A;  3NJA A;  4BBV A;  4BBU A;  4DJ3 A;  4F3L A;  4HP9 A;  1F98 A;  5HWT A;  4GCZ A;  1TS0 A;  2OOL A;  2KX6 A;  1KOU A;  2VLG A;  2VV7 A;  3H7W B;  4HI4 A;  4NXF A;  4R70 A;  2Z6C A;  2INW A;  1TS8 A;  5G4Z A;  3VE3 A;  5F6A A;  5J3W A;  2QWS A;  3NOU C;  4R6L A;  1N9O A;  1D7E A;  5HDS A;  4HJ3 A;  4I38 A;  3UB7 A;  3UB8 A;  5HSQ A;  4WN5 A;  5HD3 A;  4LPZ A;  3PYP A;  4L9F A;  4DJ2 A;  2QJ7 A;  2H28 A;  2JHE A;  2PD7 A;  1OTE A;  3CAX A;  4LRZ E;  3EEH A;  2PYR A;  4WL9 A;  2QJ5 A;  4GS9 B;  3ZQ5 A;  1T19 A;  1VB6 A;  3BWL A;  4GHI A;  4GS9 A;  3VE4 A;  3LYX A;  4R3A A;  3K3C A;  2PD8 A;  3H82 B;  2L1M A;  1OTI A;  1UGU A;  3RH8 B;  1Y28 A;  1N9N A;  2EA9 A;  1LSX A;  3MXQ A;  1NWZ A;  3H82 A;  3RTY A;  1OJG A;  2Z6D A;  4LLO B;  5F68 A;  5AVF A;  5HDD A;  3MJQ A;  5F69 A;  5HDC A;  3A0R A;  2VV6 A;  4HJ6 A;  5IS1 A;  5HD5 A;  1S66 L;  3LI9 A;  4KQD A;  3ULF A;  4EER A;  4M4X A;  3HJK A;  2V1A A;  3A0S A;  5HWV A;  1S4S A;  4K08 A;  3CLO A;  1XFN A;  4L9G A;  5DJT A;  3SW1 A;  3A0V A;  2V0W A;  2R78 A;  4RQ9 A;  3ICY A;  4WF0 A;  4HOI A;  4I39 A;  1XFQ A;  1GSW A;  3MR0 A;  4JGP A;  5I5L A;  4EQ1 A;  3E4O A;  2V9A A;  1JNU A;  3NHQ A;  3F1P B;  3C8C A;  1UWP X;  3LIE A;  5DKK A;  3UE6 A;  1OTA A;  2ZBB A;  2B02 A;  2PYP A;  2ZOH A;  3LID A;  1T1B A;  3T50 A;  3UB6 A;  4KUO A;  4HHD A;  4HNB A;  3LIF A;  2L4R A;  3E4P A;  3PHY A;  4F3L B;  1UWN X;  2WKQ A;  1WA9 A;  3BY9 A;  3LUQ A;  4EW7 A;  5G4Y A;  3NOP C;  4HQA A;  1XJ6 A;  3IS2 A;  1S1Y A;  4WUJ A;  4HP4 A;  3P7N A;  1P97 A;  1GSV A;  4YWZ A;  4LRY C;  3IS2 B;  1XJ2 A;  3UB9 A;  4I3J A;  2WKP A;  1LSV A;  4HY8 A;  3MFX A;  2BAS A;  1D06 A;  1G28 A;  4NXE A;  2D02 A;  1TS6 A;  4I5S A;  1MZU A;  1ODV A;  1N9L A;  1V9Y A;  3CWF A;  5F5Y A;  1S1Z A;  2WKR A;  5IU1 A;  1XJ3 A;  3F1P A;  1T1C A;  2I9V A;  4I3I A;  4EXO A;  3B33 A;  4HH2 A;  1DP8 A;  1DP6 A;  2A24 A;  3BY8 A;  3H9W A;  4H6J A;  4HH3 A;  4JGO A;  3K3D A;  4PKY A;  3KX0 X;  4XT2 A;  5AVE A;  5J7E A;  2A24 B;  3G6O A;  3F1N A;  2PR6 A;  4XT2 B;  4BBT A;  3H7W A;  1GSX A;  2YKF A;  2V1B A;  4HJ4 A;  5DJU A;  3F1N B;  4R38 A;  4HIA A;  4MN6 A;  2K7S A;  2W27 A;  4L9E A;  2M1C A;  3LIA A;  2D01 A;  4GW9 A;  1LSW A;  3LIC A;  2GJ3 A;  4JGR A;  1S67 L;  3UMD A;  2CMN A;  2PR5 A;  4JGQ A;  4LRX C;  5EFW A;  4GHI B;  3C2W A;  5TBM A;  2OWH A;  4PKY G;  2QKP A;  4NXG A;  2P7J A;  1OTB A;  4NXB A;  4EES A;  2V0U A;  5DKL A;  2W0N A;  3EWK A;  3NOT C;  4EEP A;  4EET B;  3GDI A;  1F9I A;  1V9Z A;  2JN7 A;  1S4R A;  3D72 A;  1DP9 A;  3HJI A;  3OLO A;  4H6J B;  4MN5 A;  4E04 A;  2J80 A;  1EW0 A;  4KUK A;  5A8B A;  3GEC A;  4I3A A;  1BYW A;  1OT6 A;  2PHY A;  3IBR A;  2PDR A;  4EEU A;  2VEA A;  3F1O B;  1X0O A;  1XJ4 A;  3FC7 A;  1TS7 A; 
#chains in the Genus database with same CATH topology
 2QMI A;  4GDB A;  3MSH A;  1K55 A;  5BOH A;  2C5W B;  2FZ0 A;  1BUL A;  5J4E A;  5GHX A;  4NG2 A;  3FZC A;  1TS8 A;  2GZA A;  4EBL A;  3SW1 A;  1N9O A;  2ZQ8 A;  4LEN A;  4UAA A;  1M6K A;  1OME A;  1VB6 A;  3VP3 A;  3LR4 A;  5C5K A;  3C7V A;  2CC1 A;  1N9N A;  3MXQ A;  4ZBE A;  1GA9 A;  4N92 A;  3IX8 A;  4KQD A;  5LBR A;  3HJK A;  5U47 A;  2J3T C;  5HWV A;  1GHI A;  1K4E A;  2J9P A;  4RQ9 A;  5GLC A;  3MXR A;  3V3S A;  1F2K A;  1C3B A;  1WE4 A;  4JKT A;  1HD8 A;  2J8Y A;  5M19 A;  3BEC A;  3NY4 A;  3HCY A;  3IS2 A;  5IHV A;  5HAP A;  1XJ2 A;  2O9B A;  4E6X A;  3IXH A;  2VGK A;  1KVL A;  1CF0 A;  3RJU A;  4JLF A;  3ZVW A;  3EGX C;  4ARZ B;  2WKR A;  4YOF A;  5E2E A;  4Q0H A;  1T1C A;  2ZMA A;  3KSI A;  3HLF A;  4DE3 A;  2OV5 A;  1P9W A;  1YT4 A;  4Y17 A;  2GJ3 A;  3LR3 A;  2PR5 A;  5CXW A;  3EWK A;  4Y0O A;  1E25 A;  1MY8 A;  1VM1 A;  2QYB A;  3IBJ A;  3HLB A;  4B9O A;  1YLT A;  1K25 A;  3MQQ A;  1O07 A;  5KIZ A;  1ES4 A;  4BBV A;  1T1A A;  4B4X A;  2VJW A;  2VLG A;  1H8Y A;  2INW A;  4H8R A;  2XF3 A;  4LPZ A;  4NEE D;  1LLB A;  1VET A;  1PWG A;  2H0Y A;  3Q7V A;  5L09 A;  1CK3 A;  1MC0 A;  4OLD A;  2GNX A;  3VP0 A;  1SDN A;  3CPT B;  3ZG8 B;  3PBR A;  4X68 A;  4BQM A;  4OP5 A;  3WS1 A;  3BFF A;  1PWD A;  3ICY A;  1ES5 A;  3PXP A;  5HW3 A;  1K54 A;  2Y91 A;  1L0G A;  4N1H A;  3LIF A;  1CEG A;  2G2W A;  1W5D A;  1NZO A;  2Y2P A;  5EE8 A;  2JKR M;  1JTG A;  1KDS A;  2BAS A;  5K5B A;  1YAX A;  3HLG A;  3TSG A;  5KSH A;  3OPR A;  4S2L A;  1CJF A;  2B18 A;  2HPB A;  2A24 B;  2PR6 A;  4AFI A;  3H7W A;  5DJU A;  3R7W B;  1PZO A;  4MN7 A;  1W7F A;  4ZJ1 A;  3C30 A;  2ZM2 A;  3KYQ A;  3Q1F A;  5EVE A;  3KO6 A;  2V0U A;  1F9I A;  4H6J B;  4GNU A;  3MKE A;  4EEU A;  1CQA A;  4KZ3 A;  2RCX A;  4M3K A;  1OT9 A;  1Z6F A;  5CHU A;  3MFD A;  3FPV A;  3IXD A;  5FQJ A;  1XXM A;  2V8F A;  1LL9 A;  4Y5F A;  4ETZ A;  5EUA A;  1DJC A;  1FQG A;  2BLS A;  3N7W A;  1PW1 A;  4P6Z S;  1G68 A;  1I2W A;  1XP4 A;  2ZJ9 A;  2G7U A;  2WGW B;  2WKI A;  4K91 A;  3LCE A;  4OPZ A;  1NZU A;  2ZQD A;  1OTE A;  3PBO A;  4X69 A;  1T19 A;  3BWL A;  5JYO A;  3SS4 A;  4R3A A;  5HL6 A;  2EXB A;  2R9W A;  1SZV A;  3HLD A;  3AGD A;  4GOG A;  4BWI A;  2ZL1 B;  3A0R A;  5HAR A;  3S7Q A;  5DTT A;  3LY3 A;  3PAG A;  5FAP A;  5FAQ A;  5D3O A;  3TW8 A;  1XFQ A;  3M2K A;  1BLS A;  2VZW A;  3IH9 A;  4WZ5 A;  3V3R A;  3B42 A;  3G34 A;  3ZHH A;  2PYP A;  2ZOH A;  4WUJ A;  3QHY A;  4HBU A;  4NKP A;  1LSV A;  2LB5 A;  1D06 A;  3MXS A;  3CWF A;  5FL3 A;  4PM6 A;  2OLU A;  2XDM A;  3BY8 A;  3UY6 A;  3GRJ A;  2PRF A;  3IX4 A;  1ERM A;  4MN6 A;  2A2L A;  4OLG A;  4UQI S;  3LIC A;  5FQK A;  4Q0J A;  4JXS A;  1GA0 A;  2ZM0 A;  2BG1 A;  3OPP A;  2W0N A;  4DXB A;  4EEP A;  2ZQ7 A;  1V9Z A;  3DWK A;  1VHM A;  1Q2Q A;  2WGV A;  2LB9 A;  4OVD A;  3BFC A;  1E3U A;  1F5M A;  3MQO A;  4OQI A;  1Y54 A;  2KDK A;  3RXW A;  2HV1 A;  4KZ6 A;  4QY5 A;  4GCZ A;  4NXF A;  3ZG0 A;  4ZJ3 A;  4EBN A;  4UEY A;  2J3T D;  5F6A A;  2VGL M;  4GN2 A;  4LV1 A;  1JWV A;  1RGY A;  5JYP A;  2W1T B;  3QP4 A;  4QHC A;  3ZDJ A;  1NRJ A;  3HLW A;  1ZTU A;  3RTY A;  3CG5 A;  3IWI A;  2Y2H A;  2VV6 A;  3IHA A;  5L10 A;  4OOL A;  2Y2J A;  4QB8 A;  1ES2 A;  2RL3 A;  1N9B A;  1Z09 A;  2ZC3 B;  1L0F A;  3DTI A;  1FSW A;  3E2K A;  4OH0 A;  2XA7 M;  4RVA A;  1YLY A;  4ZJ2 A;  2WKQ A;  1WA9 A;  1BT5 A;  2Y2K A;  4OPQ A;  4XUZ A;  4KQQ A;  5EVI C;  3IT9 A;  3OZH A;  4KZ5 A;  4S2J A;  1SKF A;  5IU1 A;  4CLC C;  2A3U A;  4I3I A;  3KYE A;  2ZD8 A;  4LCM A;  3BW6 A;  3WS2 A;  1JWP A;  3ZVT A;  3S4X A;  4Y13 A;  2Y2L A;  4KEN B;  1K55 C;  2GX5 A;  1G6O A;  2VGJ A;  3QNB A;  4KG5 A;  1JWZ A;  2XR0 A;  4GW9 A;  1XX2 A;  4U0T A;  4JGQ A;  2HP6 A;  4MDZ A;  5TBM A;  3TJZ C;  1TEM A;  3FKV A;  5TJJ A;  4EET B;  3I7J A;  2B95 A;  3FC7 A;  3V50 A;  1XGI A;  2YKH A;  2VV8 A;  1K57 A;  5F82 A;  3LY4 A;  4WLA A;  5EVI B;  3VOL A;  5KSC A;  1LT0 A;  5KMW A;  4FUW A;  1KOU A;  3G32 A;  4GZB A;  1I5Q A;  4HBT A;  5HSQ A;  2IWC A;  4WZ5 C;  2O9A A;  5DTS A;  3UO9 A;  4D60 A;  2JE5 A;  5HDD A;  1XPB A;  4JF4 A;  5HDC A;  4HJ6 A;  1EWZ A;  1SHV A;  3BLS A;  2H10 A;  4K08 A;  1ERO A;  4OOY A;  3MZF A;  4P0M A;  3MR0 A;  4JGP A;  2W3E A;  4WMC D;  1YM1 A;  1MXO A;  4PAU A;  3LUQ A;  1BUE A;  1PI4 A;  3CUE C;  5G4Y A;  1BLH A;  3RXX A;  1KE4 A;  2HJE A;  4HY8 A;  4IHQ A;  2EWW A;  2UV0 E;  3V5M A;  3B33 A;  4HH2 A;  1L0D A;  4KQO A;  4ME4 A;  3QNC A;  4OOM A;  2W1R A;  4O01 A;  4UA7 A;  3UE0 A;  3F1N B;  5F1G A;  3C5A A;  2JKG A;  1NYY A;  4KG2 A;  3W2Z A;  5GHZ A;  3BQ8 A;  2VKS A;  1IKI A;  5AQA A;  1OTB A;  4KZA A;  4BEN A;  4EES A;  1IYO A;  3NOT C;  3G35 A;  4DMZ A;  5L8M A;  3TRC A;  4MN5 A;  3OLO A;  3GEC A;  4CLC B;  3C7U A;  3A3F A;  3GVB A;  4PPR A;  2EFU A;  3MZD A;  2ZOI A;  1DRM A;  1BZA A;  4F3L A;  4C3Q A;  5J8X A;  2OAP 1;  4U0X A;  1D7E A;  4I38 A;  4KZB A;  3PYP A;  4GD6 A;  4RX2 A;  3UNW A;  5KZH A;  1E3U D;  2L1M A;  1H8Z A;  1OJG A;  2HDR A;  3VV4 A;  5HD5 A;  3N8S A;  5E43 A;  1ZG4 A;  2XRO A;  3MBZ A;  3F1P B;  4Y7P A;  3LID A;  2ZMV A;  1FIL A;  4PM9 A;  1GHP A;  1GSV A;  1H3Q A;  2ZMF A;  2HZ5 A;  2XK1 A;  1G28 A;  1U60 A;  5A90 A;  3UN7 A;  2DCF A;  3HVF A;  3PR6 A;  5CTM A;  1ZKJ A;  4K0X A;  1DP8 A;  2A24 A;  3H9W A;  4ZRR A;  2EWV A;  4PKY A;  4IBR A;  3A3I A;  1MWU A;  5TR7 A;  5HX9 A;  3UDI A;  3PTE A;  2EX6 A;  3GQZ A;  5HL1 A;  4GHI B;  4YFM A;  4NXB A;  2J80 A;  4KUK A;  3Q7Z A;  1SCW A;  2JKT M;  5FAT A;  3HL9 A;  1OJ5 A;  3L9K A;  3BFG A;  3E4Q A;  3P09 A;  5TBM B;  1FR6 A;  1W63 Q;  4R4S A;  3HLE A;  3NUL A;  1F98 A;  2W3H A;  2OOL A;  3NI9 A;  5HDS A;  5AQ9 A;  4HJ3 A;  4G3V A;  4YIN A;  1OTI A;  5EVI A;  5GHY A;  3PBQ A;  4P6Z M;  4BD1 A;  3HRE A;  3MJQ A;  4UA9 A;  4NK3 A;  1IKG A;  4Y0T A;  4DDS A;  3NCK A;  1PFL A;  3T4Q A;  1HZO A;  1OTA A;  3RFB A;  4KUO A;  2XH9 A;  3W4O A;  2IWD A;  3QP8 A;  5EPH A;  4IVK A;  2WKP A;  3G30 A;  1VEU B;  4O8G A;  2Y8H A;  1FCO A;  2Y2O A;  3VP2 A;  4S2M A;  3R4K A;  4X6T A;  1G6A A;  3N8R A;  3KX0 X;  1FOF A;  2I72 A;  2P04 A;  4U3T A;  2WZZ A;  4EU0 A;  2PT7 A;  2W27 A;  4E3L A;  3G31 A;  2WAD A;  4P85 A;  1LSW A;  3O88 A;  1ACF A;  1LI0 A;  1QMF A;  4X1L A;  5CED A;  4G3K A;  2OWH A;  4PKY G;  2PU2 A;  1XGJ A;  2OAQ 1;  2JN7 A;  5E2F A;  1EW0 A;  3OC2 A;  5A8B A;  1IFQ A;  3IXB A;  1I2S A;  1X0O A;  4JF5 A;  2V1Z A;  5F1F A;  3L7H A;  4WEK A;  2XLN A;  3A3D A;  3FG8 A;  1DJA A;  2XRN A;  5A92 A;  4YNR A;  1YLJ A;  3WWX A;  5HPI A;  4B4Z A;  4MLL A;  3BFE A;  4L9F A;  5HAI A;  3N6I A;  2P9V B;  5CGX A;  5GLA A;  4JF6 A;  3UPN A;  4E3I A;  3S1Y A;  5FEG A;  4X1M A;  3GTC A;  5FI2 A;  2B5R A;  4EER A;  3M6B A;  4Y15 A;  4CLC A;  5DJT A;  5AJG A;  5A93 A;  5GLB A;  4QU3 A;  3KSF A;  2ZQC A;  4IVI A;  5CER A;  3EQV A;  5CEB A;  1FCM A;  4F3L B;  4IUK A;  4YWZ A;  1ALQ A;  2Y2Q A;  4MCW A;  3M2J A;  3OPL A;  3T4O A;  4NXE A;  3S7P A;  1YPR A;  4G3W A;  3ZG7 B;  1H5X A;  5F5Y A;  1LL5 A;  3F1P A;  4EXO A;  4PMA A;  3BQA A;  2XA7 S;  4XXR A;  1TD5 A;  3GSG A;  2JC7 A;  4N1X A;  4MBH A;  3PAE A;  2K7S A;  3LEQ A;  3OBF A;  1CI9 A;  3FPW A;  2DMW A;  4JGR A;  1S67 L;  3UDX A;  3UMD A;  5EV0 A;  3HUM A;  3V67 A;  1WYC A;  2VEA A;  2JKF A;  3VP4 A;  2JBF A;  3HBR A;  4OP8 A;  5HWW A;  3UDF A;  2L0W A;  4PM5 A;  2G2U A;  4HEF A;  2WKH A;  3IWQ A;  4DN0 A;  4IJG A;  3T50 A;  4HI4 A;  1MKM A;  3Q82 A;  3UB5 P;  2XEP A;  4MNR A;  4DF6 A;  3T4S A;  3CZD A;  2XSS A;  3RH8 B;  2XGN A;  4BMW A;  1LSX A;  1O7E A;  3H82 A;  3A3J A;  4WM9 A;  4L0L A;  3WS4 A;  2ZC7 A;  3T12 B;  4UA6 A;  1TDG A;  2V1A A;  4FSF A;  4GKU A;  3SS5 A;  2ZC6 B;  3KSG A;  5I5L A;  4MMN A;  3Q81 A;  4LV3 A;  3VFF A;  3MS6 A;  3FKW A;  2B02 A;  1WYB A;  3P01 A;  4HHD A;  3T1R A;  4HQA A;  2ZC4 B;  1BLC A;  1P97 A;  1TS6 A;  3GV9 A;  2X02 A;  4R23 A;  5CGS A;  2EXA A;  2ACG A;  1P9R A;  4WMC A;  1MWS A;  2J7V A;  2ZQ9 A;  2Y4A A;  4ETX A;  1AWI A;  2OLV A;  2YKF A;  4HJ4 A;  5FI6 A;  3K2N A;  2DNS A;  5M18 A;  1MBL A;  4B88 A;  1YSQ A;  1VEU A;  1Q2P A;  1NY0 A;  1ESI A;  5DF9 A;  3O3V A;  3CIT A;  3S7N A;  4S2I A;  5CHJ A;  4FD8 A;  4QWO A;  1ZG6 A;  3E98 A;  4P6B A;  4WYY A;  4ID4 A;  3LI8 A;  1LL8 A;  2BTF P;  3EEA A;  2WK0 A;  1FSY A;  5FQQ A;  3UME A;  3H7W B;  1RP5 A;  2GDN A;  4R6L A;  2V2F F;  3NDG A;  4WN5 A;  2WAF A;  4RA7 A;  1IYQ A;  1ZHH B;  3UPP A;  2HP9 A;  3UB8 A;  1FIK A;  4E3K A;  2R9X A;  3LEZ A;  1JTD A;  1LI9 A;  2Q0O A;  4UQI M;  4M4X A;  4EQI A;  2Y2N A;  3IHB A;  4L9G A;  2V0W A;  3ZYT A;  2R78 A;  4O7D A;  1GSW A;  4FH4 A;  4R1G A;  3BEB A;  1ESU A;  2ZQA A;  3AGE A;  3LIE A;  2ZBB A;  4HNB A;  4K0W A;  1XA7 A;  3DTK A;  2V20 A;  3BY9 A;  3SH8 A;  3SH9 A;  3SS3 A;  4LRY C;  5EVI D;  4I3J A;  4GDN A;  3EGD C;  3HUN A;  4UHU A;  3C4P A;  3Q7V B;  2JCH A;  2J9O A;  2Y2G A;  4HH3 A;  3FV7 A;  1NLZ A;  3LR0 A;  5G18 A;  3G6O A;  2JKT I;  4FCF A;  4RYE A;  4GJ4 A;  3SOI A;  2WGW A;  3SZT A;  4E3J A;  4L9E A;  3SH7 A;  4PM8 A;  4E3M A;  3MZE A;  1PW8 A;  3C2W A;  3T4L A;  1CEF A;  3CPT A;  4HES A;  1KGF A;  3UE3 A;  1N4O A;  1S4R A;  4X25 A;  5AQ7 A;  4JXV A;  2PDR A;  1XJ4 A;  1HVB A;  3N4I A;  4OPY A;  4OQH A;  1K0K A;  4R3B A;  3AGF A;  4KZ8 A;  2NUP C;  4S2P A;  2V8C A;  3CUE A;  5G4Z A;  2J3W A;  3QP2 A;  4FH2 A;  1KGE A;  4DJ2 A;  3EEH A;  4Q8I A;  3EQU A;  2P74 A;  1PRQ A;  2W3F A;  5HAQ A;  1Y28 A;  3OCN A;  3KYZ A;  3NDE A;  1YKD A;  2Z6D A;  5AVF A;  4CPK A;  5IS1 A;  5CTN A;  2EX2 A;  3LGO A;  5FDH A;  3BJN A;  3A0V A;  3DWZ A;  4WF0 A;  1IEM A;  4HOI A;  4BJP A;  2FFF B;  3E4O A;  2V9A A;  3WRZ A;  4P87 A;  2HDQ A;  3BFD A;  3HLC A;  3HUO A;  1W8Y A;  1VQQ A;  2XQZ A;  5GL9 A;  4LV0 A;  1S1Y A;  3P7N A;  2W3D A;  1LHY A;  3UB9 A;  5M1A A;  2ZC5 B;  5F83 A;  3O87 A;  3B3X A;  3O5Y A;  2Y55 A;  1YMS A;  3V39 A;  1PIO A;  2P08 A;  3GMW A;  4DDY A;  2PBD P;  4OKP A;  4XT2 B;  1YLZ A;  2Y79 A;  4R38 A;  2PU4 A;  2WAE A;  3DW0 A;  2QKP A;  1DY6 A;  1DP9 A;  3JYI A;  4DE1 A;  3NBL A;  1W79 A;  3DBA A;  3E2L A;  4Z1W A;  3F1O A;  3D3O A;  2OWJ A;  3VMA A;  3ITB A;  2P9V A;  3U4L P;  3ZNT A;  5FQM A;  1K6R A;  3MQ0 A;  1T18 A;  5A91 A;  4HP9 A;  1S0W A;  1XA1 A;  2K31 A;  5MC7 A;  2DRW A;  5DF8 A;  5HD3 A;  5L07 A;  2E8J A;  2PD7 A;  3QP5 A;  3ZGA B;  1K38 A;  3W8K A;  4GS9 A;  3NIA A;  2EX9 A;  5EOE A;  1ONG A;  1MWT A;  3W4Q A;  3ULF A;  3JPU A;  2WGI A;  3BLM A;  3IF6 C;  2PAV P;  3CMZ A;  4I39 A;  1Y4O A;  1JNU A;  3D9Y A;  5EM0 A;  1ZC2 A;  5I94 A;  1K56 D;  4FOF A;  5DFX A;  4I5S A;  3U2A A;  1MZU A;  3G2Y A;  1ODV A;  4DRT A;  3C4O A;  5EOO A;  2A49 A;  3IF6 A;  3IWO A;  4N9K A;  4LFU A;  1HTZ A;  4CJN A;  4O0P A;  1ONH A;  4A5R A;  3CJM A;  3OOV A;  5FQI A;  5CGW A;  3FYZ A;  3CI6 A;  4OON A;  4QPR A;  1NJ4 A;  3T1X A;  1GHM A;  4EWF A;  2P7J A;  1PNE A;  1BSG A;  3VSL A;  3DAV A;  3JVV A;  4I3A A;  4EUZ A;  1OT6 A;  4DE2 A;  5DF7 A;  1J9M A;  4CQH A;  5CX7 A;  3TE8 A;  4MEZ A;  2M7V A;  3G2Z A;  4DXC A;  5DFY A;  2O9C A;  3WS0 A;  4D2O A;  3VOY A;  3DTM A;  1NYM A;  1EI5 A;  3NJA A;  4R0Q A;  4F94 A;  5HWT A;  3UE1 A;  1SDE A;  4MBF A;  1RGZ A;  2KX6 A;  3PBS A;  1QME A;  5J3W A;  3P98 A;  2QWS A;  3NOU C;  3WS5 A;  4CLC D;  4LRZ E;  1M40 A;  2Q9M A;  1YLW A;  3LYX A;  3K3C A;  3H82 B;  2Y2I A;  1UGU A;  4BD0 A;  3T4T A;  2FFY A;  3NEC A;  3O86 A;  2OSU A;  3T1Q B;  2O0Y A;  4ESP A;  1L0E A;  4Y0U A;  1YQS A;  2M7U A;  1IOU A;  3UE6 A;  1T1B A;  3E0Y A;  2WZX A;  1W63 M;  1YLP A;  3VOZ A;  1L2S A;  1TF1 A;  1K56 A;  3IS2 B;  4WZ4 A;  4KQR A;  3MFX A;  2VGL S;  2HGV A;  5FA7 A;  1S1Z A;  2JKR I;  3N8L A;  5FEF A;  2Z2L B;  5FI7 A;  3BYD A;  3TG9 A;  5IT5 A;  5E2G A;  3S22 A;  2D01 A;  1ERQ A;  3KSH A;  4R3J A;  2CMN A;  2WUQ A;  4LRX C;  1BLP A;  2EFX A;  1H0M A;  3QP1 A;  3GDI A;  2Y59 A;  3W4P A;  4X53 A;  3MF0 A;  1BYW A;  2VK3 A;  2KOI A;  5EVL A;  4E3O A;  3T1S A;  1PWC A;  4Y3I A;  2WKE A;  1FR1 A;  1TS0 A;  2Z6C A;  4LV2 A;  3A3E A;  2H28 A;  5L2F A;  4S2N C;  2QJ5 A;  1VET B;  4ZAM A;  5FSR A;  3ZG5 A;  4BL3 A;  4NET A;  4E3N A;  2EA9 A;  3T4J A;  1L3L A;  3IQA A;  1SKO A;  4LLO B;  3GR2 A;  4GB7 A;  4IUH A;  3ZCZ A;  2IA2 A;  1XKZ A;  3A0S A;  5HPF A;  1S4S A;  1K54 C;  4Y2F A;  4BLM A;  3BRM A;  1UWP X;  5DKK A;  3UB6 A;  1MKI A;  4JBF A;  2EX8 A;  3PHY A;  4EW7 A;  1KE3 A;  2K2N A;  4KZ9 A;  4OQ0 A;  4JXG A;  4QD4 A;  5DTK A;  1G5U A;  3LO7 A;  4S2O A;  2VA0 A;  4WEL A;  5FAO A;  1N9L A;  5GLD A;  2HDU A;  2X71 A;  2X01 A;  4IED A;  4Q0I A;  1DP6 A;  3K3D A;  1K6S A;  5AQB A;  4Z9Q A;  2ZM8 A;  4ZTK A;  1NRF A;  2M1C A;  3LIA A;  4X56 A;  5DVA A;  3S7O A;  1CI8 A;  2XFS A;  5FAS A;  4WEJ A;  3NC8 A;  1ES3 A;  5DKL A;  5CRF A;  4EBP A;  4WBG A;  1MPL A;  3IF5 A;  3OPH A;  1J3W A;  3IBR A;  2QPN A;  4S2K A;  3ZFZ A;  1TS7 A;  4S2N A;  1OTD A;  3WRT A;  3IF6 B;  1KE0 A;  2XD5 A;  4PM7 A;  5TFQ A;  5HFO A;  3PBN A;  1FCN A;  4DJ3 A;  1OPX A;  4N9L A;  4XUX A;  1TDL A;  1TVF A;  4R70 A;  3UB7 A;  3LR5 A;  4OPR A;  2JHE A;  2XFT A;  3CAX A;  1IYP A;  3IX3 A;  4GHI A;  5FDS A;  2VX8 A;  4IBX A;  3VE4 A;  4JPM A;  2PD8 A;  3C38 A;  5F68 A;  1NLY A;  5F69 A;  5EEC A;  1S66 L;  4LGW A;  3G4P A;  3FWL A;  2WYX A;  2KLI A;  5TGF A;  1D1J A;  4ARZ A;  2H5S A;  3JVU A;  1STZ A;  4QJG A;  1K57 C;  3C8C A;  3D4F A;  2HDS A;  1KVM A;  5E2H A;  2HJ9 C;  2FH5 A;  3EOI A;  3VE3 A;  5CEC A;  2Q9N A;  2NUT C;  3T4K A;  4PHT A;  3B47 A;  1PYY A;  1K4F A;  1GCE A;  4LCL A;  2IWB A;  1V9Y A;  3TOI A;  3CHW P;  4QY6 A;  2HP5 A;  1XJ3 A;  2I9V A;  3VP1 A;  3BM6 A;  5AVE A;  4FTX A;  5J7E A;  4XT2 A;  3IXG A;  3F1N A;  4MBK A;  4BBT A;  1GSX A;  2V1B A;  3UPO A;  4GD8 A;  4BL2 A;  2PBY A;  4II7 A;  1YMX A;  3ZG9 B;  4CLC E;  3VSK A;  2Y2M A;  3D72 A;  4E04 A;  4C75 A;  2HF6 A;  2PHY A;  4OQG A;  3F1O B;  2QHK A;  3LIB A;  3LFV A;  5HZH A;  1P0Z A;  2AVX A;  3OCL A;  4BBU A;  4KG6 A;  3IH8 A;  2VV7 A;  1JVJ A;  3Q07 A;  4C6Y A;  3MKF A;  1MWR A;  1E4D A;  2QJ7 A;  3DTE A;  2UWX A;  3ITA A;  2PYR A;  3M6H A;  3QP6 A;  4GS9 B;  4WL9 A;  3ZQ5 A;  2QZ6 A;  1IYS A;  4R4R A;  4E6W A;  1NWZ A;  2W3G A;  4RX3 A;  3LI9 A;  3R7W A;  4GLQ A;  3CLO A;  1XFN A;  5EM1 A;  1KGG A;  4X55 A;  1RCJ A;  5FQ9 A;  3ISG A;  3PBT A;  4EQ1 A;  1IEL A;  2W1T A;  3NHQ A;  2O99 A;  2H0T A;  2L4R A;  3E4P A;  1UWN X;  1HLU P;  4KZ4 A;  3MMH A;  1SKO B;  3NOP C;  1XJ6 A;  4HP4 A;  1BTL A;  1H8M A;  2D02 A;  2ZLY A;  4EV4 A;  1W8Q A;  2Z2M B;  1YSP A;  4JGO A;  4H6J A;  4DE0 A;  1S6R A;  4B93 A;  2E8I A;  1AXB A;  4HIA A;  4DKI A;  1KDW A;  3ZNY A;  5CHM A;  4JXW A;  1PZP A;  1A0K A;  4ZDX A;  1PI5 A;  5EFW A;  4NXG A;  1NXY A;  3VFH A;  3HJI A;  2MJ6 A;  4EUV A;  2ZL1 A;  1DJB A;  2C6W B;  4KZ7 A;  2XD1 A; 
#chains in the Genus database with same CATH homology
 3TE8 A;  2M7V A;  2YKH A;  2VV8 A;  5HWW A;  5DFY A;  2O9C A;  2FZ0 A;  2L0W A;  4WLA A;  3VOL A;  5J4E A;  1LT0 A;  3NJA A;  5HWT A;  4DN0 A;  4IJG A;  2KX6 A;  1KOU A;  4HI4 A;  3T50 A;  3PBS A;  1MKM A;  1TS8 A;  2GZA A;  5J3W A;  2QWS A;  3NOU C;  3SW1 A;  1N9O A;  5HSQ A;  4CLC D;  4LRZ E;  1VB6 A;  3T4S A;  3LYX A;  3LR4 A;  2O9A A;  5C5K A;  2XSS A;  3K3C A;  3H82 B;  3RH8 B;  4BMW A;  1UGU A;  1N9N A;  1LSX A;  3MXQ A;  3T4T A;  3H82 A;  5HDD A;  5HDC A;  4L0L A;  4HJ6 A;  4KQD A;  5LBR A;  3HJK A;  2V1A A;  2J3T C;  4FSF A;  5HWV A;  4K08 A;  3KSG A;  2O0Y A;  4RQ9 A;  5I5L A;  3MR0 A;  4JGP A;  4MMN A;  2M7U A;  1IOU A;  3UE6 A;  2W3E A;  2B02 A;  1T1B A;  3P01 A;  3E0Y A;  4HHD A;  1W63 M;  4PAU A;  3LUQ A;  3HCY A;  3CUE C;  5G4Y A;  4HQA A;  3IS2 A;  1P97 A;  1TF1 A;  3IS2 B;  1XJ2 A;  2O9B A;  2HJE A;  4HY8 A;  4IHQ A;  3MFX A;  2VGL S;  1TS6 A;  2EWW A;  2HGV A;  3EGX C;  4ARZ B;  1S1Z A;  2JKR I;  2WKR A;  4YOF A;  4Q0H A;  1P9R A;  1T1C A;  3KSI A;  3B33 A;  4HH2 A;  4KQO A;  4ME4 A;  4ETX A;  4OOM A;  2W1R A;  2YKF A;  4O01 A;  4HJ4 A;  5IT5 A;  3F1N B;  3K2N A;  1P9W A;  1YSQ A;  2D01 A;  2GJ3 A;  3W2Z A;  3LR3 A;  3KSH A;  5DF9 A;  2CMN A;  2PR5 A;  2VKS A;  3BQ8 A;  4LRX C;  3CIT A;  3S7N A;  1OTB A;  4EES A;  3EWK A;  3NOT C;  3GDI A;  5L8M A;  3TRC A;  4MN5 A;  3OLO A;  4DMZ A;  3E98 A;  3GEC A;  3MF0 A;  1BYW A;  2KOI A;  4CLC B;  3IBJ A;  2QYB A;  3LI8 A;  4B9O A;  3MQQ A;  5KIZ A;  1LL8 A;  2ZOI A;  1DRM A;  4BBV A;  1T1A A;  3EEA A;  4Y3I A;  4F3L A;  2VJW A;  2OAP 1;  1TS0 A;  2VLG A;  3UME A;  3H7W B;  2Z6C A;  2INW A;  4R6L A;  1D7E A;  4I38 A;  4WN5 A;  4LPZ A;  3PYP A;  4NEE D;  2H28 A;  2QJ5 A;  1ZHH B;  1MC0 A;  3UB8 A;  2GNX A;  2L1M A;  2EA9 A;  3T4J A;  1OJG A;  4LLO B;  3VV4 A;  3PBR A;  4IUH A;  2IA2 A;  5HD5 A;  4UQI M;  4M4X A;  3A0S A;  5HPF A;  1S4S A;  4L9G A;  2V0W A;  3ZYT A;  2R78 A;  3ICY A;  4Y2F A;  2XRO A;  1GSW A;  3F1P B;  3PXP A;  1UWP X;  3LIE A;  5DKK A;  2ZBB A;  3LID A;  3UB6 A;  4HNB A;  2ZMV A;  3LIF A;  3PHY A;  3BY9 A;  4EW7 A;  2K2N A;  1GSV A;  1H3Q A;  2ZMF A;  4LRY C;  2JKR M;  4I3J A;  3EGD C;  4WEL A;  2VA0 A;  2BAS A;  1G28 A;  5K5B A;  1YAX A;  3PR6 A;  1N9L A;  5KSH A;  1DP8 A;  1DP6 A;  2A24 A;  4Q0I A;  3H9W A;  2B18 A;  2EWV A;  4HH3 A;  3K3D A;  4PKY A;  4ZRR A;  1NLZ A;  3LR0 A;  2A24 B;  3G6O A;  2PR6 A;  4AFI A;  2JKT I;  3H7W A;  5DJU A;  4GJ4 A;  3R7W B;  4MN7 A;  4L9E A;  2M1C A;  3LIA A;  3C30 A;  3KYQ A;  3S7O A;  4GHI B;  3C2W A;  3T4L A;  3KO6 A;  4WEJ A;  4NXB A;  2V0U A;  5DKL A;  1F9I A;  4H6J B;  3UE3 A;  1S4R A;  2J80 A;  4KUK A;  4EEU A;  3IBR A;  2PDR A;  1XJ4 A;  2JKT M;  1TS7 A;  1OT9 A;  1OJ5 A;  1OTD A;  3FPV A;  3E4Q A;  5TBM B;  4Y5F A;  2NUP C;  4ETZ A;  1W63 Q;  3PBN A;  4P6Z S;  4DJ3 A;  3CUE A;  1F98 A;  1OPX A;  2W3H A;  2OOL A;  2G7U A;  5G4Z A;  4R70 A;  2J3W A;  5HDS A;  3UB7 A;  4HJ3 A;  4G3V A;  3LR5 A;  4DJ2 A;  2JHE A;  1OTE A;  3CAX A;  3EEH A;  3EQU A;  3PBO A;  1T19 A;  3BWL A;  4GHI A;  2VX8 A;  3VE4 A;  4R3A A;  5HL6 A;  2PD8 A;  2W3F A;  1OTI A;  3C38 A;  1Y28 A;  3OCN A;  3KYZ A;  1YKD A;  3PBQ A;  4BWI A;  2Z6D A;  4P6Z M;  1NLY A;  5F68 A;  5AVF A;  3MJQ A;  5F69 A;  3A0R A;  3S7Q A;  5IS1 A;  1S66 L;  2KLI A;  3BJN A;  3A0V A;  4WF0 A;  4HOI A;  3TW8 A;  1XFQ A;  4ARZ A;  3T4Q A;  4BJP A;  2VZW A;  3E4O A;  2V9A A;  3JVU A;  1STZ A;  3C8C A;  1OTA A;  3B42 A;  2PYP A;  2ZOH A;  3RFB A;  4KUO A;  2HJ9 C;  2FH5 A;  3EOI A;  3VE3 A;  1S1Y A;  4WUJ A;  3P7N A;  2NUT C;  2W3D A;  3UB9 A;  4NKP A;  2WKP A;  1LSV A;  3T4K A;  2LB5 A;  3B47 A;  1D06 A;  4O8G A;  4PHT A;  2Y8H A;  1V9Y A;  3CWF A;  3O5Y A;  1XJ3 A;  2I9V A;  5FL3 A;  3R4K A;  3BY8 A;  5AVE A;  2P08 A;  5J7E A;  4XT2 A;  3KX0 X;  3F1N A;  4XT2 B;  2P04 A;  4BBT A;  1GSX A;  2V1B A;  2Y79 A;  4EU0 A;  4R38 A;  2PT7 A;  4MN6 A;  2W27 A;  2A2L A;  4UQI S;  1LSW A;  3LIC A;  4Q0J A;  4II7 A;  4G3K A;  2OWH A;  4PKY G;  2QKP A;  4CLC E;  2W0N A;  4EEP A;  2OAQ 1;  1V9Z A;  2JN7 A;  3D72 A;  1DP9 A;  4E04 A;  2HF6 A;  1VHM A;  1EW0 A;  3OC2 A;  5A8B A;  2LB9 A;  1IFQ A;  2PHY A;  3DBA A;  1X0O A;  3F1O B;  4Z1W A;  2QHK A;  1F5M A;  3D3O A;  2OWJ A;  3F1O A;  3MQO A;  3LFV A;  3LIB A;  5HZH A;  1P0Z A;  4WEK A;  2KDK A;  3FG8 A;  2HV1 A;  3OCL A;  3MQ0 A;  1T18 A;  4BBU A;  2XRN A;  4HP9 A;  4GCZ A;  4NXF A;  2K31 A;  2VV7 A;  4YNR A;  4UEY A;  5HPI A;  2J3T D;  5MC7 A;  5F6A A;  2VGL M;  5HD3 A;  4L9F A;  2QJ7 A;  2PD7 A;  2PYR A;  2W1T B;  4WL9 A;  4GS9 B;  3ZQ5 A;  4GS9 A;  1NRJ A;  1NWZ A;  1ZTU A;  3RTY A;  2W3G A;  2VV6 A;  3LI9 A;  3ULF A;  3R7W A;  4EER A;  4GLQ A;  4CLC A;  3CLO A;  1XFN A;  4OOL A;  5DJT A;  5AJG A;  4I39 A;  3PBT A;  4EQ1 A;  2W1T A;  3KSF A;  1JNU A;  3NHQ A;  3EQV A;  2O99 A;  2XA7 M;  2L4R A;  3E4P A;  4F3L B;  1UWN X;  2WKQ A;  1WA9 A;  3MMH A;  3NOP C;  1XJ6 A;  4HP4 A;  4IUK A;  4YWZ A;  4MCW A;  1H8M A;  3T4O A;  4FOF A;  4NXE A;  3S7P A;  4G3W A;  5DFX A;  2D02 A;  4I5S A;  3U2A A;  1MZU A;  1ODV A;  5F5Y A;  5IU1 A;  4CLC C;  3F1P A;  4I3I A;  1YSP A;  4EXO A;  4JGO A;  4H6J A;  3BQA A;  3BW6 A;  2XA7 S;  4O0P A;  1TD5 A;  4B93 A;  4HIA A;  2GX5 A;  3OOV A;  1G6O A;  2K7S A;  3OBF A;  3CI6 A;  3FPW A;  4QPR A;  4GW9 A;  2DMW A;  4JGR A;  1S67 L;  3UMD A;  4JGQ A;  5EFW A;  4MDZ A;  5TBM A;  3TJZ C;  4NXG A;  2P7J A;  3V67 A;  5TJJ A;  4EET B;  3HJI A;  3JVV A;  2MJ6 A;  4EUV A;  4I3A A;  1OT6 A;  2VEA A;  4CQH A;  3FC7 A;  5CX7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...