4I3AA

Structures of pr1 and pr2 intermediates from time-resolved laue crystallography collected at 14id-b, aps
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
125
structure length
125
Chain Sequence
b'MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photoactive yellow protein
publication title Volume-conserving trans-cis isomerization pathways in photoactive yellow protein visualized by picosecond X-ray crystallography
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Luminescent protein
total genus 41
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2012-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4i3aA00
4R6LA 2VV6A 4MN5A 1XFNA 1DP8A 2L0WA 1XFQA 4EETB 5HZHA 3IS2A 3F1OB 1ODVA 4H6JB 2PR5A 3LIEA 4HHDA 3CWFA 1OTEA 1XJ2A 2D02A 3LI8A 2H28A 2V1AA 3T50A 3VE4A 2KX6A 2VLGA 4BBVA 2ZOHA 3HJIA 4KUOA 3A0VA 2OWHA 5IU1A 1V9YA 1XJ3A 3H9WA 3E4QA 3FC7A 4RQ9A 5F6AA 3H82A 1OTIA 1UWPX 5HWTA 4BBUA 4PKYG 1LSXA 3NOPC 2PYPA 1D06A 4JGQA 5G4YA 5J3WA 3UB9A 4F3LA 4B9OA 2PD7A 4GS9A 2Z6DA 4WL9A 1LSVA 5DJUA 3IBRA 5HD5A 2D01A 4HNBA 3UE6A 3MXQA 2OOLA 4R70A 2BASA 1OJGA 3RH8B 3UMEA 2W27A 4YWZA 5AVFA 4R38A 5KIZA 3UB7A 4NXFA 2I9VA 3F1NA 4WF0A 4LRZE 5AVEA 2ZBBA 2YKHA 5I5LA 2VV8A 1JNUA 3A0RA 1BYWA 3VOLA 4R3AA 4EXOA 3LIBA 1OTDA 2QKPA 2A24B 1XJ4A 4BBTA 1S4SA 1VB6A 1OTAA 5J4EA 3ICYA 4I3AA 2V1BA 1S1ZA 1TS0A 3P7NA 2HV1A 3GDIA 1TS7A 5HSQA 3LUQA 3LIDA 2GJ3A 4HIAA 5F5YA 2QJ5A 4WLAA 2CMNA 2J80A 2WKPA 3PHYA 2JN7A 1T1CA 3RTYA 3A0SA 4GW9A 3BY9A 3KX0X 4WN5A 1OT6A 4HQAA 5TBMB 3UB6A 4HJ4A 1F9IA 1N9LA 2K7SA 1F98A 5F69A 3BY8A 4GHIA 3C2WA 1LL8A 1OT9A 3IS2B 4L9GA 4EEUA 2PD8A 1X0OA 2PDRA 4EQ1A 3D72A 1XJ6A 4HH3A 1T1BA 1NWZA 3LYXA 4L9EA 3C8CA 1P97A 3E4OA 1OJ5A 2B02A 2PYRA 3GECA 3NHQA 1Y28A 4HI4A 1UWNX 3HJKA 1P0ZA 3NOUC 2PHYA 3H82B 3ZQ5A 4LLOB 4I38A 2L1MA 2QHKA 2VV7A 1S67L 5HWWA 3G6OA 1T19A 3NJAA 3F1OA 4F3LB 3MR0A 2V0WA 4GS9B 4EW7A 4HH2A 2WKQA 3NOTC 2VEAA 2PR6A 4HP9A 1GSXA 5F68A 4XT2A 5A8BA 4HY8A 3CLOA 3UMDA 1LSWA 1S1YA 4HOIA 3LIAA 3VE3A 1N9OA 2QWSA 1N9NA 1DP9A 4WUJA 3F1PA 1EW0A 4LPZA 1DP6A 2L4RA 3MFXA 4MN6A 4EERA 3F1NB 1V9ZA 1KOUA 4HP4A 3BWLA 1S66L 2V0UA 4GCZA 3K3CA 4DJ3A 2R78A 2INWA 1DRMA 3UB8A 4I39A 4PKYA 5HDSA 2W0NA 5DKKA 1MZUA 3SW1A 3H7WA 5EFWA 1T18A 3B33A 4NXEA 4XT2B 4LRXC 3OLOA 4JGPA 4JGOA 5HD3A 4EEPA 2ZOIA 4KQDA 5HDDA 2QJ7A 1UGUA 4M4XA 3F1PB 1TS6A 1S4RA 2V9AA 4KUKA 4K08A 1OTBA 3FG8A 4L9FA 4NXGA 4E04A 1WA9A 1LT0A 5IS1A 1GSWA 2A24A 5DJTA 5HWVA 2WKRA 2KDKA 3H7WB 3CAXA 3EWKA 4H6JA 4EESA 4GHIB 2M1CA 5G4ZA 4I3JA 4HJ3A 3LICA 4NXBA 5DKLA 4I5SA 3LI9A 2OWJA 2EA9A 1D7EA 2YKFA 5HDCA 4I3IA 4HJ6A 3K3DA 1G28A 1TS8A 4LRYC 4DJ2A 2P7JA 1GSVA 3MQQA 3ULFA 2JHEA 3E4PA 3MQOA 5TBMA 2Z6CA 1T1AA 3PYPA 3EEHA 3LIFA 3MJQA 5J7EA 4JGRA
chains in the Genus database with same CATH superfamily
2VV6A 4Y2FA 1CEFA 4N1HA 2KLIA 4X69A 4X6TA 3IHAA 3IS2A 1M6KA 2Y2OA 4KQQA 2WKHA 5FA7A 4KZ3A 2XQZA 3CITA 3T1RA 1OTEA 1ZG6A 3BQ8A 3HUNA 1KVLA 4RYEA 3EOIA 4CLCA 3IBJA 4BL3A 1GHIA 3T50A 2W3GA 3IH9A 3S7OA 4O01A 2VLGA 3UDFA 4P6ZS 1NRFA 4QY6A 1MY8A 1Z6FA 3DWZA 3GMWA 4Y7PA 1XJ3A 3E4QA 3DAVA 3BFCA 3FC7A 5BOHA 4IEDA 3IH8A 3S7NA 2JKTM 5KMWA 3HLGA 1K54A 1SHVA 2UV0E 4E6XA 4EBPA 5L2FA 3MMHA 3UB9A 4LENA 3LGOA 4Y15A 2PRFA 3D9YA 2Z6DA 2X01A 4WL9A 1W63Q 5EV0A 1I5QA 3K2NA 2UWXA 3CPTA 5E43A 3CUEC 2EFUA 3UE6A 1SZVA 4YNRA 1EWZA 2PBDP 4R1GA 1BZAA 1JTGA 2JKTI 2W27A 4YWZA 3TRCA 3UNWA 1K55C 1FCNA 2WKIA 3QP1A 3UB7A 4NXFA 5EVIA 2V20A 3F1NA 4JKTA 1PI5A 2G7UA 1L0FA 3TOIA 5AQBA 3OCLA 5AVEA 1K57C 4P87A 3D4FA 3G2YA 1BLCA 1JNUA 1ALQA 1QMFA 3A0RA 3VP2A 4R3BA 2J9OA 4EXOA 1XP4A 1CJFA 1YKDA 4PM8A 3NY4A 1XJ4A 4BBTA 2FZ0A 1BSGA 4GOGA 2WZZA 3V3SA 2HP9A 4H8RA 3T12B 1K38A 3BYDA 2HV1A 4ZJ3A 3GDIA 1TS7A 4ZDXA 3LUQA 5EVIB 1VQQA 5CERA 2QJ5A 3Q7VA 2VGJA 2OAP1 4DDYA 1TDGA 3GRJA 3DW0A 4Y5FA 3KSFA 4NEED 4BLMA 3A0SA 2ZMAA 1GHMA 4GW9A 5GLCA 2AVXA 5AQ9A 1KDWA 2Y2KA 2Y79A 3RFBA 3KSIA 4DDSA 1F9IA 5JYOA 4K0XA 2OSUA 4PM9A 3AGEA 5F69A 1SCWA 4GDNA 1ZHHB 2V1ZA 3I7JA 3AGDA 1PZOA 4CPKA 1X0OA 2PDRA 4U0TA 4DN0A 4EQ1A 3D72A 1IOUA 3CHWP 3O3VA 4P6BA 3W4QA 3JVVA 3Q7VB 1RGZA 4B93A 1NWZA 3T4KA 1KE4A 1NZOA 2ZM2A 4L9EA 3ZNYA 2EX6A 2C5WB 5KSCA 3GQZA 3G4PA 4FD8A 4CLCC 3GECA 1KE0A 4OQHA 1Y28A 1WYCA 2QMIA 3HJKA 4IUHA 5E2FA 3ITAA 4BD1A 3H82B 1SKFA 4E3NA 4QWOA 2BTFP 1LL9A 3ZG8B 4EUZA 2P9VB 1T19A 3NJAA 1A0KA 4F3LB 2Y4AA 3MR0A 4WBGA 2WGIA 2HGVA 2P08A 3IX3A 4EW7A 2ZMFA 4BL2A 3QNCA 1BT5A 4EU0A 3C38A 3TE8A 3BRMA 4JPMA 1K56D 4HOIA 5CXWA 1LL5A 1ZG4A 4N9LA 4BD0A 4UEYA 4R4RA 4FCFA 1NYYA 3F1PA 1EW0A 2CC1A 4LPZA 3MFXA 4UAAA 3A3FA 2LB9A 5CEDA 3VP3A 5EVID 2J7VA 1YSPA 1LLBA 3PTEA 2XDMA 3DTIA 1W8QA 4PKYA 5FQMA 1YAXA 2WAFA 1LI9A 2R9XA 2W0NA 3LEQA 3C4OA 4GD8A 4D2OA 3E2LA 2EX2A 2H0TA 4E3LA 3S4XA 2JKGA 3VV4A 3OLOA 3IHBA 3VP4A 3T1QB 5FAQA 3CMZA 5HDDA 4ARZA 4OQGA 3MXSA 2QJ7A 3LY4A 3F1PB 1JTDA 4P6ZM 3G30A 2V9AA 1EROA 3BLMA 5F1FA 1OTBA 3ZG7B 3DBAA 5L10A 5IT5A 5HX9A 1IKIA 1GSWA 2ZC7A 1ZKJA 2JCHA 4JBFA 5HWVA 1Y54A 3V67A 1TF1A 4LCMA 3CAXA 4S2PA 2Z2MB 4XUXA 3N6IA 4K0WA 1FIKA 5GLDA 3U4LP 3ITBA 1KGEA 2Y55A 3Q7ZA 1SKOA 4H6JA 4EESA 5EVEA 3IXHA 4ARZB 4HJ3A 3T4QA 1ONGA 2ZC5B 2EX8A 3WRZA 2QZ6A 4S2JA 3UN7A 5CGXA 2IWCA 3QP6A 4IBXA 1GA0A 1TS8A 3LR0A 4LRYC 4OVDA 2P7JA 3NI9A 3OPPA 5CGSA 4YOFA 3GR2A 2ZM0A 3E4PA 3IX8A 3GSGA 2V8CA 3PYPA 3MJQA 4JGRA 3QNBA 1W8YA 2W3FA 4U0XA 4S2LA 4PMAA 1BULA 3M6BA 3Q07A 1CI9A 3FPVA 4NG2A 3SS4A 2QPNA 4H6JB 2VGLS 4RA7A 4HHDA 4IUKA 3ZFZA 5TGFA 1XJ2A 2D02A 4G3KA 3SH9A 2W3DA 2DCFA 1NZUA 3LI8A 2H28A 5CGWA 1PWCA 1VEUA 2KX6A 1IKGA 4BBVA 3A0VA 1HVBA 3IWIA 2XK1A 2XD1A 3BLSA 4OPZA 4OLGA 5A92A 2H5SA 1LSXA 5LBRA 1SDEA 1D06A 3O88A 4KENB 4MEZA 5A91A 3IF6A 4KZ9A 3NCKA 1LSVA 5DJUA 3U2AA 4BWIA 1FOFA 1Q2QA 2Y2JA 3IBRA 3ISGA 2XF3A 3CZDA 2D01A 1G5UA 3MXQA 1XA1A 2WK0A 5EM1A 4DRTA 3HUOA 2J8YA 3OZHA 4DXCA 3NDGA 2VJWA 2ZQAA 3HCYA 3RH8B 2VGKA 4OOLA 3ZCZA 4ZTKA 1VEUB 4R38A 4WMCA 3LR3A 4N92A 5CEBA 1PWDA 2W1RA 1ERMA 1WYBA 2ZBBA 5I5LA 1AWIA 2VV8A 3JYIA 5HAIA 5AQAA 2O99A 2Q9MA 3HL9A 4R3AA 1PI4A 3SOIA 1FR6A 4G3WA 1MKIA 3QP2A 2PAVP 2A24B 2W3EA 1S4SA 1PW1A 1NY0A 2DMWA 3QHYA 3TJZC 1S1ZA 1TS0A 2WYXA 3P7NA 2FFFB 2M7VA 4S2IA 5F82A 3IT9A 3B3XA 5L09A 2Y2NA 3L7HA 4HIAA 4WLAA 4B4ZA 2EXAA 3SZTA 4Z9QA 5EOOA 3OBFA 2J80A 3OPLA 1H8ZA 2WKPA 1MWTA 1XX2A 4E3KA 2ZC6B 1PNEA 3P01A 1YLWA 3RTYA 4WZ5C 2W1TB 2B18A 3RXWA 1XGIA 3UB6A 4HJ4A 5HFOA 1G6OA 3VOYA 3NBLA 3TSGA 2VZWA 2K7SA 2ZQ9A 4GHIA 4X25A 3WWXA 2NUPC 1LL8A 4FUWA 5M18A 3IS2B 4KG5A 3MFDA 2OLVA 4DE2A 4PM7A 3BEBA 1XJ6A 4HH3A 5G18A 2P74A 3G35A 4CLCB 1T1BA 5CRFA 3LYXA 4OQIA 1P97A 3E4OA 4LV0A 2PYRA 4O0PA 2BG1A 3NHQA 4OOMA 3LO7A 2XA7M 1K25A 5FI6A 3JVUA 1P0ZA 4JXWA 3NOUC 2PHYA 3QP8A 1CI8A 2QYBA 4LLOB 4G3VA 2QHKA 5HWWA 1W63M 2HPBA 1F5MA 2JC7A 2ZL1A 1LHYA 3FPWA 2GNXA 4UQIS 1H8MA 3F1OA 2V0WA 3W8KA 3G31A 2G2WA 1GA9A 2WKQA 3NOTC 3MZEA 3CPTB 1SDNA 4EV4A 3IF6C 4WZ4A 2XROA 3GTCA 2VA0A 3UMDA 5DFYA 1BTLA 1KGFA 1S1YA 1TEMA 3LIAA 4AFIA 5HPIA 3BFEA 4ZBEA 3UPNA 3VE3A 1L3LA 2QWSA 2J3WA 5AJGA 4GNUA 3FWLA 1YMSA 4K91A 4WMCD 2HDUA 2VX8A 3RJUA 3IWOA 3F1NB 2XLNA 3OOVA 1V9ZA 4BMWA 3IXBA 1NYMA 5FQIA 3ZG9B 1BLHA 1S66L 1H5XA 5FAPA 2V0UA 4JXVA 3W2ZA 2R78A 4ZJ1A 4DJ3A 3MZDA 1XPBA 3UB8A 1MWSA 2HDRA 4WYYA 2ZQDA 4ME4A 3T4SA 5DKKA 1MZUA 3IX4A 1STZA 2GDNA 3UDIA 3MZFA 1T18A 1KDSA 5EPHA 4CJNA 4NXEA 4LRXC 1ACFA 4JGPA 2Q0OA 4Q0JA 1S0WA 5HD3A 3C7VA 3DTKA 4FH2A 4QD4A 4OP5A 1PWGA 1TS6A 3MKEA 3FZCA 5CECA 1S4RA 3Q82A 1HZOA 4KUKA 1E3UA 4GDBA 5FQJA 3UDXA 3OPRA 2RCXA 3ZGAB 4CLCD 5L8MA 1FCOA 4NXGA 1YMXA 1YLTA 5F1GA 4LGWA 2JBFA 3MSHA 2WUQA 1NLYA 1AXBA 5U47A 5IHVA 2WKRA 1IEMA 2Y2GA 2M7UA 5EE8A 1ES5A 4OKPA 5FI7A 2Q9NA 1M40A 4N9KA 3N7WA 1FILA 3NIAA 4LV3A 1J3WA 3T1SA 2Z2LB 3E2KA 3OC2A 1ERQA 2XEPA 4RX3A 3VFHA 3BFDA 3LICA 4QB8A 5DKLA 5DF7A 1IFQA 3UE3A 1O07A 1VETA 4I3IA 4HJ6A 4A5RA 1NRJA 3A3EA 4ZJ2A 5GHXA 4DJ2A 4X55A 1GSVA 3BJNA 3EQVA 4ZRRA 3ULFA 2JHEA 1G68A 5TBMA 1T1AA 5F83A 4L0LA 3EEHA 3LIFA 2WGVA 2E8JA 2JE5A 4M3KA 4R6LA 3KYZA 4D60A 1DP8A 1XFQA 4EETB 4WEJA 4X1MA 3OCNA 4XUZA 1ODVA 5FSRA 2PR5A 2J3TC 3CWFA 1VM1A 4EBLA 2Y59A 1MXOA 5FDHA 2XR0A 3BFFA 3IQAA 4GB7A 2B95A 1O7EA 3HJIA 4UA9A 4DE3A 1QMEA 5GHZA 5AQ7A 1VETB 2OWHA 4F94A 1K0KA 5IU1A 1K6SA 4OLDA 3PBTA 4RQ9A 4KG6A 4O8GA 1UWPX 2XH9A 3BW6A 4BBUA 4PKYG 4JGQA 5J3WA 4LV2A 1XGJA 1G6AA 2ACGA 2Y2HA 2PD7A 4GS9A 2J9PA 3Q1FA 1H0MA 5HD5A 2HP5A 2EX9A 4O7DA 4RVAA 3G32A 5CHMA 1CF0A 4B88A 2BASA 1OJGA 3DTEA 5HW3A 3UMEA 5FQQA 3C5AA 5AVFA 5FATA 3M2JA 2I9VA 4WF0A 4LRZE 4LFUA 4WZ5A 5C5KA 3N8LA 5FDSA 3O5YA 2YKHA 3T4OA 1KVMA 3CJMA 3A3DA 4EWFA 3N8RA 1BYWA 1IYOA 4E6WA 3VOLA 2GZAA 3M2KA 5FQKA 3SS5A 1E3UD 2WADA 2K31A 1OTDA 2MJ6A 2PU2A 3TW8A 4QPRA 3HLBA 4UQIM 3O87A 5GLBA 4BENA 1OTAA 5J4EA 2G2UA 4I3AA 3UY6A 3ZHHA 2V1BA 1L0DA 4HESA 3EEAA 4JF4A 4S2MA 5J8XA 2ZJ9A 2O9AA 1SKOB 5HSQA 3PAGA 3C30A 3ZVTA 1HLUP 1E25A 2XD5A 1L0GA 3LFVA 3B42A 5CHJA 4JF6A 1T1CA 1MKMA 4KZ4A 2WZXA 5JYPA 4ID4A 1PW8A 1U60A 3BY9A 4PM5A 3KX0X 4WN5A 3GV9A 1OT6A 2O9CA 4HQAA 1PIOA 2DNSA 3V39A 2PT7A 5FI2A 2B5RA 4Y0OA 5DVAA 3DTMA 1F98A 3V5MA 5CTMA 2XRNA 2XGNA 2X71A 4EEUA 2PD8A 5FASA 3L9KA 2WGWA 4II7A 3HREA 3WS4A 1N4OA 1W7FA 3C8CA 5TFQA 1OJ5A 3S7PA 2I72A 4KZ8A 3UO9A 3W4OA 3S1YA 2Y2LA 4DMZA 1I2WA 4NK3A 3NC8A 1FR1A 2L1MA 2VV7A 2IA2A 3G6OA 4RX2A 1DJBA 3T4JA 2Y2MA 5E2HA 3IF6B 4FTXA 2VK3A 4E3MA 4HH2A 5EM0A 2VEAA 1DJCA 4MN7A 3ZYTA 3KSHA 4X1LA 5F68A 5A8BA 3VP1A 2P04A 3E98A 4QJGA 4UA7A 3ZG0A 2WKEA 1ONHA 4BJPA 1N9NA 1HD8A 1IYPA 1DP9A 4WUJA 5HARA 2OLUA 3S7QA 1MC0A 2L4RA 4C3QA 3AGFA 5EECA 3HVFA 1KOUA 1MPLA 3BWLA 3O86A 3LCEA 2K2NA 4GCZA 3K3CA 2Y2IA 3VOZA 4OQ0A 3A3IA 4Y0TA 3KSGA 4I39A 2H10A 1BUEA 5HDSA 4MDZA 4ESPA 4Y3IA 1Y4OA 5TR7A 5E2GA 4DE1A 3ZNTA 4Y13A 3H7WA 3UE0A 5EFWA 3T1XA 1YM1A 4P0MA 1XA7A 1KE3A 5DF9A 2VKSA 5HL1A 1RGYA 4EEPA 2ZOIA 3ZG5A 4R3JA 1K4FA 3G2ZA 5KZHA 1DJAA 5EOEA 1ES3A 4K08A 3PR6A 1P9RA 4L9FA 1NLZA 3QP4A 4E04A 5IS1A 1JVJA 3HLEA 1MWUA 3BECA 3RXXA 1K56A 2KDKA 3FKWA 1JWZA 2OAQ1 3BM6A 3H7WB 1ES2A 1FSYA 4KZ6A 1OMEA 3PBSA 1IELA 4NETA 4Q8IA 3VP0A 3EQUA 3KO6A 1W79A 3IWQA 2JKFA 5GL9A 4DF6A 1PYYA 1VHMA 2ZC3B 4GHIB 1BLPA 2XFTA 4N1XA 5HAPA 1NXYA 5TJJA 3EGXC 4I5SA 2O9BA 4EUVA 4MLLA 1DY6A 2EA9A 1YSQA 2YKFA 1OPXA 2HDSA 1JWVA 5HDCA 5CTNA 3GVBA 3VSKA 4GZBA 3K3DA 2H0YA 4MCWA 2V2FF 3SS3A 3MQQA 2KOIA 1TDLA 4WM9A 2Z6CA 4MBKA 4PAUA 3A3JA 4UA6A 2ZLYA 5J7EA 1XKZA 4MN5A 3PBQA 3TG9A 1XFNA 4EQIA 2L0WA 3V3RA 1NJ4A 2ZL1B 5HZHA 2ZQCA 1FCMA 3HLWA 3G34A 4GKUA 3F1OB 3PBNA 3NDEA 3PXPA 2RL3A 2V8FA 2DRWA 2IWBA 1IYQA 3LIEA 4YFMA 3WS5A 3MS6A 3FKVA 1ZC2A 5M19A 5DFXA 1FSWA 5EUAA 2V1AA 1CQAA 1PRQA 3B47A 3DWKA 4OPQA 3VE4A 1H3QA 2Y8HA 2ZMVA 2VGLM 2ZOHA 3HUMA 4EBNA 4KUOA 1ESIA 1YLJA 3HLFA 4S2OA 4R23A 1EI5A 1V9YA 5KSHA 3H9WA 4LV1A 2LB5A 4GLQA 5F6AA 3H82A 1OTIA 1W5DA 2HZ5A 5HWTA 3NOPC 3EGDC 2PYPA 2EWVA 4YINA 4R4SA 5HAQA 2HJ9C 4OONA 2P9VA 5G4YA 2ZM8A 4F3LA 5K5BA 4B9OA 1HTZA 1YPRA 1K6RA 3UB5P 4HNBA 3HLCA 5D3OA 4DE0A 2OOLA 2HJEA 4X53A 3OPHA 3IXDA 5DTKA 4R70A 3WS1A 3UPPA 1TD5A 3C4PA 1MWRA 2EXBA 5KIZA 4Y17A 3UE1A 5L07A 4PPRA 4OPYA 5MC7A 4QU3A 4WEKA 2R9WA 2Y91A 4ETXA 5EVLA 4MBFA 2A2LA 2Y2QA 1Q2PA 1S6RA 1GHPA 3SH7A 5GHYA 2C6WB 1K54C 1RP5A 4IHQA 1I2SA 3LIBA 2A3UA 3MBZA 2QKPA 4R0QA 3T4LA 1VB6A 5CX7A 3ICYA 4P85A 4X56A 1Z09A 3QP5A 2HF6A 3VFFA 2ZC4B 3PBRA 1P9WA 3LY3A 1YLZA 2J3TD 4S2NA 5DTTA 1CEGA 2XSSA 2GX5A 4QHCA 3LIDA 2GJ3A 4JXSA 5F5YA 3VSLA 4GJ4A 1WE4A 4KZ7A 3IXGA 2CMNA 1ES4A 3MF0A 4CLCE 4Q0IA 3NECA 5EVIC 3PHYA 2JN7A 2EFXA 3CG5A 3S22A 4IBRA 3Q81A 4GD6A 1BLSA 4DXBA 5DTSA 4Q0HA 1YLYA 2FFYA 3BQAA 4B4XA 4X68A 2Y2PA 4GN2A 3KYQA 3W4PA 2O0YA 2ZQ7A 5TBMB 4DKIA 4PM6A 4KZ5A 5I94A 1N9LA 3M6HA 3BY8A 5FEGA 3C2WA 1OT9A 3V50A 4L9GA 1N9BA 4KQOA 4MNRA 2PU4A 5A93A 4PHTA 1RCJA 3E0YA 3JPUA 3WRTA 4KQRA 2X02A 2EWWA 2XA7S 2XFSA 2FH5A 3NULA 4MMNA 2PBYA 3WS0A 1YT4A 4IJGA 3D3OA 3LEZA 2B02A 4JLFA 5HL6A 5E2EA 4ZAMA 4U3TA 3KYEA 1K4EA 3FV7A 3PAEA 4HI4A 1UWNX 2A49A 3ZQ5A 1ESUA 4I38A 3CI6A 1S67L 4IVIA 2E8IA 3N8SA 2W3HA 2JKRM 5FEFA 3MKFA 1KGGA 4IVKA 3IF5A 4GS9B 1YQSA 1CK3A 5DF8A 2PR6A 4HP9A 1GSXA 4WELA 4XT2A 4C6YA 4HY8A 3CLOA 1LSWA 2HDQA 4ETZA 1ZTUA 4KG2A 1D1JA 3UPOA 1N9OA 3VMAA 2JKRI 3R4KA 1DP6A 4MN6A 4S2KA 4EERA 1JWPA 4HP4A 3CUEA 4KZBA 2INWA 4OH0A 1DRMA 1E4DA 2IWDA 3R7WA 4C75A 1GCEA 4JF5A 1K55A 4FOFA 5A90A 3SW1A 1L2SA 2NUTC 4FSFA 3B33A 4XT2B 5CHUA 1FQGA 4UHUA 1K57A 4JGOA 1TVFA 4HEFA 2ZD8A 3LR4A 5M1AA 4KQDA 5HPFA 4LCLA 1PZPA 4OP8A 1UGUA 4M4XA 4E3OA 4OPRA 4KZAA 3ZVWA 3HLDA 3N4IA 3FG8A 4S2NC 4QY5A 3MXRA 4Z1WA 3R7WB 1WA9A 1LT0A 2A24A 4CQHA 2ZQ8A 5DJTA 4E3IA 3FYZA 4XXRA 4HBUA 1J9MA 3P98A 3EWKA 3MQ0A 3LR5A 5FL3A 4NKPA 1C3BA 3PBOA 2M1CA 1IYSA 4JXGA 5G4ZA 3C7UA 3P09A 4FH4A 1XXMA 2BLSA 4I3JA 5FQ9A 3ZDJA 3BFGA 4E3JA 3HBRA 4NXBA 4Y0UA 3LI9A 2OWJA 1D7EA 1H8YA 1L0EA 3T4TA 2WGWB 4BQMA 1YLPA 5FAOA 2W1TA 1F2KA 4HBTA 2WAEA 1G28A 2HP6A 5GLAA 1PFLA 1MBLA 3MQOA 2OV5A 1LI0A 3SH8A 4OOYA 3WS2A 4MBHA
chains in the Genus database with same CATH topology
4R6LA 2VV6A 2W3FA 4Y2FA 3KYZA 4MN5A 3PBQA 1XFNA 1DP8A 2L0WA 2KLIA 1XFQA 4EETB 4WEJA 5HZHA 3OCNA 3IS2A 3FPVA 3F1OB 3PBNA 3PXPA 1ODVA 4H6JB 2VGLS 2PR5A 3LIEA 4HHDA 2J3TC 3CITA 3CWFA 4IUKA 1OTEA 3BQ8A 1XJ2A 2D02A 4G3KA 3EOIA 2W3DA 4CLCA 3IBJA 3LI8A 5DFXA 2H28A 2V1AA 3B47A 3T50A 3VE4A 2W3GA 1H3QA 2Y8HA 3S7OA 2KX6A 4O01A 2VLGA 4BBVA 4P6ZS 2ZMVA 2VGLM 2ZOHA 3HJIA 4KUOA 3A0VA 2OWHA 5IU1A 1V9YA 5KSHA 1XJ3A 3H9WA 3E4QA 2LB5A 4GLQA 3FC7A 3PBTA 4RQ9A 5F6AA 3H82A 1OTIA 4O8GA 1UWPX 5HWTA 3S7NA 3BW6A 4BBUA 2JKTM 1LSXA 4PKYG 3NOPC 3EGDC 5LBRA 2PYPA 2EWVA 1D06A 2HJ9C 4JGQA 5G4YA 5J3WA 3MMHA 3UB9A 4F3LA 5K5BA 4B9OA 2PD7A 4GS9A 2Z6DA 4WL9A 1LSVA 1W63Q 5DJUA 3U2AA 4BWIA 3IBRA 5HD5A 3K2NA 2D01A 3CUEC 4HNBA 3UE6A 3MXQA 4YNRA 2OOLA 2HJEA 4R70A 2BASA 1OJGA 3HCYA 2VJWA 3RH8B 2JKTI 1TD5A 3UMEA 2W27A 4OOLA 4YWZA 3TRCA 5AVFA 4R38A 5KIZA 3LR3A 3UB7A 4NXFA 2I9VA 3F1NA 5MC7A 2G7UA 2W1RA 4WF0A 4LRZE 4WEKA 3OCLA 5AVEA 5C5KA 2ZBBA 4ETXA 3O5YA 2YKHA 5I5LA 3T4OA 2VV8A 1JNUA 2A2LA 2O99A 3A0RA 1BYWA 3VOLA 2GZAA 4R3AA 4EXOA 4G3WA 2K31A 4IHQA 1YKDA 1OTDA 3LIBA 2MJ6A 2QKPA 2A24B 1XJ4A 4BBTA 3TW8A 2FZ0A 4QPRA 2W3EA 4UQIM 3T4LA 1S4SA 1VB6A 1OTAA 5CX7A 5J4EA 3ICYA 4I3AA 2DMWA 3TJZC 2V1BA 1S1ZA 1TS0A 2HF6A 3PBRA 1P9WA 3P7NA 2HV1A 3EEAA 2M7VA 2J3TD 3GDIA 1TS7A 2O9AA 5HSQA 3C30A 2XSSA 2GX5A 3LUQA 3LIDA 2GJ3A 4HIAA 5F5YA 2QJ5A 4GJ4A 4WLAA 2OAP1 2CMNA 3MF0A 3LFVA 4CLCE 3B42A 3OBFA 2J80A 2WKPA 4Q0IA 4Y5FA 3PHYA 2JN7A 1T1CA 3KSFA 3P01A 1MKMA 4NEED 3RTYA 3A0SA 4Q0HA 2W1TB 4GW9A 3BY9A 3BQAA 3KX0X 3KYQA 2B18A 4WN5A 2O0YA 1OT6A 2O9CA 4HQAA 5TBMB 2Y79A 3UB6A 4HJ4A 2PT7A 3RFBA 1G6OA 3KSIA 1F9IA 1N9LA 2VZWA 2K7SA 1F98A 5F69A 3BY8A 4GHIA 1ZHHB 3C2WA 2NUPC 2XRNA 1LL8A 1OT9A 3IS2B 4L9GA 4EEUA 4KQOA 2PD8A 1X0OA 2PDRA 4DN0A 4EQ1A 3D72A 4PHTA 1IOUA 1XJ6A 3E0YA 4HH3A 3JVVA 4II7A 4CLCB 2EWWA 2XA7S 4B93A 1T1BA 1NWZA 3T4KA 2FH5A 3LYXA 4MMNA 4L9EA 3C8CA 4IJGA 1P97A 3E4OA 3D3OA 1OJ5A 3S7PA 2B02A 2PYRA 4O0PA 5HL6A 4CLCC 3GECA 3NHQA 4OOMA 1Y28A 2XA7M 4HI4A 4DMZA 1UWNX 3HJKA 4IUHA 3JVUA 1P0ZA 3NOUC 2PHYA 3H82B 3ZQ5A 2QYBA 4LLOB 4I38A 2L1MA 2QHKA 3CI6A 4G3VA 2VV7A 2IA2A 1S67L 1W63M 5HWWA 1F5MA 3G6OA 3FPWA 2GNXA 1T19A 2W3HA 4UQIS 1H8MA 2JKRM 3NJAA 3T4JA 3F1OA 4F3LB 3MR0A 2V0WA 2HGVA 2P08A 4GS9B 4EW7A 4HH2A 2ZMFA 2WKQA 3NOTC 2VEAA 4MN7A 3ZYTA 3KSHA 2PR6A 4HP9A 1GSXA 4WELA 5F68A 2XROA 4XT2A 5A8BA 4HY8A 3C38A 3CLOA 3TE8A 4EU0A 2VA0A 2P04A 3UMDA 5DFYA 1LSWA 3E98A 1S1YA 4HOIA 3LIAA 4ETZA 4AFIA 1ZTUA 5HPIA 3VE3A 1N9OA 4UEYA 2QWSA 4BJPA 1N9NA 2J3WA 2JKRI 5AJGA 1DP9A 4WUJA 3F1PA 1EW0A 3R4KA 3S7QA 1MC0A 1DP6A 2L4RA 3MFXA 4LPZA 4MN6A 2VX8A 4EERA 2LB9A 3OOVA 3F1NB 1V9ZA 1KOUA 4BMWA 4HP4A 3BWLA 3CUEA 1S66L 1YSPA 2V0UA 2K2NA 4GCZA 3K3CA 3W2ZA 2R78A 4DJ3A 2INWA 3KSGA 1DRMA 3R7WA 4I39A 3UB8A 4PKYA 5HDSA 1YAXA 4MDZA 4ME4A 4Y3IA 4FOFA 2W0NA 3T4SA 5DKKA 1MZUA 1STZA 3SW1A 3H7WA 5EFWA 2NUTC 4FSFA 1T18A 3B33A 2VKSA 4NXEA 4XT2B 4LRXC 5DF9A 3VV4A 3OLOA 4JGPA 4Q0JA 4JGOA 5HD3A 3LR4A 4EEPA 2ZOIA 4KQDA 5HPFA 5HDDA 4ARZA 2QJ7A 1UGUA 4M4XA 3F1PB 1TS6A 4P6ZM 1S4RA 2V9AA 4KUKA 4K08A 3PR6A 1P9RA 1OTBA 3FG8A 4L9FA 4CLCD 1NLZA 5L8MA 4NXGA 4Z1WA 3DBAA 4E04A 3R7WB 1WA9A 5IT5A 1LT0A 5IS1A 1GSWA 2A24A 4CQHA 1NLYA 5DJTA 5HWVA 2WKRA 2KDKA 3V67A 2OAQ1 1TF1A 3H7WB 2M7UA 3CAXA 3PBSA 3EWKA 3EQUA 3KO6A 3MQ0A 3LR5A 5FL3A 4H6JA 4NKPA 4EESA 1VHMA 4GHIB 3PBOA 3OC2A 2M1CA 4ARZB 5G4ZA 4I3JA 5TJJA 3EGXC 4HJ3A 3T4QA 3LICA 4NXBA 5DKLA 4I5SA 2O9BA 4EUVA 3LI9A 2OWJA 2EA9A 1D7EA 1YSQA 1IFQA 2YKFA 3T4TA 1OPXA 3UE3A 2W1TA 5HDCA 4I3IA 4HJ6A 1NRJA 3K3DA 1G28A 1TS8A 3LR0A 4LRYC 4DJ2A 2P7JA 4MCWA 1GSVA 4YOFA 3MQQA 3BJNA 3EQVA 4ZRRA 3ULFA 2JHEA 2KOIA 3E4PA 3MQOA 5TBMA 2Z6CA 1T1AA 4PAUA 4L0LA 3PYPA 3EEHA 3LIFA 3MJQA 5J7EA 4JGRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R6L A;  2VV6 A;  4MN5 A;  1XFN A;  1DP8 A;  2L0W A;  1XFQ A;  4EET B;  5HZH A;  3IS2 A;  3F1O B;  1ODV A;  4H6J B;  2PR5 A;  3LIE A;  4HHD A;  3CWF A;  1OTE A;  1XJ2 A;  2D02 A;  3LI8 A;  2H28 A;  2V1A A;  3T50 A;  3VE4 A;  2KX6 A;  2VLG A;  4BBV A;  2ZOH A;  3HJI A;  4KUO A;  3A0V A;  2OWH A;  5IU1 A;  1V9Y A;  1XJ3 A;  3H9W A;  3E4Q A;  3FC7 A;  4RQ9 A;  5F6A A;  3H82 A;  1OTI A;  1UWP X;  5HWT A;  4BBU A;  4PKY G;  1LSX A;  3NOP C;  2PYP A;  1D06 A;  4JGQ A;  5G4Y A;  5J3W A;  3UB9 A;  4F3L A;  4B9O A;  2PD7 A;  4GS9 A;  2Z6D A;  4WL9 A;  1LSV A;  5DJU A;  3IBR A;  5HD5 A;  2D01 A;  4HNB A;  3UE6 A;  3MXQ A;  2OOL A;  4R70 A;  2BAS A;  1OJG A;  3RH8 B;  3UME A;  2W27 A;  4YWZ A;  5AVF A;  4R38 A;  5KIZ A;  3UB7 A;  4NXF A;  2I9V A;  3F1N A;  4WF0 A;  4LRZ E;  5AVE A;  2ZBB A;  2YKH A;  5I5L A;  2VV8 A;  1JNU A;  3A0R A;  1BYW A;  3VOL A;  4R3A A;  4EXO A;  3LIB A;  1OTD A;  2QKP A;  2A24 B;  1XJ4 A;  4BBT A;  1S4S A;  1VB6 A;  1OTA A;  5J4E A;  3ICY A;  4I3A A;  2V1B A;  1S1Z A;  1TS0 A;  3P7N A;  2HV1 A;  3GDI A;  1TS7 A;  5HSQ A;  3LUQ A;  3LID A;  2GJ3 A;  4HIA A;  5F5Y A;  2QJ5 A;  4WLA A;  2CMN A;  2J80 A;  2WKP A;  3PHY A;  2JN7 A;  1T1C A;  3RTY A;  3A0S A;  4GW9 A;  3BY9 A;  3KX0 X;  4WN5 A;  1OT6 A;  4HQA A;  5TBM B;  3UB6 A;  4HJ4 A;  1F9I A;  1N9L A;  2K7S A;  1F98 A;  5F69 A;  3BY8 A;  4GHI A;  3C2W A;  1LL8 A;  1OT9 A;  3IS2 B;  4L9G A;  4EEU A;  2PD8 A;  1X0O A;  2PDR A;  4EQ1 A;  3D72 A;  1XJ6 A;  4HH3 A;  1T1B A;  1NWZ A;  3LYX A;  4L9E A;  3C8C A;  1P97 A;  3E4O A;  1OJ5 A;  2B02 A;  2PYR A;  3GEC A;  3NHQ A;  1Y28 A;  4HI4 A;  1UWN X;  3HJK A;  1P0Z A;  3NOU C;  2PHY A;  3H82 B;  3ZQ5 A;  4LLO B;  4I38 A;  2L1M A;  2QHK A;  2VV7 A;  1S67 L;  5HWW A;  3G6O A;  1T19 A;  3NJA A;  3F1O A;  4F3L B;  3MR0 A;  2V0W A;  4GS9 B;  4EW7 A;  4HH2 A;  2WKQ A;  3NOT C;  2VEA A;  2PR6 A;  4HP9 A;  1GSX A;  5F68 A;  4XT2 A;  5A8B A;  4HY8 A;  3CLO A;  3UMD A;  1LSW A;  1S1Y A;  4HOI A;  3LIA A;  3VE3 A;  1N9O A;  2QWS A;  1N9N A;  1DP9 A;  4WUJ A;  3F1P A;  1EW0 A;  4LPZ A;  1DP6 A;  2L4R A;  3MFX A;  4MN6 A;  4EER A;  3F1N B;  1V9Z A;  1KOU A;  4HP4 A;  3BWL A;  1S66 L;  2V0U A;  4GCZ A;  3K3C A;  4DJ3 A;  2R78 A;  2INW A;  1DRM A;  3UB8 A;  4I39 A;  4PKY A;  5HDS A;  2W0N A;  5DKK A;  1MZU A;  3SW1 A;  3H7W A;  5EFW A;  1T18 A;  3B33 A;  4NXE A;  4XT2 B;  4LRX C;  3OLO A;  4JGP A;  4JGO A;  5HD3 A;  4EEP A;  2ZOI A;  4KQD A;  5HDD A;  2QJ7 A;  1UGU A;  4M4X A;  3F1P B;  1TS6 A;  1S4R A;  2V9A A;  4KUK A;  4K08 A;  1OTB A;  3FG8 A;  4L9F A;  4NXG A;  4E04 A;  1WA9 A;  1LT0 A;  5IS1 A;  1GSW A;  2A24 A;  5DJT A;  5HWV A;  2WKR A;  2KDK A;  3H7W B;  3CAX A;  3EWK A;  4H6J A;  4EES A;  4GHI B;  2M1C A;  5G4Z A;  4I3J A;  4HJ3 A;  3LIC A;  4NXB A;  5DKL A;  4I5S A;  3LI9 A;  2OWJ A;  2EA9 A;  1D7E A;  2YKF A;  5HDC A;  4I3I A;  4HJ6 A;  3K3D A;  1G28 A;  1TS8 A;  4LRY C;  4DJ2 A;  2P7J A;  1GSV A;  3MQQ A;  3ULF A;  2JHE A;  3E4P A;  3MQO A;  5TBM A;  2Z6C A;  1T1A A;  3PYP A;  3EEH A;  3LIF A;  3MJQ A;  5J7E A;  4JGR A; 
#chains in the Genus database with same CATH topology
 2VV6 A;  4Y2F A;  1CEF A;  4N1H A;  2KLI A;  4X69 A;  4X6T A;  3IHA A;  3IS2 A;  1M6K A;  2Y2O A;  4KQQ A;  2WKH A;  5FA7 A;  4KZ3 A;  2XQZ A;  3CIT A;  3T1R A;  1OTE A;  1ZG6 A;  3BQ8 A;  3HUN A;  1KVL A;  4RYE A;  3EOI A;  4CLC A;  3IBJ A;  4BL3 A;  1GHI A;  3T50 A;  2W3G A;  3IH9 A;  3S7O A;  4O01 A;  2VLG A;  3UDF A;  4P6Z S;  1NRF A;  4QY6 A;  1MY8 A;  1Z6F A;  3DWZ A;  3GMW A;  4Y7P A;  1XJ3 A;  3E4Q A;  3DAV A;  3BFC A;  3FC7 A;  5BOH A;  4IED A;  3IH8 A;  3S7N A;  2JKT M;  5KMW A;  3HLG A;  1K54 A;  1SHV A;  2UV0 E;  4E6X A;  4EBP A;  5L2F A;  3MMH A;  3UB9 A;  4LEN A;  3LGO A;  4Y15 A;  2PRF A;  3D9Y A;  2Z6D A;  2X01 A;  4WL9 A;  1W63 Q;  5EV0 A;  1I5Q A;  3K2N A;  2UWX A;  3CPT A;  5E43 A;  3CUE C;  2EFU A;  3UE6 A;  1SZV A;  4YNR A;  1EWZ A;  2PBD P;  4R1G A;  1BZA A;  1JTG A;  2JKT I;  2W27 A;  4YWZ A;  3TRC A;  3UNW A;  1K55 C;  1FCN A;  2WKI A;  3QP1 A;  3UB7 A;  4NXF A;  5EVI A;  2V20 A;  3F1N A;  4JKT A;  1PI5 A;  2G7U A;  1L0F A;  3TOI A;  5AQB A;  3OCL A;  5AVE A;  1K57 C;  4P87 A;  3D4F A;  3G2Y A;  1BLC A;  1JNU A;  1ALQ A;  1QMF A;  3A0R A;  3VP2 A;  4R3B A;  2J9O A;  4EXO A;  1XP4 A;  1CJF A;  1YKD A;  4PM8 A;  3NY4 A;  1XJ4 A;  4BBT A;  2FZ0 A;  1BSG A;  4GOG A;  2WZZ A;  3V3S A;  2HP9 A;  4H8R A;  3T12 B;  1K38 A;  3BYD A;  2HV1 A;  4ZJ3 A;  3GDI A;  1TS7 A;  4ZDX A;  3LUQ A;  5EVI B;  1VQQ A;  5CER A;  2QJ5 A;  3Q7V A;  2VGJ A;  2OAP 1;  4DDY A;  1TDG A;  3GRJ A;  3DW0 A;  4Y5F A;  3KSF A;  4NEE D;  4BLM A;  3A0S A;  2ZMA A;  1GHM A;  4GW9 A;  5GLC A;  2AVX A;  5AQ9 A;  1KDW A;  2Y2K A;  2Y79 A;  3RFB A;  3KSI A;  4DDS A;  1F9I A;  5JYO A;  4K0X A;  2OSU A;  4PM9 A;  3AGE A;  5F69 A;  1SCW A;  4GDN A;  1ZHH B;  2V1Z A;  3I7J A;  3AGD A;  1PZO A;  4CPK A;  1X0O A;  2PDR A;  4U0T A;  4DN0 A;  4EQ1 A;  3D72 A;  1IOU A;  3CHW P;  3O3V A;  4P6B A;  3W4Q A;  3JVV A;  3Q7V B;  1RGZ A;  4B93 A;  1NWZ A;  3T4K A;  1KE4 A;  1NZO A;  2ZM2 A;  4L9E A;  3ZNY A;  2EX6 A;  2C5W B;  5KSC A;  3GQZ A;  3G4P A;  4FD8 A;  4CLC C;  3GEC A;  1KE0 A;  4OQH A;  1Y28 A;  1WYC A;  2QMI A;  3HJK A;  4IUH A;  5E2F A;  3ITA A;  4BD1 A;  3H82 B;  1SKF A;  4E3N A;  4QWO A;  2BTF P;  1LL9 A;  3ZG8 B;  4EUZ A;  2P9V B;  1T19 A;  3NJA A;  1A0K A;  4F3L B;  2Y4A A;  3MR0 A;  4WBG A;  2WGI A;  2HGV A;  2P08 A;  3IX3 A;  4EW7 A;  2ZMF A;  4BL2 A;  3QNC A;  1BT5 A;  4EU0 A;  3C38 A;  3TE8 A;  3BRM A;  4JPM A;  1K56 D;  4HOI A;  5CXW A;  1LL5 A;  1ZG4 A;  4N9L A;  4BD0 A;  4UEY A;  4R4R A;  4FCF A;  1NYY A;  3F1P A;  1EW0 A;  2CC1 A;  4LPZ A;  3MFX A;  4UAA A;  3A3F A;  2LB9 A;  5CED A;  3VP3 A;  5EVI D;  2J7V A;  1YSP A;  1LLB A;  3PTE A;  2XDM A;  3DTI A;  1W8Q A;  4PKY A;  5FQM A;  1YAX A;  2WAF A;  1LI9 A;  2R9X A;  2W0N A;  3LEQ A;  3C4O A;  4GD8 A;  4D2O A;  3E2L A;  2EX2 A;  2H0T A;  4E3L A;  3S4X A;  2JKG A;  3VV4 A;  3OLO A;  3IHB A;  3VP4 A;  3T1Q B;  5FAQ A;  3CMZ A;  5HDD A;  4ARZ A;  4OQG A;  3MXS A;  2QJ7 A;  3LY4 A;  3F1P B;  1JTD A;  4P6Z M;  3G30 A;  2V9A A;  1ERO A;  3BLM A;  5F1F A;  1OTB A;  3ZG7 B;  3DBA A;  5L10 A;  5IT5 A;  5HX9 A;  1IKI A;  1GSW A;  2ZC7 A;  1ZKJ A;  2JCH A;  4JBF A;  5HWV A;  1Y54 A;  3V67 A;  1TF1 A;  4LCM A;  3CAX A;  4S2P A;  2Z2M B;  4XUX A;  3N6I A;  4K0W A;  1FIK A;  5GLD A;  3U4L P;  3ITB A;  1KGE A;  2Y55 A;  3Q7Z A;  1SKO A;  4H6J A;  4EES A;  5EVE A;  3IXH A;  4ARZ B;  4HJ3 A;  3T4Q A;  1ONG A;  2ZC5 B;  2EX8 A;  3WRZ A;  2QZ6 A;  4S2J A;  3UN7 A;  5CGX A;  2IWC A;  3QP6 A;  4IBX A;  1GA0 A;  1TS8 A;  3LR0 A;  4LRY C;  4OVD A;  2P7J A;  3NI9 A;  3OPP A;  5CGS A;  4YOF A;  3GR2 A;  2ZM0 A;  3E4P A;  3IX8 A;  3GSG A;  2V8C A;  3PYP A;  3MJQ A;  4JGR A;  3QNB A;  1W8Y A;  2W3F A;  4U0X A;  4S2L A;  4PMA A;  1BUL A;  3M6B A;  3Q07 A;  1CI9 A;  3FPV A;  4NG2 A;  3SS4 A;  2QPN A;  4H6J B;  2VGL S;  4RA7 A;  4HHD A;  4IUK A;  3ZFZ A;  5TGF A;  1XJ2 A;  2D02 A;  4G3K A;  3SH9 A;  2W3D A;  2DCF A;  1NZU A;  3LI8 A;  2H28 A;  5CGW A;  1PWC A;  1VEU A;  2KX6 A;  1IKG A;  4BBV A;  3A0V A;  1HVB A;  3IWI A;  2XK1 A;  2XD1 A;  3BLS A;  4OPZ A;  4OLG A;  5A92 A;  2H5S A;  1LSX A;  5LBR A;  1SDE A;  1D06 A;  3O88 A;  4KEN B;  4MEZ A;  5A91 A;  3IF6 A;  4KZ9 A;  3NCK A;  1LSV A;  5DJU A;  3U2A A;  4BWI A;  1FOF A;  1Q2Q A;  2Y2J A;  3IBR A;  3ISG A;  2XF3 A;  3CZD A;  2D01 A;  1G5U A;  3MXQ A;  1XA1 A;  2WK0 A;  5EM1 A;  4DRT A;  3HUO A;  2J8Y A;  3OZH A;  4DXC A;  3NDG A;  2VJW A;  2ZQA A;  3HCY A;  3RH8 B;  2VGK A;  4OOL A;  3ZCZ A;  4ZTK A;  1VEU B;  4R38 A;  4WMC A;  3LR3 A;  4N92 A;  5CEB A;  1PWD A;  2W1R A;  1ERM A;  1WYB A;  2ZBB A;  5I5L A;  1AWI A;  2VV8 A;  3JYI A;  5HAI A;  5AQA A;  2O99 A;  2Q9M A;  3HL9 A;  4R3A A;  1PI4 A;  3SOI A;  1FR6 A;  4G3W A;  1MKI A;  3QP2 A;  2PAV P;  2A24 B;  2W3E A;  1S4S A;  1PW1 A;  1NY0 A;  2DMW A;  3QHY A;  3TJZ C;  1S1Z A;  1TS0 A;  2WYX A;  3P7N A;  2FFF B;  2M7V A;  4S2I A;  5F82 A;  3IT9 A;  3B3X A;  5L09 A;  2Y2N A;  3L7H A;  4HIA A;  4WLA A;  4B4Z A;  2EXA A;  3SZT A;  4Z9Q A;  5EOO A;  3OBF A;  2J80 A;  3OPL A;  1H8Z A;  2WKP A;  1MWT A;  1XX2 A;  4E3K A;  2ZC6 B;  1PNE A;  3P01 A;  1YLW A;  3RTY A;  4WZ5 C;  2W1T B;  2B18 A;  3RXW A;  1XGI A;  3UB6 A;  4HJ4 A;  5HFO A;  1G6O A;  3VOY A;  3NBL A;  3TSG A;  2VZW A;  2K7S A;  2ZQ9 A;  4GHI A;  4X25 A;  3WWX A;  2NUP C;  1LL8 A;  4FUW A;  5M18 A;  3IS2 B;  4KG5 A;  3MFD A;  2OLV A;  4DE2 A;  4PM7 A;  3BEB A;  1XJ6 A;  4HH3 A;  5G18 A;  2P74 A;  3G35 A;  4CLC B;  1T1B A;  5CRF A;  3LYX A;  4OQI A;  1P97 A;  3E4O A;  4LV0 A;  2PYR A;  4O0P A;  2BG1 A;  3NHQ A;  4OOM A;  3LO7 A;  2XA7 M;  1K25 A;  5FI6 A;  3JVU A;  1P0Z A;  4JXW A;  3NOU C;  2PHY A;  3QP8 A;  1CI8 A;  2QYB A;  4LLO B;  4G3V A;  2QHK A;  5HWW A;  1W63 M;  2HPB A;  1F5M A;  2JC7 A;  2ZL1 A;  1LHY A;  3FPW A;  2GNX A;  4UQI S;  1H8M A;  3F1O A;  2V0W A;  3W8K A;  3G31 A;  2G2W A;  1GA9 A;  2WKQ A;  3NOT C;  3MZE A;  3CPT B;  1SDN A;  4EV4 A;  3IF6 C;  4WZ4 A;  2XRO A;  3GTC A;  2VA0 A;  3UMD A;  5DFY A;  1BTL A;  1KGF A;  1S1Y A;  1TEM A;  3LIA A;  4AFI A;  5HPI A;  3BFE A;  4ZBE A;  3UPN A;  3VE3 A;  1L3L A;  2QWS A;  2J3W A;  5AJG A;  4GNU A;  3FWL A;  1YMS A;  4K91 A;  4WMC D;  2HDU A;  2VX8 A;  3RJU A;  3IWO A;  3F1N B;  2XLN A;  3OOV A;  1V9Z A;  4BMW A;  3IXB A;  1NYM A;  5FQI A;  3ZG9 B;  1BLH A;  1S66 L;  1H5X A;  5FAP A;  2V0U A;  4JXV A;  3W2Z A;  2R78 A;  4ZJ1 A;  4DJ3 A;  3MZD A;  1XPB A;  3UB8 A;  1MWS A;  2HDR A;  4WYY A;  2ZQD A;  4ME4 A;  3T4S A;  5DKK A;  1MZU A;  3IX4 A;  1STZ A;  2GDN A;  3UDI A;  3MZF A;  1T18 A;  1KDS A;  5EPH A;  4CJN A;  4NXE A;  4LRX C;  1ACF A;  4JGP A;  2Q0O A;  4Q0J A;  1S0W A;  5HD3 A;  3C7V A;  3DTK A;  4FH2 A;  4QD4 A;  4OP5 A;  1PWG A;  1TS6 A;  3MKE A;  3FZC A;  5CEC A;  1S4R A;  3Q82 A;  1HZO A;  4KUK A;  1E3U A;  4GDB A;  5FQJ A;  3UDX A;  3OPR A;  2RCX A;  3ZGA B;  4CLC D;  5L8M A;  1FCO A;  4NXG A;  1YMX A;  1YLT A;  5F1G A;  4LGW A;  2JBF A;  3MSH A;  2WUQ A;  1NLY A;  1AXB A;  5U47 A;  5IHV A;  2WKR A;  1IEM A;  2Y2G A;  2M7U A;  5EE8 A;  1ES5 A;  4OKP A;  5FI7 A;  2Q9N A;  1M40 A;  4N9K A;  3N7W A;  1FIL A;  3NIA A;  4LV3 A;  1J3W A;  3T1S A;  2Z2L B;  3E2K A;  3OC2 A;  1ERQ A;  2XEP A;  4RX3 A;  3VFH A;  3BFD A;  3LIC A;  4QB8 A;  5DKL A;  5DF7 A;  1IFQ A;  3UE3 A;  1O07 A;  1VET A;  4I3I A;  4HJ6 A;  4A5R A;  1NRJ A;  3A3E A;  4ZJ2 A;  5GHX A;  4DJ2 A;  4X55 A;  1GSV A;  3BJN A;  3EQV A;  4ZRR A;  3ULF A;  2JHE A;  1G68 A;  5TBM A;  1T1A A;  5F83 A;  4L0L A;  3EEH A;  3LIF A;  2WGV A;  2E8J A;  2JE5 A;  4M3K A;  4R6L A;  3KYZ A;  4D60 A;  1DP8 A;  1XFQ A;  4EET B;  4WEJ A;  4X1M A;  3OCN A;  4XUZ A;  1ODV A;  5FSR A;  2PR5 A;  2J3T C;  3CWF A;  1VM1 A;  4EBL A;  2Y59 A;  1MXO A;  5FDH A;  2XR0 A;  3BFF A;  3IQA A;  4GB7 A;  2B95 A;  1O7E A;  3HJI A;  4UA9 A;  4DE3 A;  1QME A;  5GHZ A;  5AQ7 A;  1VET B;  2OWH A;  4F94 A;  1K0K A;  5IU1 A;  1K6S A;  4OLD A;  3PBT A;  4RQ9 A;  4KG6 A;  4O8G A;  1UWP X;  2XH9 A;  3BW6 A;  4BBU A;  4PKY G;  4JGQ A;  5J3W A;  4LV2 A;  1XGJ A;  1G6A A;  2ACG A;  2Y2H A;  2PD7 A;  4GS9 A;  2J9P A;  3Q1F A;  1H0M A;  5HD5 A;  2HP5 A;  2EX9 A;  4O7D A;  4RVA A;  3G32 A;  5CHM A;  1CF0 A;  4B88 A;  2BAS A;  1OJG A;  3DTE A;  5HW3 A;  3UME A;  5FQQ A;  3C5A A;  5AVF A;  5FAT A;  3M2J A;  2I9V A;  4WF0 A;  4LRZ E;  4LFU A;  4WZ5 A;  5C5K A;  3N8L A;  5FDS A;  3O5Y A;  2YKH A;  3T4O A;  1KVM A;  3CJM A;  3A3D A;  4EWF A;  3N8R A;  1BYW A;  1IYO A;  4E6W A;  3VOL A;  2GZA A;  3M2K A;  5FQK A;  3SS5 A;  1E3U D;  2WAD A;  2K31 A;  1OTD A;  2MJ6 A;  2PU2 A;  3TW8 A;  4QPR A;  3HLB A;  4UQI M;  3O87 A;  5GLB A;  4BEN A;  1OTA A;  5J4E A;  2G2U A;  4I3A A;  3UY6 A;  3ZHH A;  2V1B A;  1L0D A;  4HES A;  3EEA A;  4JF4 A;  4S2M A;  5J8X A;  2ZJ9 A;  2O9A A;  1SKO B;  5HSQ A;  3PAG A;  3C30 A;  3ZVT A;  1HLU P;  1E25 A;  2XD5 A;  1L0G A;  3LFV A;  3B42 A;  5CHJ A;  4JF6 A;  1T1C A;  1MKM A;  4KZ4 A;  2WZX A;  5JYP A;  4ID4 A;  1PW8 A;  1U60 A;  3BY9 A;  4PM5 A;  3KX0 X;  4WN5 A;  3GV9 A;  1OT6 A;  2O9C A;  4HQA A;  1PIO A;  2DNS A;  3V39 A;  2PT7 A;  5FI2 A;  2B5R A;  4Y0O A;  5DVA A;  3DTM A;  1F98 A;  3V5M A;  5CTM A;  2XRN A;  2XGN A;  2X71 A;  4EEU A;  2PD8 A;  5FAS A;  3L9K A;  2WGW A;  4II7 A;  3HRE A;  3WS4 A;  1N4O A;  1W7F A;  3C8C A;  5TFQ A;  1OJ5 A;  3S7P A;  2I72 A;  4KZ8 A;  3UO9 A;  3W4O A;  3S1Y A;  2Y2L A;  4DMZ A;  1I2W A;  4NK3 A;  3NC8 A;  1FR1 A;  2L1M A;  2VV7 A;  2IA2 A;  3G6O A;  4RX2 A;  1DJB A;  3T4J A;  2Y2M A;  5E2H A;  3IF6 B;  4FTX A;  2VK3 A;  4E3M A;  4HH2 A;  5EM0 A;  2VEA A;  1DJC A;  4MN7 A;  3ZYT A;  3KSH A;  4X1L A;  5F68 A;  5A8B A;  3VP1 A;  2P04 A;  3E98 A;  4QJG A;  4UA7 A;  3ZG0 A;  2WKE A;  1ONH A;  4BJP A;  1N9N A;  1HD8 A;  1IYP A;  1DP9 A;  4WUJ A;  5HAR A;  2OLU A;  3S7Q A;  1MC0 A;  2L4R A;  4C3Q A;  3AGF A;  5EEC A;  3HVF A;  1KOU A;  1MPL A;  3BWL A;  3O86 A;  3LCE A;  2K2N A;  4GCZ A;  3K3C A;  2Y2I A;  3VOZ A;  4OQ0 A;  3A3I A;  4Y0T A;  3KSG A;  4I39 A;  2H10 A;  1BUE A;  5HDS A;  4MDZ A;  4ESP A;  4Y3I A;  1Y4O A;  5TR7 A;  5E2G A;  4DE1 A;  3ZNT A;  4Y13 A;  3H7W A;  3UE0 A;  5EFW A;  3T1X A;  1YM1 A;  4P0M A;  1XA7 A;  1KE3 A;  5DF9 A;  2VKS A;  5HL1 A;  1RGY A;  4EEP A;  2ZOI A;  3ZG5 A;  4R3J A;  1K4F A;  3G2Z A;  5KZH A;  1DJA A;  5EOE A;  1ES3 A;  4K08 A;  3PR6 A;  1P9R A;  4L9F A;  1NLZ A;  3QP4 A;  4E04 A;  5IS1 A;  1JVJ A;  3HLE A;  1MWU A;  3BEC A;  3RXX A;  1K56 A;  2KDK A;  3FKW A;  1JWZ A;  2OAQ 1;  3BM6 A;  3H7W B;  1ES2 A;  1FSY A;  4KZ6 A;  1OME A;  3PBS A;  1IEL A;  4NET A;  4Q8I A;  3VP0 A;  3EQU A;  3KO6 A;  1W79 A;  3IWQ A;  2JKF A;  5GL9 A;  4DF6 A;  1PYY A;  1VHM A;  2ZC3 B;  4GHI B;  1BLP A;  2XFT A;  4N1X A;  5HAP A;  1NXY A;  5TJJ A;  3EGX C;  4I5S A;  2O9B A;  4EUV A;  4MLL A;  1DY6 A;  2EA9 A;  1YSQ A;  2YKF A;  1OPX A;  2HDS A;  1JWV A;  5HDC A;  5CTN A;  3GVB A;  3VSK A;  4GZB A;  3K3D A;  2H0Y A;  4MCW A;  2V2F F;  3SS3 A;  3MQQ A;  2KOI A;  1TDL A;  4WM9 A;  2Z6C A;  4MBK A;  4PAU A;  3A3J A;  4UA6 A;  2ZLY A;  5J7E A;  1XKZ A;  4MN5 A;  3PBQ A;  3TG9 A;  1XFN A;  4EQI A;  2L0W A;  3V3R A;  1NJ4 A;  2ZL1 B;  5HZH A;  2ZQC A;  1FCM A;  3HLW A;  3G34 A;  4GKU A;  3F1O B;  3PBN A;  3NDE A;  3PXP A;  2RL3 A;  2V8F A;  2DRW A;  2IWB A;  1IYQ A;  3LIE A;  4YFM A;  3WS5 A;  3MS6 A;  3FKV A;  1ZC2 A;  5M19 A;  5DFX A;  1FSW A;  5EUA A;  2V1A A;  1CQA A;  1PRQ A;  3B47 A;  3DWK A;  4OPQ A;  3VE4 A;  1H3Q A;  2Y8H A;  2ZMV A;  2VGL M;  2ZOH A;  3HUM A;  4EBN A;  4KUO A;  1ESI A;  1YLJ A;  3HLF A;  4S2O A;  4R23 A;  1EI5 A;  1V9Y A;  5KSH A;  3H9W A;  4LV1 A;  2LB5 A;  4GLQ A;  5F6A A;  3H82 A;  1OTI A;  1W5D A;  2HZ5 A;  5HWT A;  3NOP C;  3EGD C;  2PYP A;  2EWV A;  4YIN A;  4R4S A;  5HAQ A;  2HJ9 C;  4OON A;  2P9V A;  5G4Y A;  2ZM8 A;  4F3L A;  5K5B A;  4B9O A;  1HTZ A;  1YPR A;  1K6R A;  3UB5 P;  4HNB A;  3HLC A;  5D3O A;  4DE0 A;  2OOL A;  2HJE A;  4X53 A;  3OPH A;  3IXD A;  5DTK A;  4R70 A;  3WS1 A;  3UPP A;  1TD5 A;  3C4P A;  1MWR A;  2EXB A;  5KIZ A;  4Y17 A;  3UE1 A;  5L07 A;  4PPR A;  4OPY A;  5MC7 A;  4QU3 A;  4WEK A;  2R9W A;  2Y91 A;  4ETX A;  5EVL A;  4MBF A;  2A2L A;  2Y2Q A;  1Q2P A;  1S6R A;  1GHP A;  3SH7 A;  5GHY A;  2C6W B;  1K54 C;  1RP5 A;  4IHQ A;  1I2S A;  3LIB A;  2A3U A;  3MBZ A;  2QKP A;  4R0Q A;  3T4L A;  1VB6 A;  5CX7 A;  3ICY A;  4P85 A;  4X56 A;  1Z09 A;  3QP5 A;  2HF6 A;  3VFF A;  2ZC4 B;  3PBR A;  1P9W A;  3LY3 A;  1YLZ A;  2J3T D;  4S2N A;  5DTT A;  1CEG A;  2XSS A;  2GX5 A;  4QHC A;  3LID A;  2GJ3 A;  4JXS A;  5F5Y A;  3VSL A;  4GJ4 A;  1WE4 A;  4KZ7 A;  3IXG A;  2CMN A;  1ES4 A;  3MF0 A;  4CLC E;  4Q0I A;  3NEC A;  5EVI C;  3PHY A;  2JN7 A;  2EFX A;  3CG5 A;  3S22 A;  4IBR A;  3Q81 A;  4GD6 A;  1BLS A;  4DXB A;  5DTS A;  4Q0H A;  1YLY A;  2FFY A;  3BQA A;  4B4X A;  4X68 A;  2Y2P A;  4GN2 A;  3KYQ A;  3W4P A;  2O0Y A;  2ZQ7 A;  5TBM B;  4DKI A;  4PM6 A;  4KZ5 A;  5I94 A;  1N9L A;  3M6H A;  3BY8 A;  5FEG A;  3C2W A;  1OT9 A;  3V50 A;  4L9G A;  1N9B A;  4KQO A;  4MNR A;  2PU4 A;  5A93 A;  4PHT A;  1RCJ A;  3E0Y A;  3JPU A;  3WRT A;  4KQR A;  2X02 A;  2EWW A;  2XA7 S;  2XFS A;  2FH5 A;  3NUL A;  4MMN A;  2PBY A;  3WS0 A;  1YT4 A;  4IJG A;  3D3O A;  3LEZ A;  2B02 A;  4JLF A;  5HL6 A;  5E2E A;  4ZAM A;  4U3T A;  3KYE A;  1K4E A;  3FV7 A;  3PAE A;  4HI4 A;  1UWN X;  2A49 A;  3ZQ5 A;  1ESU A;  4I38 A;  3CI6 A;  1S67 L;  4IVI A;  2E8I A;  3N8S A;  2W3H A;  2JKR M;  5FEF A;  3MKF A;  1KGG A;  4IVK A;  3IF5 A;  4GS9 B;  1YQS A;  1CK3 A;  5DF8 A;  2PR6 A;  4HP9 A;  1GSX A;  4WEL A;  4XT2 A;  4C6Y A;  4HY8 A;  3CLO A;  1LSW A;  2HDQ A;  4ETZ A;  1ZTU A;  4KG2 A;  1D1J A;  3UPO A;  1N9O A;  3VMA A;  2JKR I;  3R4K A;  1DP6 A;  4MN6 A;  4S2K A;  4EER A;  1JWP A;  4HP4 A;  3CUE A;  4KZB A;  2INW A;  4OH0 A;  1DRM A;  1E4D A;  2IWD A;  3R7W A;  4C75 A;  1GCE A;  4JF5 A;  1K55 A;  4FOF A;  5A90 A;  3SW1 A;  1L2S A;  2NUT C;  4FSF A;  3B33 A;  4XT2 B;  5CHU A;  1FQG A;  4UHU A;  1K57 A;  4JGO A;  1TVF A;  4HEF A;  2ZD8 A;  3LR4 A;  5M1A A;  4KQD A;  5HPF A;  4LCL A;  1PZP A;  4OP8 A;  1UGU A;  4M4X A;  4E3O A;  4OPR A;  4KZA A;  3ZVW A;  3HLD A;  3N4I A;  3FG8 A;  4S2N C;  4QY5 A;  3MXR A;  4Z1W A;  3R7W B;  1WA9 A;  1LT0 A;  2A24 A;  4CQH A;  2ZQ8 A;  5DJT A;  4E3I A;  3FYZ A;  4XXR A;  4HBU A;  1J9M A;  3P98 A;  3EWK A;  3MQ0 A;  3LR5 A;  5FL3 A;  4NKP A;  1C3B A;  3PBO A;  2M1C A;  1IYS A;  4JXG A;  5G4Z A;  3C7U A;  3P09 A;  4FH4 A;  1XXM A;  2BLS A;  4I3J A;  5FQ9 A;  3ZDJ A;  3BFG A;  4E3J A;  3HBR A;  4NXB A;  4Y0U A;  3LI9 A;  2OWJ A;  1D7E A;  1H8Y A;  1L0E A;  3T4T A;  2WGW B;  4BQM A;  1YLP A;  5FAO A;  2W1T A;  1F2K A;  4HBT A;  2WAE A;  1G28 A;  2HP6 A;  5GLA A;  1PFL A;  1MBL A;  3MQO A;  2OV5 A;  1LI0 A;  3SH8 A;  4OOY A;  3WS2 A;  4MBH A; 
#chains in the Genus database with same CATH homology
 4R6L A;  2VV6 A;  2W3F A;  4Y2F A;  3KYZ A;  4MN5 A;  3PBQ A;  1XFN A;  1DP8 A;  2L0W A;  2KLI A;  1XFQ A;  4EET B;  4WEJ A;  5HZH A;  3OCN A;  3IS2 A;  3FPV A;  3F1O B;  3PBN A;  3PXP A;  1ODV A;  4H6J B;  2VGL S;  2PR5 A;  3LIE A;  4HHD A;  2J3T C;  3CIT A;  3CWF A;  4IUK A;  1OTE A;  3BQ8 A;  1XJ2 A;  2D02 A;  4G3K A;  3EOI A;  2W3D A;  4CLC A;  3IBJ A;  3LI8 A;  5DFX A;  2H28 A;  2V1A A;  3B47 A;  3T50 A;  3VE4 A;  2W3G A;  1H3Q A;  2Y8H A;  3S7O A;  2KX6 A;  4O01 A;  2VLG A;  4BBV A;  4P6Z S;  2ZMV A;  2VGL M;  2ZOH A;  3HJI A;  4KUO A;  3A0V A;  2OWH A;  5IU1 A;  1V9Y A;  5KSH A;  1XJ3 A;  3H9W A;  3E4Q A;  2LB5 A;  4GLQ A;  3FC7 A;  3PBT A;  4RQ9 A;  5F6A A;  3H82 A;  1OTI A;  4O8G A;  1UWP X;  5HWT A;  3S7N A;  3BW6 A;  4BBU A;  2JKT M;  1LSX A;  4PKY G;  3NOP C;  3EGD C;  5LBR A;  2PYP A;  2EWV A;  1D06 A;  2HJ9 C;  4JGQ A;  5G4Y A;  5J3W A;  3MMH A;  3UB9 A;  4F3L A;  5K5B A;  4B9O A;  2PD7 A;  4GS9 A;  2Z6D A;  4WL9 A;  1LSV A;  1W63 Q;  5DJU A;  3U2A A;  4BWI A;  3IBR A;  5HD5 A;  3K2N A;  2D01 A;  3CUE C;  4HNB A;  3UE6 A;  3MXQ A;  4YNR A;  2OOL A;  2HJE A;  4R70 A;  2BAS A;  1OJG A;  3HCY A;  2VJW A;  3RH8 B;  2JKT I;  1TD5 A;  3UME A;  2W27 A;  4OOL A;  4YWZ A;  3TRC A;  5AVF A;  4R38 A;  5KIZ A;  3LR3 A;  3UB7 A;  4NXF A;  2I9V A;  3F1N A;  5MC7 A;  2G7U A;  2W1R A;  4WF0 A;  4LRZ E;  4WEK A;  3OCL A;  5AVE A;  5C5K A;  2ZBB A;  4ETX A;  3O5Y A;  2YKH A;  5I5L A;  3T4O A;  2VV8 A;  1JNU A;  2A2L A;  2O99 A;  3A0R A;  1BYW A;  3VOL A;  2GZA A;  4R3A A;  4EXO A;  4G3W A;  2K31 A;  4IHQ A;  1YKD A;  1OTD A;  3LIB A;  2MJ6 A;  2QKP A;  2A24 B;  1XJ4 A;  4BBT A;  3TW8 A;  2FZ0 A;  4QPR A;  2W3E A;  4UQI M;  3T4L A;  1S4S A;  1VB6 A;  1OTA A;  5CX7 A;  5J4E A;  3ICY A;  4I3A A;  2DMW A;  3TJZ C;  2V1B A;  1S1Z A;  1TS0 A;  2HF6 A;  3PBR A;  1P9W A;  3P7N A;  2HV1 A;  3EEA A;  2M7V A;  2J3T D;  3GDI A;  1TS7 A;  2O9A A;  5HSQ A;  3C30 A;  2XSS A;  2GX5 A;  3LUQ A;  3LID A;  2GJ3 A;  4HIA A;  5F5Y A;  2QJ5 A;  4GJ4 A;  4WLA A;  2OAP 1;  2CMN A;  3MF0 A;  3LFV A;  4CLC E;  3B42 A;  3OBF A;  2J80 A;  2WKP A;  4Q0I A;  4Y5F A;  3PHY A;  2JN7 A;  1T1C A;  3KSF A;  3P01 A;  1MKM A;  4NEE D;  3RTY A;  3A0S A;  4Q0H A;  2W1T B;  4GW9 A;  3BY9 A;  3BQA A;  3KX0 X;  3KYQ A;  2B18 A;  4WN5 A;  2O0Y A;  1OT6 A;  2O9C A;  4HQA A;  5TBM B;  2Y79 A;  3UB6 A;  4HJ4 A;  2PT7 A;  3RFB A;  1G6O A;  3KSI A;  1F9I A;  1N9L A;  2VZW A;  2K7S A;  1F98 A;  5F69 A;  3BY8 A;  4GHI A;  1ZHH B;  3C2W A;  2NUP C;  2XRN A;  1LL8 A;  1OT9 A;  3IS2 B;  4L9G A;  4EEU A;  4KQO A;  2PD8 A;  1X0O A;  2PDR A;  4DN0 A;  4EQ1 A;  3D72 A;  4PHT A;  1IOU A;  1XJ6 A;  3E0Y A;  4HH3 A;  3JVV A;  4II7 A;  4CLC B;  2EWW A;  2XA7 S;  4B93 A;  1T1B A;  1NWZ A;  3T4K A;  2FH5 A;  3LYX A;  4MMN A;  4L9E A;  3C8C A;  4IJG A;  1P97 A;  3E4O A;  3D3O A;  1OJ5 A;  3S7P A;  2B02 A;  2PYR A;  4O0P A;  5HL6 A;  4CLC C;  3GEC A;  3NHQ A;  4OOM A;  1Y28 A;  2XA7 M;  4HI4 A;  4DMZ A;  1UWN X;  3HJK A;  4IUH A;  3JVU A;  1P0Z A;  3NOU C;  2PHY A;  3H82 B;  3ZQ5 A;  2QYB A;  4LLO B;  4I38 A;  2L1M A;  2QHK A;  3CI6 A;  4G3V A;  2VV7 A;  2IA2 A;  1S67 L;  1W63 M;  5HWW A;  1F5M A;  3G6O A;  3FPW A;  2GNX A;  1T19 A;  2W3H A;  4UQI S;  1H8M A;  2JKR M;  3NJA A;  3T4J A;  3F1O A;  4F3L B;  3MR0 A;  2V0W A;  2HGV A;  2P08 A;  4GS9 B;  4EW7 A;  4HH2 A;  2ZMF A;  2WKQ A;  3NOT C;  2VEA A;  4MN7 A;  3ZYT A;  3KSH A;  2PR6 A;  4HP9 A;  1GSX A;  4WEL A;  5F68 A;  2XRO A;  4XT2 A;  5A8B A;  4HY8 A;  3C38 A;  3CLO A;  3TE8 A;  4EU0 A;  2VA0 A;  2P04 A;  3UMD A;  5DFY A;  1LSW A;  3E98 A;  1S1Y A;  4HOI A;  3LIA A;  4ETZ A;  4AFI A;  1ZTU A;  5HPI A;  3VE3 A;  1N9O A;  4UEY A;  2QWS A;  4BJP A;  1N9N A;  2J3W A;  2JKR I;  5AJG A;  1DP9 A;  4WUJ A;  3F1P A;  1EW0 A;  3R4K A;  3S7Q A;  1MC0 A;  1DP6 A;  2L4R A;  3MFX A;  4LPZ A;  4MN6 A;  2VX8 A;  4EER A;  2LB9 A;  3OOV A;  3F1N B;  1V9Z A;  1KOU A;  4BMW A;  4HP4 A;  3BWL A;  3CUE A;  1S66 L;  1YSP A;  2V0U A;  2K2N A;  4GCZ A;  3K3C A;  3W2Z A;  2R78 A;  4DJ3 A;  2INW A;  3KSG A;  1DRM A;  3R7W A;  4I39 A;  3UB8 A;  4PKY A;  5HDS A;  1YAX A;  4MDZ A;  4ME4 A;  4Y3I A;  4FOF A;  2W0N A;  3T4S A;  5DKK A;  1MZU A;  1STZ A;  3SW1 A;  3H7W A;  5EFW A;  2NUT C;  4FSF A;  1T18 A;  3B33 A;  2VKS A;  4NXE A;  4XT2 B;  4LRX C;  5DF9 A;  3VV4 A;  3OLO A;  4JGP A;  4Q0J A;  4JGO A;  5HD3 A;  3LR4 A;  4EEP A;  2ZOI A;  4KQD A;  5HPF A;  5HDD A;  4ARZ A;  2QJ7 A;  1UGU A;  4M4X A;  3F1P B;  1TS6 A;  4P6Z M;  1S4R A;  2V9A A;  4KUK A;  4K08 A;  3PR6 A;  1P9R A;  1OTB A;  3FG8 A;  4L9F A;  4CLC D;  1NLZ A;  5L8M A;  4NXG A;  4Z1W A;  3DBA A;  4E04 A;  3R7W B;  1WA9 A;  5IT5 A;  1LT0 A;  5IS1 A;  1GSW A;  2A24 A;  4CQH A;  1NLY A;  5DJT A;  5HWV A;  2WKR A;  2KDK A;  3V67 A;  2OAQ 1;  1TF1 A;  3H7W B;  2M7U A;  3CAX A;  3PBS A;  3EWK A;  3EQU A;  3KO6 A;  3MQ0 A;  3LR5 A;  5FL3 A;  4H6J A;  4NKP A;  4EES A;  1VHM A;  4GHI B;  3PBO A;  3OC2 A;  2M1C A;  4ARZ B;  5G4Z A;  4I3J A;  5TJJ A;  3EGX C;  4HJ3 A;  3T4Q A;  3LIC A;  4NXB A;  5DKL A;  4I5S A;  2O9B A;  4EUV A;  3LI9 A;  2OWJ A;  2EA9 A;  1D7E A;  1YSQ A;  1IFQ A;  2YKF A;  3T4T A;  1OPX A;  3UE3 A;  2W1T A;  5HDC A;  4I3I A;  4HJ6 A;  1NRJ A;  3K3D A;  1G28 A;  1TS8 A;  3LR0 A;  4LRY C;  4DJ2 A;  2P7J A;  4MCW A;  1GSV A;  4YOF A;  3MQQ A;  3BJN A;  3EQV A;  4ZRR A;  3ULF A;  2JHE A;  2KOI A;  3E4P A;  3MQO A;  5TBM A;  2Z6C A;  1T1A A;  4PAU A;  4L0L A;  3PYP A;  3EEH A;  3LIF A;  3MJQ A;  5J7E A;  4JGR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...