4I3BA

Crystal structure of fluorescent protein unag wild type
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
139
structure length
139
Chain Sequence
b'MVEKFVGTWKIADSHNFGEYLKAIGAPKELSDGGDATTPTLYISQKDGDKMTVKIENGPPTFLDTQVKFKLGEEFDEFPSDRRKGVKSVVNLVGEKLVYVQKWDGKETTYVREIKDGKLVVTLTMGDVVAVRSYRRATE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bilirubin-inducible fluorescent protein UnaG
publication title A bilirubin-inducible fluorescent protein from eel muscle
pubmed doi rcsb
source organism Anguilla japonica
molecule tags Fluorescent protein
total genus 33
structure length 139
sequence length 139
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2012-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 4i3bA00
3HWGA 3KFFA 3NPOA 3PEDA 4ZHCA 3CWKA 4NP1A 5IO5A 1A2DA 1FDQA 4QZUA 3U9PC 4TKHA 2MM3A 3CQNA 2WQAE 3BU1A 4TLJA 4Y0PA 2LBAA 1UREA 1X89A 1KZWA 2AT6X 1X8PA 2OVDA 4N7CA 1DFVA 1QY2A 3FIQA 1DC9A 4ODDA 1QY0A 3FLLA 1T68X 2JU8A 1IKJA 3B2IA 3F8AA 1NGLA 3ZUOA 2WUTA 3FA7A 3QKGA 1B8EA 1VYGA 1PM1X 2NNDA 3P6GA 4ZHFA 1GT1A 1ZNGA 2FR3A 2WEXA 1AELA 2JU3A 1EIIA 1LIDA 4A1YA 2G7BA 1JV4A 3I17A 1FEMA 5B27A 5HZQA 2AT3X 4LZVA 1I06A 1GKAA 5LJDA 1SA8A 5LJKA 1KZXA 4XMHA 4GNYA 3RZYA 4HPCA 2RQ0A 1GX8A 5HTEA 3KQ0A 3BDRA 1OEEA 4ORXA 4AW8A 3NX2A 1AB0A 1BBPA 4AZNA 2FLJA 4GKCA 3DSZA 1QG5A 3U03A 2OZQA 2FS7A 1HBPA 3HK1A 3VG5A 3PH6A 3APUA 4RUUA 2R56A 4IB9A 1OEJA 2QM9A 4N7DA 4I9SA 1X8NA 1SXYA 3P6HA 1AQBA 2POAA 3L4RA 4OMWA 3FR5A 3NR3A 4RUNA 1LICA 5EEDA 1CBIA 2WSJA 2DM5A 2Q9SA 5EPQA 2RD7C 1A3YA 3KFGA 4O9SA 1CBSA 1O8VA 1BRPA 4YBUA 3BRNA 1VYFA 3B2KA 3PECA 5C0NA 1JJJA 1GGLA 3WVMA 2YG2A 5BVTA 1JBHA 3D97A 5CE4A 4XMCA 1DV9A 2AL0X 3EMMA 3SAOA 1BSOA 4ORWA 1CBRA 1CBQA 1AVGI 2JU7A 4YMYA 1HMSA 1DZPA 1B4MA 4IB6A 4AZMA 4K19A 5D4AA 4ZHHA 5D8JA 3C76X 4MVIA 1LF7A 5LJEA 3WXQA 4A60A 2HYSA 2MJIA 1E06A 1SY2A 3G7XA 3PH5A 1G5WA 3ZUIA 4OS0A 1KT3A 5F58A 1SXWA 3O22A 3CR6A 2L5PA 4TNNA 3VG2A 3JS1A 2HLVA 3FENA 1ACDA 5L8OA 2XKLA 1P6PA 1BLRA 2X46A 1FENA 1OPBA 5IO6A 1B0OA 1MX8A 1XKIA 2QOSC 2HZRA 5HTDA 2Q2MA 1G74A 4ORSA 1SY1A 4D6AA 1EPBA 2ACPX 1ICMA 1SXXA 1IW2A 3APWA 3FA6A 4MVKA 4R0BA 1X8UA 3VG6A 4ARHA 1SY0A 2JOZA 2W2AA 1D3SA 1ZNDA 1EQDA 4GNWA 3B2LA 1MX7A 5LJBA 1OBPA 1PMPA 2Q4NA 3KZAA 1IFCA 2X45A 4YKMA 1LNMA 4IB7A 4YFQA 4LZUA 1ZNHA 2HMBA 3WJBA 4EFGA 1FTPA 1DZJA 2AMMX 4Y0SA 1U0XA 4EEJA 1HQPA 4NLJA 1A18A 5L8NA 4IAXA 1ALBA 3BU9A 3FR4A 2ANSA 1N0SA 5F7GA 5KICA 3HWEA 1KQXA 5BVSA 3JSQA 1OPAA 3IFBA 3VG4A 2OVAA 2E4JA 3ELZA 4YCEA 1EIOA 2N93A 4HPBA 1BJ7A 5FAZA 4HFOA 1S44A 1CRBA 2W2BA 5F6BA 3WJCA 3EM0A 2OFRX 4WBKA 4ALBA 1EALA 3C77X 3P6EA 4QAEA 1TXLA 3EBWA 1GT4A 4ES7A 1MDCA 5DPQA 4A8ZA 1S7DA 3FA8A 5D48A 4EXZA 2FS6A 1ADLA 4A1HA 1YWDA 2W2FA 2FT9A 2NNQA 1XCAA 2ACOA 5HCDC 3NQ9A 3TZSA 4YGZA 4AZPA 4LKPA 3WJGA 3P6CA 2L67A 4GETA 4YGGA 2NP1A 4TQ2A 1BWYA 2CBSA 3BY0A 1B56A 2CM4A 1PEEA 3D96A 3P6FA 4NNTA 5EDBA 4CK4A 4WFVA 1S2PA 3FEKA 1BSYA 3NP1A 5DG4A 5H9AA 1MVGA 4OS8A 5HA1A 3BS2A 2CM9A 5H9KA 5LKEA 4GH7A 2LFOA 3WJFA 1E5PA 1E00A 4ZFXA 2EU7X 2FRSA 3C78X 5AQ6A 1ML7A 5H9NA 1MUPA 3VG7A 1FELA 1IIUA 2G78A 3EYCA 4ZCBA 1U17A 2R73A 1G7NA 2HNXA 3FMZA 4MVLA 1YUPA 1GX9A 4XMFA 3UEUA 4IBAA 4QGXA 3T1DA 2ASNX 3STMX 1E02A 4Y0QA 3CBCA 3FR2A 1BEBA 4AYHA 5D45A 1TVQA 1CJ5A 2F73A 1ICNA 3PPTA 2GTFX 4ZGUA 3TGBA 2RCQA 1LIFA 4QGWA 3FA9A 2WWPA 1HN2A 1A57A 1KOIA 1LPJA 1YWAA 1QQSA 1QY1A 1EXSA 1GKAB 1PBOA 2AKQA 1GT3A 2CBRA 4GE1A 4IMNA 5HCCC 4YKOA 5KHPA 2A3FX 1ZNEA 2A2GA 1QABE 2AT0X 5KIDA 5HAEA 1YWCA 2AT8X 4M6SA 3FW5A 1YP6A 4YH0A 2WEWA 5F6ZA 1JYDA 3NX1A 5IO7A 1TOUA 1ERBA 4D6BA 3ZQ3A 3NADA 2OVEA 3PP6A 3CBSA 5HA0A 3HWDA 5HZ9A 2LBVA 2ALLX 3AKNA 1X8QA 5EEEA 4YBPA 1KXOA 1JJXA 1ZRYA 4ORRA 1GM6A 2O62A 1KT6A 2GC9A 4Y0RA 5EZ2A 1LIEA 4YGHA 2XSTA 1O1VA 2PY1A 4TKBA 3UEVA 1GXAA 4TKJA 1TOWA 4AZOA 4ORUA 1R0UA 3MBTA 5LJCA 5HCEC 4KIIA 4NYQA 1LFOA 5HZ5A 5HZ8A 4XMDA 3TF6A 2WR6A 4ZHDA 4I3DA 4ORYA 4WFUA 1BM5A 4XMGA 2RA6A 4YDAA 5B29A 3VG3A 4BOEA 1EUOA 2R74A 1I05A 2L68A 3STKA 3O19A 1YIVA 2CZTA 1TW4A 1JYJA 5FFHA 1LIBA 5K06A 5HZ6A 4PSQA 2Q39A 1ZNLA 5L8IA 3BLGA 1IKEA 1X8OA 2LKKA 4IB8A 4M7MA 3RSWA 1SXUA 2A0AA 5HWZA 3WJDA 4ZH9A 1QFTA 4HPAA 1HMTA 1T8VA 3EBKA 5EDCA 5BVQA 2KTDA 4BVMA 2BLGA 5D47A 1U18A 5LKFA 1DZMA 1RBPA 4ZR2A 1QFVA 2A13A 2HZQA 1KT5A 4QYNA 4QGVA 1ERXA 1O1UA 2NNEA 3FELA 3KFIA 3F9DA 3MVFA 1T0VA 4GRJA 4YFRA 4DQ3A 1KT4A 2L9CA 1UZ2X 2LB6A 5H8TA 3I0AA 1YWBA 2A2UA 2Q2PA 1HBQA 3AKMA 4AZRA 1HMRA 2CZUA 4OMXA 5HBSA 3FW4A 1GT5A 4I3BA 1QWDA 2K23A 2AH7X 1D2UA 3BX8A 4NLIA 1BSQA 1BRQA 1OEKA 4DQ4A 3DTQA 4QZTA 2FR2A 3IA8A 3FEPA 1H91A 1DZKA 2IFBA 5JR8A 3S26A 2JN3A 4YCHA 2GJ5A 4OS3A 4UU3A 4I3CA 1EPAA 3CMPA 1L6MA 4EDEA 2MO5A 2QO6A 5LJHA 1JZUA 4YDBA 4IAWA 2G79A 5FENA 3TGCA 3APXA 5LJGA 1OBQA 2FTBA 4XMEA 1DF3A 3K3LA 1KT7A 3UEWA 4TJZA 3WBGA 1IFBA 2QO5A 3STNA 3TGAA 1Z24A 2K62A 3HWFA 3B2JA 2FWVA 4NNSA 3O2YA 5F1EA 4I9RA 4ZHGA 4LKTA 3BX7A 4BQUA 3Q6LA 4NYRA 3WJEA 1I04A 3KFHA 1OBUA 3D95A 1SY3A 3ELXA 2KT4B 1I4UA 4IMOA 3NQ3A 2QO4A 1G85A 4AZQA 4ZJ0A 1FE3A 1LKEA 2P8GA 3BSZE 3GAQA 3P6DA 5H9LA 3UEXA 1EW3A 2RCTA 1VPRA 3OJYC 3APVA 4UU2A 2WQ9A 4YFPA 4QYPA 4ALOA 1RLBE 2OFMX 1NP1A 1KGLA 1YP7A 1ZNKA 3B2HA 1NP4A 3CQRA 3U0DA 4HPDA 2AT5X 4ZH6A 1KQWA 1X71A
chains in the Genus database with same CATH superfamily
1UYNX 3OD9A 5B11O 3HWGA 3KFFA 1LUQA 3NPOA 3PEDA 4ZHCA 4GJSA 3CWKA 4NP1A 5IO5A 1A2DA 2LA7A 1FDQA 4QZUA 3U9PC 4BX5B 4TKHA 4BX6B 3RE5A 2FKGA 2MM3A 3CQNA 3WZPA 2WQAE 3BU1A 4TLJA 4Y0PA 2LBAA 2FHNX 1UREA 1X89A 2OY1O 2AT6X 1KZWA 1X8PA 2FGSA 2OVDA 4N7CA 1DFVA 1QY2A 2RTMA 3CKFA 3FIQA 1DC9A 4FBVA 4ML7B 4ODDA 4BBOA 1QY0A 3FLLA 4IRWA 1T68X 2JU8A 4ON1A 5B5GA 3WZQA 4KT5A 1IKJA 3B2IA 3F8AA 1SWKA 1SWSA 1NGLA 3LV4A 3RDSA 3X00A 2QMIA 2WUTA 3FA7A 3PQUA 3ZUOA 3QKGA 1B8EA 3SLTA 4DNEA 1VYGA 1RAVA 2RTHB 3LTWA 1PM1X 2NNDA 3P6GA 4L1NA 4ZHFA 2OY7A 1GT1A 1ZNGA 2FR3A 2WEXA 3ZW0A 2JU3A 4ID2A 1AELA 1LIDA 1EIIA 2X32A 4A1YA 2G7BA 1JV4A 3I17A 1FEMA 5B27A 5HZQA 2G8CO 2AT3X 2AF5A 4LZVA 1Y9TA 4CSBA 4MISA 1MOYA 1I06A 1GKAA 5LJDA 1SA8A 1SRJA 5LJKA 1KZXA 4XMHA 4GU8A 4GNYA 3RZYA 3SZHA 4HPCA 3SLJA 1FJ1E 4Z6JA 2RQ0A 1GX8A 3E3CA 2IZCB 5HTEA 2OYBO 3KQ0A 3BDRA 1OEEA 1VWDB 4ORXA 1SWUA 5AJBA 4AW8A 5B5FA 4KH8A 3NX2A 1AB0A 1BBPA 4AZNA 2RTJA 4I6SA 2FLJA 4GGTA 4GKCA 5AJCA 4O3XB 3DSZA 1N9MA 1QG5A 3U03A 2OZQA 2ZAGA 2FS7A 1HBPA 3HK1A 3VG5A 3PH6A 3APUA 4RUUA 1KL5A 5IRUA 5IRAA 1UYOX 2R56A 2F09A 4IB9A 1OEJA 2QM9A 4N7DA 4YVBA 2BT9A 4I9SA 1X8NA 1SXYA 3P6HA 2RTOB 1AQBA 1PTSA 2OF8A 2POAA 1AVDA 3FR5A 3L4RA 3NR3A 4OMWA 4RUNA 1SWQA 1LICA 4GK9A 1CBIA 2WSJA 2DM5A 2Q9SA 2VFCA 2RD7C 5EEDA 5EPQA 2MWHA 1A3YA 3KFGA 4O9SA 5FQ7E 3VHMA 1SWEA 1CBSA 1O8VA 2BC3A 1BRPA 4YBUA 3FDCA 3BRNA 1VYFA 3B2KA 3PECA 2X55A 5C0NA 5IXGA 1JJJA 1GGLA 2WPUA 3WVMA 2YG2A 5BVTA 1JBHA 1STRB 1DF8A 3D97A 5CE4A 1SWBA 4XMCA 5CHKA 1DV9A 2AL0X 4BGFA 3EMMA 3SAOA 1BSOA 4ORWA 1CBRA 1CBQA 1AVGI 1GX3A 2JU7A 3CKGA 4O4SA 1HMSA 3SZIA 4BX6A 4YMYA 3WYPA 4CDCA 1DZPA 1B4MA 4IB6A 4O3WA 4AZMA 4K19A 5D4AA 3WZOA 4ZHHA 5D8JA 2X8SA 3C76X 2A5CA 4MVIA 1LF7A 1N9YA 5LJEA 1SRFA 3WXQA 1I78A 2HYSA 4A60A 2MJIA 3EW2A 1E06A 1SY2A 3G7XA 3PH5A 4HWMA 4OKAA 3ZUIA 4CPHB 1G5WA 4OS0A 1KT3A 5F58A 3RDOA 1SXWA 5HTDA 3S60A 2BSZA 1STSB 3O22A 3CR6A 2L5PA 1RXKA 2IZBA 4TNNA 1VWFB 2RTAA 1SREA 3JS1A 3MM0A 3VG2A 2HLVA 3FENA 1ACDA 1SWPA 3LHNA 3ZW1B 5L8OA 2XKLA 1P6PA 1BLRA 2X46A 1FENA 1OPBA 5AEOA 1B0OA 1MX8A 1XKIA 5IO6A 2QOSC 2HZRA 2Y3FA 1Y9LA 2Q2MA 3EC5A 1G74A 1NDJA 1SY1A 2KW1A 4L3RA 4ORSA 1E2TA 4D6AA 1EPBA 2ACPX 1ICMA 1SXXA 1IW2A 3APWA 3FA6A 4MVKA 2Z4HA 4R0BA 4U8UM 1X8UA 3RWXA 3VG6A 3D9WA 2A5BA 4FBOA 4ARHA 1SY0A 2JOZA 2W2AA 1D3SA 1ZNDA 5FQ6E 1EQDA 4GNWA 1RSTB 3B2LA 1MX7A 2RTIB 5LJBA 1OBPA 2X8FA 1PMPA 3ZW2A 1SMPI 2Q4NA 2PI3O 2RTPB 3D4RA 2RTQB 3KZAA 1IFCA 4NV7A 2X45A 1HXZA 4YKMA 1LNMA 4IB7A 4YFQA 4CPFA 4LZUA 1ZNHA 1SWGA 2HMBA 3WJBA 4EFGA 1FTPA 3MG5A 1DZJA 2AMMX 4Y0SA 1U0XA 3NBXX 4EEJA 2X8TA 4BCSA 1HQPA 4NLJA 2IZLB 3AEHA 1A18A 5L8NA 4IAXA 1ALBA 2KTSA 2RTGB 3BU9A 1Y0GA 3FR4A 4O3ZA 2ANSA 4Z2PA 1N0SA 1SLDB 5F7GA 5KICA 4GDZA 3RKGA 3HWEA 5F2BA 1KQXA 5BVSA 4Z27A 1JMXA 2RTLA 2JW1A 3JSQA 1OSPO 1OPAA 4QQ1A 3IFBA 3VG4A 2OVAA 3WYQA 2E4JA 2AVIA 2Y32A 3ELZA 4YCEA 1EIOA 3QQ2A 3T2XA 2N93A 4HPBA 1BJ7A 5FAZA 2G5LA 4HFOA 1S44A 1CRBA 2IZHB 4B55A 2OFBA 2W2BA 5F6BA 3SZJA 3WJCA 3EM0A 1W4TA 4OEMA 3Q34A 2OFRX 4WBKA 4ALBA 1EALA 3C77X 3P6EA 4QAEA 1TXLA 4GGRA 3EBWA 4LQZA 1GT4A 4ES7A 1MDCA 5DPQA 4A8ZA 1S7DA 2X56A 3FA8A 5D48A 2FS6A 1HXLA 4EXZA 5K67A 2IZJA 2GTLO 2OVSA 2VDFA 1ADLA 4A1HA 1YWDA 2W2FA 2FT9A 2NNQA 2IZGB 1VWNB 1XCAA 2ACOA 3UAQA 5HCDC 1KFFA 3NQ9A 3TZSA 4YGZA 4AZPA 4LKPA 1NQMA 3WJGA 3P6CA 2L67A 4GETA 4QRLA 4YGGA 3RDQA 2NP1A 4TQ2A 1BWYA 4WHIA 2CBSA 3BY0A 1B56A 2CM4A 1PEEA 3D96A 3P6FA 4NNTA 5EDBA 3ZW1A 2IZDB 4CK4A 4WFVA 1S2PA 3FEKA 1BSYA 3ZZVA 3EW1A 3NP1A 5DG4A 5H9AA 1MK5A 1MVGA 5B10O 2GTLM 3P24A 4OS8A 5HA1A 2RTNB 1W5RA 3BS2A 2CM9A 5H9KA 5LKEA 4GH7A 2LFOA 3WJFA 1E5PA 1E00A 4ZFXA 2EU7X 1RXHA 4ZGFA 3FIDA 2FRSA 4BJ8A 2BHVA 3C78X 5AQ6A 2OL8O 1ML7A 4DCBA 1HQQA 5H9NA 1MUPA 3VG7A 1FELA 1K24A 1IIUA 2G78A 3EYCA 4ZCBA 1U17A 4O4OA 1VWKB 3OBLA 4O49A 2IZFB 1HY2A 1SWRA 2C1SA 2R73A 3T6LA 4BX5A 1G7NA 1SWHA 2HNXA 3FMZA 3RDUA 4MVLA 4CPIA 1YUPA 1GX9A 4XMFA 3UEUA 4IBAA 4Z28A 4QGXA 5FQ8E 2ASNX 2RTBB 3T1DA 1NQNA 3STMX 1E02A 4Y0QA 2RTEB 5CYBA 3CBCA 3FR2A 1BEBA 4PJ2A 3VHHA 4AYHA 1VWRB 4U46A 5D45A 4GGZA 1TVQA 1CJ5A 1RXJA 2F73A 1ICNA 3PPTA 1JMZA 2GTFX 4ZGUA 3TGBA 2RCQA 1LIFA 2QOMA 4FGIB 3HOLA 4QGWA 3FA9A 2WWPA 1HN2A 3ZI8A 1A57A 1KOIA 1LPJA 1YWAA 1QQSA 1QY1A 1SLEB 3PDFA 3RE6A 4CV7A 1EXSA 1GKAB 1PBOA 1VWLB 1GT3A 2AKQA 2CBRA 4GE1A 4IMNA 4KC7A 3RDMA 5HCCC 2DJGA 4Y5DA 4YKOA 5KHPA 1NC9A 2A3FX 1ZNEA 2A2GA 2OF9A 2OL6O 4I60A 4OELA 1QABE 2AT0X 5KIDA 5HAEA 1VWGB 1YWCA 3HTYA 1LDQA 5CSEA 2AT8X 2I5ZO 3SLOA 2JGSA 2DJFA 3AUMO 4M6SA 2CAMA 3FW5A 1YP6A 4YH0A 1SWFA 2WEWA 5F6ZA 1JYDA 3NX1A 5IO7A 1TOUA 1ERBA 4JNJA 4D6BA 3ZQ3A 3NADA 2UZ2A 2OVEA 1SWJA 2IZEB 3CBSA 3PP6A 3PQSA 3HWDA 1LDOA 5HA0A 2LBVA 5HZ9A 2ALLX 3AKNA 1X8QA 5EEEA 3VPJE 4U8UN 3WZNA 1KXOA 1PBYA 4YBPA 1JJXA 3RY1A 1ZRYA 3VU1A 2IZKA 1EI5A 1SLFB 4ORRA 3PK2A 1N7YA 2HKDA 1K3BA 1GM6A 1SWAA 2O62A 1SRHA 1KT6A 2RTRB 2GC9A 2RTFB 4CPEA 1SWDA 3NQKA 4Y0RA 1SWOA 5EZ2A 2FKJA 1LIEA 2OL7A 2OFAA 4FBRA 4YGHA 1VWOB 2XSTA 1O1VA 1SRIA 1W6FA 2PY1A 4TKBA 3UEVA 1VWEB 1KL3A 1Y53X 1GXAA 4TKJA 5B2AO 2M4LA 1TOWA 5K68A 4AZOA 1MM9A 4NV8A 1LCWA 4ORUA 1R0UA 3MBTA 4U9CA 4BX7B 2KD2A 5HCEC 4KIIA 5LJCA 4NYQA 1LFOA 1Y55X 2C1QA 5HZ5A 5HZ8A 4XMDA 5IRWA 3TF6A 1JIWI 2WR6A 3T6FA 4ZHDA 4I3DA 4MVEA 1JQPA 2OY5O 5L3YA 2FHLA 2BS6A 4ORYA 4WFUA 1BM5A 2ZSCA 4MEEA 4XMGA 3VE1A 2RA6A 4YDAA 5B29A 2Y3EA 3MX7A 3VG3A 2X34A 4BOEA 3JQOA 2OY8A 1EUOA 2R74A 3OE3A 4CDDA 2IZIA 1I05A 1VWCB 2L68A 3STKA 1Y52X 2RTDB 3GE2A 3O19A 3T2WA 1YIVA 2CZTA 4MIRA 1TW4A 1JYJA 5FFHA 1LIBA 4CDFA 5K06A 5HZ6A 4PSQA 2Q39A 1SWLA 1ZNLA 5L8IA 1AVEA 3BLGA 1IKEA 1N43A 1X8OA 2LKKA 4IB8A 4M7MA 4GJVA 3RSWA 4CPHA 1SXUA 2A0AA 5HWZA 3WJDA 1VYOA 4ZH9A 1QFTA 3F6ZB 4HPAA 2YMSA 1SLGB 1SWCA 1HMTA 1T8VA 3EBKA 5EDCA 5B3MO 5BVQA 4EQAC 5BYPA 1SWNA 2A8GA 2KTDA 4KC8A 4BVMA 2BLGA 4KCAA 5D47A 1U18A 5LKFA 1DZMA 1RBPA 4ZR2A 1N4JA 1QFVA 2A13A 2HZQA 1VWMB 1KT5A 3RBYA 3FYFA 1WBIA 3P02A 4QYNA 4QGVA 1VWIB 1ERXA 1O1UA 3RDXA 2NNEA 3FELA 2JMBA 1LCVA 3KFIA 3H3IA 3F9DA 3MVFA 1T0VA 4GRJA 4YFRA 4O4XA 3VGWA 4DQ3A 1KT4A 2L9CA 1UZ2X 2LB6A 2I5VO 5H8TA 2IZAA 3I0AA 4EKVA 2MF6A 4COTA 1YWBA 2A2UA 3N91A 4I95A 1HBQA 2Q2PA 3AKMA 5JD2A 4AZRA 1HMRA 2GTLN 4QNIA 2CZUA 4OMXA 5HBSA 3FW4A 1GT5A 4FQBB 1QWDA 4I3BA 3RY2A 2K23A 4O4UA 4Z2OA 2AH7X 1LELA 4INNA 1D2UA 1IJ8A 3BX8A 4NLIA 1BSQA 1SWTA 1BRQA 1OEKA 4GD9A 1I9HA 4DQ4A 3DTQA 4QZTA 2FR2A 3IA8A 4JHQA 3FEPA 1H91A 1DZKA 1VWQB 2IFBA 2RTCB 5JR8A 4GZVA 3S26A 2JN3A 4YCHA 4C5PA 2GJ5A 4OS3A 4UU3A 4U3QA 4I3CA 1EPAA 4NW4A 3ZW0B 4BX7A 3HPEA 1NBXA 3CMPA 1L6MA 4GUZA 4JGLA 2Z4IA 4EDEA 2MO5A 2QO6A 5LJHA 1JZUA 1STPA 4JO6A 4YDBA 1VWAB 2VFBA 4IAWA 2G79A 3SOTA 5FENA 3TGCA 3APXA 5LJGA 1OBQA 2FTBA 1RSUB 4XMEA 1DF3A 4CDEA 2MHDA 3K3LA 1KT7A 2RTKA 3UEWA 1MEPA 4TJZA 3ZWEA 1WUBA 2ZAIA 3WBGA 1IFBA 2QO5A 3STNA 3TGAA 1VWJB 1Z24A 2K62A 2C4IA 2RN4A 3HWFA 3B2JA 2FWVA 4U8UO 3S5VA 3V8UA 3VHIA 4NNSA 2GH7A 3O2YA 5F1EA 4I9RA 4ZHGA 4LKTA 3BX7A 1LCZA 3Q6LA 4NYRA 3WJEA 3WOVA 1I04A 4BQUA 3KFHA 4IABA 1OBUA 3D95A 1SY3A 3ELXA 2KT4B 1I4UA 4IMOA 3NQ3A 2QO4A 1G85A 3HOEA 4AZQA 1JJUA 4ZJ0A 2X4MA 1FE3A 1LKEA 2P8GA 2UYWA 3BSZE 3GAQA 3KVNA 3P6DA 5H9LA 4GDAA 1KL4A 2F01A 3UEXA 1VWBB 1EW3A 2RCTA 3VE2A 4Y59A 4Z2VA 1VPRA 3OJYC 3APVA 2BS5A 1VWPB 4UU2A 2WQ9A 4YFPA 4QYPA 4ALOA 1RLBE 1SRGA 2OFMX 1NP1A 1KGLA 1YP7A 1ZNKA 3B2HA 1NP4A 3CQRA 3U0DA 2QCBA 1VWHB 4HPDA 4O3YA 2AT5X 4ZH6A 1KQWA 3S5XA 1X71A
chains in the Genus database with same CATH topology
3OD9A 3HWGA 3KFFA 3NPOA 3PEDA 4ZHCA 3CWKA 4NP1A 5IO5A 1A2DA 2LA7A 1FDQA 4QZUA 3U9PC 4TKHA 2MM3A 3CQNA 2WQAE 3BU1A 4TLJA 4Y0PA 2LBAA 1UREA 1X89A 1KZWA 2AT6X 1X8PA 2OVDA 4N7CA 1DFVA 1QY2A 4FBVA 3FIQA 1DC9A 4ODDA 1QY0A 3FLLA 4ON1A 1T68X 2JU8A 4KT5A 1IKJA 3B2IA 3F8AA 3LV4A 1NGLA 2QMIA 2WUTA 3FA7A 3PQUA 3ZUOA 3QKGA 1B8EA 1VYGA 1PM1X 2NNDA 3P6GA 4L1NA 4ZHFA 1GT1A 1ZNGA 2FR3A 2WEXA 3ZW0A 2JU3A 4ID2A 1AELA 1LIDA 1EIIA 4A1YA 2G7BA 1JV4A 3I17A 1FEMA 5B27A 5HZQA 2AT3X 4LZVA 1Y9TA 4CSBA 4MISA 1I06A 1GKAA 5LJDA 1SA8A 5LJKA 1KZXA 4XMHA 4GU8A 4GNYA 3RZYA 4HPCA 2RQ0A 1GX8A 3E3CA 5HTEA 3KQ0A 3BDRA 1OEEA 4ORXA 5AJBA 4AW8A 4KH8A 3NX2A 1AB0A 1BBPA 4AZNA 4I6SA 2FLJA 4GKCA 5AJCA 4O3XB 3DSZA 1QG5A 3U03A 2OZQA 2ZAGA 2FS7A 1HBPA 3HK1A 3VG5A 3PH6A 3APUA 4RUUA 2R56A 2F09A 4IB9A 1OEJA 2QM9A 4N7DA 2BT9A 4I9SA 1X8NA 1SXYA 3P6HA 1AQBA 2POAA 3L4RA 4OMWA 3FR5A 3NR3A 4RUNA 1LICA 4GK9A 1CBIA 2WSJA 2DM5A 2Q9SA 5EEDA 2RD7C 5EPQA 3ZZVA 2MWHA 1A3YA 3KFGA 4O9SA 5FQ7E 1CBSA 1O8VA 1BRPA 4YBUA 3BRNA 1VYFA 3B2KA 3PECA 5C0NA 1JJJA 1GGLA 3WVMA 2YG2A 5BVTA 1JBHA 3D97A 5CE4A 4XMCA 1DV9A 2AL0X 3EMMA 3SAOA 1BSOA 4ORWA 1CBRA 1CBQA 1AVGI 2JU7A 4O4SA 4YMYA 1HMSA 1DZPA 1B4MA 4IB6A 4O3WA 4AZMA 4K19A 5D4AA 4ZHHA 5D8JA 2X8SA 3C76X 4MVIA 1LF7A 5LJEA 3WXQA 4A60A 2HYSA 2MJIA 1E06A 1SY2A 3G7XA 3PH5A 4HWMA 1G5WA 3ZUIA 4OS0A 1KT3A 5F58A 1SXWA 3S60A 3O22A 3CR6A 2L5PA 4TNNA 3VG2A 3JS1A 3ZW1B 2HLVA 3FENA 1ACDA 3LHNA 5L8OA 2XKLA 1P6PA 1BLRA 2X46A 1FENA 1OPBA 5AEOA 1B0OA 1MX8A 1XKIA 5IO6A 2QOSC 2HZRA 5HTDA 1Y9LA 2Q2MA 4L3RA 1G74A 2KW1A 1SY1A 4ORSA 4D6AA 1EPBA 2ACPX 1ICMA 1SXXA 1IW2A 3APWA 3FA6A 4MVKA 2Z4HA 4R0BA 4U8UM 1X8UA 3RWXA 3VG6A 4FBOA 4ARHA 1SY0A 2JOZA 2W2AA 1D3SA 1ZNDA 5FQ6E 1EQDA 4GNWA 3B2LA 1MX7A 5LJBA 1OBPA 2X8FA 1PMPA 3ZW2A 1SMPI 2Q4NA 3D4RA 3KZAA 1IFCA 2X45A 4YKMA 1LNMA 4IB7A 4YFQA 4LZUA 1ZNHA 2HMBA 3WJBA 4EFGA 1FTPA 1DZJA 2AMMX 4Y0SA 1U0XA 3NBXX 4EEJA 2X8TA 1HQPA 4NLJA 1A18A 5L8NA 4IAXA 1ALBA 2KTSA 3BU9A 3FR4A 4O3ZA 2ANSA 1N0SA 5F7GA 5KICA 4GDZA 3RKGA 3HWEA 1KQXA 5BVSA 3JSQA 2JW1A 1OPAA 4QQ1A 3IFBA 3VG4A 2OVAA 2E4JA 3ELZA 4YCEA 1EIOA 2N93A 4HPBA 1BJ7A 5FAZA 4HFOA 1S44A 1CRBA 2W2BA 5F6BA 3WJCA 3EM0A 2OFRX 4WBKA 4ALBA 1EALA 3C77X 3P6EA 4QAEA 1TXLA 3EBWA 4LQZA 1GT4A 4ES7A 1MDCA 5DPQA 4A8ZA 1S7DA 3FA8A 5D48A 4EXZA 2FS6A 2GTLO 2OVSA 1ADLA 4A1HA 1YWDA 2W2FA 2FT9A 2NNQA 1XCAA 2ACOA 3UAQA 5HCDC 3NQ9A 3TZSA 4YGZA 4AZPA 4LKPA 3WJGA 3P6CA 2L67A 4GETA 4QRLA 4YGGA 2NP1A 4TQ2A 1BWYA 4WHIA 2CBSA 3BY0A 1B56A 2CM4A 1PEEA 3D96A 3P6FA 4NNTA 5EDBA 3ZW1A 4CK4A 4WFVA 1S2PA 3FEKA 1BSYA 3NP1A 5DG4A 5H9AA 1MVGA 2GTLM 3P24A 4OS8A 5HA1A 3BS2A 2CM9A 5H9KA 5LKEA 4GH7A 2LFOA 3WJFA 1E5PA 1E00A 4ZFXA 2EU7X 4ZGFA 2FRSA 2BHVA 3C78X 5AQ6A 1ML7A 5H9NA 1MUPA 3VG7A 1FELA 1IIUA 2G78A 3EYCA 4ZCBA 1U17A 4O4OA 3OBLA 4O49A 2R73A 1G7NA 2HNXA 3FMZA 4MVLA 1YUPA 1GX9A 4XMFA 3UEUA 4IBAA 4QGXA 5FQ8E 2ASNX 3T1DA 3STMX 1E02A 4Y0QA 5CYBA 3CBCA 3FR2A 1BEBA 4PJ2A 4AYHA 5D45A 1TVQA 1CJ5A 2F73A 1ICNA 3PPTA 2GTFX 4ZGUA 3TGBA 2RCQA 1LIFA 4FGIB 3HOLA 4QGWA 3FA9A 2WWPA 1HN2A 3ZI8A 1A57A 1KOIA 1LPJA 1YWAA 1QQSA 1QY1A 4CV7A 1EXSA 1GKAB 1PBOA 2AKQA 1GT3A 2CBRA 4GE1A 4IMNA 4KC7A 4ML7B 5HCCC 4YKOA 5KHPA 2A3FX 1ZNEA 2A2GA 1QABE 2AT0X 5KIDA 5HAEA 1YWCA 3HTYA 2AT8X 4M6SA 3FW5A 1YP6A 4YH0A 2WEWA 5F6ZA 1JYDA 3NX1A 5IO7A 1TOUA 1ERBA 4D6BA 3ZQ3A 3NADA 2OVEA 3PP6A 3CBSA 3PQSA 5HA0A 3HWDA 5HZ9A 2LBVA 2ALLX 3AKNA 1X8QA 5EEEA 3VPJE 4U8UN 4YBPA 1KXOA 1JJXA 1ZRYA 3VU1A 1EI5A 4ORRA 1GM6A 2O62A 1KT6A 2GC9A 3NQKA 4Y0RA 5EZ2A 1LIEA 4FBRA 4YGHA 2XSTA 1O1VA 2PY1A 4TKBA 3UEVA 1GXAA 4TKJA 2M4LA 1TOWA 4AZOA 4U9CA 4ORUA 1R0UA 3MBTA 5LJCA 2KD2A 5HCEC 4KIIA 4NYQA 1LFOA 5HZ5A 5HZ8A 4XMDA 3TF6A 1JIWI 2WR6A 4ZHDA 4I3DA 4MVEA 2BS6A 4ORYA 4WFUA 1BM5A 4XMGA 3VE1A 2RA6A 4YDAA 5B29A 3MX7A 3VG3A 4BOEA 3JQOA 1EUOA 2R74A 3OE3A 1I05A 2L68A 3STKA 3GE2A 3O19A 1YIVA 2CZTA 4MIRA 1TW4A 1JYJA 5FFHA 1LIBA 5K06A 5HZ6A 4PSQA 2Q39A 1ZNLA 5L8IA 3BLGA 1IKEA 1X8OA 2LKKA 4IB8A 4M7MA 3RSWA 1SXUA 2A0AA 5HWZA 3WJDA 4ZH9A 1QFTA 3F6ZB 4HPAA 2YMSA 1HMTA 1T8VA 3EBKA 5EDCA 5BVQA 4EQAC 5BYPA 2KTDA 4KC8A 4BVMA 2BLGA 4KCAA 5D47A 1U18A 5LKFA 1DZMA 1RBPA 4ZR2A 1QFVA 2A13A 2HZQA 1KT5A 3RBYA 3FYFA 3P02A 4QYNA 4QGVA 1ERXA 1O1UA 2NNEA 3FELA 2JMBA 3KFIA 3H3IA 3F9DA 3MVFA 1T0VA 4GRJA 4YFRA 4O4XA 4DQ3A 1KT4A 2L9CA 1UZ2X 2LB6A 5H8TA 3I0AA 4COTA 1YWBA 2A2UA 3N91A 4I95A 1HBQA 2Q2PA 3AKMA 4AZRA 1HMRA 2GTLN 4QNIA 2CZUA 4OMXA 5HBSA 3FW4A 1GT5A 4FQBB 1QWDA 4I3BA 2K23A 4O4UA 2AH7X 4INNA 1D2UA 3BX8A 4NLIA 1BSQA 1BRQA 1OEKA 4DQ4A 3DTQA 4QZTA 2FR2A 3IA8A 3FEPA 1H91A 1DZKA 2IFBA 5JR8A 4GZVA 3S26A 2JN3A 4YCHA 2GJ5A 4OS3A 4UU3A 4U3QA 4I3CA 1EPAA 4NW4A 3ZW0B 3CMPA 1L6MA 4EDEA 4JGLA 2Z4IA 2MO5A 2QO6A 5LJHA 1JZUA 4YDBA 4IAWA 2G79A 3SOTA 5FENA 3TGCA 3APXA 5LJGA 1OBQA 2FTBA 4XMEA 1DF3A 2MHDA 3K3LA 1KT7A 3UEWA 4TJZA 3ZWEA 2ZAIA 3WBGA 1IFBA 2QO5A 3STNA 3TGAA 1Z24A 2K62A 2RN4A 3HWFA 3B2JA 2FWVA 4U8UO 3S5VA 3V8UA 4NNSA 3O2YA 5F1EA 4I9RA 4ZHGA 4LKTA 3BX7A 4BQUA 3Q6LA 4NYRA 3WJEA 3WOVA 1I04A 3KFHA 4IABA 1OBUA 3D95A 1SY3A 3ELXA 2KT4B 1I4UA 4IMOA 3NQ3A 2QO4A 1G85A 3HOEA 4AZQA 4ZJ0A 1FE3A 1LKEA 2P8GA 3BSZE 3GAQA 3P6DA 5H9LA 3UEXA 1EW3A 2RCTA 3VE2A 1VPRA 3OJYC 3APVA 2BS5A 4UU2A 2WQ9A 4YFPA 4QYPA 4ALOA 1RLBE 2OFMX 1NP1A 1KGLA 1YP7A 1ZNKA 3B2HA 1NP4A 3CQRA 3U0DA 4HPDA 4O3YA 2AT5X 4ZH6A 1KQWA 3S5XA 1X71A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HWG A;  3KFF A;  3NPO A;  3PED A;  4ZHC A;  3CWK A;  4NP1 A;  5IO5 A;  1A2D A;  1FDQ A;  4QZU A;  3U9P C;  4TKH A;  2MM3 A;  3CQN A;  2WQA E;  3BU1 A;  4TLJ A;  4Y0P A;  2LBA A;  1URE A;  1X89 A;  1KZW A;  2AT6 X;  1X8P A;  2OVD A;  4N7C A;  1DFV A;  1QY2 A;  3FIQ A;  1DC9 A;  4ODD A;  1QY0 A;  3FLL A;  1T68 X;  2JU8 A;  1IKJ A;  3B2I A;  3F8A A;  1NGL A;  3ZUO A;  2WUT A;  3FA7 A;  3QKG A;  1B8E A;  1VYG A;  1PM1 X;  2NND A;  3P6G A;  4ZHF A;  1GT1 A;  1ZNG A;  2FR3 A;  2WEX A;  1AEL A;  2JU3 A;  1EII A;  1LID A;  4A1Y A;  2G7B A;  1JV4 A;  3I17 A;  1FEM A;  5B27 A;  5HZQ A;  2AT3 X;  4LZV A;  1I06 A;  1GKA A;  5LJD A;  1SA8 A;  5LJK A;  1KZX A;  4XMH A;  4GNY A;  3RZY A;  4HPC A;  2RQ0 A;  1GX8 A;  5HTE A;  3KQ0 A;  3BDR A;  1OEE A;  4ORX A;  4AW8 A;  3NX2 A;  1AB0 A;  1BBP A;  4AZN A;  2FLJ A;  4GKC A;  3DSZ A;  1QG5 A;  3U03 A;  2OZQ A;  2FS7 A;  1HBP A;  3HK1 A;  3VG5 A;  3PH6 A;  3APU A;  4RUU A;  2R56 A;  4IB9 A;  1OEJ A;  2QM9 A;  4N7D A;  4I9S A;  1X8N A;  1SXY A;  3P6H A;  1AQB A;  2POA A;  3L4R A;  4OMW A;  3FR5 A;  3NR3 A;  4RUN A;  1LIC A;  5EED A;  1CBI A;  2WSJ A;  2DM5 A;  2Q9S A;  5EPQ A;  2RD7 C;  1A3Y A;  3KFG A;  4O9S A;  1CBS A;  1O8V A;  1BRP A;  4YBU A;  3BRN A;  1VYF A;  3B2K A;  3PEC A;  5C0N A;  1JJJ A;  1GGL A;  3WVM A;  2YG2 A;  5BVT A;  1JBH A;  3D97 A;  5CE4 A;  4XMC A;  1DV9 A;  2AL0 X;  3EMM A;  3SAO A;  1BSO A;  4ORW A;  1CBR A;  1CBQ A;  1AVG I;  2JU7 A;  4YMY A;  1HMS A;  1DZP A;  1B4M A;  4IB6 A;  4AZM A;  4K19 A;  5D4A A;  4ZHH A;  5D8J A;  3C76 X;  4MVI A;  1LF7 A;  5LJE A;  3WXQ A;  4A60 A;  2HYS A;  2MJI A;  1E06 A;  1SY2 A;  3G7X A;  3PH5 A;  1G5W A;  3ZUI A;  4OS0 A;  1KT3 A;  5F58 A;  1SXW A;  3O22 A;  3CR6 A;  2L5P A;  4TNN A;  3VG2 A;  3JS1 A;  2HLV A;  3FEN A;  1ACD A;  5L8O A;  2XKL A;  1P6P A;  1BLR A;  2X46 A;  1FEN A;  1OPB A;  5IO6 A;  1B0O A;  1MX8 A;  1XKI A;  2QOS C;  2HZR A;  5HTD A;  2Q2M A;  1G74 A;  4ORS A;  1SY1 A;  4D6A A;  1EPB A;  2ACP X;  1ICM A;  1SXX A;  1IW2 A;  3APW A;  3FA6 A;  4MVK A;  4R0B A;  1X8U A;  3VG6 A;  4ARH A;  1SY0 A;  2JOZ A;  2W2A A;  1D3S A;  1ZND A;  1EQD A;  4GNW A;  3B2L A;  1MX7 A;  5LJB A;  1OBP A;  1PMP A;  2Q4N A;  3KZA A;  1IFC A;  2X45 A;  4YKM A;  1LNM A;  4IB7 A;  4YFQ A;  4LZU A;  1ZNH A;  2HMB A;  3WJB A;  4EFG A;  1FTP A;  1DZJ A;  2AMM X;  4Y0S A;  1U0X A;  4EEJ A;  1HQP A;  4NLJ A;  1A18 A;  5L8N A;  4IAX A;  1ALB A;  3BU9 A;  3FR4 A;  2ANS A;  1N0S A;  5F7G A;  5KIC A;  3HWE A;  1KQX A;  5BVS A;  3JSQ A;  1OPA A;  3IFB A;  3VG4 A;  2OVA A;  2E4J A;  3ELZ A;  4YCE A;  1EIO A;  2N93 A;  4HPB A;  1BJ7 A;  5FAZ A;  4HFO A;  1S44 A;  1CRB A;  2W2B A;  5F6B A;  3WJC A;  3EM0 A;  2OFR X;  4WBK A;  4ALB A;  1EAL A;  3C77 X;  3P6E A;  4QAE A;  1TXL A;  3EBW A;  1GT4 A;  4ES7 A;  1MDC A;  5DPQ A;  4A8Z A;  1S7D A;  3FA8 A;  5D48 A;  4EXZ A;  2FS6 A;  1ADL A;  4A1H A;  1YWD A;  2W2F A;  2FT9 A;  2NNQ A;  1XCA A;  2ACO A;  5HCD C;  3NQ9 A;  3TZS A;  4YGZ A;  4AZP A;  4LKP A;  3WJG A;  3P6C A;  2L67 A;  4GET A;  4YGG A;  2NP1 A;  4TQ2 A;  1BWY A;  2CBS A;  3BY0 A;  1B56 A;  2CM4 A;  1PEE A;  3D96 A;  3P6F A;  4NNT A;  5EDB A;  4CK4 A;  4WFV A;  1S2P A;  3FEK A;  1BSY A;  3NP1 A;  5DG4 A;  5H9A A;  1MVG A;  4OS8 A;  5HA1 A;  3BS2 A;  2CM9 A;  5H9K A;  5LKE A;  4GH7 A;  2LFO A;  3WJF A;  1E5P A;  1E00 A;  4ZFX A;  2EU7 X;  2FRS A;  3C78 X;  5AQ6 A;  1ML7 A;  5H9N A;  1MUP A;  3VG7 A;  1FEL A;  1IIU A;  2G78 A;  3EYC A;  4ZCB A;  1U17 A;  2R73 A;  1G7N A;  2HNX A;  3FMZ A;  4MVL A;  1YUP A;  1GX9 A;  4XMF A;  3UEU A;  4IBA A;  4QGX A;  3T1D A;  2ASN X;  3STM X;  1E02 A;  4Y0Q A;  3CBC A;  3FR2 A;  1BEB A;  4AYH A;  5D45 A;  1TVQ A;  1CJ5 A;  2F73 A;  1ICN A;  3PPT A;  2GTF X;  4ZGU A;  3TGB A;  2RCQ A;  1LIF A;  4QGW A;  3FA9 A;  2WWP A;  1HN2 A;  1A57 A;  1KOI A;  1LPJ A;  1YWA A;  1QQS A;  1QY1 A;  1EXS A;  1GKA B;  1PBO A;  2AKQ A;  1GT3 A;  2CBR A;  4GE1 A;  4IMN A;  5HCC C;  4YKO A;  5KHP A;  2A3F X;  1ZNE A;  2A2G A;  1QAB E;  2AT0 X;  5KID A;  5HAE A;  1YWC A;  2AT8 X;  4M6S A;  3FW5 A;  1YP6 A;  4YH0 A;  2WEW A;  5F6Z A;  1JYD A;  3NX1 A;  5IO7 A;  1TOU A;  1ERB A;  4D6B A;  3ZQ3 A;  3NAD A;  2OVE A;  3PP6 A;  3CBS A;  5HA0 A;  3HWD A;  5HZ9 A;  2LBV A;  2ALL X;  3AKN A;  1X8Q A;  5EEE A;  4YBP A;  1KXO A;  1JJX A;  1ZRY A;  4ORR A;  1GM6 A;  2O62 A;  1KT6 A;  2GC9 A;  4Y0R A;  5EZ2 A;  1LIE A;  4YGH A;  2XST A;  1O1V A;  2PY1 A;  4TKB A;  3UEV A;  1GXA A;  4TKJ A;  1TOW A;  4AZO A;  4ORU A;  1R0U A;  3MBT A;  5LJC A;  5HCE C;  4KII A;  4NYQ A;  1LFO A;  5HZ5 A;  5HZ8 A;  4XMD A;  3TF6 A;  2WR6 A;  4ZHD A;  4I3D A;  4ORY A;  4WFU A;  1BM5 A;  4XMG A;  2RA6 A;  4YDA A;  5B29 A;  3VG3 A;  4BOE A;  1EUO A;  2R74 A;  1I05 A;  2L68 A;  3STK A;  3O19 A;  1YIV A;  2CZT A;  1TW4 A;  1JYJ A;  5FFH A;  1LIB A;  5K06 A;  5HZ6 A;  4PSQ A;  2Q39 A;  1ZNL A;  5L8I A;  3BLG A;  1IKE A;  1X8O A;  2LKK A;  4IB8 A;  4M7M A;  3RSW A;  1SXU A;  2A0A A;  5HWZ A;  3WJD A;  4ZH9 A;  1QFT A;  4HPA A;  1HMT A;  1T8V A;  3EBK A;  5EDC A;  5BVQ A;  2KTD A;  4BVM A;  2BLG A;  5D47 A;  1U18 A;  5LKF A;  1DZM A;  1RBP A;  4ZR2 A;  1QFV A;  2A13 A;  2HZQ A;  1KT5 A;  4QYN A;  4QGV A;  1ERX A;  1O1U A;  2NNE A;  3FEL A;  3KFI A;  3F9D A;  3MVF A;  1T0V A;  4GRJ A;  4YFR A;  4DQ3 A;  1KT4 A;  2L9C A;  1UZ2 X;  2LB6 A;  5H8T A;  3I0A A;  1YWB A;  2A2U A;  2Q2P A;  1HBQ A;  3AKM A;  4AZR A;  1HMR A;  2CZU A;  4OMX A;  5HBS A;  3FW4 A;  1GT5 A;  4I3B A;  1QWD A;  2K23 A;  2AH7 X;  1D2U A;  3BX8 A;  4NLI A;  1BSQ A;  1BRQ A;  1OEK A;  4DQ4 A;  3DTQ A;  4QZT A;  2FR2 A;  3IA8 A;  3FEP A;  1H91 A;  1DZK A;  2IFB A;  5JR8 A;  3S26 A;  2JN3 A;  4YCH A;  2GJ5 A;  4OS3 A;  4UU3 A;  4I3C A;  1EPA A;  3CMP A;  1L6M A;  4EDE A;  2MO5 A;  2QO6 A;  5LJH A;  1JZU A;  4YDB A;  4IAW A;  2G79 A;  5FEN A;  3TGC A;  3APX A;  5LJG A;  1OBQ A;  2FTB A;  4XME A;  1DF3 A;  3K3L A;  1KT7 A;  3UEW A;  4TJZ A;  3WBG A;  1IFB A;  2QO5 A;  3STN A;  3TGA A;  1Z24 A;  2K62 A;  3HWF A;  3B2J A;  2FWV A;  4NNS A;  3O2Y A;  5F1E A;  4I9R A;  4ZHG A;  4LKT A;  3BX7 A;  4BQU A;  3Q6L A;  4NYR A;  3WJE A;  1I04 A;  3KFH A;  1OBU A;  3D95 A;  1SY3 A;  3ELX A;  2KT4 B;  1I4U A;  4IMO A;  3NQ3 A;  2QO4 A;  1G85 A;  4AZQ A;  4ZJ0 A;  1FE3 A;  1LKE A;  2P8G A;  3BSZ E;  3GAQ A;  3P6D A;  5H9L A;  3UEX A;  1EW3 A;  2RCT A;  1VPR A;  3OJY C;  3APV A;  4UU2 A;  2WQ9 A;  4YFP A;  4QYP A;  4ALO A;  1RLB E;  2OFM X;  1NP1 A;  1KGL A;  1YP7 A;  1ZNK A;  3B2H A;  1NP4 A;  3CQR A;  3U0D A;  4HPD A;  2AT5 X;  4ZH6 A;  1KQW A;  1X71 A; 
#chains in the Genus database with same CATH topology
 1UYN X;  3OD9 A;  5B11 O;  3HWG A;  3KFF A;  1LUQ A;  3NPO A;  3PED A;  4ZHC A;  4GJS A;  3CWK A;  4NP1 A;  5IO5 A;  1A2D A;  2LA7 A;  1FDQ A;  4QZU A;  3U9P C;  4BX5 B;  4TKH A;  4BX6 B;  3RE5 A;  2FKG A;  2MM3 A;  3CQN A;  3WZP A;  2WQA E;  3BU1 A;  4TLJ A;  4Y0P A;  2LBA A;  2FHN X;  1URE A;  1X89 A;  2OY1 O;  2AT6 X;  1KZW A;  1X8P A;  2FGS A;  2OVD A;  4N7C A;  1DFV A;  1QY2 A;  2RTM A;  3CKF A;  3FIQ A;  1DC9 A;  4FBV A;  4ML7 B;  4ODD A;  4BBO A;  1QY0 A;  3FLL A;  4IRW A;  1T68 X;  2JU8 A;  4ON1 A;  5B5G A;  3WZQ A;  4KT5 A;  1IKJ A;  3B2I A;  3F8A A;  1SWK A;  1SWS A;  1NGL A;  3LV4 A;  3RDS A;  3X00 A;  2QMI A;  2WUT A;  3FA7 A;  3PQU A;  3ZUO A;  3QKG A;  1B8E A;  3SLT A;  4DNE A;  1VYG A;  1RAV A;  2RTH B;  3LTW A;  1PM1 X;  2NND A;  3P6G A;  4L1N A;  4ZHF A;  2OY7 A;  1GT1 A;  1ZNG A;  2FR3 A;  2WEX A;  3ZW0 A;  2JU3 A;  4ID2 A;  1AEL A;  1LID A;  1EII A;  2X32 A;  4A1Y A;  2G7B A;  1JV4 A;  3I17 A;  1FEM A;  5B27 A;  5HZQ A;  2G8C O;  2AT3 X;  2AF5 A;  4LZV A;  1Y9T A;  4CSB A;  4MIS A;  1MOY A;  1I06 A;  1GKA A;  5LJD A;  1SA8 A;  1SRJ A;  5LJK A;  1KZX A;  4XMH A;  4GU8 A;  4GNY A;  3RZY A;  3SZH A;  4HPC A;  3SLJ A;  1FJ1 E;  4Z6J A;  2RQ0 A;  1GX8 A;  3E3C A;  2IZC B;  5HTE A;  2OYB O;  3KQ0 A;  3BDR A;  1OEE A;  1VWD B;  4ORX A;  1SWU A;  5AJB A;  4AW8 A;  5B5F A;  4KH8 A;  3NX2 A;  1AB0 A;  1BBP A;  4AZN A;  2RTJ A;  4I6S A;  2FLJ A;  4GGT A;  4GKC A;  5AJC A;  4O3X B;  3DSZ A;  1N9M A;  1QG5 A;  3U03 A;  2OZQ A;  2ZAG A;  2FS7 A;  1HBP A;  3HK1 A;  3VG5 A;  3PH6 A;  3APU A;  4RUU A;  1KL5 A;  5IRU A;  5IRA A;  1UYO X;  2R56 A;  2F09 A;  4IB9 A;  1OEJ A;  2QM9 A;  4N7D A;  4YVB A;  2BT9 A;  4I9S A;  1X8N A;  1SXY A;  3P6H A;  2RTO B;  1AQB A;  1PTS A;  2OF8 A;  2POA A;  1AVD A;  3FR5 A;  3L4R A;  3NR3 A;  4OMW A;  4RUN A;  1SWQ A;  1LIC A;  4GK9 A;  1CBI A;  2WSJ A;  2DM5 A;  2Q9S A;  2VFC A;  2RD7 C;  5EED A;  5EPQ A;  2MWH A;  1A3Y A;  3KFG A;  4O9S A;  5FQ7 E;  3VHM A;  1SWE A;  1CBS A;  1O8V A;  2BC3 A;  1BRP A;  4YBU A;  3FDC A;  3BRN A;  1VYF A;  3B2K A;  3PEC A;  2X55 A;  5C0N A;  5IXG A;  1JJJ A;  1GGL A;  2WPU A;  3WVM A;  2YG2 A;  5BVT A;  1JBH A;  1STR B;  1DF8 A;  3D97 A;  5CE4 A;  1SWB A;  4XMC A;  5CHK A;  1DV9 A;  2AL0 X;  4BGF A;  3EMM A;  3SAO A;  1BSO A;  4ORW A;  1CBR A;  1CBQ A;  1AVG I;  1GX3 A;  2JU7 A;  3CKG A;  4O4S A;  1HMS A;  3SZI A;  4BX6 A;  4YMY A;  3WYP A;  4CDC A;  1DZP A;  1B4M A;  4IB6 A;  4O3W A;  4AZM A;  4K19 A;  5D4A A;  3WZO A;  4ZHH A;  5D8J A;  2X8S A;  3C76 X;  2A5C A;  4MVI A;  1LF7 A;  1N9Y A;  5LJE A;  1SRF A;  3WXQ A;  1I78 A;  2HYS A;  4A60 A;  2MJI A;  3EW2 A;  1E06 A;  1SY2 A;  3G7X A;  3PH5 A;  4HWM A;  4OKA A;  3ZUI A;  4CPH B;  1G5W A;  4OS0 A;  1KT3 A;  5F58 A;  3RDO A;  1SXW A;  5HTD A;  3S60 A;  2BSZ A;  1STS B;  3O22 A;  3CR6 A;  2L5P A;  1RXK A;  2IZB A;  4TNN A;  1VWF B;  2RTA A;  1SRE A;  3JS1 A;  3MM0 A;  3VG2 A;  2HLV A;  3FEN A;  1ACD A;  1SWP A;  3LHN A;  3ZW1 B;  5L8O A;  2XKL A;  1P6P A;  1BLR A;  2X46 A;  1FEN A;  1OPB A;  5AEO A;  1B0O A;  1MX8 A;  1XKI A;  5IO6 A;  2QOS C;  2HZR A;  2Y3F A;  1Y9L A;  2Q2M A;  3EC5 A;  1G74 A;  1NDJ A;  1SY1 A;  2KW1 A;  4L3R A;  4ORS A;  1E2T A;  4D6A A;  1EPB A;  2ACP X;  1ICM A;  1SXX A;  1IW2 A;  3APW A;  3FA6 A;  4MVK A;  2Z4H A;  4R0B A;  4U8U M;  1X8U A;  3RWX A;  3VG6 A;  3D9W A;  2A5B A;  4FBO A;  4ARH A;  1SY0 A;  2JOZ A;  2W2A A;  1D3S A;  1ZND A;  5FQ6 E;  1EQD A;  4GNW A;  1RST B;  3B2L A;  1MX7 A;  2RTI B;  5LJB A;  1OBP A;  2X8F A;  1PMP A;  3ZW2 A;  1SMP I;  2Q4N A;  2PI3 O;  2RTP B;  3D4R A;  2RTQ B;  3KZA A;  1IFC A;  4NV7 A;  2X45 A;  1HXZ A;  4YKM A;  1LNM A;  4IB7 A;  4YFQ A;  4CPF A;  4LZU A;  1ZNH A;  1SWG A;  2HMB A;  3WJB A;  4EFG A;  1FTP A;  3MG5 A;  1DZJ A;  2AMM X;  4Y0S A;  1U0X A;  3NBX X;  4EEJ A;  2X8T A;  4BCS A;  1HQP A;  4NLJ A;  2IZL B;  3AEH A;  1A18 A;  5L8N A;  4IAX A;  1ALB A;  2KTS A;  2RTG B;  3BU9 A;  1Y0G A;  3FR4 A;  4O3Z A;  2ANS A;  4Z2P A;  1N0S A;  1SLD B;  5F7G A;  5KIC A;  4GDZ A;  3RKG A;  3HWE A;  5F2B A;  1KQX A;  5BVS A;  4Z27 A;  1JMX A;  2RTL A;  2JW1 A;  3JSQ A;  1OSP O;  1OPA A;  4QQ1 A;  3IFB A;  3VG4 A;  2OVA A;  3WYQ A;  2E4J A;  2AVI A;  2Y32 A;  3ELZ A;  4YCE A;  1EIO A;  3QQ2 A;  3T2X A;  2N93 A;  4HPB A;  1BJ7 A;  5FAZ A;  2G5L A;  4HFO A;  1S44 A;  1CRB A;  2IZH B;  4B55 A;  2OFB A;  2W2B A;  5F6B A;  3SZJ A;  3WJC A;  3EM0 A;  1W4T A;  4OEM A;  3Q34 A;  2OFR X;  4WBK A;  4ALB A;  1EAL A;  3C77 X;  3P6E A;  4QAE A;  1TXL A;  4GGR A;  3EBW A;  4LQZ A;  1GT4 A;  4ES7 A;  1MDC A;  5DPQ A;  4A8Z A;  1S7D A;  2X56 A;  3FA8 A;  5D48 A;  2FS6 A;  1HXL A;  4EXZ A;  5K67 A;  2IZJ A;  2GTL O;  2OVS A;  2VDF A;  1ADL A;  4A1H A;  1YWD A;  2W2F A;  2FT9 A;  2NNQ A;  2IZG B;  1VWN B;  1XCA A;  2ACO A;  3UAQ A;  5HCD C;  1KFF A;  3NQ9 A;  3TZS A;  4YGZ A;  4AZP A;  4LKP A;  1NQM A;  3WJG A;  3P6C A;  2L67 A;  4GET A;  4QRL A;  4YGG A;  3RDQ A;  2NP1 A;  4TQ2 A;  1BWY A;  4WHI A;  2CBS A;  3BY0 A;  1B56 A;  2CM4 A;  1PEE A;  3D96 A;  3P6F A;  4NNT A;  5EDB A;  3ZW1 A;  2IZD B;  4CK4 A;  4WFV A;  1S2P A;  3FEK A;  1BSY A;  3ZZV A;  3EW1 A;  3NP1 A;  5DG4 A;  5H9A A;  1MK5 A;  1MVG A;  5B10 O;  2GTL M;  3P24 A;  4OS8 A;  5HA1 A;  2RTN B;  1W5R A;  3BS2 A;  2CM9 A;  5H9K A;  5LKE A;  4GH7 A;  2LFO A;  3WJF A;  1E5P A;  1E00 A;  4ZFX A;  2EU7 X;  1RXH A;  4ZGF A;  3FID A;  2FRS A;  4BJ8 A;  2BHV A;  3C78 X;  5AQ6 A;  2OL8 O;  1ML7 A;  4DCB A;  1HQQ A;  5H9N A;  1MUP A;  3VG7 A;  1FEL A;  1K24 A;  1IIU A;  2G78 A;  3EYC A;  4ZCB A;  1U17 A;  4O4O A;  1VWK B;  3OBL A;  4O49 A;  2IZF B;  1HY2 A;  1SWR A;  2C1S A;  2R73 A;  3T6L A;  4BX5 A;  1G7N A;  1SWH A;  2HNX A;  3FMZ A;  3RDU A;  4MVL A;  4CPI A;  1YUP A;  1GX9 A;  4XMF A;  3UEU A;  4IBA A;  4Z28 A;  4QGX A;  5FQ8 E;  2ASN X;  2RTB B;  3T1D A;  1NQN A;  3STM X;  1E02 A;  4Y0Q A;  2RTE B;  5CYB A;  3CBC A;  3FR2 A;  1BEB A;  4PJ2 A;  3VHH A;  4AYH A;  1VWR B;  4U46 A;  5D45 A;  4GGZ A;  1TVQ A;  1CJ5 A;  1RXJ A;  2F73 A;  1ICN A;  3PPT A;  1JMZ A;  2GTF X;  4ZGU A;  3TGB A;  2RCQ A;  1LIF A;  2QOM A;  4FGI B;  3HOL A;  4QGW A;  3FA9 A;  2WWP A;  1HN2 A;  3ZI8 A;  1A57 A;  1KOI A;  1LPJ A;  1YWA A;  1QQS A;  1QY1 A;  1SLE B;  3PDF A;  3RE6 A;  4CV7 A;  1EXS A;  1GKA B;  1PBO A;  1VWL B;  1GT3 A;  2AKQ A;  2CBR A;  4GE1 A;  4IMN A;  4KC7 A;  3RDM A;  5HCC C;  2DJG A;  4Y5D A;  4YKO A;  5KHP A;  1NC9 A;  2A3F X;  1ZNE A;  2A2G A;  2OF9 A;  2OL6 O;  4I60 A;  4OEL A;  1QAB E;  2AT0 X;  5KID A;  5HAE A;  1VWG B;  1YWC A;  3HTY A;  1LDQ A;  5CSE A;  2AT8 X;  2I5Z O;  3SLO A;  2JGS A;  2DJF A;  3AUM O;  4M6S A;  2CAM A;  3FW5 A;  1YP6 A;  4YH0 A;  1SWF A;  2WEW A;  5F6Z A;  1JYD A;  3NX1 A;  5IO7 A;  1TOU A;  1ERB A;  4JNJ A;  4D6B A;  3ZQ3 A;  3NAD A;  2UZ2 A;  2OVE A;  1SWJ A;  2IZE B;  3CBS A;  3PP6 A;  3PQS A;  3HWD A;  1LDO A;  5HA0 A;  2LBV A;  5HZ9 A;  2ALL X;  3AKN A;  1X8Q A;  5EEE A;  3VPJ E;  4U8U N;  3WZN A;  1KXO A;  1PBY A;  4YBP A;  1JJX A;  3RY1 A;  1ZRY A;  3VU1 A;  2IZK A;  1EI5 A;  1SLF B;  4ORR A;  3PK2 A;  1N7Y A;  2HKD A;  1K3B A;  1GM6 A;  1SWA A;  2O62 A;  1SRH A;  1KT6 A;  2RTR B;  2GC9 A;  2RTF B;  4CPE A;  1SWD A;  3NQK A;  4Y0R A;  1SWO A;  5EZ2 A;  2FKJ A;  1LIE A;  2OL7 A;  2OFA A;  4FBR A;  4YGH A;  1VWO B;  2XST A;  1O1V A;  1SRI A;  1W6F A;  2PY1 A;  4TKB A;  3UEV A;  1VWE B;  1KL3 A;  1Y53 X;  1GXA A;  4TKJ A;  5B2A O;  2M4L A;  1TOW A;  5K68 A;  4AZO A;  1MM9 A;  4NV8 A;  1LCW A;  4ORU A;  1R0U A;  3MBT A;  4U9C A;  4BX7 B;  2KD2 A;  5HCE C;  4KII A;  5LJC A;  4NYQ A;  1LFO A;  1Y55 X;  2C1Q A;  5HZ5 A;  5HZ8 A;  4XMD A;  5IRW A;  3TF6 A;  1JIW I;  2WR6 A;  3T6F A;  4ZHD A;  4I3D A;  4MVE A;  1JQP A;  2OY5 O;  5L3Y A;  2FHL A;  2BS6 A;  4ORY A;  4WFU A;  1BM5 A;  2ZSC A;  4MEE A;  4XMG A;  3VE1 A;  2RA6 A;  4YDA A;  5B29 A;  2Y3E A;  3MX7 A;  3VG3 A;  2X34 A;  4BOE A;  3JQO A;  2OY8 A;  1EUO A;  2R74 A;  3OE3 A;  4CDD A;  2IZI A;  1I05 A;  1VWC B;  2L68 A;  3STK A;  1Y52 X;  2RTD B;  3GE2 A;  3O19 A;  3T2W A;  1YIV A;  2CZT A;  4MIR A;  1TW4 A;  1JYJ A;  5FFH A;  1LIB A;  4CDF A;  5K06 A;  5HZ6 A;  4PSQ A;  2Q39 A;  1SWL A;  1ZNL A;  5L8I A;  1AVE A;  3BLG A;  1IKE A;  1N43 A;  1X8O A;  2LKK A;  4IB8 A;  4M7M A;  4GJV A;  3RSW A;  4CPH A;  1SXU A;  2A0A A;  5HWZ A;  3WJD A;  1VYO A;  4ZH9 A;  1QFT A;  3F6Z B;  4HPA A;  2YMS A;  1SLG B;  1SWC A;  1HMT A;  1T8V A;  3EBK A;  5EDC A;  5B3M O;  5BVQ A;  4EQA C;  5BYP A;  1SWN A;  2A8G A;  2KTD A;  4KC8 A;  4BVM A;  2BLG A;  4KCA A;  5D47 A;  1U18 A;  5LKF A;  1DZM A;  1RBP A;  4ZR2 A;  1N4J A;  1QFV A;  2A13 A;  2HZQ A;  1VWM B;  1KT5 A;  3RBY A;  3FYF A;  1WBI A;  3P02 A;  4QYN A;  4QGV A;  1VWI B;  1ERX A;  1O1U A;  3RDX A;  2NNE A;  3FEL A;  2JMB A;  1LCV A;  3KFI A;  3H3I A;  3F9D A;  3MVF A;  1T0V A;  4GRJ A;  4YFR A;  4O4X A;  3VGW A;  4DQ3 A;  1KT4 A;  2L9C A;  1UZ2 X;  2LB6 A;  2I5V O;  5H8T A;  2IZA A;  3I0A A;  4EKV A;  2MF6 A;  4COT A;  1YWB A;  2A2U A;  3N91 A;  4I95 A;  1HBQ A;  2Q2P A;  3AKM A;  5JD2 A;  4AZR A;  1HMR A;  2GTL N;  4QNI A;  2CZU A;  4OMX A;  5HBS A;  3FW4 A;  1GT5 A;  4FQB B;  1QWD A;  4I3B A;  3RY2 A;  2K23 A;  4O4U A;  4Z2O A;  2AH7 X;  1LEL A;  4INN A;  1D2U A;  1IJ8 A;  3BX8 A;  4NLI A;  1BSQ A;  1SWT A;  1BRQ A;  1OEK A;  4GD9 A;  1I9H A;  4DQ4 A;  3DTQ A;  4QZT A;  2FR2 A;  3IA8 A;  4JHQ A;  3FEP A;  1H91 A;  1DZK A;  1VWQ B;  2IFB A;  2RTC B;  5JR8 A;  4GZV A;  3S26 A;  2JN3 A;  4YCH A;  4C5P A;  2GJ5 A;  4OS3 A;  4UU3 A;  4U3Q A;  4I3C A;  1EPA A;  4NW4 A;  3ZW0 B;  4BX7 A;  3HPE A;  1NBX A;  3CMP A;  1L6M A;  4GUZ A;  4JGL A;  2Z4I A;  4EDE A;  2MO5 A;  2QO6 A;  5LJH A;  1JZU A;  1STP A;  4JO6 A;  4YDB A;  1VWA B;  2VFB A;  4IAW A;  2G79 A;  3SOT A;  5FEN A;  3TGC A;  3APX A;  5LJG A;  1OBQ A;  2FTB A;  1RSU B;  4XME A;  1DF3 A;  4CDE A;  2MHD A;  3K3L A;  1KT7 A;  2RTK A;  3UEW A;  1MEP A;  4TJZ A;  3ZWE A;  1WUB A;  2ZAI A;  3WBG A;  1IFB A;  2QO5 A;  3STN A;  3TGA A;  1VWJ B;  1Z24 A;  2K62 A;  2C4I A;  2RN4 A;  3HWF A;  3B2J A;  2FWV A;  4U8U O;  3S5V A;  3V8U A;  3VHI A;  4NNS A;  2GH7 A;  3O2Y A;  5F1E A;  4I9R A;  4ZHG A;  4LKT A;  3BX7 A;  1LCZ A;  3Q6L A;  4NYR A;  3WJE A;  3WOV A;  1I04 A;  4BQU A;  3KFH A;  4IAB A;  1OBU A;  3D95 A;  1SY3 A;  3ELX A;  2KT4 B;  1I4U A;  4IMO A;  3NQ3 A;  2QO4 A;  1G85 A;  3HOE A;  4AZQ A;  1JJU A;  4ZJ0 A;  2X4M A;  1FE3 A;  1LKE A;  2P8G A;  2UYW A;  3BSZ E;  3GAQ A;  3KVN A;  3P6D A;  5H9L A;  4GDA A;  1KL4 A;  2F01 A;  3UEX A;  1VWB B;  1EW3 A;  2RCT A;  3VE2 A;  4Y59 A;  4Z2V A;  1VPR A;  3OJY C;  3APV A;  2BS5 A;  1VWP B;  4UU2 A;  2WQ9 A;  4YFP A;  4QYP A;  4ALO A;  1RLB E;  1SRG A;  2OFM X;  1NP1 A;  1KGL A;  1YP7 A;  1ZNK A;  3B2H A;  1NP4 A;  3CQR A;  3U0D A;  2QCB A;  1VWH B;  4HPD A;  4O3Y A;  2AT5 X;  4ZH6 A;  1KQW A;  3S5X A;  1X71 A; 
#chains in the Genus database with same CATH homology
 3OD9 A;  3HWG A;  3KFF A;  3NPO A;  3PED A;  4ZHC A;  3CWK A;  4NP1 A;  5IO5 A;  1A2D A;  2LA7 A;  1FDQ A;  4QZU A;  3U9P C;  4TKH A;  2MM3 A;  3CQN A;  2WQA E;  3BU1 A;  4TLJ A;  4Y0P A;  2LBA A;  1URE A;  1X89 A;  1KZW A;  2AT6 X;  1X8P A;  2OVD A;  4N7C A;  1DFV A;  1QY2 A;  4FBV A;  3FIQ A;  1DC9 A;  4ODD A;  1QY0 A;  3FLL A;  4ON1 A;  1T68 X;  2JU8 A;  4KT5 A;  1IKJ A;  3B2I A;  3F8A A;  3LV4 A;  1NGL A;  2QMI A;  2WUT A;  3FA7 A;  3PQU A;  3ZUO A;  3QKG A;  1B8E A;  1VYG A;  1PM1 X;  2NND A;  3P6G A;  4L1N A;  4ZHF A;  1GT1 A;  1ZNG A;  2FR3 A;  2WEX A;  3ZW0 A;  2JU3 A;  4ID2 A;  1AEL A;  1LID A;  1EII A;  4A1Y A;  2G7B A;  1JV4 A;  3I17 A;  1FEM A;  5B27 A;  5HZQ A;  2AT3 X;  4LZV A;  1Y9T A;  4CSB A;  4MIS A;  1I06 A;  1GKA A;  5LJD A;  1SA8 A;  5LJK A;  1KZX A;  4XMH A;  4GU8 A;  4GNY A;  3RZY A;  4HPC A;  2RQ0 A;  1GX8 A;  3E3C A;  5HTE A;  3KQ0 A;  3BDR A;  1OEE A;  4ORX A;  5AJB A;  4AW8 A;  4KH8 A;  3NX2 A;  1AB0 A;  1BBP A;  4AZN A;  4I6S A;  2FLJ A;  4GKC A;  5AJC A;  4O3X B;  3DSZ A;  1QG5 A;  3U03 A;  2OZQ A;  2ZAG A;  2FS7 A;  1HBP A;  3HK1 A;  3VG5 A;  3PH6 A;  3APU A;  4RUU A;  2R56 A;  2F09 A;  4IB9 A;  1OEJ A;  2QM9 A;  4N7D A;  2BT9 A;  4I9S A;  1X8N A;  1SXY A;  3P6H A;  1AQB A;  2POA A;  3L4R A;  4OMW A;  3FR5 A;  3NR3 A;  4RUN A;  1LIC A;  4GK9 A;  1CBI A;  2WSJ A;  2DM5 A;  2Q9S A;  5EED A;  2RD7 C;  5EPQ A;  3ZZV A;  2MWH A;  1A3Y A;  3KFG A;  4O9S A;  5FQ7 E;  1CBS A;  1O8V A;  1BRP A;  4YBU A;  3BRN A;  1VYF A;  3B2K A;  3PEC A;  5C0N A;  1JJJ A;  1GGL A;  3WVM A;  2YG2 A;  5BVT A;  1JBH A;  3D97 A;  5CE4 A;  4XMC A;  1DV9 A;  2AL0 X;  3EMM A;  3SAO A;  1BSO A;  4ORW A;  1CBR A;  1CBQ A;  1AVG I;  2JU7 A;  4O4S A;  4YMY A;  1HMS A;  1DZP A;  1B4M A;  4IB6 A;  4O3W A;  4AZM A;  4K19 A;  5D4A A;  4ZHH A;  5D8J A;  2X8S A;  3C76 X;  4MVI A;  1LF7 A;  5LJE A;  3WXQ A;  4A60 A;  2HYS A;  2MJI A;  1E06 A;  1SY2 A;  3G7X A;  3PH5 A;  4HWM A;  1G5W A;  3ZUI A;  4OS0 A;  1KT3 A;  5F58 A;  1SXW A;  3S60 A;  3O22 A;  3CR6 A;  2L5P A;  4TNN A;  3VG2 A;  3JS1 A;  3ZW1 B;  2HLV A;  3FEN A;  1ACD A;  3LHN A;  5L8O A;  2XKL A;  1P6P A;  1BLR A;  2X46 A;  1FEN A;  1OPB A;  5AEO A;  1B0O A;  1MX8 A;  1XKI A;  5IO6 A;  2QOS C;  2HZR A;  5HTD A;  1Y9L A;  2Q2M A;  4L3R A;  1G74 A;  2KW1 A;  1SY1 A;  4ORS A;  4D6A A;  1EPB A;  2ACP X;  1ICM A;  1SXX A;  1IW2 A;  3APW A;  3FA6 A;  4MVK A;  2Z4H A;  4R0B A;  4U8U M;  1X8U A;  3RWX A;  3VG6 A;  4FBO A;  4ARH A;  1SY0 A;  2JOZ A;  2W2A A;  1D3S A;  1ZND A;  5FQ6 E;  1EQD A;  4GNW A;  3B2L A;  1MX7 A;  5LJB A;  1OBP A;  2X8F A;  1PMP A;  3ZW2 A;  1SMP I;  2Q4N A;  3D4R A;  3KZA A;  1IFC A;  2X45 A;  4YKM A;  1LNM A;  4IB7 A;  4YFQ A;  4LZU A;  1ZNH A;  2HMB A;  3WJB A;  4EFG A;  1FTP A;  1DZJ A;  2AMM X;  4Y0S A;  1U0X A;  3NBX X;  4EEJ A;  2X8T A;  1HQP A;  4NLJ A;  1A18 A;  5L8N A;  4IAX A;  1ALB A;  2KTS A;  3BU9 A;  3FR4 A;  4O3Z A;  2ANS A;  1N0S A;  5F7G A;  5KIC A;  4GDZ A;  3RKG A;  3HWE A;  1KQX A;  5BVS A;  3JSQ A;  2JW1 A;  1OPA A;  4QQ1 A;  3IFB A;  3VG4 A;  2OVA A;  2E4J A;  3ELZ A;  4YCE A;  1EIO A;  2N93 A;  4HPB A;  1BJ7 A;  5FAZ A;  4HFO A;  1S44 A;  1CRB A;  2W2B A;  5F6B A;  3WJC A;  3EM0 A;  2OFR X;  4WBK A;  4ALB A;  1EAL A;  3C77 X;  3P6E A;  4QAE A;  1TXL A;  3EBW A;  4LQZ A;  1GT4 A;  4ES7 A;  1MDC A;  5DPQ A;  4A8Z A;  1S7D A;  3FA8 A;  5D48 A;  4EXZ A;  2FS6 A;  2GTL O;  2OVS A;  1ADL A;  4A1H A;  1YWD A;  2W2F A;  2FT9 A;  2NNQ A;  1XCA A;  2ACO A;  3UAQ A;  5HCD C;  3NQ9 A;  3TZS A;  4YGZ A;  4AZP A;  4LKP A;  3WJG A;  3P6C A;  2L67 A;  4GET A;  4QRL A;  4YGG A;  2NP1 A;  4TQ2 A;  1BWY A;  4WHI A;  2CBS A;  3BY0 A;  1B56 A;  2CM4 A;  1PEE A;  3D96 A;  3P6F A;  4NNT A;  5EDB A;  3ZW1 A;  4CK4 A;  4WFV A;  1S2P A;  3FEK A;  1BSY A;  3NP1 A;  5DG4 A;  5H9A A;  1MVG A;  2GTL M;  3P24 A;  4OS8 A;  5HA1 A;  3BS2 A;  2CM9 A;  5H9K A;  5LKE A;  4GH7 A;  2LFO A;  3WJF A;  1E5P A;  1E00 A;  4ZFX A;  2EU7 X;  4ZGF A;  2FRS A;  2BHV A;  3C78 X;  5AQ6 A;  1ML7 A;  5H9N A;  1MUP A;  3VG7 A;  1FEL A;  1IIU A;  2G78 A;  3EYC A;  4ZCB A;  1U17 A;  4O4O A;  3OBL A;  4O49 A;  2R73 A;  1G7N A;  2HNX A;  3FMZ A;  4MVL A;  1YUP A;  1GX9 A;  4XMF A;  3UEU A;  4IBA A;  4QGX A;  5FQ8 E;  2ASN X;  3T1D A;  3STM X;  1E02 A;  4Y0Q A;  5CYB A;  3CBC A;  3FR2 A;  1BEB A;  4PJ2 A;  4AYH A;  5D45 A;  1TVQ A;  1CJ5 A;  2F73 A;  1ICN A;  3PPT A;  2GTF X;  4ZGU A;  3TGB A;  2RCQ A;  1LIF A;  4FGI B;  3HOL A;  4QGW A;  3FA9 A;  2WWP A;  1HN2 A;  3ZI8 A;  1A57 A;  1KOI A;  1LPJ A;  1YWA A;  1QQS A;  1QY1 A;  4CV7 A;  1EXS A;  1GKA B;  1PBO A;  2AKQ A;  1GT3 A;  2CBR A;  4GE1 A;  4IMN A;  4KC7 A;  4ML7 B;  5HCC C;  4YKO A;  5KHP A;  2A3F X;  1ZNE A;  2A2G A;  1QAB E;  2AT0 X;  5KID A;  5HAE A;  1YWC A;  3HTY A;  2AT8 X;  4M6S A;  3FW5 A;  1YP6 A;  4YH0 A;  2WEW A;  5F6Z A;  1JYD A;  3NX1 A;  5IO7 A;  1TOU A;  1ERB A;  4D6B A;  3ZQ3 A;  3NAD A;  2OVE A;  3PP6 A;  3CBS A;  3PQS A;  5HA0 A;  3HWD A;  5HZ9 A;  2LBV A;  2ALL X;  3AKN A;  1X8Q A;  5EEE A;  3VPJ E;  4U8U N;  4YBP A;  1KXO A;  1JJX A;  1ZRY A;  3VU1 A;  1EI5 A;  4ORR A;  1GM6 A;  2O62 A;  1KT6 A;  2GC9 A;  3NQK A;  4Y0R A;  5EZ2 A;  1LIE A;  4FBR A;  4YGH A;  2XST A;  1O1V A;  2PY1 A;  4TKB A;  3UEV A;  1GXA A;  4TKJ A;  2M4L A;  1TOW A;  4AZO A;  4U9C A;  4ORU A;  1R0U A;  3MBT A;  5LJC A;  2KD2 A;  5HCE C;  4KII A;  4NYQ A;  1LFO A;  5HZ5 A;  5HZ8 A;  4XMD A;  3TF6 A;  1JIW I;  2WR6 A;  4ZHD A;  4I3D A;  4MVE A;  2BS6 A;  4ORY A;  4WFU A;  1BM5 A;  4XMG A;  3VE1 A;  2RA6 A;  4YDA A;  5B29 A;  3MX7 A;  3VG3 A;  4BOE A;  3JQO A;  1EUO A;  2R74 A;  3OE3 A;  1I05 A;  2L68 A;  3STK A;  3GE2 A;  3O19 A;  1YIV A;  2CZT A;  4MIR A;  1TW4 A;  1JYJ A;  5FFH A;  1LIB A;  5K06 A;  5HZ6 A;  4PSQ A;  2Q39 A;  1ZNL A;  5L8I A;  3BLG A;  1IKE A;  1X8O A;  2LKK A;  4IB8 A;  4M7M A;  3RSW A;  1SXU A;  2A0A A;  5HWZ A;  3WJD A;  4ZH9 A;  1QFT A;  3F6Z B;  4HPA A;  2YMS A;  1HMT A;  1T8V A;  3EBK A;  5EDC A;  5BVQ A;  4EQA C;  5BYP A;  2KTD A;  4KC8 A;  4BVM A;  2BLG A;  4KCA A;  5D47 A;  1U18 A;  5LKF A;  1DZM A;  1RBP A;  4ZR2 A;  1QFV A;  2A13 A;  2HZQ A;  1KT5 A;  3RBY A;  3FYF A;  3P02 A;  4QYN A;  4QGV A;  1ERX A;  1O1U A;  2NNE A;  3FEL A;  2JMB A;  3KFI A;  3H3I A;  3F9D A;  3MVF A;  1T0V A;  4GRJ A;  4YFR A;  4O4X A;  4DQ3 A;  1KT4 A;  2L9C A;  1UZ2 X;  2LB6 A;  5H8T A;  3I0A A;  4COT A;  1YWB A;  2A2U A;  3N91 A;  4I95 A;  1HBQ A;  2Q2P A;  3AKM A;  4AZR A;  1HMR A;  2GTL N;  4QNI A;  2CZU A;  4OMX A;  5HBS A;  3FW4 A;  1GT5 A;  4FQB B;  1QWD A;  4I3B A;  2K23 A;  4O4U A;  2AH7 X;  4INN A;  1D2U A;  3BX8 A;  4NLI A;  1BSQ A;  1BRQ A;  1OEK A;  4DQ4 A;  3DTQ A;  4QZT A;  2FR2 A;  3IA8 A;  3FEP A;  1H91 A;  1DZK A;  2IFB A;  5JR8 A;  4GZV A;  3S26 A;  2JN3 A;  4YCH A;  2GJ5 A;  4OS3 A;  4UU3 A;  4U3Q A;  4I3C A;  1EPA A;  4NW4 A;  3ZW0 B;  3CMP A;  1L6M A;  4EDE A;  4JGL A;  2Z4I A;  2MO5 A;  2QO6 A;  5LJH A;  1JZU A;  4YDB A;  4IAW A;  2G79 A;  3SOT A;  5FEN A;  3TGC A;  3APX A;  5LJG A;  1OBQ A;  2FTB A;  4XME A;  1DF3 A;  2MHD A;  3K3L A;  1KT7 A;  3UEW A;  4TJZ A;  3ZWE A;  2ZAI A;  3WBG A;  1IFB A;  2QO5 A;  3STN A;  3TGA A;  1Z24 A;  2K62 A;  2RN4 A;  3HWF A;  3B2J A;  2FWV A;  4U8U O;  3S5V A;  3V8U A;  4NNS A;  3O2Y A;  5F1E A;  4I9R A;  4ZHG A;  4LKT A;  3BX7 A;  4BQU A;  3Q6L A;  4NYR A;  3WJE A;  3WOV A;  1I04 A;  3KFH A;  4IAB A;  1OBU A;  3D95 A;  1SY3 A;  3ELX A;  2KT4 B;  1I4U A;  4IMO A;  3NQ3 A;  2QO4 A;  1G85 A;  3HOE A;  4AZQ A;  4ZJ0 A;  1FE3 A;  1LKE A;  2P8G A;  3BSZ E;  3GAQ A;  3P6D A;  5H9L A;  3UEX A;  1EW3 A;  2RCT A;  3VE2 A;  1VPR A;  3OJY C;  3APV A;  2BS5 A;  4UU2 A;  2WQ9 A;  4YFP A;  4QYP A;  4ALO A;  1RLB E;  2OFM X;  1NP1 A;  1KGL A;  1YP7 A;  1ZNK A;  3B2H A;  1NP4 A;  3CQR A;  3U0D A;  4HPD A;  4O3Y A;  2AT5 X;  4ZH6 A;  1KQW A;  3S5X A;  1X71 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...