4I3MA

Aer2 poly-hamp domains: l44h hamp1 cw-lock mutant
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
150
structure length
150
Chain Sequence
HAVAQQRADRIATLLQSFADGQLDTAVGEAPAPGYERHYDSLRALQRQLREQRAELQQVESLEAGLAEMSRQHEAGWIDQTIPAERLEGRAARIAKGVNELVAAHIAVKMKVVSVVTAYGQGNFEPLMDRLPGKKAQITEAIDGVRERLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title HAMP Domain Conformers That Propagate Opposite Signals in Bacterial Chemoreceptors.
pubmed doi rcsb
molecule keywords Aerotaxis transducer Aer2
molecule tags Signaling protein
source organism Pseudomonas aeruginosa
total genus 60
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2012-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18575 HAMP_N3 HAMP N-terminal domain 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1530 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4i3mA00
4I3MA 3LNRA 4I44A
chains in the Genus database with same CATH superfamily
3ZQVA 4YT8A 4EBBA 2VCAA 4IB4A 4OIQF 1LS1A 3NKDA 4CS8A 1CGME 1TQGA 2CGEA 2Q4FA 4J7TA 1YA7O 2H7VC 1ORSC 1OW8A 2B0JA 3AJMA 2KGOA 2R03A 1CGNA 3L1MA 1LS4A 5JLIA 3HJCA 3EGDA 4IWBA 2YVKA 2LIGA 1Q0MA 2J9VA 4CS7A 3DM5A 3PMRA 3RW0A 3TK0A 3EH2A 2HV6A 2J0WA 3IQTA 4WGYA 4XPWA 1CPRA 2LD6A 4JTAB 2R7TA 1L7CA 5L0HA 3DJUB 2IYLD 1XWJA 1ZVZA 3HTKC 3FAPB 2XLDA 3FAJA 1YZAA 2OU6A 4CDVA 4MW3A 2YL1A 3K6BA 4MVSA 4C3EA 1HE9A 2PX3A 3UGPA 2JX0A 3HKKA 2H8AA 4KI2A 2YLDA 2G3KA 5L0FA 2AVKA 3IQ5A 4N06A 4GYTA 2W9YA 4JEBA 4PJNA 4BJ6C 1OCCC 1Q0FA 3UMIA 1OKKD 2XLMA 2Q7RA 5DQZA 2Q9BA 4P9TA 2XLHA 4WGZA 5A69A 1TR2A 2ICWG 5IY5C 4R32A 1M2VA 2CYDA 1GQAA 1OQCA 2RSEB 1Z63A 4XPYA 4QDLA 3KYIA 3U9MA 3FDQA 3X1OA 1NSGB 2IBFA 3K1IC 4CSAA 4YT2A 2AWCA 2OEXA 3SP1A 2J8WA 2WZLA 1R4TA 1VOMA 3MBGA 3FOOA 2A6HF 3PHF2 3RVYA 1GS9A 2MHRA 2YL3A 3QW1A 4JC7A 2XXAA 4DRJB 4Z9IA 1H6GA 1BR1A 2AU5A 1YDIA 2CNWD 3UNGC 2NUPB 1S05A 2YKZA 3T4RA 2W45A 1YZCA 1FMVA 1HW1A 4U5HA 1M57C 1OW6A 2P7VA 2KW3C 2GDCA 3IQCA 4C7OB 1QZXA 2Y69C 2J9WA 4H54A 4ULVA 5D92A 3WG7C 5HV9A 3EFOA 2XL8A 4J7YA 1LPEA 3NKEA 3C8ZA 3UR3C 1ZHZA 1SF8A 2DI3A 4JIOA 4E7SA 4G7HF 2QE9A 3C8GD 1LE4A 3L0IA 3LEVA 4ONSA 1QSPA 5D91A 1D1BA 1K04A 2VCCA 1OXKA 1E2XA 3W8HA 1A41A 1T6QA 1D1CA 1VYIA 1TKNA 1H9GA 1CGOA 4DBQA 1XZQA 2PBEA 3V7OA 4EBKA 5L3VA 3EGDB 4U5FE 3FMSA 3LEOA 5DVWA 4AX2A 4XTKA 2YZSA 4C3BA 5JSLA 5KYWB 2Y3HA 2TMVP 2WL8A 1RJ9B 4FX5A 1C02A 1V54C 2WVQA 3ASNC 4YK5A 3LUTB 1QKRA 2ZPAA 2M64A 2GAQA 2QTVA 5EK0A 3DE8A 2B0HA 3CQZA 2O9XA 3S29A 4JRZA 4NY3A 4E0IA 3LLIA 3RYLA 1I4ZA 4XPXA 3JRMO 1NFNA 1ZU4A 1B68A 3O10A 3QMKA 1IW7F 3NYLA 4JTCB 1T6IA 4M63A 3ZWIA 2Z15A 1T01A 3IPMO 4BEMJ 1VLTA 3GEHA 5T3TA 2NUTA 4DRIB 1M2VB 3NMKA 4G7ZF 1LM3B 1TWGA 4OIPF 1HW2A 2YL0A 1ORJA 2AP3A 4JZAA 3L34A 2R7RA 3IEEA 3B29A 1J8MF 4BEJA 1FAPB 1GGQA 1K05A 4CS9C 3HNKA 1PV3A 2IXOA 2L6FA 3LLKA 3TJ6A 4F4BA 5CI8A 2DB4A 1DOWA 2OJED 3DI5A 1OKKA 4NTBA 4D4XA 3FHDA 4HFFB 1WTYA 3EHMA 1W2WA 2HKVA 3JSEO 1LI7A 1DOVA 2XXAB 1PD0A 1YA9A 4PACA 3US6A 2LP4A 4ER9A 4CS9A 1D0YA 2KK1A 3RQEA 3S84A 4FAPB 4I44A 1LKXA 5FZTA 1KU2A 4AL1A 1FR0A 2KSFA 3ABMC 3DAGA 2A1DD 3OA1A 1PCXA 3CZ6A 4HE8D 1AVOB 2Q9CA 2OCCC 5A6KA 3HNLA 3EFOB 4OIRF 3DD7A 3EHNA 3ITFA 3SNHA 3SXZA 3R7CA 3KYJA 4CS8C 4JCHA 5JRAA 1BDJB 1JR8A 3K33A 3NG1A 4HFKB 2YHSA 2A0UA 2CNWA 2Q9AA 4Q7CA 3L8IA 3M79A 3U3BA 3M4BA 1SYQA 3LS0A 3NRHA 4JKVA 4KNVA 5TJ5E 1A0BA 1YARO 2ASRA 2OOCA 4MVQA 3VAYA 3F47A 4YL3A 5CIVA 3KKBA 1JPJA 4O79A 5L0IA 3M4CA 4MNDA 4IARA 4XWJA 3EPVA 2XL4A 2A0BA 3ZC4A 1ZHWA 4LLEA 2EPKX 1N1CA 4WJ0A 2MWQA 3C8GA 3G50A 4C7OA 2H7BA 3IHUA 1OCZC 3RQFA 2G62A 3BEHA 3QZCA 3AG3C 4CIPA 5KYWA 1WWPA 1C03A 1RJ9A 4ZLCA 2EINC 1G5ZA 4MVZA 4XEKA 5F28E 4I1OB 3RH3A 1M2OA 2P0NA 2C03A 2ZXOA 3ZTZA 3SXMA 5DS5A 3J06A 4FWVA 1Z23A 2ZXPA 4YL0A 2NSFA 2NUTB 3V5ZA 2Y39A 1MQVA 2XS1A 3SEOA 1ZHTA 3I5QA 4CSAC 1BBHA 1ST6A 2EPNA 3ZQYA 1XZPA 4AL0A 4CBEA 3B71A 4LLCA 5JS5A 3I5PA 2DYSC 1Z5ZA 5L0CA 2CW0F 4O7GA 1MNEA 2BE5F 3UMHA 3VYWA 5AC5A 1D1AA 1FTSA 3T9OA 3VF0A 1RMVA 3IQ6A 2Q00A 3M15A 3U0CA 5KYUA 3W8IA 2R7QA 4O6YA 2WZFA 3ABKC 2UUIA 1LIHA 4PR9A 2KJGA 1S7ZA 3JCUQ 2EIJC 2J9UA 5B3SC 4MTFA 4DBRA 2P61A 3JSZA 3KL4A 3RKOF 4YN0B 2RD9A 2YLIA 1O3UA 1U89A 2BL2A 2D4UA 1EA8A 1RCPA 1YYXA 3AGTA 3MFNA 2J9BA 2PFDA 2Q3TA 2PP4A 4IJJA 4QI0A 3U5SA 3GM1A 2GWWA 3ZVRA 3GEEA 1T9KA 4U5BE 3S0XA 3U8VA 1G8XA 1YJGA 1MNDA 1EI7A 3ATPA 2OQMA 2F22A 1MMAA 3C63A 4MTOA 4LDQA 1O87A 2IXMA 2EILC 1V4AA 3KMIA 3E70C 1JPNA 1ZU5A 3AG1C 4K7BA 5A6JA 1A7EA 5JUAA 1V74B 4FESA 3WODF 1VLSA 2HJ3A 1WATA 3C8GB 3ABLC 4JW1A 2HS5A 1OR2A 2DGJA 4GEHA 1Y6DA 1I4YA 2LQGA 3U9JA 5DLJA 1WOLA 4Q4ZF 2XL6A 1OW7A 3EGXB 1M56C 2XM4A 3B9QA 4XEVA 1E86A 2VC9A 4GQHA 3EJNA 3U3FA 1RXQA 3Q7LA 3RVZA 3ZG1A 3CSKA 1KTMA 2A6EF 4OD5A 1FFHA 2D5RB 2NG1A 2R7VA 3S28A 1NG1A 2PX0A 5B3IA 4I1MA 3W4YA 4CX9A 3B0VC 2HUJA 3DZAA 2ZXRA 4EUKB 3DJNB 4UDVA 1AUEA 2IXNA 2EIMC 3EG9A 3HLZA 5L0GA 3CEXA 4JJFA 3WHNA 2V26A 2W4BA 3EZIA 3KPHA 1VK5A 4K0DA 5FCLA 2R7WA 2OEVA 5E33A 2WZGA 3TOLA 3AG4C 3CAXA 2L6GA 1Q0GA 2EPLX 2HMQA 4U9DA 4XEFA 2R7SA 2LCHA 2C04A 3K66A 3S9OA 2YRFA 1L3PA 5KYYA 1JOGA 2Y3BA 5KYUB 5K0IA 2WVNA 3G4XA 1WGWA 1YVIA 1SR2A 2KYHA 3TOMA 3JYYA 3QW0A 4MVUA 3Q6MA 4N4WA 5KYNA 3RQGA 2MYSA 5DS4A 4MVMA 4OINF 2W4MA 1U0BB 2YEVA 1MMGA 3RIPA 2IOQA 3V5XA 4DXWA 2LFFA 1Z6AA 1JAFA 3AOUA 1OR3A 3L8JA 1Z7Qc 2J7PD 1YYJA 2L7AA 2R02A 4YJWA 1TFOB 5T3WA 3T6JA 5DS6A 4IRUA 2VB6A 2GFHA 2I15A 1O5HA 3LESA 3MYIA 4Z9HA 4C3DA 4OIOF 4CDAA 3N0TA 4N6HA 3ZTMA 2UUHA 3S90A 3WAQA 5KYXA 3R2PA 2L81A 3ECSA 4JTDB 3MX3A 1M6TA 4CIHA 1V55C 2WB7A 4BG0A 1HMDA 3NYJA 5BQHA 1ORYA 2VCBA 1BR2A 4K1OA 4RBNA 2XLEA 4BJ5C 5BQGA 3GODA 2Y3DA 3O55A 4KC9A 4A4AA 3AG2C 1RKCA 5COMA 1EKYA 1QVXA 3A9CA 4EBJA 5A6BD 3GANA 2XRHA 2PF4E 1UG7A 1ZW2A 3PCVA 2X51A 3ASOC 4XQ1A 2R7UA 4IAOA 1R5ID 3GM2A 5E2QA 1NLXA 1F1MA 4BJ5A 2R7OA 3OEOA 4JJGA 3EGXA 4KNWA 2NPUA 2EPMX 1QQ3A 4NCQA 1A7VA 2WVOA 4O6NA 2A69F 3DAFA 2PNOA 1TFKB 3GWNA 1ZHYA 2HMZA 4AK9A 1LVKA 3SXYA 4O6MA 2XLWA 3EG9B 4PJMA 3DXJF 4JEAA 3ZSUA 4J30B 3NMIA 3TQOA 1VMAA 4IAQA 3W2WA 5HSWA 3MLGA 3GM3A 3EH1A 3T6BA 3LNRA 4EWCA 1RKEA 4MVOA 3DE9A 1NU7D 2JD3A 3UGOA 4JE9A 2X0CA 5EGYA 3KH2A 1E85A 5BUOA 2YL7A 1OCRC 4EKWA 4MTGA 2KC3A 1FMWA 2L6HA 3QTHA 5KYYB 1UFBA 3I4UA 1HY5A 2XLVA 5BQIA 5F5FA 2P1AA 3PDMP 2YQYA 5B1BC 1APCA 3HNIA 4RD9A 4YL1A 4DJ9A 3C62A 3X2QC 2QY9A 3FXHA 4N6CA 1SZIA 1J8YF 2P6VA 5COGA 5GPGB 1U6HA 4MS2A 4H4KC 4CJGA 3DMDA 3K1HA 3JRTA 4RDAA 2VASA 1Q0KA 3V5YA 4MQ9F 4E0HA 2H7OA 3G4ZA 3LNMB 2EPOA 3EZHA 3LS1A 4KBLA 1D0ZA 1G4US 4MW8A 4A2NB 3H2VA 3N2ZB 1HMOA 4YT4A 1SMYF 3NDBB 1YAUO 3DKAA 1D0XA 5KYXB 1TWHA 1EQ1A 3SXKA 1ZHXA 4Z9JA 4BJ1A 4G7OF 1A7DA 4NTFA 1K40A 5JP7A 4L6RA 1QPUA 2IM8A 5CI9A 4BJ6A 4E17A 4EIYA 2J7PA 3U2MA 2FGYA 2LFDA 2R9RB 2QUPA 2HJMA 4W8KA 3FOPA 3Q6NA 3NMJA 4MVRA 3VRCA 1E83A 1LI5A 2GA0A 4G78A 4DRHB 4HEAJ 5E3AA 5L3QA 3K1IA 1KNYA 3M1CB 1NFOA 5AC4A 2XS8A 3BRJA 5L0DA 1GM5A 1BZ4A 4NQFA 1WN0A 1Z3IX 1FFTC 4W8PA 1T5OA 1IZMA 2OJQA 4OD4A 1FNTc 5A6BA 4Q5SF 3UMKA 4X0RA 5B1AC 4AE4A 5JT4A 1PD1A 3GORA 1BR4A 1C17M 4IGGA 5T1DB 3VM6A 3GWLA 2XLOA 2Y3GA 4I3MA 3LAYA 3O39A 3U2LA 1RKEB 4J32B 4BJTA 5DQTA 3S27A 2ETSA 3N24A 2FFHA 3Q7GA 5F5HA 2BC5A 4LACB 2LK4A 2ZXWC 1ZW3A 2XM0A 2OKUA 2HSQA 2KQ9A 1JRAA 1Q0DA 4PJJA 5AGFA 4WABA 1HE1A 2ZD9A 3JTLO 3MYFA 2R25A 2YLGA 3O6XA 3EQLF 3SZRA 4E18A 3QVZA 4JCZA 3AQCA 2R7XA 3C18A 4P6IC 4PFPA 3TULA 3OWTA 3TD7A 2OG2A 3ZIBA 4DVYP 2FAPB 4NTAA 3U8PA 2R05A 2HV7A 3AGUA 3W2VA 1T6UA 4CJOA 3JYHA 3SYNA 3F46A 4XLNF 3RFYA 1MMDA 1OXBA 3H2UA 4YT5A 4DOZA 2E87A 3LJBA 5EHHA 4PJLA 1QLEC 2J0XA 2YWAA 3A11A 2IXPA 2L9JA 2VH3A 1VYKA 4ULWA 2J46A 2QLAA 2QNLA 3E9VA 5L0JA 1TWCA 1VB5A 1ZYRF 3AQBA 3C7JA 1CPQA 3K7DA 3DWWA 4P9FA 1TWAA 4QI2A 5COFA 3ZDLA 1OCOC 2HSBA 3GEIA 2LSEA 5E3CA 4E7ZA 1E84A 1NBBA 2KNHA 4U5CE 2HZ8A 4B6IA 4CDYA 4XLPF 3POVA 1WASA 4YWQA 2CDQA 4BPMA 3B0UX 4JURI 2A68F 5A6AA 2HFIA 4EHPA 2I8BA 4LDRA 2G3VA 4ANJA 3FVYA 4G0HA 1Y4CA 2XSEA 3B0PA 256BA 1G4WR 1NU9C 2DYRC 3DM9B 3JZ0A 4JVSA 4D4NA 2NSGA 4DVZA 1H9TA 1VTMP 4LERA 2EIKC 3JT1A 2AWYA 4ZLDA 3H65A 4U9EA 2NUPA 2J45A 4NC3A 3NYMA 4U5EE 2M4EA 1YLMA 1AEPA 3HNJA 4PK4A 4U5DE 4PFOA 4LDKA 1LE2A 2V3CC 4AE4B 1NZEA 1MMNA 4U5GA 3RF3A 5JVEA 3TJ5A 3T6GB 1JMWA 1I5NA 1ZZPA 2CCYA 2JPUA 1H7IA 3QVYA
chains in the Genus database with same CATH topology
4YT8A 4EBBA 4OIQF 1LS1A 3NKDA 4CS8A 2CGEA 2H7VC 2B0JA 2KGOA 3HJCA 3EGDA 4IWBA 4CS7A 2J9VA 3DM5A 3PMRA 3EH2A 2HV6A 2J0WA 2R7TA 3DJUB 2IYLD 3HTKC 3FAJA 4C3EA 3K6BA 2PX3A 3UGPA 4KI2A 2G3KA 4N06A 4GYTA 2W9YA 4PJNA 4BJ6C 1OCCC 5DQZA 3UMIA 1OKKD 2Q9BA 5IY5C 1TR2A 1M2VA 1Z63A 4QDLA 3FDQA 3X1OA 3K1IC 4CSAA 4YT2A 3SP1A 2WZLA 1VOMA 2A6HF 3PHF2 2XXAA 1BR1A 2CNWD 3UNGC 2NUPB 3T4RA 2W45A 1FMVA 4U5HA 1M57C 2P7VA 2KW3C 1QZXA 2Y69C 2J9WA 3WG7C 5D92A 3EFOA 3NKEA 3UR3C 1ZHZA 1SF8A 4E7SA 4G7HF 3L0IA 5D91A 3LEVA 1D1BA 3W8HA 1D1CA 1VYIA 1TKNA 4DBQA 3V7OA 5L3VA 3EGDB 4U5FE 5DVWA 4AX2A 4XTKA 2YZSA 4C3BA 5KYWB 2Y3HA 2WL8A 1RJ9B 4FX5A 1V54C 2WVQA 3ASNC 2ZPAA 2QTVA 3CQZA 2O9XA 3S29A 4NY3A 3LLIA 1ZU4A 3QMKA 1IW7F 3NYLA 4M63A 2Z15A 5T3TA 2NUTA 1M2VB 4G7ZF 1TWGA 4OIPF 2R7RA 4JZAA 3L34A 3IEEA 1J8MF 4BEJA 4CS9C 3LLKA 2IXOA 4F4BA 5CI8A 1OKKA 3FHDA 4HFFB 3EHMA 1W2WA 2XXAB 1PD0A 4CS9A 1D0YA 4I44A 1LKXA 1KU2A 3ABMC 3DAGA 2A1DD 3OA1A 1PCXA 3CZ6A 4HE8D 2Q9CA 2OCCC 3EFOB 4OIRF 3DD7A 3EHNA 3ITFA 3SNHA 4CS8C 4JCHA 3K33A 3NG1A 4HFKB 2YHSA 2CNWA 2Q9AA 4Q7CA 3LS0A 3NRHA 4KNVA 3VAYA 3F47A 3KKBA 1JPJA 4O79A 4MNDA 4XWJA 3EPVA 2XL4A 3ZC4A 1ZHWA 4LLEA 1N1CA 4WJ0A 2MWQA 4C7OA 2H7BA 1OCZC 2G62A 3QZCA 3AG3C 5KYWA 1RJ9A 4ZLCA 2EINC 4I1OB 3RH3A 1M2OA 2C03A 2ZXOA 5DS5A 4FWVA 1Z23A 2ZXPA 2NUTB 2Y39A 3SEOA 1ZHTA 3I5QA 4CSAC 1ST6A 4CBEA 4LLCA 3I5PA 2DYSC 1Z5ZA 2CW0F 4O7GA 1MNEA 2BE5F 3UMHA 3VYWA 1D1AA 1FTSA 5KYUA 3W8IA 2R7QA 4O6YA 2WZFA 3ABKC 2KJGA 1S7ZA 3JCUQ 2EIJC 2J9UA 5B3SC 4DBRA 3JSZA 3KL4A 3RKOF 4YN0B 3RYLA 4IJJA 2PFDA 2Q3TA 4YWQA 2PP4A 4QI0A 5DS4A 3ZVRA 4U5BE 3S0XA 1G8XA 1MNDA 1MMAA 1O87A 2IXMA 2EILC 3KMIA 3E70C 1JPNA 1ZU5A 3AG1C 4K7BA 4FESA 3WODF 5CI9A 4JW1A 3ABLC 5DLJA 4GEHA 2DGJA 4C7OB 4Q4ZF 3EGXB 1M56C 3B9QA 3EJNA 3Q7LA 3ZG1A 3CSKA 2A6EF 4OD5A 1FFHA 2D5RB 2NG1A 2R7VA 3S28A 1NG1A 2PX0A 4I1MA 3B0VC 3DZAA 2ZXRA 3DJNB 2IXNA 2EIMC 3EG9A 3HLZA 4JJFA 2V26A 2W4BA 3EZIA 1VK5A 4K0DA 5FCLA 2R7WA 5E33A 2WZGA 3AG4C 2R7SA 2C04A 3K66A 5KYYA 5KYUB 2Y3BA 2WVNA 1WGWA 3Q6MA 5KYNA 2MYSA 4OINF 2W4MA 2YEVA 1MMGA 3RIPA 2IOQA 1Z6AA 2J7PD 5T3WA 4YJWA 3T6JA 5DS6A 4IRUA 2VB6A 2GFHA 1O5HA 3LESA 4C3DA 4OIOF 3N0TA 5KYXA 2L81A 3ECSA 3MX3A 4CIHA 1V55C 2WB7A 4BG0A 3NYJA 1BR2A 4RBNA 4BJ5C 3GODA 2Y3DA 4KC9A 3AG2C 3GANA 2XRHA 2PF4E 2X51A 3ASOC 2R7UA 4IAOA 5E2QA 4BJ5A 2R7OA 3OEOA 4JJGA 3EGXA 4KNWA 2WVOA 4O6NA 2A69F 3DAFA 1ZHYA 4AK9A 1LVKA 4O6MA 3EG9B 4PJMA 3DXJF 3ZSUA 4J30B 1VMAA 3W2WA 5HSWA 3MLGA 3EH1A 3T6BA 3LNRA 4EWCA 3UGOA 1NU7D 2JD3A 5EGYA 3KH2A 5BUOA 1OCRC 1FMWA 5KYYB 3I4UA 5F5FA 5B1BC 4RD9A 3X2QC 2QY9A 1SZIA 1J8YF 2P6VA 4H4KC 3DMDA 3K1HA 3JRTA 4RDAA 2VASA 4MQ9F 2H7OA 4KBLA 3EZHA 3LS1A 1D0ZA 4A2NB 3N2ZB 4YT4A 1SMYF 3NDBB 1D0XA 5KYXB 1TWHA 4G7OF 1ZHXA 4BJ1A 4BJ6A 2J7PA 2FGYA 4W8KA 3Q6NA 4HEAJ 5E3AA 5L3QA 3M1CB 1Z3IX 1FFTC 1IZMA 4OD4A 4Q5SF 3UMKA 4X0RA 5B1AC 4AE4A 1PD1A 1BR4A 5T1DB 2Y3GA 4I3MA 3LAYA 3O39A 4J32B 4BJTA 5DQTA 3S27A 3N24A 2FFHA 3Q7GA 5F5HA 4LACB 2ZXWC 2KQ9A 4PJJA 3O6XA 3EQLF 3SZRA 3AQCA 2R7XA 4PFPA 4P6IC 3OWTA 3TD7A 2OG2A 3ZIBA 4DVYP 3W2VA 2HV7A 3JYHA 3SYNA 3F46A 4XLNF 3RFYA 1MMDA 4YT5A 4DOZA 2E87A 3LJBA 5EHHA 4PJLA 1QLEC 2J0XA 2IXPA 2L9JA 2VH3A 1VYKA 4ULWA 2J46A 3E9VA 1TWCA 3K7DA 1ZYRF 3AQBA 1TWAA 4QI2A 1OCOC 5E3CA 2LSEA 4E7ZA 2KNHA 4U5CE 4B6IA 3POVA 4XLPF 2CDQA 3B0UX 4JURI 2A68F 2I8BA 2G3VA 4ANJA 3FVYA 4G0HA 2XSEA 3B0PA 2DYRC 3DM9B 1NU9C 4JVSA 4DVZA 4LERA 2EIKC 3JT1A 4ZLDA 3H65A 2NUPA 2J45A 3NYMA 4U5EE 2M4EA 4U5DE 4PK4A 4PFOA 2V3CC 4AE4B 1NZEA 1MMNA 4U5GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I3M A;  3LNR A;  4I44 A; 
#chains in the Genus database with same CATH topology
 3ZQV A;  4YT8 A;  4EBB A;  2VCA A;  4IB4 A;  4OIQ F;  1LS1 A;  3NKD A;  4CS8 A;  1CGM E;  1TQG A;  2CGE A;  2Q4F A;  4J7T A;  1YA7 O;  2H7V C;  1ORS C;  1OW8 A;  2B0J A;  3AJM A;  2KGO A;  2R03 A;  1CGN A;  3L1M A;  1LS4 A;  5JLI A;  3HJC A;  3EGD A;  4IWB A;  2YVK A;  2LIG A;  1Q0M A;  2J9V A;  4CS7 A;  3DM5 A;  3PMR A;  3RW0 A;  3TK0 A;  3EH2 A;  2HV6 A;  2J0W A;  3IQT A;  4WGY A;  4XPW A;  1CPR A;  2LD6 A;  4JTA B;  2R7T A;  1L7C A;  5L0H A;  3DJU B;  2IYL D;  1XWJ A;  1ZVZ A;  3HTK C;  3FAP B;  2XLD A;  3FAJ A;  1YZA A;  2OU6 A;  4CDV A;  4MW3 A;  2YL1 A;  3K6B A;  4MVS A;  4C3E A;  1HE9 A;  2PX3 A;  3UGP A;  2JX0 A;  3HKK A;  2H8A A;  4KI2 A;  2YLD A;  2G3K A;  5L0F A;  2AVK A;  3IQ5 A;  4N06 A;  4GYT A;  2W9Y A;  4JEB A;  4PJN A;  4BJ6 C;  1OCC C;  1Q0F A;  3UMI A;  1OKK D;  2XLM A;  2Q7R A;  5DQZ A;  2Q9B A;  4P9T A;  2XLH A;  4WGZ A;  5A69 A;  1TR2 A;  2ICW G;  5IY5 C;  4R32 A;  1M2V A;  2CYD A;  1GQA A;  1OQC A;  2RSE B;  1Z63 A;  4XPY A;  4QDL A;  3KYI A;  3U9M A;  3FDQ A;  3X1O A;  1NSG B;  2IBF A;  3K1I C;  4CSA A;  4YT2 A;  2AWC A;  2OEX A;  3SP1 A;  2J8W A;  2WZL A;  1R4T A;  1VOM A;  3MBG A;  3FOO A;  2A6H F;  3PHF 2;  3RVY A;  1GS9 A;  2MHR A;  2YL3 A;  3QW1 A;  4JC7 A;  2XXA A;  4DRJ B;  4Z9I A;  1H6G A;  1BR1 A;  2AU5 A;  1YDI A;  2CNW D;  3UNG C;  2NUP B;  1S05 A;  2YKZ A;  3T4R A;  2W45 A;  1YZC A;  1FMV A;  1HW1 A;  4U5H A;  1M57 C;  1OW6 A;  2P7V A;  2KW3 C;  2GDC A;  3IQC A;  4C7O B;  1QZX A;  2Y69 C;  2J9W A;  4H54 A;  4ULV A;  5D92 A;  3WG7 C;  5HV9 A;  3EFO A;  2XL8 A;  4J7Y A;  1LPE A;  3NKE A;  3C8Z A;  3UR3 C;  1ZHZ A;  1SF8 A;  2DI3 A;  4JIO A;  4E7S A;  4G7H F;  2QE9 A;  3C8G D;  1LE4 A;  3L0I A;  3LEV A;  4ONS A;  1QSP A;  5D91 A;  1D1B A;  1K04 A;  2VCC A;  1OXK A;  1E2X A;  3W8H A;  1A41 A;  1T6Q A;  1D1C A;  1VYI A;  1TKN A;  1H9G A;  1CGO A;  4DBQ A;  1XZQ A;  2PBE A;  3V7O A;  4EBK A;  5L3V A;  3EGD B;  4U5F E;  3FMS A;  3LEO A;  5DVW A;  4AX2 A;  4XTK A;  2YZS A;  4C3B A;  5JSL A;  5KYW B;  2Y3H A;  2TMV P;  2WL8 A;  1RJ9 B;  4FX5 A;  1C02 A;  1V54 C;  2WVQ A;  3ASN C;  4YK5 A;  3LUT B;  1QKR A;  2ZPA A;  2M64 A;  2GAQ A;  2QTV A;  5EK0 A;  3DE8 A;  2B0H A;  3CQZ A;  2O9X A;  3S29 A;  4JRZ A;  4NY3 A;  4E0I A;  3LLI A;  3RYL A;  1I4Z A;  4XPX A;  3JRM O;  1NFN A;  1ZU4 A;  1B68 A;  3O10 A;  3QMK A;  1IW7 F;  3NYL A;  4JTC B;  1T6I A;  4M63 A;  3ZWI A;  2Z15 A;  1T01 A;  3IPM O;  4BEM J;  1VLT A;  3GEH A;  5T3T A;  2NUT A;  4DRI B;  1M2V B;  3NMK A;  4G7Z F;  1LM3 B;  1TWG A;  4OIP F;  1HW2 A;  2YL0 A;  1ORJ A;  2AP3 A;  4JZA A;  3L34 A;  2R7R A;  3IEE A;  3B29 A;  1J8M F;  4BEJ A;  1FAP B;  1GGQ A;  1K05 A;  4CS9 C;  3HNK A;  1PV3 A;  2IXO A;  2L6F A;  3LLK A;  3TJ6 A;  4F4B A;  5CI8 A;  2DB4 A;  1DOW A;  2OJE D;  3DI5 A;  1OKK A;  4NTB A;  4D4X A;  3FHD A;  4HFF B;  1WTY A;  3EHM A;  1W2W A;  2HKV A;  3JSE O;  1LI7 A;  1DOV A;  2XXA B;  1PD0 A;  1YA9 A;  4PAC A;  3US6 A;  2LP4 A;  4ER9 A;  4CS9 A;  1D0Y A;  2KK1 A;  3RQE A;  3S84 A;  4FAP B;  4I44 A;  1LKX A;  5FZT A;  1KU2 A;  4AL1 A;  1FR0 A;  2KSF A;  3ABM C;  3DAG A;  2A1D D;  3OA1 A;  1PCX A;  3CZ6 A;  4HE8 D;  1AVO B;  2Q9C A;  2OCC C;  5A6K A;  3HNL A;  3EFO B;  4OIR F;  3DD7 A;  3EHN A;  3ITF A;  3SNH A;  3SXZ A;  3R7C A;  3KYJ A;  4CS8 C;  4JCH A;  5JRA A;  1BDJ B;  1JR8 A;  3K33 A;  3NG1 A;  4HFK B;  2YHS A;  2A0U A;  2CNW A;  2Q9A A;  4Q7C A;  3L8I A;  3M79 A;  3U3B A;  3M4B A;  1SYQ A;  3LS0 A;  3NRH A;  4JKV A;  4KNV A;  5TJ5 E;  1A0B A;  1YAR O;  2ASR A;  2OOC A;  4MVQ A;  3VAY A;  3F47 A;  4YL3 A;  5CIV A;  3KKB A;  1JPJ A;  4O79 A;  5L0I A;  3M4C A;  4MND A;  4IAR A;  4XWJ A;  3EPV A;  2XL4 A;  2A0B A;  3ZC4 A;  1ZHW A;  4LLE A;  2EPK X;  1N1C A;  4WJ0 A;  2MWQ A;  3C8G A;  3G50 A;  4C7O A;  2H7B A;  3IHU A;  1OCZ C;  3RQF A;  2G62 A;  3BEH A;  3QZC A;  3AG3 C;  4CIP A;  5KYW A;  1WWP A;  1C03 A;  1RJ9 A;  4ZLC A;  2EIN C;  1G5Z A;  4MVZ A;  4XEK A;  5F28 E;  4I1O B;  3RH3 A;  1M2O A;  2P0N A;  2C03 A;  2ZXO A;  3ZTZ A;  3SXM A;  5DS5 A;  3J06 A;  4FWV A;  1Z23 A;  2ZXP A;  4YL0 A;  2NSF A;  2NUT B;  3V5Z A;  2Y39 A;  1MQV A;  2XS1 A;  3SEO A;  1ZHT A;  3I5Q A;  4CSA C;  1BBH A;  1ST6 A;  2EPN A;  3ZQY A;  1XZP A;  4AL0 A;  4CBE A;  3B71 A;  4LLC A;  5JS5 A;  3I5P A;  2DYS C;  1Z5Z A;  5L0C A;  2CW0 F;  4O7G A;  1MNE A;  2BE5 F;  3UMH A;  3VYW A;  5AC5 A;  1D1A A;  1FTS A;  3T9O A;  3VF0 A;  1RMV A;  3IQ6 A;  2Q00 A;  3M15 A;  3U0C A;  5KYU A;  3W8I A;  2R7Q A;  4O6Y A;  2WZF A;  3ABK C;  2UUI A;  1LIH A;  4PR9 A;  2KJG A;  1S7Z A;  3JCU Q;  2EIJ C;  2J9U A;  5B3S C;  4MTF A;  4DBR A;  2P61 A;  3JSZ A;  3KL4 A;  3RKO F;  4YN0 B;  2RD9 A;  2YLI A;  1O3U A;  1U89 A;  2BL2 A;  2D4U A;  1EA8 A;  1RCP A;  1YYX A;  3AGT A;  3MFN A;  2J9B A;  2PFD A;  2Q3T A;  2PP4 A;  4IJJ A;  4QI0 A;  3U5S A;  3GM1 A;  2GWW A;  3ZVR A;  3GEE A;  1T9K A;  4U5B E;  3S0X A;  3U8V A;  1G8X A;  1YJG A;  1MND A;  1EI7 A;  3ATP A;  2OQM A;  2F22 A;  1MMA A;  3C63 A;  4MTO A;  4LDQ A;  1O87 A;  2IXM A;  2EIL C;  1V4A A;  3KMI A;  3E70 C;  1JPN A;  1ZU5 A;  3AG1 C;  4K7B A;  5A6J A;  1A7E A;  5JUA A;  1V74 B;  4FES A;  3WOD F;  1VLS A;  2HJ3 A;  1WAT A;  3C8G B;  3ABL C;  4JW1 A;  2HS5 A;  1OR2 A;  2DGJ A;  4GEH A;  1Y6D A;  1I4Y A;  2LQG A;  3U9J A;  5DLJ A;  1WOL A;  4Q4Z F;  2XL6 A;  1OW7 A;  3EGX B;  1M56 C;  2XM4 A;  3B9Q A;  4XEV A;  1E86 A;  2VC9 A;  4GQH A;  3EJN A;  3U3F A;  1RXQ A;  3Q7L A;  3RVZ A;  3ZG1 A;  3CSK A;  1KTM A;  2A6E F;  4OD5 A;  1FFH A;  2D5R B;  2NG1 A;  2R7V A;  3S28 A;  1NG1 A;  2PX0 A;  5B3I A;  4I1M A;  3W4Y A;  4CX9 A;  3B0V C;  2HUJ A;  3DZA A;  2ZXR A;  4EUK B;  3DJN B;  4UDV A;  1AUE A;  2IXN A;  2EIM C;  3EG9 A;  3HLZ A;  5L0G A;  3CEX A;  4JJF A;  3WHN A;  2V26 A;  2W4B A;  3EZI A;  3KPH A;  1VK5 A;  4K0D A;  5FCL A;  2R7W A;  2OEV A;  5E33 A;  2WZG A;  3TOL A;  3AG4 C;  3CAX A;  2L6G A;  1Q0G A;  2EPL X;  2HMQ A;  4U9D A;  4XEF A;  2R7S A;  2LCH A;  2C04 A;  3K66 A;  3S9O A;  2YRF A;  1L3P A;  5KYY A;  1JOG A;  2Y3B A;  5KYU B;  5K0I A;  2WVN A;  3G4X A;  1WGW A;  1YVI A;  1SR2 A;  2KYH A;  3TOM A;  3JYY A;  3QW0 A;  4MVU A;  3Q6M A;  4N4W A;  5KYN A;  3RQG A;  2MYS A;  5DS4 A;  4MVM A;  4OIN F;  2W4M A;  1U0B B;  2YEV A;  1MMG A;  3RIP A;  2IOQ A;  3V5X A;  4DXW A;  2LFF A;  1Z6A A;  1JAF A;  3AOU A;  1OR3 A;  3L8J A;  1Z7Q c;  2J7P D;  1YYJ A;  2L7A A;  2R02 A;  4YJW A;  1TFO B;  5T3W A;  3T6J A;  5DS6 A;  4IRU A;  2VB6 A;  2GFH A;  2I15 A;  1O5H A;  3LES A;  3MYI A;  4Z9H A;  4C3D A;  4OIO F;  4CDA A;  3N0T A;  4N6H A;  3ZTM A;  2UUH A;  3S90 A;  3WAQ A;  5KYX A;  3R2P A;  2L81 A;  3ECS A;  4JTD B;  3MX3 A;  1M6T A;  4CIH A;  1V55 C;  2WB7 A;  4BG0 A;  1HMD A;  3NYJ A;  5BQH A;  1ORY A;  2VCB A;  1BR2 A;  4K1O A;  4RBN A;  2XLE A;  4BJ5 C;  5BQG A;  3GOD A;  2Y3D A;  3O55 A;  4KC9 A;  4A4A A;  3AG2 C;  1RKC A;  5COM A;  1EKY A;  1QVX A;  3A9C A;  4EBJ A;  5A6B D;  3GAN A;  2XRH A;  2PF4 E;  1UG7 A;  1ZW2 A;  3PCV A;  2X51 A;  3ASO C;  4XQ1 A;  2R7U A;  4IAO A;  1R5I D;  3GM2 A;  5E2Q A;  1NLX A;  1F1M A;  4BJ5 A;  2R7O A;  3OEO A;  4JJG A;  3EGX A;  4KNW A;  2NPU A;  2EPM X;  1QQ3 A;  4NCQ A;  1A7V A;  2WVO A;  4O6N A;  2A69 F;  3DAF A;  2PNO A;  1TFK B;  3GWN A;  1ZHY A;  2HMZ A;  4AK9 A;  1LVK A;  3SXY A;  4O6M A;  2XLW A;  3EG9 B;  4PJM A;  3DXJ F;  4JEA A;  3ZSU A;  4J30 B;  3NMI A;  3TQO A;  1VMA A;  4IAQ A;  3W2W A;  5HSW A;  3MLG A;  3GM3 A;  3EH1 A;  3T6B A;  3LNR A;  4EWC A;  1RKE A;  4MVO A;  3DE9 A;  1NU7 D;  2JD3 A;  3UGO A;  4JE9 A;  2X0C A;  5EGY A;  3KH2 A;  1E85 A;  5BUO A;  2YL7 A;  1OCR C;  4EKW A;  4MTG A;  2KC3 A;  1FMW A;  2L6H A;  3QTH A;  5KYY B;  1UFB A;  3I4U A;  1HY5 A;  2XLV A;  5BQI A;  5F5F A;  2P1A A;  3PDM P;  2YQY A;  5B1B C;  1APC A;  3HNI A;  4RD9 A;  4YL1 A;  4DJ9 A;  3C62 A;  3X2Q C;  2QY9 A;  3FXH A;  4N6C A;  1SZI A;  1J8Y F;  2P6V A;  5COG A;  5GPG B;  1U6H A;  4MS2 A;  4H4K C;  4CJG A;  3DMD A;  3K1H A;  3JRT A;  4RDA A;  2VAS A;  1Q0K A;  3V5Y A;  4MQ9 F;  4E0H A;  2H7O A;  3G4Z A;  3LNM B;  2EPO A;  3EZH A;  3LS1 A;  4KBL A;  1D0Z A;  1G4U S;  4MW8 A;  4A2N B;  3H2V A;  3N2Z B;  1HMO A;  4YT4 A;  1SMY F;  3NDB B;  1YAU O;  3DKA A;  1D0X A;  5KYX B;  1TWH A;  1EQ1 A;  3SXK A;  1ZHX A;  4Z9J A;  4BJ1 A;  4G7O F;  1A7D A;  4NTF A;  1K40 A;  5JP7 A;  4L6R A;  1QPU A;  2IM8 A;  5CI9 A;  4BJ6 A;  4E17 A;  4EIY A;  2J7P A;  3U2M A;  2FGY A;  2LFD A;  2R9R B;  2QUP A;  2HJM A;  4W8K A;  3FOP A;  3Q6N A;  3NMJ A;  4MVR A;  3VRC A;  1E83 A;  1LI5 A;  2GA0 A;  4G78 A;  4DRH B;  4HEA J;  5E3A A;  5L3Q A;  3K1I A;  1KNY A;  3M1C B;  1NFO A;  5AC4 A;  2XS8 A;  3BRJ A;  5L0D A;  1GM5 A;  1BZ4 A;  4NQF A;  1WN0 A;  1Z3I X;  1FFT C;  4W8P A;  1T5O A;  1IZM A;  2OJQ A;  4OD4 A;  1FNT c;  5A6B A;  4Q5S F;  3UMK A;  4X0R A;  5B1A C;  4AE4 A;  5JT4 A;  1PD1 A;  3GOR A;  1BR4 A;  1C17 M;  4IGG A;  5T1D B;  3VM6 A;  3GWL A;  2XLO A;  2Y3G A;  4I3M A;  3LAY A;  3O39 A;  3U2L A;  1RKE B;  4J32 B;  4BJT A;  5DQT A;  3S27 A;  2ETS A;  3N24 A;  2FFH A;  3Q7G A;  5F5H A;  2BC5 A;  4LAC B;  2LK4 A;  2ZXW C;  1ZW3 A;  2XM0 A;  2OKU A;  2HSQ A;  2KQ9 A;  1JRA A;  1Q0D A;  4PJJ A;  5AGF A;  4WAB A;  1HE1 A;  2ZD9 A;  3JTL O;  3MYF A;  2R25 A;  2YLG A;  3O6X A;  3EQL F;  3SZR A;  4E18 A;  3QVZ A;  4JCZ A;  3AQC A;  2R7X A;  3C18 A;  4P6I C;  4PFP A;  3TUL A;  3OWT A;  3TD7 A;  2OG2 A;  3ZIB A;  4DVY P;  2FAP B;  4NTA A;  3U8P A;  2R05 A;  2HV7 A;  3AGU A;  3W2V A;  1T6U A;  4CJO A;  3JYH A;  3SYN A;  3F46 A;  4XLN F;  3RFY A;  1MMD A;  1OXB A;  3H2U A;  4YT5 A;  4DOZ A;  2E87 A;  3LJB A;  5EHH A;  4PJL A;  1QLE C;  2J0X A;  2YWA A;  3A11 A;  2IXP A;  2L9J A;  2VH3 A;  1VYK A;  4ULW A;  2J46 A;  2QLA A;  2QNL A;  3E9V A;  5L0J A;  1TWC A;  1VB5 A;  1ZYR F;  3AQB A;  3C7J A;  1CPQ A;  3K7D A;  3DWW A;  4P9F A;  1TWA A;  4QI2 A;  5COF A;  3ZDL A;  1OCO C;  2HSB A;  3GEI A;  2LSE A;  5E3C A;  4E7Z A;  1E84 A;  1NBB A;  2KNH A;  4U5C E;  2HZ8 A;  4B6I A;  4CDY A;  4XLP F;  3POV A;  1WAS A;  4YWQ A;  2CDQ A;  4BPM A;  3B0U X;  4JUR I;  2A68 F;  5A6A A;  2HFI A;  4EHP A;  2I8B A;  4LDR A;  2G3V A;  4ANJ A;  3FVY A;  4G0H A;  1Y4C A;  2XSE A;  3B0P A;  256B A;  1G4W R;  1NU9 C;  2DYR C;  3DM9 B;  3JZ0 A;  4JVS A;  4D4N A;  2NSG A;  4DVZ A;  1H9T A;  1VTM P;  4LER A;  2EIK C;  3JT1 A;  2AWY A;  4ZLD A;  3H65 A;  4U9E A;  2NUP A;  2J45 A;  4NC3 A;  3NYM A;  4U5E E;  2M4E A;  1YLM A;  1AEP A;  3HNJ A;  4PK4 A;  4U5D E;  4PFO A;  4LDK A;  1LE2 A;  2V3C C;  4AE4 B;  1NZE A;  1MMN A;  4U5G A;  3RF3 A;  5JVE A;  3TJ5 A;  3T6G B;  1JMW A;  1I5N A;  1ZZP A;  2CCY A;  2JPU A;  1H7I A;  3QVY A; 
#chains in the Genus database with same CATH homology
 4YT8 A;  4EBB A;  4OIQ F;  1LS1 A;  3NKD A;  4CS8 A;  2CGE A;  2H7V C;  2B0J A;  2KGO A;  3HJC A;  3EGD A;  4IWB A;  4CS7 A;  2J9V A;  3DM5 A;  3PMR A;  3EH2 A;  2HV6 A;  2J0W A;  2R7T A;  3DJU B;  2IYL D;  3HTK C;  3FAJ A;  4C3E A;  3K6B A;  2PX3 A;  3UGP A;  4KI2 A;  2G3K A;  4N06 A;  4GYT A;  2W9Y A;  4PJN A;  4BJ6 C;  1OCC C;  5DQZ A;  3UMI A;  1OKK D;  2Q9B A;  5IY5 C;  1TR2 A;  1M2V A;  1Z63 A;  4QDL A;  3FDQ A;  3X1O A;  3K1I C;  4CSA A;  4YT2 A;  3SP1 A;  2WZL A;  1VOM A;  2A6H F;  3PHF 2;  2XXA A;  1BR1 A;  2CNW D;  3UNG C;  2NUP B;  3T4R A;  2W45 A;  1FMV A;  4U5H A;  1M57 C;  2P7V A;  2KW3 C;  1QZX A;  2Y69 C;  2J9W A;  3WG7 C;  5D92 A;  3EFO A;  3NKE A;  3UR3 C;  1ZHZ A;  1SF8 A;  4E7S A;  4G7H F;  3L0I A;  5D91 A;  3LEV A;  1D1B A;  3W8H A;  1D1C A;  1VYI A;  1TKN A;  4DBQ A;  3V7O A;  5L3V A;  3EGD B;  4U5F E;  5DVW A;  4AX2 A;  4XTK A;  2YZS A;  4C3B A;  5KYW B;  2Y3H A;  2WL8 A;  1RJ9 B;  4FX5 A;  1V54 C;  2WVQ A;  3ASN C;  2ZPA A;  2QTV A;  3CQZ A;  2O9X A;  3S29 A;  4NY3 A;  3LLI A;  1ZU4 A;  3QMK A;  1IW7 F;  3NYL A;  4M63 A;  2Z15 A;  5T3T A;  2NUT A;  1M2V B;  4G7Z F;  1TWG A;  4OIP F;  2R7R A;  4JZA A;  3L34 A;  3IEE A;  1J8M F;  4BEJ A;  4CS9 C;  3LLK A;  2IXO A;  4F4B A;  5CI8 A;  1OKK A;  3FHD A;  4HFF B;  3EHM A;  1W2W A;  2XXA B;  1PD0 A;  4CS9 A;  1D0Y A;  4I44 A;  1LKX A;  1KU2 A;  3ABM C;  3DAG A;  2A1D D;  3OA1 A;  1PCX A;  3CZ6 A;  4HE8 D;  2Q9C A;  2OCC C;  3EFO B;  4OIR F;  3DD7 A;  3EHN A;  3ITF A;  3SNH A;  4CS8 C;  4JCH A;  3K33 A;  3NG1 A;  4HFK B;  2YHS A;  2CNW A;  2Q9A A;  4Q7C A;  3LS0 A;  3NRH A;  4KNV A;  3VAY A;  3F47 A;  3KKB A;  1JPJ A;  4O79 A;  4MND A;  4XWJ A;  3EPV A;  2XL4 A;  3ZC4 A;  1ZHW A;  4LLE A;  1N1C A;  4WJ0 A;  2MWQ A;  4C7O A;  2H7B A;  1OCZ C;  2G62 A;  3QZC A;  3AG3 C;  5KYW A;  1RJ9 A;  4ZLC A;  2EIN C;  4I1O B;  3RH3 A;  1M2O A;  2C03 A;  2ZXO A;  5DS5 A;  4FWV A;  1Z23 A;  2ZXP A;  2NUT B;  2Y39 A;  3SEO A;  1ZHT A;  3I5Q A;  4CSA C;  1ST6 A;  4CBE A;  4LLC A;  3I5P A;  2DYS C;  1Z5Z A;  2CW0 F;  4O7G A;  1MNE A;  2BE5 F;  3UMH A;  3VYW A;  1D1A A;  1FTS A;  5KYU A;  3W8I A;  2R7Q A;  4O6Y A;  2WZF A;  3ABK C;  2KJG A;  1S7Z A;  3JCU Q;  2EIJ C;  2J9U A;  5B3S C;  4DBR A;  3JSZ A;  3KL4 A;  3RKO F;  4YN0 B;  3RYL A;  4IJJ A;  2PFD A;  2Q3T A;  4YWQ A;  2PP4 A;  4QI0 A;  5DS4 A;  3ZVR A;  4U5B E;  3S0X A;  1G8X A;  1MND A;  1MMA A;  1O87 A;  2IXM A;  2EIL C;  3KMI A;  3E70 C;  1JPN A;  1ZU5 A;  3AG1 C;  4K7B A;  4FES A;  3WOD F;  5CI9 A;  4JW1 A;  3ABL C;  5DLJ A;  4GEH A;  2DGJ A;  4C7O B;  4Q4Z F;  3EGX B;  1M56 C;  3B9Q A;  3EJN A;  3Q7L A;  3ZG1 A;  3CSK A;  2A6E F;  4OD5 A;  1FFH A;  2D5R B;  2NG1 A;  2R7V A;  3S28 A;  1NG1 A;  2PX0 A;  4I1M A;  3B0V C;  3DZA A;  2ZXR A;  3DJN B;  2IXN A;  2EIM C;  3EG9 A;  3HLZ A;  4JJF A;  2V26 A;  2W4B A;  3EZI A;  1VK5 A;  4K0D A;  5FCL A;  2R7W A;  5E33 A;  2WZG A;  3AG4 C;  2R7S A;  2C04 A;  3K66 A;  5KYY A;  5KYU B;  2Y3B A;  2WVN A;  1WGW A;  3Q6M A;  5KYN A;  2MYS A;  4OIN F;  2W4M A;  2YEV A;  1MMG A;  3RIP A;  2IOQ A;  1Z6A A;  2J7P D;  5T3W A;  4YJW A;  3T6J A;  5DS6 A;  4IRU A;  2VB6 A;  2GFH A;  1O5H A;  3LES A;  4C3D A;  4OIO F;  3N0T A;  5KYX A;  2L81 A;  3ECS A;  3MX3 A;  4CIH A;  1V55 C;  2WB7 A;  4BG0 A;  3NYJ A;  1BR2 A;  4RBN A;  4BJ5 C;  3GOD A;  2Y3D A;  4KC9 A;  3AG2 C;  3GAN A;  2XRH A;  2PF4 E;  2X51 A;  3ASO C;  2R7U A;  4IAO A;  5E2Q A;  4BJ5 A;  2R7O A;  3OEO A;  4JJG A;  3EGX A;  4KNW A;  2WVO A;  4O6N A;  2A69 F;  3DAF A;  1ZHY A;  4AK9 A;  1LVK A;  4O6M A;  3EG9 B;  4PJM A;  3DXJ F;  3ZSU A;  4J30 B;  1VMA A;  3W2W A;  5HSW A;  3MLG A;  3EH1 A;  3T6B A;  3LNR A;  4EWC A;  3UGO A;  1NU7 D;  2JD3 A;  5EGY A;  3KH2 A;  5BUO A;  1OCR C;  1FMW A;  5KYY B;  3I4U A;  5F5F A;  5B1B C;  4RD9 A;  3X2Q C;  2QY9 A;  1SZI A;  1J8Y F;  2P6V A;  4H4K C;  3DMD A;  3K1H A;  3JRT A;  4RDA A;  2VAS A;  4MQ9 F;  2H7O A;  4KBL A;  3EZH A;  3LS1 A;  1D0Z A;  4A2N B;  3N2Z B;  4YT4 A;  1SMY F;  3NDB B;  1D0X A;  5KYX B;  1TWH A;  4G7O F;  1ZHX A;  4BJ1 A;  4BJ6 A;  2J7P A;  2FGY A;  4W8K A;  3Q6N A;  4HEA J;  5E3A A;  5L3Q A;  3M1C B;  1Z3I X;  1FFT C;  1IZM A;  4OD4 A;  4Q5S F;  3UMK A;  4X0R A;  5B1A C;  4AE4 A;  1PD1 A;  1BR4 A;  5T1D B;  2Y3G A;  4I3M A;  3LAY A;  3O39 A;  4J32 B;  4BJT A;  5DQT A;  3S27 A;  3N24 A;  2FFH A;  3Q7G A;  5F5H A;  4LAC B;  2ZXW C;  2KQ9 A;  4PJJ A;  3O6X A;  3EQL F;  3SZR A;  3AQC A;  2R7X A;  4PFP A;  4P6I C;  3OWT A;  3TD7 A;  2OG2 A;  3ZIB A;  4DVY P;  3W2V A;  2HV7 A;  3JYH A;  3SYN A;  3F46 A;  4XLN F;  3RFY A;  1MMD A;  4YT5 A;  4DOZ A;  2E87 A;  3LJB A;  5EHH A;  4PJL A;  1QLE C;  2J0X A;  2IXP A;  2L9J A;  2VH3 A;  1VYK A;  4ULW A;  2J46 A;  3E9V A;  1TWC A;  3K7D A;  1ZYR F;  3AQB A;  1TWA A;  4QI2 A;  1OCO C;  5E3C A;  2LSE A;  4E7Z A;  2KNH A;  4U5C E;  4B6I A;  3POV A;  4XLP F;  2CDQ A;  3B0U X;  4JUR I;  2A68 F;  2I8B A;  2G3V A;  4ANJ A;  3FVY A;  4G0H A;  2XSE A;  3B0P A;  2DYR C;  3DM9 B;  1NU9 C;  4JVS A;  4DVZ A;  4LER A;  2EIK C;  3JT1 A;  4ZLD A;  3H65 A;  2NUP A;  2J45 A;  3NYM A;  4U5E E;  2M4E A;  4U5D E;  4PK4 A;  4PFO A;  2V3C C;  4AE4 B;  1NZE A;  1MMN A;  4U5G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...