4I3MA

Aer2 poly-hamp domains: l44h hamp1 cw-lock mutant
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
150
structure length
150
Chain Sequence
HAVAQQRADRIATLLQSFADGQLDTAVGEAPAPGYERHYDSLRALQRQLREQRAELQQVESLEAGLAEMSRQHEAGWIDQTIPAERLEGRAARIAKGVNELVAAHIAVKMKVVSVVTAYGQGNFEPLMDRLPGKKAQITEAIDGVRERLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aerotaxis transducer Aer2
publication title HAMP Domain Conformers That Propagate Opposite Signals in Bacterial Chemoreceptors.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Signaling protein
total genus 60
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2012-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18575 HAMP_N3 HAMP N-terminal domain 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1530 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4i3mA00
3LNRA 4I44A 4I3MA
chains in the Genus database with same CATH superfamily
1OR3A 3J06A 1VLTA 3ASOC 3TQOA 5JUAA 4LERA 4KC9A 1NLXA 4YL3A 2YL0A 3ABKC 3O55A 5T1DB 1HW2A 2Y3GA 1VOMA 4E7SA 1BDJB 4YK5A 4DVYP 1R4TA 2VH3A 4XEFA 1KTMA 2XLOA 3O39A 4NTAA 3UGPA 3AG1C 3ZIBA 1RKEB 3QVZA 3DM5A 3RKOF 3V5XA 4P9TA 3B0PA 2O9XA 2VCAA 1Z6AA 2OU6A 1QZXA 1G8XA 2PFDA 2NPUA 3KYJA 1RXQA 3Q7GA 3RF3A 3U3BA 3U5SA 2ETSA 2L7AA 5A69A 1SZIA 3C7JA 3VM6A 3WAQA 5COGA 4MW3A 3ZQVA 5D91A 2XLVA 1YYXA 3LLKA 2Q9AA 3QMKA 2LD6A 2X0CA 1YZAA 3RW0A 3TJ5A 1YZCA 2XLMA 1LVKA 3GEHA 4OIRF 3U3FA 3T6JA 3SYNA 4YWQA 1HY5A 3KMIA 1GGQA 2GA0A 1O87A 2XLEA 2I8BA 3Q7LA 4PJJA 4ULWA 4RD9A 4OIPF 1O5HA 2W45A 2YQYA 1OW7A 3S9OA 5AC5A 4CS7A 1Q0KA 3EGDA 1M2OA 3KPHA 1OXKA 3LS0A 3SXMA 2HJ3A 1HW1A 4IAQA 2XLHA 1E84A 3HTKC 2H7VC 3EH1A 3FAPB 2HMQA 2OJQA 2C04A 4MNDA 4MTGA 2DYRC 4XPXA 4MVUA 4C7OB 5KYNA 1VMAA 2J45A 4CDYA 1UG7A 1LE4A 3DAGA 2QUPA 4D4NA 3LEOA 2HFIA 1F1MA 3NMJA 2R02A 4MVRA 1A0BA 4YT5A 4HEAJ 2BC5A 3TJ6A 1JR8A 3EH2A 4JKVA 4RDAA 2HKVA 4B6IA 3C8ZA 4H4KC 3ZWIA 3H2UA 4CIPA 5KYYA 4CIHA 2XXAB 2W4MA 5EGYA 2GDCA 3G4XA 5L3QA 1RCPA 1ZHTA 3L8JA 3TK0A 4OIOF 1D0XA 4WJ0A 4CS8A 4W8PA 1RMVA 4K1OA 2W4BA 2RD9A 3K66A 4XEKA 5F28E 2NUPA 5T3TA 2CCYA 2G62A 1T6QA 3NG1A 4J7TA 3KYIA 4E0IA 3K1HA 3DWWA 2J46A 5JVEA 1G4WR 2VASA 3KH2A 4PJMA 3EJNA 3E70C 1NFOA 2OKUA 3S90A 4N4WA 4WGZA 3W8IA 2MWQA 3ASNC 3MLGA 3HNLA 3JRTA 4LACB 3LNMB 3AOUA 1K40A 2R7RA 2HJMA 3UMHA 3AQBA 4J30B 4QI2A 1EI7A 2P7VA 4JJGA 2EPOA 2Y39A 4KNVA 4IWBA 1RKEA 4CS8C 3RIPA 4O6MA 4Q5SF 2KC3A 1TFKB 5L3VA 2Q7RA 4C3EA 1G5ZA 4EIYA 1CGOA 1MQVA 2KJGA 4EUKB 1Q0FA 3SZRA 3PHF2 2M64A 3BRJA 2VCCA 2OJED 3WODF 2OQMA 2JPUA 2AWYA 2DI3A 2XL4A 3Q6NA 1YAUO 2J7PA 5F5HA 3U8VA 1QLEC 3JYHA 1LKXA 1WATA 4EHPA 4GEHA 1FFTC 4PR9A 1NSGB 2V26A 3NKDA 2E87A 3H65A 3IHUA 1R5ID 3DJUB 4O6YA 3WG7C 4AX2A 4E17A 1S7ZA 4EBJA 3TOMA 1VLSA 1TWAA 3F47A 4BG0A 3LESA 3SP1A 1T6UA 2XS1A 4LDRA 3HLZA 1H9TA 3T6GB 4BEJA 3S0XA 1OKKA 4C3BA 4P9FA 3MYFA 2VB6A 1ORJA 3ZSUA 4O6NA 3GM2A 5B1BC 3U2LA 4ANJA 3POVA 2GAQA 5CIVA 3FAJA 4FWVA 1ZU5A 3NYMA 1ORSC 2P1AA 2EPLX 4HFFB 5E3AA 3V7OA 4CJOA 1LE2A 5COFA 2H7OA 4C7OA 4DXWA 3JZ0A 3MYIA 1GM5A 2XL6A 2EPKX 3HNKA 4YL1A 4CS9A 2BL2A 2HUJA 3FHDA 1T6IA 1T01A 5D92A 5DS4A 3C63A 4BJ6A 2M4EA 4YT8A 3JSZA 1V4AA 1A7DA 1ZYRF 2H8AA 4N06A 2VC9A 2XXAA 1UFBA 3MBGA 3TD7A 4G7OF 3TOLA 2EILC 3OA1A 3VRCA 1N1CA 1H9GA 1E86A 2J9WA 4JIOA 3JRMO 2DGJA 3JCUQ 2IXOA 1MNDA 4QI0A 3V5YA 1JRAA 4EBBA 4AK9A 2VCBA 1ZW3A 3W2VA 5JRAA 3EFOB 1OXBA 1IW7F 2XRHA 3DAFA 2WVNA 1D0YA 3N0TA 4JTCB 1FFHA 4CS9C 1JMWA 2HSBA 3OEOA 3T9OA 1V74B 5L0GA 4KI2A 3A9CA 4CJGA 3JSEO 4BJ6C 1V54C 4CBEA 3JTLO 4E7ZA 1IZMA 4ER9A 3PDMP 3AJMA 4Q7CA 5KYXB 4K7BA 1Y6DA 3HNJA 4FX5A 1H7IA 1V55C 2YL1A 4P6IC 4BJ1A 5TJ5E 3LLIA 3FMSA 2NG1A 5EHHA 2OG2A 3U8PA 4N6CA 5A6BA 2YEVA 3FXHA 1I5NA 1U89A 2R7QA 1G4US 4IAOA 4IJJA 2LK4A 4MW8A 1Z63A 4NCQA 4YT4A 4W8KA 1ZHWA 4JCHA 1ZHXA 1Y4CA 3DJNB 1ST6A 2IBFA 3M1CB 4I3MA 5JS5A 4DBRA 4PFOA 3CQZA 2ICWG 4NTBA 2KW3C 1VB5A 4JVSA 1Z7Qc 4LDKA 1OQCA 1TWHA 1VTMP 5BUOA 4O7GA 1YLMA 2G3VA 2G3KA 5JP7A 4QDLA 2A0UA 5DQTA 4YL0A 1Z23A 3EHNA 1GS9A 3HNIA 4YN0B 1OKKD 5E33A 2R7UA 1EKYA 2WZFA 5K0IA 1E85A 1NU9C 3PCVA 3SNHA 3X1OA 2AP3A 3U9MA 1PV3A 2D4UA 3HJCA 1K04A 4G7HF 2IXPA 3AGTA 3B0VC 4IB4A 1XZQA 4PFPA 3CAXA 2KGOA 2R25A 4U9EA 3SXYA 1AUEA 3VAYA 2FFHA 2R7TA 4DJ9A 5L0IA 1Q0GA 3NMIA 2QTVA 4MTOA 3MX3A 4I1MA 2YWAA 5BQHA 1XWJA 3C18A 1MMNA 2IOQA 1LI5A 1WGWA 2IXMA 2ZD9A 1SMYF 3T6BA 4X0RA 4O79A 2R7XA 1WASA 2JX0A 2ZXRA 1ZU4A 1M56C 3AGUA 3QW0A 5KYUB 5DLJA 2WVQA 3I5PA 4JW1A 2Q3TA 3RYLA 5BQIA 2R7WA 3N24A 4J7YA 1KNYA 2Q9BA 5E3CA 3SXKA 1HE9A 1Q0DA 3EFOA 3IQTA 4DRIB 2A0BA 3L34A 2KYHA 3US6A 2ASRA 4NQFA 3CZ6A 4NTFA 2WL8A 1TFOB 3RQFA 2J8WA 3GWLA 4EWCA 4G7ZF 3ECSA 2TMVP 1PD1A 1A7VA 1WTYA 3KL4A 3BEHA 3NRHA 5A6BD 1TKNA 4JEBA 3ZG1A 5KYXA 4ZLDA 2KQ9A 2LP4A 4XPYA 1K05A 3RQEA 4R32A 4HE8D 4IARA 3EPVA 5EK0A 1YA9A 3V5ZA 2QLAA 1C02A 3RH3A 1W2WA 1YARO 4DBQA 3ATPA 3UMIA 2J9UA 2P0NA 1BBHA 2EINC 3R2PA 4DRJB 4DVZA 1HMDA 2QE9A 3L8IA 2KSFA 1M2VB 2FGYA 1CPRA 1T9KA 1TWGA 2HV7A 2WZLA 1QSPA 4JC7A 3PMRA 1ZVZA 1NU7D 1D1AA 2CYDA 1WN0A 3I4UA 3IQ5A 3QVYA 1VK5A 2YL7A 2J0WA 4U5FE 3ZQYA 2LCHA 4A4AA 3QW1A 4U5CE 1I4ZA 2D5RB 1C17M 1VYIA 2AWCA 3KKBA 2EIMC 3S29A 1A7EA 1XZPA 3LAYA 3NYLA 3SXZA 4JURI 4Z9JA 2EIJC 4AL0A 3DE8A 4G0HA 5GPGB 3LJBA 5L0DA 1O3UA 4U5HA 2HS5A 4LLCA 3UNGC 5E2QA 1HMOA 1WOLA 1WWPA 2UUHA 4ULVA 3R7CA 4L6RA 3C62A 3W2WA 2DB4A 2UUIA 3JYYA 5HV9A 2X51A 3A11A 3E9VA 4XPWA 1GQAA 3AG3C 3K6BA 1TR2A 1RJ9B 2WVOA 3GM3A 1LM3B 3C8GB 4JTAB 3EGXB 2YLDA 2YZSA 4AE4B 2C03A 3CSKA 3LEVA 3DXJF 5B3IA 1EA8A 2L6FA 3DZAA 2LSEA 2YKZA 3N2ZB 1TWCA 3GEIA 1A41A 2L6HA 2JD3A 5COMA 3H2VA 3X2QC 1YYJA 3B0UX 3DE9A 4PJNA 1YJGA 5HSWA 4K0DA 1BR4A 3UMKA 5DVWA 1LPEA 3NKEA 4Q4ZF 5JLIA 5KYUA 2YLGA 4E0HA 2H7BA 1MMAA 2YRFA 1Z3IX 3S27A 3B71A 1I4YA 1MMDA 2NUTB 2ZXWC 2QNLA 3ZTZA 1BR2A 2HMZA 1JPJA 4IGGA 1FTSA 2B0JA 2XSEA 1JOGA 4KNWA 1YA7O 1QKRA 4H54A 3EQLF 4FESA 3U9JA 5DS6A 4CDAA 4U5BE 3I5QA 1ZHZA 3UGOA 3O6XA 4XWJA 3K33A 2OOCA 4YJWA 2AVKA 2MHRA 2EPNA 2J7PD 2QY9A 4U5EE 4XQ1A 2GFHA 3ZVRA 1PCXA 3DI5A 1OCRC 1VYKA 3MFNA 4U9DA 4AL1A 2XLDA 2Y3DA 4CDVA 4UDVA 4LDQA 1AEPA 1MNEA 3DKAA 4MVSA 5T3WA 2Q4FA 3UR3C 1BR1A 3K1IA 1M57C 3M4BA 2ZPAA 2P6VA 5F5FA 5JSLA 1D0ZA 2LQGA 2WB7A 1AVOB 2Y3HA 1M2VA 5IY5C 4JTDB 2R03A 1FNTc 2LFDA 4I44A 3TULA 4CSAA 2CNWA 2R7VA 3EHMA 3Q6MA 3GORA 5L0FA 4N6HA 2A69F 3EZIA 3F46A 4C3DA 2DYSC 4F4BA 2J9BA 2KNHA 2HV6A 3EG9B 1ZW2A 2HZ8A 3M15A 2Y3BA 4GYTA 4NC3A 2IM8A 2R05A 1YVIA 2EIKC 2OEXA 2ZXOA 4YT2A 2IYLD 2YHSA 1OCZC 2CW0F 1EQ1A 4HFKB 4OD4A 2R7SA 1NFNA 3LUTB 2XS8A 3K1IC 3AG4C 3QZCA 4A2NB 2XL8A 1OCOC 5DS5A 1ZHYA 2PF4E 4EKWA 4NY3A 2CGEA 1CGME 3NDBB 1FMWA 1QPUA 4U5GA 4ZLCA 2A68F 2MYSA 3VF0A 4CSAC 1PD0A 3FDQA 2XM0A 5KYWB 256BA 1U0BB 1T5OA 2NSFA 4JCZA 4WGYA 4IRUA 4J32B 1RJ9A 3GM1A 3SEOA 1Z5ZA 4D4XA 3RQGA 2PP4A 2GWWA 3C8GA 3IQ6A 1SR2A 2R7OA 3EGXA 4I1OB 2WZGA 4MVQA 4XEVA 3WHNA 4AE4A 2V3CC 3RFYA 2LFFA 4OD5A 1ORYA 2EPMX 4MVMA 3HKKA 3K7DA 3RVYA 3GEEA 1QQ3A 3U0CA 5BQGA 4JE9A 1TQGA 2L6GA 4KBLA 1J8YF 2B0HA 4MVZA 4Z9IA 3T4RA 2NSGA 4E18A 1SYQA 4MS2A 1L3PA 2L81A 2OEVA 2YVKA 4JEAA 2A6EF 3ZC4A 4DRHB 5FCLA 3QTHA 2NUTA 2PNOA 3FVYA 3ITFA 5CI8A 2I15A 4JZAA 3DD7A 3DM9B 1APCA 1FAPB 5AGFA 2PX0A 4JRZA 1JPNA 1NZEA 4GQHA 1QVXA 4BEMJ 5L0HA 3FOPA 2Q00A 1CGNA 1D1BA 1OCCC 3B29A 4JJFA 2W9YA 5L0CA 1ZZPA 1NG1A 2HSQA 4XTKA 3VYWA 3NYJA 2A1DD 5CI9A 3FOOA 4OINF 1LIHA 4MVOA 2YL3A 3OWTA 2A6HF 1YDIA 1B68A 3JT1A 3ZTMA 1H6GA 1SF8A 1DOWA 3ABMC 1Q0MA 4LLEA 2FAPB 2LIGA 1J8MF 4M63A 2CNWD 1OW8A 1BZ4A 3LS1A 2IXNA 4FAPB 1FMVA 3S84A 3ABLC 5AC4A 4OIQF 4EBKA 3W4YA 2Q9CA 2P61A 1MMGA 2YLIA 1LS4A 3AG2C 1M6TA 1L7CA 3EGDB 3L0IA 5L0JA 4PJLA 4BPMA 2L9JA 3G4ZA 4MTFA 5B3SC 3O10A 3U2MA 4DOZA 5FZTA 3NMKA 2R9RB 4BJ5A 2J9VA 2ZXPA 5A6AA 2KK1A 2AU5A 3S28A 1CPQA 3EG9A 5B1AC 1U6HA 3CEXA 3GODA 1NBBA 2XLWA 1S05A 3G50A 3GANA 3M79A 4U5DE 4RBNA 3RVZA 4Z9HA 4BJTA 4MQ9F 3IQCA 1E2XA 1C03A 3LNRA 1RKCA 4XLNF 4PK4A 1LS1A 4G78A 3B9QA 4PACA 2Z15A 3EZHA 4WABA 3M4CA 5DQZA 1FR0A 5KYYB 1DOVA 3AQCA 2BE5F 2J0XA 1LI7A 3C8GD 1OR2A 1KU2A 5KYWA 1D1CA 4ONSA 3GWNA 1HE1A 5JT4A 2PBEA 3W8HA 1OW6A 3IEEA 4BJ5C 5A6KA 1E83A 4XLPF 2NUPB 3DMDA 1JAFA 2Y69C 2PX3A 3IPMO 5A6JA 2RSEB 2OCCC 3L1MA 2XM4A 2F22A 3ZDLA 4CX9A 2CDQA
chains in the Genus database with same CATH topology
3ASOC 4LERA 4KC9A 3ABKC 5T1DB 2Y3GA 1VOMA 4E7SA 4DVYP 2VH3A 3O39A 3UGPA 3AG1C 3ZIBA 3DM5A 3RKOF 3B0PA 2O9XA 1Z6AA 1QZXA 1G8XA 2PFDA 3Q7GA 1SZIA 5D91A 3LLKA 2Q9AA 3QMKA 1LVKA 4OIRF 3T6JA 3SYNA 4YWQA 3KMIA 3Q7LA 1O87A 4PJJA 2I8BA 4ULWA 4RD9A 4OIPF 1O5HA 2W45A 4CS7A 3EGDA 1M2OA 3LS0A 3HTKC 2H7VC 3EH1A 2C04A 4MNDA 2DYRC 4C7OB 5KYNA 1VMAA 2J45A 3DAGA 4YT5A 4HEAJ 4B6IA 3EH2A 4RDAA 4H4KC 5KYYA 4CIHA 2XXAB 2W4MA 5EGYA 5L3QA 1ZHTA 4OIOF 1D0XA 4WJ0A 4CS8A 2W4BA 3K66A 2NUPA 5T3TA 2G62A 3NG1A 3K1HA 2J46A 3KH2A 2VASA 4PJMA 3EJNA 3E70C 3W8IA 2MWQA 3ASNC 3MLGA 3JRTA 4LACB 2R7RA 3UMHA 3AQBA 4J30B 2P7VA 4JJGA 2Y39A 4KNVA 4IWBA 4CS8C 3RIPA 4O6MA 4Q5SF 5L3VA 4C3EA 2KJGA 3SZRA 3PHF2 3WODF 2XL4A 3Q6NA 5F5HA 2J7PA 1QLEC 3JYHA 1LKXA 4GEHA 1FFTC 3NKDA 2V26A 2E87A 3H65A 4O6YA 3DJUB 3WG7C 4AX2A 1S7ZA 1TWAA 3F47A 4BG0A 3LESA 3SP1A 3HLZA 4BEJA 3S0XA 1OKKA 4C3BA 2VB6A 3ZSUA 4O6NA 5B1BC 4ANJA 3POVA 3FAJA 4FWVA 1ZU5A 3NYMA 4HFFB 5E3AA 3V7OA 2H7OA 4C7OA 4CS9A 5D92A 3FHDA 5DS4A 4BJ6A 2M4EA 4YT8A 3JSZA 1ZYRF 4N06A 2XXAA 3TD7A 4G7OF 2EILC 3OA1A 1N1CA 2J9WA 2DGJA 3JCUQ 2IXOA 1MNDA 4QI0A 4EBBA 4AK9A 3W2VA 3EFOB 1IW7F 2XRHA 3DAFA 2WVNA 1D0YA 3N0TA 1FFHA 4CS9C 4KI2A 3OEOA 4BJ6C 4CBEA 1V54C 4E7ZA 1IZMA 4Q7CA 5KYXB 4K7BA 4FX5A 4BJ1A 1V55C 4P6IC 3LLIA 2NG1A 5EHHA 2OG2A 2YEVA 4IAOA 2R7QA 4IJJA 1Z63A 4YT4A 4W8KA 1ZHWA 4JCHA 1ZHXA 3DJNB 1ST6A 3M1CB 4I3MA 4DBRA 4PFOA 3CQZA 2KW3C 4JVSA 1TWHA 5BUOA 4O7GA 2G3VA 2G3KA 5DQTA 4QDLA 1Z23A 3EHNA 4YN0B 1OKKD 5E33A 2R7UA 2WZFA 1NU9C 3SNHA 3X1OA 3HJCA 4G7HF 2IXPA 3B0VC 4PFPA 2KGOA 3VAYA 2FFHA 2R7TA 2QTVA 3MX3A 4I1MA 1MMNA 2IOQA 1WGWA 2IXMA 1SMYF 3T6BA 4X0RA 4O79A 2R7XA 2ZXRA 1ZU4A 1M56C 5KYUB 5DLJA 2WVQA 3I5PA 4JW1A 2Q3TA 3RYLA 2R7WA 3N24A 5E3CA 2Q9BA 3EFOA 3L34A 4EWCA 3CZ6A 2WL8A 4G7ZF 3ECSA 1PD1A 3KL4A 3NRHA 1TKNA 5KYXA 3ZG1A 4ZLDA 2KQ9A 4HE8D 3EPVA 3RH3A 1W2WA 4DBQA 3UMIA 2J9UA 2EINC 4DVZA 1M2VB 2FGYA 1TWGA 2HV7A 2WZLA 3PMRA 1NU7D 1D1AA 3I4UA 1VK5A 4U5FE 2J0WA 4U5CE 2D5RB 1VYIA 3KKBA 2EIMC 3S29A 3LAYA 3NYLA 4JURI 2EIJC 4G0HA 3LJBA 4U5HA 4LLCA 3UNGC 5E2QA 3W2WA 2X51A 3E9VA 3AG3C 3K6BA 1TR2A 1RJ9B 2WVOA 3EGXB 2YZSA 4AE4B 2C03A 3CSKA 3LEVA 3DXJF 3DZAA 2LSEA 3N2ZB 1TWCA 3X2QC 2JD3A 3B0UX 5HSWA 4PJNA 4K0DA 1BR4A 3UMKA 5DVWA 3NKEA 4Q4ZF 5KYUA 2H7BA 1MMAA 1Z3IX 3S27A 1MMDA 2NUTB 2ZXWC 1BR2A 1JPJA 1FTSA 2B0JA 2XSEA 4KNWA 3EQLF 4FESA 5DS6A 4U5BE 3I5QA 1ZHZA 3UGOA 3O6XA 4XWJA 3K33A 4YJWA 2QY9A 2J7PD 4U5EE 3ZVRA 2GFHA 1PCXA 4QI2A 1OCRC 1VYKA 2Y3DA 1MNEA 5T3WA 3UR3C 1BR1A 1M57C 2ZPAA 2P6VA 5F5FA 1D0ZA 2WB7A 2Y3HA 1M2VA 5IY5C 4CSAA 2R7VA 4I44A 2CNWA 3EHMA 3Q6MA 2A69F 3EZIA 3F46A 4C3DA 2DYSC 4F4BA 2KNHA 2HV6A 3EG9B 4GYTA 2Y3BA 2EIKC 2ZXOA 4YT2A 2IYLD 2YHSA 1OCZC 2CW0F 4HFKB 4OD4A 2R7SA 3K1IC 3AG4C 3QZCA 4A2NB 1OCOC 5DS5A 1ZHYA 2PF4E 3NDBB 4NY3A 2CGEA 1FMWA 4ZLCA 4U5GA 2A68F 2MYSA 4CSAC 1PD0A 3FDQA 5KYWB 4IRUA 4J32B 1RJ9A 3SEOA 1Z5ZA 2PP4A 2R7OA 3EGXA 4I1OB 2WZGA 4AE4A 2V3CC 3RFYA 4OD5A 3K7DA 4KBLA 1J8YF 3T4RA 2L81A 3ZC4A 2A6EF 5FCLA 2NUTA 3FVYA 3ITFA 5CI8A 4JZAA 3DD7A 3DM9B 2PX0A 1JPNA 1NZEA 1OCCC 1D1BA 4JJFA 2W9YA 1NG1A 4XTKA 3VYWA 3NYJA 2A1DD 5CI9A 4OINF 3OWTA 2A6HF 3JT1A 1SF8A 3ABMC 4LLEA 4M63A 1J8MF 2CNWD 3LS1A 2IXNA 1FMVA 4OIQF 3ABLC 2Q9CA 1MMGA 3AG2C 3L0IA 3EGDB 4PJLA 2L9JA 5B3SC 4DOZA 4BJ5A 2J9VA 2ZXPA 3S28A 3EG9A 5B1AC 3GODA 4RBNA 3GANA 4U5DE 4BJTA 4MQ9F 3LNRA 4XLNF 4PK4A 1LS1A 3B9QA 2Z15A 3EZHA 5DQZA 5KYYB 3AQCA 2BE5F 2J0XA 1KU2A 5KYWA 1D1CA 3W8HA 4BJ5C 3IEEA 4XLPF 2NUPB 3DMDA 2Y69C 2PX3A 2OCCC 2CDQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LNR A;  4I44 A;  4I3M A; 
#chains in the Genus database with same CATH topology
 1OR3 A;  3J06 A;  1VLT A;  3ASO C;  3TQO A;  5JUA A;  4LER A;  4KC9 A;  1NLX A;  4YL3 A;  2YL0 A;  3ABK C;  3O55 A;  5T1D B;  1HW2 A;  2Y3G A;  1VOM A;  4E7S A;  1BDJ B;  4YK5 A;  4DVY P;  1R4T A;  2VH3 A;  4XEF A;  1KTM A;  2XLO A;  3O39 A;  4NTA A;  3UGP A;  3AG1 C;  3ZIB A;  1RKE B;  3QVZ A;  3DM5 A;  3RKO F;  3V5X A;  4P9T A;  3B0P A;  2O9X A;  2VCA A;  1Z6A A;  2OU6 A;  1QZX A;  1G8X A;  2PFD A;  2NPU A;  3KYJ A;  1RXQ A;  3Q7G A;  3RF3 A;  3U3B A;  3U5S A;  2ETS A;  2L7A A;  5A69 A;  1SZI A;  3C7J A;  3VM6 A;  3WAQ A;  5COG A;  4MW3 A;  3ZQV A;  5D91 A;  2XLV A;  1YYX A;  3LLK A;  2Q9A A;  3QMK A;  2LD6 A;  2X0C A;  1YZA A;  3RW0 A;  3TJ5 A;  1YZC A;  2XLM A;  1LVK A;  3GEH A;  4OIR F;  3U3F A;  3T6J A;  3SYN A;  4YWQ A;  1HY5 A;  3KMI A;  1GGQ A;  2GA0 A;  1O87 A;  2XLE A;  2I8B A;  3Q7L A;  4PJJ A;  4ULW A;  4RD9 A;  4OIP F;  1O5H A;  2W45 A;  2YQY A;  1OW7 A;  3S9O A;  5AC5 A;  4CS7 A;  1Q0K A;  3EGD A;  1M2O A;  3KPH A;  1OXK A;  3LS0 A;  3SXM A;  2HJ3 A;  1HW1 A;  4IAQ A;  2XLH A;  1E84 A;  3HTK C;  2H7V C;  3EH1 A;  3FAP B;  2HMQ A;  2OJQ A;  2C04 A;  4MND A;  4MTG A;  2DYR C;  4XPX A;  4MVU A;  4C7O B;  5KYN A;  1VMA A;  2J45 A;  4CDY A;  1UG7 A;  1LE4 A;  3DAG A;  2QUP A;  4D4N A;  3LEO A;  2HFI A;  1F1M A;  3NMJ A;  2R02 A;  4MVR A;  1A0B A;  4YT5 A;  4HEA J;  2BC5 A;  3TJ6 A;  1JR8 A;  3EH2 A;  4JKV A;  4RDA A;  2HKV A;  4B6I A;  3C8Z A;  4H4K C;  3ZWI A;  3H2U A;  4CIP A;  5KYY A;  4CIH A;  2XXA B;  2W4M A;  5EGY A;  2GDC A;  3G4X A;  5L3Q A;  1RCP A;  1ZHT A;  3L8J A;  3TK0 A;  4OIO F;  1D0X A;  4WJ0 A;  4CS8 A;  4W8P A;  1RMV A;  4K1O A;  2W4B A;  2RD9 A;  3K66 A;  4XEK A;  5F28 E;  2NUP A;  5T3T A;  2CCY A;  2G62 A;  1T6Q A;  3NG1 A;  4J7T A;  3KYI A;  4E0I A;  3K1H A;  3DWW A;  2J46 A;  5JVE A;  1G4W R;  2VAS A;  3KH2 A;  4PJM A;  3EJN A;  3E70 C;  1NFO A;  2OKU A;  3S90 A;  4N4W A;  4WGZ A;  3W8I A;  2MWQ A;  3ASN C;  3MLG A;  3HNL A;  3JRT A;  4LAC B;  3LNM B;  3AOU A;  1K40 A;  2R7R A;  2HJM A;  3UMH A;  3AQB A;  4J30 B;  4QI2 A;  1EI7 A;  2P7V A;  4JJG A;  2EPO A;  2Y39 A;  4KNV A;  4IWB A;  1RKE A;  4CS8 C;  3RIP A;  4O6M A;  4Q5S F;  2KC3 A;  1TFK B;  5L3V A;  2Q7R A;  4C3E A;  1G5Z A;  4EIY A;  1CGO A;  1MQV A;  2KJG A;  4EUK B;  1Q0F A;  3SZR A;  3PHF 2;  2M64 A;  3BRJ A;  2VCC A;  2OJE D;  3WOD F;  2OQM A;  2JPU A;  2AWY A;  2DI3 A;  2XL4 A;  3Q6N A;  1YAU O;  2J7P A;  5F5H A;  3U8V A;  1QLE C;  3JYH A;  1LKX A;  1WAT A;  4EHP A;  4GEH A;  1FFT C;  4PR9 A;  1NSG B;  2V26 A;  3NKD A;  2E87 A;  3H65 A;  3IHU A;  1R5I D;  3DJU B;  4O6Y A;  3WG7 C;  4AX2 A;  4E17 A;  1S7Z A;  4EBJ A;  3TOM A;  1VLS A;  1TWA A;  3F47 A;  4BG0 A;  3LES A;  3SP1 A;  1T6U A;  2XS1 A;  4LDR A;  3HLZ A;  1H9T A;  3T6G B;  4BEJ A;  3S0X A;  1OKK A;  4C3B A;  4P9F A;  3MYF A;  2VB6 A;  1ORJ A;  3ZSU A;  4O6N A;  3GM2 A;  5B1B C;  3U2L A;  4ANJ A;  3POV A;  2GAQ A;  5CIV A;  3FAJ A;  4FWV A;  1ZU5 A;  3NYM A;  1ORS C;  2P1A A;  2EPL X;  4HFF B;  5E3A A;  3V7O A;  4CJO A;  1LE2 A;  5COF A;  2H7O A;  4C7O A;  4DXW A;  3JZ0 A;  3MYI A;  1GM5 A;  2XL6 A;  2EPK X;  3HNK A;  4YL1 A;  4CS9 A;  2BL2 A;  2HUJ A;  3FHD A;  1T6I A;  1T01 A;  5D92 A;  5DS4 A;  3C63 A;  4BJ6 A;  2M4E A;  4YT8 A;  3JSZ A;  1V4A A;  1A7D A;  1ZYR F;  2H8A A;  4N06 A;  2VC9 A;  2XXA A;  1UFB A;  3MBG A;  3TD7 A;  4G7O F;  3TOL A;  2EIL C;  3OA1 A;  3VRC A;  1N1C A;  1H9G A;  1E86 A;  2J9W A;  4JIO A;  3JRM O;  2DGJ A;  3JCU Q;  2IXO A;  1MND A;  4QI0 A;  3V5Y A;  1JRA A;  4EBB A;  4AK9 A;  2VCB A;  1ZW3 A;  3W2V A;  5JRA A;  3EFO B;  1OXB A;  1IW7 F;  2XRH A;  3DAF A;  2WVN A;  1D0Y A;  3N0T A;  4JTC B;  1FFH A;  4CS9 C;  1JMW A;  2HSB A;  3OEO A;  3T9O A;  1V74 B;  5L0G A;  4KI2 A;  3A9C A;  4CJG A;  3JSE O;  4BJ6 C;  1V54 C;  4CBE A;  3JTL O;  4E7Z A;  1IZM A;  4ER9 A;  3PDM P;  3AJM A;  4Q7C A;  5KYX B;  4K7B A;  1Y6D A;  3HNJ A;  4FX5 A;  1H7I A;  1V55 C;  2YL1 A;  4P6I C;  4BJ1 A;  5TJ5 E;  3LLI A;  3FMS A;  2NG1 A;  5EHH A;  2OG2 A;  3U8P A;  4N6C A;  5A6B A;  2YEV A;  3FXH A;  1I5N A;  1U89 A;  2R7Q A;  1G4U S;  4IAO A;  4IJJ A;  2LK4 A;  4MW8 A;  1Z63 A;  4NCQ A;  4YT4 A;  4W8K A;  1ZHW A;  4JCH A;  1ZHX A;  1Y4C A;  3DJN B;  1ST6 A;  2IBF A;  3M1C B;  4I3M A;  5JS5 A;  4DBR A;  4PFO A;  3CQZ A;  2ICW G;  4NTB A;  2KW3 C;  1VB5 A;  4JVS A;  1Z7Q c;  4LDK A;  1OQC A;  1TWH A;  1VTM P;  5BUO A;  4O7G A;  1YLM A;  2G3V A;  2G3K A;  5JP7 A;  4QDL A;  2A0U A;  5DQT A;  4YL0 A;  1Z23 A;  3EHN A;  1GS9 A;  3HNI A;  4YN0 B;  1OKK D;  5E33 A;  2R7U A;  1EKY A;  2WZF A;  5K0I A;  1E85 A;  1NU9 C;  3PCV A;  3SNH A;  3X1O A;  2AP3 A;  3U9M A;  1PV3 A;  2D4U A;  3HJC A;  1K04 A;  4G7H F;  2IXP A;  3AGT A;  3B0V C;  4IB4 A;  1XZQ A;  4PFP A;  3CAX A;  2KGO A;  2R25 A;  4U9E A;  3SXY A;  1AUE A;  3VAY A;  2FFH A;  2R7T A;  4DJ9 A;  5L0I A;  1Q0G A;  3NMI A;  2QTV A;  4MTO A;  3MX3 A;  4I1M A;  2YWA A;  5BQH A;  1XWJ A;  3C18 A;  1MMN A;  2IOQ A;  1LI5 A;  1WGW A;  2IXM A;  2ZD9 A;  1SMY F;  3T6B A;  4X0R A;  4O79 A;  2R7X A;  1WAS A;  2JX0 A;  2ZXR A;  1ZU4 A;  1M56 C;  3AGU A;  3QW0 A;  5KYU B;  5DLJ A;  2WVQ A;  3I5P A;  4JW1 A;  2Q3T A;  3RYL A;  5BQI A;  2R7W A;  3N24 A;  4J7Y A;  1KNY A;  2Q9B A;  5E3C A;  3SXK A;  1HE9 A;  1Q0D A;  3EFO A;  3IQT A;  4DRI B;  2A0B A;  3L34 A;  2KYH A;  3US6 A;  2ASR A;  4NQF A;  3CZ6 A;  4NTF A;  2WL8 A;  1TFO B;  3RQF A;  2J8W A;  3GWL A;  4EWC A;  4G7Z F;  3ECS A;  2TMV P;  1PD1 A;  1A7V A;  1WTY A;  3KL4 A;  3BEH A;  3NRH A;  5A6B D;  1TKN A;  4JEB A;  3ZG1 A;  5KYX A;  4ZLD A;  2KQ9 A;  2LP4 A;  4XPY A;  1K05 A;  3RQE A;  4R32 A;  4HE8 D;  4IAR A;  3EPV A;  5EK0 A;  1YA9 A;  3V5Z A;  2QLA A;  1C02 A;  3RH3 A;  1W2W A;  1YAR O;  4DBQ A;  3ATP A;  3UMI A;  2J9U A;  2P0N A;  1BBH A;  2EIN C;  3R2P A;  4DRJ B;  4DVZ A;  1HMD A;  2QE9 A;  3L8I A;  2KSF A;  1M2V B;  2FGY A;  1CPR A;  1T9K A;  1TWG A;  2HV7 A;  2WZL A;  1QSP A;  4JC7 A;  3PMR A;  1ZVZ A;  1NU7 D;  1D1A A;  2CYD A;  1WN0 A;  3I4U A;  3IQ5 A;  3QVY A;  1VK5 A;  2YL7 A;  2J0W A;  4U5F E;  3ZQY A;  2LCH A;  4A4A A;  3QW1 A;  4U5C E;  1I4Z A;  2D5R B;  1C17 M;  1VYI A;  2AWC A;  3KKB A;  2EIM C;  3S29 A;  1A7E A;  1XZP A;  3LAY A;  3NYL A;  3SXZ A;  4JUR I;  4Z9J A;  2EIJ C;  4AL0 A;  3DE8 A;  4G0H A;  5GPG B;  3LJB A;  5L0D A;  1O3U A;  4U5H A;  2HS5 A;  4LLC A;  3UNG C;  5E2Q A;  1HMO A;  1WOL A;  1WWP A;  2UUH A;  4ULV A;  3R7C A;  4L6R A;  3C62 A;  3W2W A;  2DB4 A;  2UUI A;  3JYY A;  5HV9 A;  2X51 A;  3A11 A;  3E9V A;  4XPW A;  1GQA A;  3AG3 C;  3K6B A;  1TR2 A;  1RJ9 B;  2WVO A;  3GM3 A;  1LM3 B;  3C8G B;  4JTA B;  3EGX B;  2YLD A;  2YZS A;  4AE4 B;  2C03 A;  3CSK A;  3LEV A;  3DXJ F;  5B3I A;  1EA8 A;  2L6F A;  3DZA A;  2LSE A;  2YKZ A;  3N2Z B;  1TWC A;  3GEI A;  1A41 A;  2L6H A;  2JD3 A;  5COM A;  3H2V A;  3X2Q C;  1YYJ A;  3B0U X;  3DE9 A;  4PJN A;  1YJG A;  5HSW A;  4K0D A;  1BR4 A;  3UMK A;  5DVW A;  1LPE A;  3NKE A;  4Q4Z F;  5JLI A;  5KYU A;  2YLG A;  4E0H A;  2H7B A;  1MMA A;  2YRF A;  1Z3I X;  3S27 A;  3B71 A;  1I4Y A;  1MMD A;  2NUT B;  2ZXW C;  2QNL A;  3ZTZ A;  1BR2 A;  2HMZ A;  1JPJ A;  4IGG A;  1FTS A;  2B0J A;  2XSE A;  1JOG A;  4KNW A;  1YA7 O;  1QKR A;  4H54 A;  3EQL F;  4FES A;  3U9J A;  5DS6 A;  4CDA A;  4U5B E;  3I5Q A;  1ZHZ A;  3UGO A;  3O6X A;  4XWJ A;  3K33 A;  2OOC A;  4YJW A;  2AVK A;  2MHR A;  2EPN A;  2J7P D;  2QY9 A;  4U5E E;  4XQ1 A;  2GFH A;  3ZVR A;  1PCX A;  3DI5 A;  1OCR C;  1VYK A;  3MFN A;  4U9D A;  4AL1 A;  2XLD A;  2Y3D A;  4CDV A;  4UDV A;  4LDQ A;  1AEP A;  1MNE A;  3DKA A;  4MVS A;  5T3W A;  2Q4F A;  3UR3 C;  1BR1 A;  3K1I A;  1M57 C;  3M4B A;  2ZPA A;  2P6V A;  5F5F A;  5JSL A;  1D0Z A;  2LQG A;  2WB7 A;  1AVO B;  2Y3H A;  1M2V A;  5IY5 C;  4JTD B;  2R03 A;  1FNT c;  2LFD A;  4I44 A;  3TUL A;  4CSA A;  2CNW A;  2R7V A;  3EHM A;  3Q6M A;  3GOR A;  5L0F A;  4N6H A;  2A69 F;  3EZI A;  3F46 A;  4C3D A;  2DYS C;  4F4B A;  2J9B A;  2KNH A;  2HV6 A;  3EG9 B;  1ZW2 A;  2HZ8 A;  3M15 A;  2Y3B A;  4GYT A;  4NC3 A;  2IM8 A;  2R05 A;  1YVI A;  2EIK C;  2OEX A;  2ZXO A;  4YT2 A;  2IYL D;  2YHS A;  1OCZ C;  2CW0 F;  1EQ1 A;  4HFK B;  4OD4 A;  2R7S A;  1NFN A;  3LUT B;  2XS8 A;  3K1I C;  3AG4 C;  3QZC A;  4A2N B;  2XL8 A;  1OCO C;  5DS5 A;  1ZHY A;  2PF4 E;  4EKW A;  4NY3 A;  2CGE A;  1CGM E;  3NDB B;  1FMW A;  1QPU A;  4U5G A;  4ZLC A;  2A68 F;  2MYS A;  3VF0 A;  4CSA C;  1PD0 A;  3FDQ A;  2XM0 A;  5KYW B;  256B A;  1U0B B;  1T5O A;  2NSF A;  4JCZ A;  4WGY A;  4IRU A;  4J32 B;  1RJ9 A;  3GM1 A;  3SEO A;  1Z5Z A;  4D4X A;  3RQG A;  2PP4 A;  2GWW A;  3C8G A;  3IQ6 A;  1SR2 A;  2R7O A;  3EGX A;  4I1O B;  2WZG A;  4MVQ A;  4XEV A;  3WHN A;  4AE4 A;  2V3C C;  3RFY A;  2LFF A;  4OD5 A;  1ORY A;  2EPM X;  4MVM A;  3HKK A;  3K7D A;  3RVY A;  3GEE A;  1QQ3 A;  3U0C A;  5BQG A;  4JE9 A;  1TQG A;  2L6G A;  4KBL A;  1J8Y F;  2B0H A;  4MVZ A;  4Z9I A;  3T4R A;  2NSG A;  4E18 A;  1SYQ A;  4MS2 A;  1L3P A;  2L81 A;  2OEV A;  2YVK A;  4JEA A;  2A6E F;  3ZC4 A;  4DRH B;  5FCL A;  3QTH A;  2NUT A;  2PNO A;  3FVY A;  3ITF A;  5CI8 A;  2I15 A;  4JZA A;  3DD7 A;  3DM9 B;  1APC A;  1FAP B;  5AGF A;  2PX0 A;  4JRZ A;  1JPN A;  1NZE A;  4GQH A;  1QVX A;  4BEM J;  5L0H A;  3FOP A;  2Q00 A;  1CGN A;  1D1B A;  1OCC C;  3B29 A;  4JJF A;  2W9Y A;  5L0C A;  1ZZP A;  1NG1 A;  2HSQ A;  4XTK A;  3VYW A;  3NYJ A;  2A1D D;  5CI9 A;  3FOO A;  4OIN F;  1LIH A;  4MVO A;  2YL3 A;  3OWT A;  2A6H F;  1YDI A;  1B68 A;  3JT1 A;  3ZTM A;  1H6G A;  1SF8 A;  1DOW A;  3ABM C;  1Q0M A;  4LLE A;  2FAP B;  2LIG A;  1J8M F;  4M63 A;  2CNW D;  1OW8 A;  1BZ4 A;  3LS1 A;  2IXN A;  4FAP B;  1FMV A;  3S84 A;  3ABL C;  5AC4 A;  4OIQ F;  4EBK A;  3W4Y A;  2Q9C A;  2P61 A;  1MMG A;  2YLI A;  1LS4 A;  3AG2 C;  1M6T A;  1L7C A;  3EGD B;  3L0I A;  5L0J A;  4PJL A;  4BPM A;  2L9J A;  3G4Z A;  4MTF A;  5B3S C;  3O10 A;  3U2M A;  4DOZ A;  5FZT A;  3NMK A;  2R9R B;  4BJ5 A;  2J9V A;  2ZXP A;  5A6A A;  2KK1 A;  2AU5 A;  3S28 A;  1CPQ A;  3EG9 A;  5B1A C;  1U6H A;  3CEX A;  3GOD A;  1NBB A;  2XLW A;  1S05 A;  3G50 A;  3GAN A;  3M79 A;  4U5D E;  4RBN A;  3RVZ A;  4Z9H A;  4BJT A;  4MQ9 F;  3IQC A;  1E2X A;  1C03 A;  3LNR A;  1RKC A;  4XLN F;  4PK4 A;  1LS1 A;  4G78 A;  3B9Q A;  4PAC A;  2Z15 A;  3EZH A;  4WAB A;  3M4C A;  5DQZ A;  1FR0 A;  5KYY B;  1DOV A;  3AQC A;  2BE5 F;  2J0X A;  1LI7 A;  3C8G D;  1OR2 A;  1KU2 A;  5KYW A;  1D1C A;  4ONS A;  3GWN A;  1HE1 A;  5JT4 A;  2PBE A;  3W8H A;  1OW6 A;  3IEE A;  4BJ5 C;  5A6K A;  1E83 A;  4XLP F;  2NUP B;  3DMD A;  1JAF A;  2Y69 C;  2PX3 A;  3IPM O;  5A6J A;  2RSE B;  2OCC C;  3L1M A;  2XM4 A;  2F22 A;  3ZDL A;  4CX9 A;  2CDQ A; 
#chains in the Genus database with same CATH homology
 3ASO C;  4LER A;  4KC9 A;  3ABK C;  5T1D B;  2Y3G A;  1VOM A;  4E7S A;  4DVY P;  2VH3 A;  3O39 A;  3UGP A;  3AG1 C;  3ZIB A;  3DM5 A;  3RKO F;  3B0P A;  2O9X A;  1Z6A A;  1QZX A;  1G8X A;  2PFD A;  3Q7G A;  1SZI A;  5D91 A;  3LLK A;  2Q9A A;  3QMK A;  1LVK A;  4OIR F;  3T6J A;  3SYN A;  4YWQ A;  3KMI A;  3Q7L A;  1O87 A;  4PJJ A;  2I8B A;  4ULW A;  4RD9 A;  4OIP F;  1O5H A;  2W45 A;  4CS7 A;  3EGD A;  1M2O A;  3LS0 A;  3HTK C;  2H7V C;  3EH1 A;  2C04 A;  4MND A;  2DYR C;  4C7O B;  5KYN A;  1VMA A;  2J45 A;  3DAG A;  4YT5 A;  4HEA J;  4B6I A;  3EH2 A;  4RDA A;  4H4K C;  5KYY A;  4CIH A;  2XXA B;  2W4M A;  5EGY A;  5L3Q A;  1ZHT A;  4OIO F;  1D0X A;  4WJ0 A;  4CS8 A;  2W4B A;  3K66 A;  2NUP A;  5T3T A;  2G62 A;  3NG1 A;  3K1H A;  2J46 A;  3KH2 A;  2VAS A;  4PJM A;  3EJN A;  3E70 C;  3W8I A;  2MWQ A;  3ASN C;  3MLG A;  3JRT A;  4LAC B;  2R7R A;  3UMH A;  3AQB A;  4J30 B;  2P7V A;  4JJG A;  2Y39 A;  4KNV A;  4IWB A;  4CS8 C;  3RIP A;  4O6M A;  4Q5S F;  5L3V A;  4C3E A;  2KJG A;  3SZR A;  3PHF 2;  3WOD F;  2XL4 A;  3Q6N A;  5F5H A;  2J7P A;  1QLE C;  3JYH A;  1LKX A;  4GEH A;  1FFT C;  3NKD A;  2V26 A;  2E87 A;  3H65 A;  4O6Y A;  3DJU B;  3WG7 C;  4AX2 A;  1S7Z A;  1TWA A;  3F47 A;  4BG0 A;  3LES A;  3SP1 A;  3HLZ A;  4BEJ A;  3S0X A;  1OKK A;  4C3B A;  2VB6 A;  3ZSU A;  4O6N A;  5B1B C;  4ANJ A;  3POV A;  3FAJ A;  4FWV A;  1ZU5 A;  3NYM A;  4HFF B;  5E3A A;  3V7O A;  2H7O A;  4C7O A;  4CS9 A;  5D92 A;  3FHD A;  5DS4 A;  4BJ6 A;  2M4E A;  4YT8 A;  3JSZ A;  1ZYR F;  4N06 A;  2XXA A;  3TD7 A;  4G7O F;  2EIL C;  3OA1 A;  1N1C A;  2J9W A;  2DGJ A;  3JCU Q;  2IXO A;  1MND A;  4QI0 A;  4EBB A;  4AK9 A;  3W2V A;  3EFO B;  1IW7 F;  2XRH A;  3DAF A;  2WVN A;  1D0Y A;  3N0T A;  1FFH A;  4CS9 C;  4KI2 A;  3OEO A;  4BJ6 C;  4CBE A;  1V54 C;  4E7Z A;  1IZM A;  4Q7C A;  5KYX B;  4K7B A;  4FX5 A;  4BJ1 A;  1V55 C;  4P6I C;  3LLI A;  2NG1 A;  5EHH A;  2OG2 A;  2YEV A;  4IAO A;  2R7Q A;  4IJJ A;  1Z63 A;  4YT4 A;  4W8K A;  1ZHW A;  4JCH A;  1ZHX A;  3DJN B;  1ST6 A;  3M1C B;  4I3M A;  4DBR A;  4PFO A;  3CQZ A;  2KW3 C;  4JVS A;  1TWH A;  5BUO A;  4O7G A;  2G3V A;  2G3K A;  5DQT A;  4QDL A;  1Z23 A;  3EHN A;  4YN0 B;  1OKK D;  5E33 A;  2R7U A;  2WZF A;  1NU9 C;  3SNH A;  3X1O A;  3HJC A;  4G7H F;  2IXP A;  3B0V C;  4PFP A;  2KGO A;  3VAY A;  2FFH A;  2R7T A;  2QTV A;  3MX3 A;  4I1M A;  1MMN A;  2IOQ A;  1WGW A;  2IXM A;  1SMY F;  3T6B A;  4X0R A;  4O79 A;  2R7X A;  2ZXR A;  1ZU4 A;  1M56 C;  5KYU B;  5DLJ A;  2WVQ A;  3I5P A;  4JW1 A;  2Q3T A;  3RYL A;  2R7W A;  3N24 A;  5E3C A;  2Q9B A;  3EFO A;  3L34 A;  4EWC A;  3CZ6 A;  2WL8 A;  4G7Z F;  3ECS A;  1PD1 A;  3KL4 A;  3NRH A;  1TKN A;  5KYX A;  3ZG1 A;  4ZLD A;  2KQ9 A;  4HE8 D;  3EPV A;  3RH3 A;  1W2W A;  4DBQ A;  3UMI A;  2J9U A;  2EIN C;  4DVZ A;  1M2V B;  2FGY A;  1TWG A;  2HV7 A;  2WZL A;  3PMR A;  1NU7 D;  1D1A A;  3I4U A;  1VK5 A;  4U5F E;  2J0W A;  4U5C E;  2D5R B;  1VYI A;  3KKB A;  2EIM C;  3S29 A;  3LAY A;  3NYL A;  4JUR I;  2EIJ C;  4G0H A;  3LJB A;  4U5H A;  4LLC A;  3UNG C;  5E2Q A;  3W2W A;  2X51 A;  3E9V A;  3AG3 C;  3K6B A;  1TR2 A;  1RJ9 B;  2WVO A;  3EGX B;  2YZS A;  4AE4 B;  2C03 A;  3CSK A;  3LEV A;  3DXJ F;  3DZA A;  2LSE A;  3N2Z B;  1TWC A;  3X2Q C;  2JD3 A;  3B0U X;  5HSW A;  4PJN A;  4K0D A;  1BR4 A;  3UMK A;  5DVW A;  3NKE A;  4Q4Z F;  5KYU A;  2H7B A;  1MMA A;  1Z3I X;  3S27 A;  1MMD A;  2NUT B;  2ZXW C;  1BR2 A;  1JPJ A;  1FTS A;  2B0J A;  2XSE A;  4KNW A;  3EQL F;  4FES A;  5DS6 A;  4U5B E;  3I5Q A;  1ZHZ A;  3UGO A;  3O6X A;  4XWJ A;  3K33 A;  4YJW A;  2QY9 A;  2J7P D;  4U5E E;  3ZVR A;  2GFH A;  1PCX A;  4QI2 A;  1OCR C;  1VYK A;  2Y3D A;  1MNE A;  5T3W A;  3UR3 C;  1BR1 A;  1M57 C;  2ZPA A;  2P6V A;  5F5F A;  1D0Z A;  2WB7 A;  2Y3H A;  1M2V A;  5IY5 C;  4CSA A;  2R7V A;  4I44 A;  2CNW A;  3EHM A;  3Q6M A;  2A69 F;  3EZI A;  3F46 A;  4C3D A;  2DYS C;  4F4B A;  2KNH A;  2HV6 A;  3EG9 B;  4GYT A;  2Y3B A;  2EIK C;  2ZXO A;  4YT2 A;  2IYL D;  2YHS A;  1OCZ C;  2CW0 F;  4HFK B;  4OD4 A;  2R7S A;  3K1I C;  3AG4 C;  3QZC A;  4A2N B;  1OCO C;  5DS5 A;  1ZHY A;  2PF4 E;  3NDB B;  4NY3 A;  2CGE A;  1FMW A;  4ZLC A;  4U5G A;  2A68 F;  2MYS A;  4CSA C;  1PD0 A;  3FDQ A;  5KYW B;  4IRU A;  4J32 B;  1RJ9 A;  3SEO A;  1Z5Z A;  2PP4 A;  2R7O A;  3EGX A;  4I1O B;  2WZG A;  4AE4 A;  2V3C C;  3RFY A;  4OD5 A;  3K7D A;  4KBL A;  1J8Y F;  3T4R A;  2L81 A;  3ZC4 A;  2A6E F;  5FCL A;  2NUT A;  3FVY A;  3ITF A;  5CI8 A;  4JZA A;  3DD7 A;  3DM9 B;  2PX0 A;  1JPN A;  1NZE A;  1OCC C;  1D1B A;  4JJF A;  2W9Y A;  1NG1 A;  4XTK A;  3VYW A;  3NYJ A;  2A1D D;  5CI9 A;  4OIN F;  3OWT A;  2A6H F;  3JT1 A;  1SF8 A;  3ABM C;  4LLE A;  4M63 A;  1J8M F;  2CNW D;  3LS1 A;  2IXN A;  1FMV A;  4OIQ F;  3ABL C;  2Q9C A;  1MMG A;  3AG2 C;  3L0I A;  3EGD B;  4PJL A;  2L9J A;  5B3S C;  4DOZ A;  4BJ5 A;  2J9V A;  2ZXP A;  3S28 A;  3EG9 A;  5B1A C;  3GOD A;  4RBN A;  3GAN A;  4U5D E;  4BJT A;  4MQ9 F;  3LNR A;  4XLN F;  4PK4 A;  1LS1 A;  3B9Q A;  2Z15 A;  3EZH A;  5DQZ A;  5KYY B;  3AQC A;  2BE5 F;  2J0X A;  1KU2 A;  5KYW A;  1D1C A;  3W8H A;  4BJ5 C;  3IEE A;  4XLP F;  2NUP B;  3DMD A;  2Y69 C;  2PX3 A;  2OCC C;  2CDQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...