4I3MA

Aer2 poly-hamp domains: l44h hamp1 cw-lock mutant
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
150
structure length
150
Chain Sequence
HAVAQQRADRIATLLQSFADGQLDTAVGEAPAPGYERHYDSLRALQRQLREQRAELQQVESLEAGLAEMSRQHEAGWIDQTIPAERLEGRAARIAKGVNELVAAHIAVKMKVVSVVTAYGQGNFEPLMDRLPGKKAQITEAIDGVRERLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title HAMP Domain Conformers That Propagate Opposite Signals in Bacterial Chemoreceptors.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Signaling protein
molecule keywords Aerotaxis transducer Aer2
total genus 60
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2012-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18575 HAMP_N3 HAMP N-terminal domain 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1530 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4i3mA00
4I3MA 3LNRA 4I44A
chains in the Genus database with same CATH superfamily
2HMZA 5CI8A 1Y6DA 3DAGA 3ITFA 3JSEO 2CW0F 1M57C 1M2OA 2D4UA 2IXPA 3EZHA 3HNLA 4KNWA 3KL4A 1BZ4A 5BUOA 3CSKA 1TWCA 3A9CA 1RCPA 4MVSA 5A6AA 5EHHA 2OCCC 1VYKA 4OIQF 3LEOA 3JYYA 3SNHA 2YL7A 2HV7A 3ABKC 3NKEA 1LM3B 1LKXA 3OA1A 1XWJA 2R7SA 3UMHA 1ZHXA 3ZG1A 4RD9A 3JZ0A 5E33A 4E7SA 1O87A 2PP4A 2XSEA 3KPHA 4DRJB 1RXQA 2NUTA 2J7PD 2WB7A 3B71A 4Z9JA 4I3MA 1C17M 1QPUA 3VM6A 4ZLCA 4JKVA 4BJ5C 4BEJA 3GM2A 1A7VA 4Q4ZF 2JD3A 3PCVA 1ORSC 2YKZA 1K40A 3HNKA 1HMOA 3IQ6A 2BE5F 2EPLX 2HJMA 4R32A 1TFOB 1VTMP 1ZHTA 2WZGA 2KGOA 4AL1A 4PR9A 3AGTA 3ZC4A 2CGEA 2EPMX 3HJCA 3C8ZA 2AU5A 1NBBA 3U8VA 3RH3A 3JRTA 3L0IA 4HE8D 2BL2A 4EIYA 2E87A 5L3QA 1CPRA 1G8XA 4YL1A 4XEVA 4JEBA 4HFFB 4XQ1A 2EPKX 4OINF 3GODA 3N0TA 1QQ3A 1APCA 4PFOA 2A1DD 2JPUA 2VASA 4WABA 1J8MF 5L0FA 3K66A 3MYFA 1FAPB 4NY3A 2Z15A 4AE4A 1OW8A 3K1HA 5T3WA 4OD4A 4UDVA 2OG2A 2XLMA 4NQFA 2FFHA 3C7JA 3EHNA 4X0RA 4Z9HA 4BJ1A 3PHF2 4HFKB 2HJ3A 1SZIA 1TQGA 2EPNA 2R7XA 4HEAJ 5DS6A 1MMDA 3FMSA 3ZWIA 1YA9A 3S84A 3F47A 3W2WA 3SZRA 1T6QA 2R05A 3GORA 1WASA 3AG2C 3GM1A 1ZU4A 5JUAA 2Y3HA 2PX3A 3EQLF 3LNRA 4LLCA 4O7GA 1F1MA 1Z5ZA 2L81A 5COMA 4DBRA 2OEVA 4BJ5A 2R03A 3S0XA 2P1AA 2A0BA 2BC5A 2R02A 3F46A 3M15A 1SYQA 1AEPA 2LIGA 3LUTB 1E85A 5AGFA 4CSAC 1S05A 1B68A 3AG4C 2IXMA 1D1CA 3CZ6A 3TD7A 2UUHA 3EG9A 3EZIA 5AC5A 2J0XA 2XLVA 4CDYA 1N1CA 1NU7D 3H65A 4U5DE 4D4XA 2MYSA 3TOLA 3X2QC 4C7OA 1NFOA 1TWHA 2HMQA 3M4CA 2GAQA 2A6EF 4CS9A 3MFNA 4EBKA 2HFIA 4N4WA 2B0HA 1VB5A 3W4YA 4BPMA 1L7CA 3SEOA 4ER9A 1Z6AA 4Q5SF 1EQ1A 3B0PA 4IARA 1BR2A 3NDBB 4ULWA 1SF8A 5F5FA 1DOWA 2J45A 3IQTA 4OIRF 2V3CC 2H7OA 3IHUA 4G0HA 4XEFA 3TK0A 1BR1A 3GEHA 3DM5A 4XPXA 3CEXA 4KC9A 3LS1A 2Q3TA 1FFHA 3EJNA 1ZZPA 5B3SC 4OIOF 2KYHA 2R25A 2CNWD 3FXHA 3H2UA 3K33A 2KQ9A 4DOZA 1JPNA 2Y39A 5FCLA 2XM4A 4J7YA 1D1AA 3WHNA 3DWWA 2XL6A 3NG1A 3ZQYA 4C3BA 2W9YA 3C62A 2NUPA 4IB4A 4E0HA 1PCXA 1YJGA 3GEIA 4MNDA 3NMKA 3LESA 4JURI 3RYLA 3ATPA 4H4KC 1NFNA 4P9FA 4D4NA 3S29A 5L0HA 1NG1A 5COGA 1EI7A 1MQVA 2R9RB 4RDAA 5JSLA 2L9JA 3DE8A 3N24A 4ONSA 1M6TA 5KYNA 1NSGB 5L0GA 1E84A 2LFDA 2RSEB 2VCBA 2VC9A 3ABLC 2IYLD 2J9VA 2PBEA 4CDAA 3VF0A 4DVYP 5TJ5E 2X51A 4WGZA 3NRHA 1JOGA 3ABMC 3NMJA 2R7UA 1HY5A 3Q7LA 1MNEA 3U9MA 1WGWA 1ORJA 4I1MA 3RFYA 2EIJC 2QNLA 3I5PA 3LS0A 1Q0KA 3Q6NA 2G3VA 2XLHA 3CAXA 1V54C 3GEEA 4U5BE 4YT5A 1T6UA 4FESA 2NSGA 5A6BA 4E7ZA 2L6HA 2MHRA 1IZMA 1ZHYA 5A69A 5L0JA 3B0UX 4JRZA 3EH1A 3K1IA 5B1BC 1MMGA 2H7BA 1TWGA 4AE4B 3RVZA 4BJTA 2FGYA 2J8WA 4CJGA 4EWCA 2AWCA 3K7DA 3Q6MA 4DVZA 4YT2A 1WTYA 1RJ9A 1XZQA 2DB4A 2M64A 2XL4A 2EPOA 3DJNB 4JCHA 1R4TA 2KW3C 4XWJA 3S28A 4EBJA 5K0IA 5HSWA 1BBHA 1C03A 3RW0A 1CGOA 3LLKA 1GQAA 5D91A 2AWYA 2A0UA 3IPMO 1OQCA 1HW1A 3M1CB 4LLEA 4O6MA 3UR3C 5CI9A 2P0NA 1Q0DA 2KJGA 3KMIA 2H8AA 4YJWA 3UGPA 1HE9A 1GGQA 4MW8A 1D0YA 2FAPB 3E9VA 2A69F 5KYXA 4KNVA 2LD6A 1KU2A 2VCCA 5KYYA 1K05A 4GQHA 2DYSC 4CJOA 1YYJA 3T9OA 3AQCA 4BG0A 5DS4A 5A6JA 2C04A 2B0JA 4FX5A 4IAOA 4LDKA 4U9EA 4A2NB 1Q0MA 2OKUA 1LS1A 1PV3A 1ZU5A 1EA8A 2UUIA 2XLDA 4LACB 4PFPA 4CS8C 3EHMA 2PNOA 2LSEA 1AVOB 3L34A 5EK0A 1TFKB 1A7EA 1QLEC 4MQ9F 5KYYB 5KYXB 3AGUA 3MBGA 1WOLA 2OJED 4ZLDA 3T6BA 3QVZA 4O6NA 3LAYA 4U5HA 1YDIA 5L0CA 4MTGA 4MVRA 1TKNA 1YLMA 2Q9AA 3AG3C 2YVKA 3O55A 4H54A 3S90A 1ZHZA 1E2XA 2LFFA 2XLWA 5L0IA 3ZTMA 4KI2A 1RMVA 3FOPA 3HTKC 4JW1A 1VOMA 2QY9A 2CCYA 3K1IC 4NTAA 4MVQA 1HW2A 1RJ9B 1JRAA 1ST6A 2J7PA 2ZPAA 2H7VC 2ZXOA 4KBLA 3OEOA 3MX3A 3ZTZA 1VLSA 3SXMA 5JS5A 1E83A 2MWQA 3E70C 2HSQA 4J32B 2J46A 4LERA 3T4RA 2ZD9A 3J06A 2IM8A 4K0DA 4L6RA 1C02A 4XEKA 4G78A 4ULVA 2J0WA 3AQBA 3VYWA 4CS7A 2P61A 3NYMA 3US6A 2R7TA 2IOQA 2WL8A 4U9DA 4ANJA 1L3PA 1LI5A 2OEXA 3RKOF 3B29A 2WVNA 3DKAA 3Q7GA 3ZQVA 3B0VC 5E2QA 3EG9B 2WZLA 1VYIA 2ZXWC 4YT8A 1U0BB 3QTHA 1WWPA 1ZVZA 2EILC 3HLZA 3AOUA 2RD9A 4U5EE 3O39A 3W8HA 5COFA 2HV6A 4CIPA 4JZAA 2YL1A 3JRMO 2Q00A 3U8PA 5JLIA 1HMDA 3LNMB 3VRCA 4O6YA 3IEEA 2GA0A 3EH2A 2QUPA 4AK9A 3O6XA 4EUKB 1G4US 2J9UA 1QZXA 4RBNA 2XXAA 4IJJA 1D1BA 2GFHA 1SMYF 4PJNA 3BRJA 1GM5A 3DM9B 3G4ZA 1V55C 3L8JA 4J7TA 3KKBA 4PJMA 4JTDB 1Z23A 3HNJA 3SXZA 3U0CA 1OCZC 1OCRC 3NMIA 2C03A 4AX2A 5HV9A 4QDLA 2NUPB 3AG1C 1H9TA 2A68F 3A11A 4CBEA 4W8PA 1MNDA 3CQZA 1DOVA 2EINC 2R7QA 2Q9BA 3I5QA 4JTCB 3T6GB 2HKVA 1KNYA 4C3DA 2PX0A 3DD7A 2XXAB 1OR2A 5CIVA 1T6IA 1QKRA 2DGJA 3AJMA 5A6BD 2G62A 1J8YF 1FTSA 2GWWA 3IQ5A 4Z9IA 3U5SA 3DAFA 3WG7C 3X1OA 2XL8A 1YZAA 1U89A 5T1DB 2LQGA 4JJFA 3L1MA 2HS5A 5BQGA 1LE4A 3UMIA 2Y69C 1R5ID 1BDJB 3QW1A 3H2VA 1OKKA 2Q9CA 3K6BA 4JE9A 3RQEA 5F5HA 3T6JA 1Z3IX 2OJQA 3N2ZB 4DRIB 4IGGA 1A41A 1PD1A 2I15A 5D92A 4AL0A 4EHPA 3LJBA 2PF4E 1E86A 5A6KA 4BJ6C 4OD5A 2Q4FA 1G5ZA 2ETSA 4E17A 1D0XA 2L6GA 2PFDA 4IWBA 3FAPB 1O5HA 1ORYA 2KSFA 3TQOA 4O79A 1LI7A 3V5YA 1PD0A 4PK4A 2G3KA 2YEVA 2J9WA 4C7OB 2P6VA 5DVWA 2NUTB 4U5FE 4CSAA 1V4AA 4BJ6A 3C8GD 2YLGA 3TULA 3HNIA 1W2WA 2YLIA 1TWAA 4MVOA 4A4AA 1Z63A 1JR8A 3EFOA 1LE2A 2NG1A 4YN0B 1M56C 3UMKA 1EKYA 3EGDB 4OIPF 2NSFA 4EBBA 3EGXA 2R7RA 3DE9A 2OU6A 3ASOC 4P9TA 4PJJA 1RKEB 2QTVA 3WODF 5E3CA 5EGYA 2CNWA 2EIKC 2HSBA 4I1OB 5L3VA 4NTBA 3G50A 3UNGC 1BR4A 4K1OA 3BEHA 1ZW3A 256BA 3R2PA 2WZFA 3U9JA 3M79A 4W8KA 1VK5A 3VAYA 4MS2A 3JYHA 1I4ZA 1M2VA 1OXBA 1Q0FA 3IQCA 2I8BA 3V7OA 2W4MA 2AVKA 2CYDA 1CPQA 2IXNA 3LEVA 1YARO 2YQYA 1LVKA 3U3FA 4DRHB 2R7WA 4P6IC 2W4BA 1NLXA 2OQMA 4QI2A 4E0IA 4XTKA 3LLIA 3GANA 3ZSUA 3ZVRA 2YL3A 4XLPF 3NKDA 4JCZA 2LK4A 2IXOA 1IW7F 2ZXPA 3DXJF 1YVIA 2IBFA 5KYWB 2OOCA 3MLGA 4B6IA 2XLEA 1AUEA 4DBQA 3ASNC 1WATA 4NC3A 3RVYA 2WVQA 3NYLA 1YYXA 3U3BA 4E18A 3KYIA 2DI3A 4DJ9A 4CX9A 4CS8A 5DLJA 2HUJA 2QE9A 3ZIBA 2KK1A 3DJUB 4MVMA 3FDQA 1VMAA 3U2MA 1MMAA 1QVXA 3TJ6A 4F4BA 3EGXB 3RQFA 1OCOC 2CDQA 2DYRC 2YLDA 2ZXRA 3OWTA 3PDMP 4M63A 2Y3GA 1NU9C 1LPEA 5B1AC 5IY5C 1FMWA 4JJGA 1OR3A 3PMRA 2XS8A 3V5ZA 2M4EA 3QZCA 4G7OF 4XPYA 4PJLA 3ZDLA 2ASRA 1V74B 3GM3A 3L8IA 3U2LA 4CS9C 1RKCA 2LCHA 2YZSA 4IRUA 2YRFA 5DQTA 2GDCA 4PACA 4G7ZF 4JIOA 1GS9A 1WN0A 1ZYRF 2JX0A 4LDRA 3TJ5A 1SR2A 1OW7A 1T9KA 4XLNF 4N06A 1CGME 5JP7A 4N6CA 1FMVA 3SXYA 1UFBA 2A6HF 3HKKA 3KYJA 2L7AA 4JTAB 4MTFA 5F28E 1OW6A 3FAJA 4MVUA 1UG7A 2VCAA 4DXWA 5B3IA 1JMWA 1S7ZA 2ICWG 4YL0A 3R7CA 1Q0GA 4K7BA 2YL0A 3DMDA 3S9OA 3ECSA 3RIPA 3GWLA 1JAFA 2KC3A 3JCUQ 4CDVA 5BQIA 4NCQA 3TOMA 3RF3A 3SXKA 3KH2A 3QW0A 2AP3A 1I4YA 1NZEA 1D0ZA 2XS1A 3JT1A 2TMVP 4XPWA 3SYNA 4YT4A 4J30B 2F22A 3JTLO 1G4WR 1OKKD 2EIMC 5DQZA 1LS4A 4JEAA 1CGNA 3MYIA 3G4XA 2XRHA 3GWNA 1YA7O 2Q7RA 5BQHA 2R7VA 1QSPA 1T5OA 3O10A 4MTOA 3POVA 4JVSA 1O3UA 1LIHA 5JVEA 4WJ0A 2LP4A 3W2VA 1FFTC 5KYUA 1I5NA 5GPGB 3DZAA 2W45A 3B9QA 4N6HA 1U6HA 3FHDA 3V5XA 4Q7CA 3M4BA 1XZPA 3UGOA 2O9XA 2V26A 4U5GA 2YHSA 3S27A 5JRAA 1H9GA 5AC4A 4FWVA 2YWAA 5L0DA 3C8GA 2QLAA 3I4UA 1JPJA 4YK5A 4BEMJ 4EKWA 4FAPB 1A7DA 1YZCA 1OCCC 1HE1A 3FOOA 4I44A 1H7IA 2NPUA 4YWQA 3NYJA 3W8IA 1MMNA 1RKEA 3C8GB 4GYTA 2XM0A 2R7OA 2Y3DA 1KTMA 2WVOA 1A0BA 5FZTA 3C63A 1Y4CA 3EPVA 5KYWA 3QMKA 4JC7A 4LDQA 3EGDA 2D5RB 2KNHA 3WAQA 4G7HF 4MW3A 4QI0A 4C3EA 2Y3BA 3EFOB 3JSZA 3SP1A 1FNTc 4YL3A 5KYUB 4CIHA 1OXKA 3FVYA 1FR0A 4MVZA 3C18A 2P7VA 5DS5A 4IAQA 1VLTA 1T01A 2VH3A 4NTFA 2HZ8A 4WGYA 2J9BA 5E3AA 1Z7Qc 3DI5A 2VB6A 2XLOA 1H6GA 4U5CE 3QVYA 1K04A 1M2VB 1ZHWA 1ZW2A 1YAUO 4GEHA 1TR2A 5T3TA 2L6FA 3RQGA 5JT4A 2X0CA
chains in the Genus database with same CATH topology
5CI8A 3ITFA 3DAGA 2CW0F 1M57C 1M2OA 3EZHA 2IXPA 4KNWA 5BUOA 3KL4A 3CSKA 1TWCA 5EHHA 2OCCC 1VYKA 4OIQF 3SNHA 2HV7A 3ABKC 3NKEA 1LKXA 3OA1A 2R7SA 3UMHA 1ZHXA 3ZG1A 4RD9A 5E33A 4E7SA 1O87A 2PP4A 2XSEA 2NUTA 2J7PD 2WB7A 4I3MA 4ZLCA 4BJ5C 4BEJA 4Q4ZF 2JD3A 2BE5F 1ZHTA 2WZGA 2KGOA 3ZC4A 2CGEA 3HJCA 3RH3A 3JRTA 3L0IA 4HE8D 2E87A 5L3QA 1G8XA 4HFFB 4OINF 3GODA 3N0TA 4PFOA 2A1DD 2VASA 1J8MF 3K66A 4NY3A 2Z15A 4AE4A 3K1HA 5T3WA 4OD4A 2OG2A 2FFHA 3EHNA 4X0RA 4BJ1A 3PHF2 4HFKB 1SZIA 4HEAJ 5DS6A 1MMDA 3F47A 3W2WA 3SZRA 3AG2C 1ZU4A 2Y3HA 2PX3A 3EQLF 3LNRA 4LLCA 4O7GA 1Z5ZA 2L81A 4DBRA 4BJ5A 3S0XA 3F46A 4CSAC 3AG4C 3TD7A 2IXMA 1D1CA 3CZ6A 3EG9A 3EZIA 2J0XA 1N1CA 1NU7D 3H65A 4U5DE 2MYSA 3X2QC 4C7OA 1TWHA 2A6EF 4CS9A 3SEOA 1Z6AA 4Q5SF 3B0PA 1BR2A 3NDBB 4ULWA 1SF8A 5F5FA 2J45A 4OIRF 2V3CC 2H7OA 4G0HA 1BR1A 3DM5A 4KC9A 3LS1A 2Q3TA 1FFHA 3EJNA 4OIOF 5B3SC 2CNWD 3K33A 2KQ9A 4DOZA 1JPNA 2Y39A 5FCLA 1D1AA 3NG1A 4C3BA 2W9YA 2NUPA 1PCXA 4MNDA 3LESA 4JURI 3RYLA 4H4KC 3S29A 1NG1A 2XXAB 4RDAA 5KYNA 2L9JA 3N24A 3ABLC 2IYLD 2J9VA 4DVYP 2X51A 2R7UA 3NRHA 3ABMC 3Q7LA 1MNEA 1WGWA 4I1MA 3RFYA 2EIJC 3I5PA 3Q6NA 3LS0A 4U5BE 2G3VA 4YT5A 1V54C 4FESA 4E7ZA 1IZMA 1ZHYA 3B0UX 3EH1A 5B1BC 4AE4B 1MMGA 2H7BA 1TWGA 4BJTA 4EWCA 2FGYA 3K7DA 3Q6MA 4DVZA 4YT2A 2XL4A 1RJ9A 3DJNB 4JCHA 4LLEA 3S28A 4XWJA 2KW3C 5HSWA 3LLKA 5D91A 3M1CB 4O6MA 3UR3C 5CI9A 2KJGA 3KMIA 4YJWA 3UGPA 1D0YA 3E9VA 2A69F 5KYXA 4KNVA 5KYYA 1KU2A 2DYSC 5DS4A 3AQCA 4BG0A 2C04A 2B0JA 4FX5A 4IAOA 4A2NB 1LS1A 4PFPA 1ZU5A 3POVA 4LACB 4CS8C 2R7XA 3EHMA 2LSEA 3L34A 5KYYB 5KYXB 1QLEC 4MQ9F 4ZLDA 3T6BA 4O6NA 3LAYA 4U5HA 1TKNA 3AG3C 2Q9AA 1ZHZA 4KI2A 3HTKC 4JW1A 1VOMA 2QY9A 3K1IC 1RJ9B 1ST6A 2J7PA 2ZXOA 2ZPAA 2H7VC 4KBLA 3OEOA 3MX3A 2MWQA 3E70C 4LERA 4J32B 2J46A 3T4RA 4K0DA 3UGOA 3VYWA 2J0WA 3AQBA 4CS7A 3NYMA 2R7TA 2IOQA 2WL8A 4ANJA 3RKOF 2WVNA 3Q7GA 3B0VC 5E2QA 3EG9B 2WZLA 1VYIA 2ZXWC 4YT8A 2EILC 3HLZA 3W8HA 4U5EE 3O39A 2HV6A 4JZAA 4O6YA 3IEEA 3EH2A 4AK9A 3O6XA 2J9UA 1QZXA 4RBNA 2XXAA 4IJJA 1D1BA 2GFHA 1SMYF 4PJNA 3DM9B 1V55C 3KKBA 4PJMA 1Z23A 1OCZC 1OCRC 2C03A 4AX2A 4QDLA 2NUPB 3AG1C 2A68F 4CBEA 1MNDA 3CQZA 2EINC 2R7QA 2Q9BA 3I5QA 4C3DA 2PX0A 3DD7A 2DGJA 2G62A 1J8YF 1FTSA 3DAFA 3WG7C 3X1OA 5T1DB 4JJFA 3UMIA 2Y69C 1OKKA 2Q9CA 3K6BA 5F5HA 3T6JA 1Z3IX 3N2ZB 1PD1A 5D92A 3LJBA 2PF4E 4BJ6C 4OD5A 1D0XA 4IWBA 2PFDA 1O5HA 4O79A 4C7OB 1PD0A 4PK4A 2G3KA 2YEVA 2J9WA 2P6VA 5DVWA 2NUTB 4U5FE 4CSAA 4BJ6A 1W2WA 1TWAA 1Z63A 3EFOA 2NG1A 4YN0B 1M56C 3UMKA 3EGDB 4OIPF 4EBBA 3EGXA 2R7RA 3ASOC 4PJJA 3WODF 2QTVA 5E3CA 5EGYA 2CNWA 2EIKC 4I1OB 5L3VA 3UNGC 1BR4A 2WZFA 4W8KA 1VK5A 3VAYA 3JYHA 1M2VA 2I8BA 3V7OA 2W4MA 2IXNA 3LEVA 1LVKA 2R7WA 4P6IC 2W4BA 4QI2A 4XTKA 3LLIA 3GANA 3ZSUA 3ZVRA 4XLPF 3NKDA 2IXOA 1IW7F 2ZXPA 3DXJF 5KYWB 3MLGA 4B6IA 4DBQA 3ASNC 2WVQA 3NYLA 4CS8A 5DLJA 3ZIBA 3DJUB 3FDQA 1VMAA 1MMAA 4F4BA 3EGXB 1OCOC 2CDQA 2DYRC 2ZXRA 3OWTA 4M63A 2Y3GA 1NU9C 5B1AC 5IY5C 1FMWA 4JJGA 3PMRA 2M4EA 3QZCA 4G7OF 4PJLA 4CS9C 2YZSA 4IRUA 5DQTA 4G7ZF 1ZYRF 4XLNF 4N06A 1FMVA 2A6HF 3FAJA 1S7ZA 4K7BA 3DMDA 3ECSA 3RIPA 3JCUQ 3KH2A 1NZEA 1D0ZA 3JT1A 4YT4A 3SYNA 4J30B 5DQZA 1OKKD 2EIMC 2XRHA 2R7VA 4JVSA 4WJ0A 3W2VA 1FFTC 5KYUA 3DZAA 2W45A 3B9QA 3FHDA 4Q7CA 2O9XA 2V26A 4U5GA 2YHSA 3S27A 4FWVA 3I4UA 1JPJA 1OCCC 4I44A 4YWQA 3NYJA 3W8IA 1MMNA 4GYTA 2R7OA 2Y3DA 2WVOA 3EPVA 5KYWA 3QMKA 3EGDA 2D5RB 2KNHA 4G7HF 4QI0A 4C3EA 2Y3BA 3EFOB 3JSZA 3SP1A 5KYUB 4CIHA 3FVYA 2P7VA 5DS5A 2VH3A 5E3AA 2VB6A 4U5CE 1M2VB 1ZHWA 4GEHA 1TR2A 5T3TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I3M A;  3LNR A;  4I44 A; 
#chains in the Genus database with same CATH topology
 2HMZ A;  5CI8 A;  1Y6D A;  3DAG A;  3ITF A;  3JSE O;  2CW0 F;  1M57 C;  1M2O A;  2D4U A;  2IXP A;  3EZH A;  3HNL A;  4KNW A;  3KL4 A;  1BZ4 A;  5BUO A;  3CSK A;  1TWC A;  3A9C A;  1RCP A;  4MVS A;  5A6A A;  5EHH A;  2OCC C;  1VYK A;  4OIQ F;  3LEO A;  3JYY A;  3SNH A;  2YL7 A;  2HV7 A;  3ABK C;  3NKE A;  1LM3 B;  1LKX A;  3OA1 A;  1XWJ A;  2R7S A;  3UMH A;  1ZHX A;  3ZG1 A;  4RD9 A;  3JZ0 A;  5E33 A;  4E7S A;  1O87 A;  2PP4 A;  2XSE A;  3KPH A;  4DRJ B;  1RXQ A;  2NUT A;  2J7P D;  2WB7 A;  3B71 A;  4Z9J A;  4I3M A;  1C17 M;  1QPU A;  3VM6 A;  4ZLC A;  4JKV A;  4BJ5 C;  4BEJ A;  3GM2 A;  1A7V A;  4Q4Z F;  2JD3 A;  3PCV A;  1ORS C;  2YKZ A;  1K40 A;  3HNK A;  1HMO A;  3IQ6 A;  2BE5 F;  2EPL X;  2HJM A;  4R32 A;  1TFO B;  1VTM P;  1ZHT A;  2WZG A;  2KGO A;  4AL1 A;  4PR9 A;  3AGT A;  3ZC4 A;  2CGE A;  2EPM X;  3HJC A;  3C8Z A;  2AU5 A;  1NBB A;  3U8V A;  3RH3 A;  3JRT A;  3L0I A;  4HE8 D;  2BL2 A;  4EIY A;  2E87 A;  5L3Q A;  1CPR A;  1G8X A;  4YL1 A;  4XEV A;  4JEB A;  4HFF B;  4XQ1 A;  2EPK X;  4OIN F;  3GOD A;  3N0T A;  1QQ3 A;  1APC A;  4PFO A;  2A1D D;  2JPU A;  2VAS A;  4WAB A;  1J8M F;  5L0F A;  3K66 A;  3MYF A;  1FAP B;  4NY3 A;  2Z15 A;  4AE4 A;  1OW8 A;  3K1H A;  5T3W A;  4OD4 A;  4UDV A;  2OG2 A;  2XLM A;  4NQF A;  2FFH A;  3C7J A;  3EHN A;  4X0R A;  4Z9H A;  4BJ1 A;  3PHF 2;  4HFK B;  2HJ3 A;  1SZI A;  1TQG A;  2EPN A;  2R7X A;  4HEA J;  5DS6 A;  1MMD A;  3FMS A;  3ZWI A;  1YA9 A;  3S84 A;  3F47 A;  3W2W A;  3SZR A;  1T6Q A;  2R05 A;  3GOR A;  1WAS A;  3AG2 C;  3GM1 A;  1ZU4 A;  5JUA A;  2Y3H A;  2PX3 A;  3EQL F;  3LNR A;  4LLC A;  4O7G A;  1F1M A;  1Z5Z A;  2L81 A;  5COM A;  4DBR A;  2OEV A;  4BJ5 A;  2R03 A;  3S0X A;  2P1A A;  2A0B A;  2BC5 A;  2R02 A;  3F46 A;  3M15 A;  1SYQ A;  1AEP A;  2LIG A;  3LUT B;  1E85 A;  5AGF A;  4CSA C;  1S05 A;  1B68 A;  3AG4 C;  2IXM A;  1D1C A;  3CZ6 A;  3TD7 A;  2UUH A;  3EG9 A;  3EZI A;  5AC5 A;  2J0X A;  2XLV A;  4CDY A;  1N1C A;  1NU7 D;  3H65 A;  4U5D E;  4D4X A;  2MYS A;  3TOL A;  3X2Q C;  4C7O A;  1NFO A;  1TWH A;  2HMQ A;  3M4C A;  2GAQ A;  2A6E F;  4CS9 A;  3MFN A;  4EBK A;  2HFI A;  4N4W A;  2B0H A;  1VB5 A;  3W4Y A;  4BPM A;  1L7C A;  3SEO A;  4ER9 A;  1Z6A A;  4Q5S F;  1EQ1 A;  3B0P A;  4IAR A;  1BR2 A;  3NDB B;  4ULW A;  1SF8 A;  5F5F A;  1DOW A;  2J45 A;  3IQT A;  4OIR F;  2V3C C;  2H7O A;  3IHU A;  4G0H A;  4XEF A;  3TK0 A;  1BR1 A;  3GEH A;  3DM5 A;  4XPX A;  3CEX A;  4KC9 A;  3LS1 A;  2Q3T A;  1FFH A;  3EJN A;  1ZZP A;  5B3S C;  4OIO F;  2KYH A;  2R25 A;  2CNW D;  3FXH A;  3H2U A;  3K33 A;  2KQ9 A;  4DOZ A;  1JPN A;  2Y39 A;  5FCL A;  2XM4 A;  4J7Y A;  1D1A A;  3WHN A;  3DWW A;  2XL6 A;  3NG1 A;  3ZQY A;  4C3B A;  2W9Y A;  3C62 A;  2NUP A;  4IB4 A;  4E0H A;  1PCX A;  1YJG A;  3GEI A;  4MND A;  3NMK A;  3LES A;  4JUR I;  3RYL A;  3ATP A;  4H4K C;  1NFN A;  4P9F A;  4D4N A;  3S29 A;  5L0H A;  1NG1 A;  5COG A;  1EI7 A;  1MQV A;  2R9R B;  4RDA A;  5JSL A;  2L9J A;  3DE8 A;  3N24 A;  4ONS A;  1M6T A;  5KYN A;  1NSG B;  5L0G A;  1E84 A;  2LFD A;  2RSE B;  2VCB A;  2VC9 A;  3ABL C;  2IYL D;  2J9V A;  2PBE A;  4CDA A;  3VF0 A;  4DVY P;  5TJ5 E;  2X51 A;  4WGZ A;  3NRH A;  1JOG A;  3ABM C;  3NMJ A;  2R7U A;  1HY5 A;  3Q7L A;  1MNE A;  3U9M A;  1WGW A;  1ORJ A;  4I1M A;  3RFY A;  2EIJ C;  2QNL A;  3I5P A;  3LS0 A;  1Q0K A;  3Q6N A;  2G3V A;  2XLH A;  3CAX A;  1V54 C;  3GEE A;  4U5B E;  4YT5 A;  1T6U A;  4FES A;  2NSG A;  5A6B A;  4E7Z A;  2L6H A;  2MHR A;  1IZM A;  1ZHY A;  5A69 A;  5L0J A;  3B0U X;  4JRZ A;  3EH1 A;  3K1I A;  5B1B C;  1MMG A;  2H7B A;  1TWG A;  4AE4 B;  3RVZ A;  4BJT A;  2FGY A;  2J8W A;  4CJG A;  4EWC A;  2AWC A;  3K7D A;  3Q6M A;  4DVZ A;  4YT2 A;  1WTY A;  1RJ9 A;  1XZQ A;  2DB4 A;  2M64 A;  2XL4 A;  2EPO A;  3DJN B;  4JCH A;  1R4T A;  2KW3 C;  4XWJ A;  3S28 A;  4EBJ A;  5K0I A;  5HSW A;  1BBH A;  1C03 A;  3RW0 A;  1CGO A;  3LLK A;  1GQA A;  5D91 A;  2AWY A;  2A0U A;  3IPM O;  1OQC A;  1HW1 A;  3M1C B;  4LLE A;  4O6M A;  3UR3 C;  5CI9 A;  2P0N A;  1Q0D A;  2KJG A;  3KMI A;  2H8A A;  4YJW A;  3UGP A;  1HE9 A;  1GGQ A;  4MW8 A;  1D0Y A;  2FAP B;  3E9V A;  2A69 F;  5KYX A;  4KNV A;  2LD6 A;  1KU2 A;  2VCC A;  5KYY A;  1K05 A;  4GQH A;  2DYS C;  4CJO A;  1YYJ A;  3T9O A;  3AQC A;  4BG0 A;  5DS4 A;  5A6J A;  2C04 A;  2B0J A;  4FX5 A;  4IAO A;  4LDK A;  4U9E A;  4A2N B;  1Q0M A;  2OKU A;  1LS1 A;  1PV3 A;  1ZU5 A;  1EA8 A;  2UUI A;  2XLD A;  4LAC B;  4PFP A;  4CS8 C;  3EHM A;  2PNO A;  2LSE A;  1AVO B;  3L34 A;  5EK0 A;  1TFK B;  1A7E A;  1QLE C;  4MQ9 F;  5KYY B;  5KYX B;  3AGU A;  3MBG A;  1WOL A;  2OJE D;  4ZLD A;  3T6B A;  3QVZ A;  4O6N A;  3LAY A;  4U5H A;  1YDI A;  5L0C A;  4MTG A;  4MVR A;  1TKN A;  1YLM A;  2Q9A A;  3AG3 C;  2YVK A;  3O55 A;  4H54 A;  3S90 A;  1ZHZ A;  1E2X A;  2LFF A;  2XLW A;  5L0I A;  3ZTM A;  4KI2 A;  1RMV A;  3FOP A;  3HTK C;  4JW1 A;  1VOM A;  2QY9 A;  2CCY A;  3K1I C;  4NTA A;  4MVQ A;  1HW2 A;  1RJ9 B;  1JRA A;  1ST6 A;  2J7P A;  2ZPA A;  2H7V C;  2ZXO A;  4KBL A;  3OEO A;  3MX3 A;  3ZTZ A;  1VLS A;  3SXM A;  5JS5 A;  1E83 A;  2MWQ A;  3E70 C;  2HSQ A;  4J32 B;  2J46 A;  4LER A;  3T4R A;  2ZD9 A;  3J06 A;  2IM8 A;  4K0D A;  4L6R A;  1C02 A;  4XEK A;  4G78 A;  4ULV A;  2J0W A;  3AQB A;  3VYW A;  4CS7 A;  2P61 A;  3NYM A;  3US6 A;  2R7T A;  2IOQ A;  2WL8 A;  4U9D A;  4ANJ A;  1L3P A;  1LI5 A;  2OEX A;  3RKO F;  3B29 A;  2WVN A;  3DKA A;  3Q7G A;  3ZQV A;  3B0V C;  5E2Q A;  3EG9 B;  2WZL A;  1VYI A;  2ZXW C;  4YT8 A;  1U0B B;  3QTH A;  1WWP A;  1ZVZ A;  2EIL C;  3HLZ A;  3AOU A;  2RD9 A;  4U5E E;  3O39 A;  3W8H A;  5COF A;  2HV6 A;  4CIP A;  4JZA A;  2YL1 A;  3JRM O;  2Q00 A;  3U8P A;  5JLI A;  1HMD A;  3LNM B;  3VRC A;  4O6Y A;  3IEE A;  2GA0 A;  3EH2 A;  2QUP A;  4AK9 A;  3O6X A;  4EUK B;  1G4U S;  2J9U A;  1QZX A;  4RBN A;  2XXA A;  4IJJ A;  1D1B A;  2GFH A;  1SMY F;  4PJN A;  3BRJ A;  1GM5 A;  3DM9 B;  3G4Z A;  1V55 C;  3L8J A;  4J7T A;  3KKB A;  4PJM A;  4JTD B;  1Z23 A;  3HNJ A;  3SXZ A;  3U0C A;  1OCZ C;  1OCR C;  3NMI A;  2C03 A;  4AX2 A;  5HV9 A;  4QDL A;  2NUP B;  3AG1 C;  1H9T A;  2A68 F;  3A11 A;  4CBE A;  4W8P A;  1MND A;  3CQZ A;  1DOV A;  2EIN C;  2R7Q A;  2Q9B A;  3I5Q A;  4JTC B;  3T6G B;  2HKV A;  1KNY A;  4C3D A;  2PX0 A;  3DD7 A;  2XXA B;  1OR2 A;  5CIV A;  1T6I A;  1QKR A;  2DGJ A;  3AJM A;  5A6B D;  2G62 A;  1J8Y F;  1FTS A;  2GWW A;  3IQ5 A;  4Z9I A;  3U5S A;  3DAF A;  3WG7 C;  3X1O A;  2XL8 A;  1YZA A;  1U89 A;  5T1D B;  2LQG A;  4JJF A;  3L1M A;  2HS5 A;  5BQG A;  1LE4 A;  3UMI A;  2Y69 C;  1R5I D;  1BDJ B;  3QW1 A;  3H2V A;  1OKK A;  2Q9C A;  3K6B A;  4JE9 A;  3RQE A;  5F5H A;  3T6J A;  1Z3I X;  2OJQ A;  3N2Z B;  4DRI B;  4IGG A;  1A41 A;  1PD1 A;  2I15 A;  5D92 A;  4AL0 A;  4EHP A;  3LJB A;  2PF4 E;  1E86 A;  5A6K A;  4BJ6 C;  4OD5 A;  2Q4F A;  1G5Z A;  2ETS A;  4E17 A;  1D0X A;  2L6G A;  2PFD A;  4IWB A;  3FAP B;  1O5H A;  1ORY A;  2KSF A;  3TQO A;  4O79 A;  1LI7 A;  3V5Y A;  1PD0 A;  4PK4 A;  2G3K A;  2YEV A;  2J9W A;  4C7O B;  2P6V A;  5DVW A;  2NUT B;  4U5F E;  4CSA A;  1V4A A;  4BJ6 A;  3C8G D;  2YLG A;  3TUL A;  3HNI A;  1W2W A;  2YLI A;  1TWA A;  4MVO A;  4A4A A;  1Z63 A;  1JR8 A;  3EFO A;  1LE2 A;  2NG1 A;  4YN0 B;  1M56 C;  3UMK A;  1EKY A;  3EGD B;  4OIP F;  2NSF A;  4EBB A;  3EGX A;  2R7R A;  3DE9 A;  2OU6 A;  3ASO C;  4P9T A;  4PJJ A;  1RKE B;  2QTV A;  3WOD F;  5E3C A;  5EGY A;  2CNW A;  2EIK C;  2HSB A;  4I1O B;  5L3V A;  4NTB A;  3G50 A;  3UNG C;  1BR4 A;  4K1O A;  3BEH A;  1ZW3 A;  256B A;  3R2P A;  2WZF A;  3U9J A;  3M79 A;  4W8K A;  1VK5 A;  3VAY A;  4MS2 A;  3JYH A;  1I4Z A;  1M2V A;  1OXB A;  1Q0F A;  3IQC A;  2I8B A;  3V7O A;  2W4M A;  2AVK A;  2CYD A;  1CPQ A;  2IXN A;  3LEV A;  1YAR O;  2YQY A;  1LVK A;  3U3F A;  4DRH B;  2R7W A;  4P6I C;  2W4B A;  1NLX A;  2OQM A;  4QI2 A;  4E0I A;  4XTK A;  3LLI A;  3GAN A;  3ZSU A;  3ZVR A;  2YL3 A;  4XLP F;  3NKD A;  4JCZ A;  2LK4 A;  2IXO A;  1IW7 F;  2ZXP A;  3DXJ F;  1YVI A;  2IBF A;  5KYW B;  2OOC A;  3MLG A;  4B6I A;  2XLE A;  1AUE A;  4DBQ A;  3ASN C;  1WAT A;  4NC3 A;  3RVY A;  2WVQ A;  3NYL A;  1YYX A;  3U3B A;  4E18 A;  3KYI A;  2DI3 A;  4DJ9 A;  4CX9 A;  4CS8 A;  5DLJ A;  2HUJ A;  2QE9 A;  3ZIB A;  2KK1 A;  3DJU B;  4MVM A;  3FDQ A;  1VMA A;  3U2M A;  1MMA A;  1QVX A;  3TJ6 A;  4F4B A;  3EGX B;  3RQF A;  1OCO C;  2CDQ A;  2DYR C;  2YLD A;  2ZXR A;  3OWT A;  3PDM P;  4M63 A;  2Y3G A;  1NU9 C;  1LPE A;  5B1A C;  5IY5 C;  1FMW A;  4JJG A;  1OR3 A;  3PMR A;  2XS8 A;  3V5Z A;  2M4E A;  3QZC A;  4G7O F;  4XPY A;  4PJL A;  3ZDL A;  2ASR A;  1V74 B;  3GM3 A;  3L8I A;  3U2L A;  4CS9 C;  1RKC A;  2LCH A;  2YZS A;  4IRU A;  2YRF A;  5DQT A;  2GDC A;  4PAC A;  4G7Z F;  4JIO A;  1GS9 A;  1WN0 A;  1ZYR F;  2JX0 A;  4LDR A;  3TJ5 A;  1SR2 A;  1OW7 A;  1T9K A;  4XLN F;  4N06 A;  1CGM E;  5JP7 A;  4N6C A;  1FMV A;  3SXY A;  1UFB A;  2A6H F;  3HKK A;  3KYJ A;  2L7A A;  4JTA B;  4MTF A;  5F28 E;  1OW6 A;  3FAJ A;  4MVU A;  1UG7 A;  2VCA A;  4DXW A;  5B3I A;  1JMW A;  1S7Z A;  2ICW G;  4YL0 A;  3R7C A;  1Q0G A;  4K7B A;  2YL0 A;  3DMD A;  3S9O A;  3ECS A;  3RIP A;  3GWL A;  1JAF A;  2KC3 A;  3JCU Q;  4CDV A;  5BQI A;  4NCQ A;  3TOM A;  3RF3 A;  3SXK A;  3KH2 A;  3QW0 A;  2AP3 A;  1I4Y A;  1NZE A;  1D0Z A;  2XS1 A;  3JT1 A;  2TMV P;  4XPW A;  3SYN A;  4YT4 A;  4J30 B;  2F22 A;  3JTL O;  1G4W R;  1OKK D;  2EIM C;  5DQZ A;  1LS4 A;  4JEA A;  1CGN A;  3MYI A;  3G4X A;  2XRH A;  3GWN A;  1YA7 O;  2Q7R A;  5BQH A;  2R7V A;  1QSP A;  1T5O A;  3O10 A;  4MTO A;  3POV A;  4JVS A;  1O3U A;  1LIH A;  5JVE A;  4WJ0 A;  2LP4 A;  3W2V A;  1FFT C;  5KYU A;  1I5N A;  5GPG B;  3DZA A;  2W45 A;  3B9Q A;  4N6H A;  1U6H A;  3FHD A;  3V5X A;  4Q7C A;  3M4B A;  1XZP A;  3UGO A;  2O9X A;  2V26 A;  4U5G A;  2YHS A;  3S27 A;  5JRA A;  1H9G A;  5AC4 A;  4FWV A;  2YWA A;  5L0D A;  3C8G A;  2QLA A;  3I4U A;  1JPJ A;  4YK5 A;  4BEM J;  4EKW A;  4FAP B;  1A7D A;  1YZC A;  1OCC C;  1HE1 A;  3FOO A;  4I44 A;  1H7I A;  2NPU A;  4YWQ A;  3NYJ A;  3W8I A;  1MMN A;  1RKE A;  3C8G B;  4GYT A;  2XM0 A;  2R7O A;  2Y3D A;  1KTM A;  2WVO A;  1A0B A;  5FZT A;  3C63 A;  1Y4C A;  3EPV A;  5KYW A;  3QMK A;  4JC7 A;  4LDQ A;  3EGD A;  2D5R B;  2KNH A;  3WAQ A;  4G7H F;  4MW3 A;  4QI0 A;  4C3E A;  2Y3B A;  3EFO B;  3JSZ A;  3SP1 A;  1FNT c;  4YL3 A;  5KYU B;  4CIH A;  1OXK A;  3FVY A;  1FR0 A;  4MVZ A;  3C18 A;  2P7V A;  5DS5 A;  4IAQ A;  1VLT A;  1T01 A;  2VH3 A;  4NTF A;  2HZ8 A;  4WGY A;  2J9B A;  5E3A A;  1Z7Q c;  3DI5 A;  2VB6 A;  2XLO A;  1H6G A;  4U5C E;  3QVY A;  1K04 A;  1M2V B;  1ZHW A;  1ZW2 A;  1YAU O;  4GEH A;  1TR2 A;  5T3T A;  2L6F A;  3RQG A;  5JT4 A;  2X0C A; 
#chains in the Genus database with same CATH homology
 5CI8 A;  3ITF A;  3DAG A;  2CW0 F;  1M57 C;  1M2O A;  3EZH A;  2IXP A;  4KNW A;  5BUO A;  3KL4 A;  3CSK A;  1TWC A;  5EHH A;  2OCC C;  1VYK A;  4OIQ F;  3SNH A;  2HV7 A;  3ABK C;  3NKE A;  1LKX A;  3OA1 A;  2R7S A;  3UMH A;  1ZHX A;  3ZG1 A;  4RD9 A;  5E33 A;  4E7S A;  1O87 A;  2PP4 A;  2XSE A;  2NUT A;  2J7P D;  2WB7 A;  4I3M A;  4ZLC A;  4BJ5 C;  4BEJ A;  4Q4Z F;  2JD3 A;  2BE5 F;  1ZHT A;  2WZG A;  2KGO A;  3ZC4 A;  2CGE A;  3HJC A;  3RH3 A;  3JRT A;  3L0I A;  4HE8 D;  2E87 A;  5L3Q A;  1G8X A;  4HFF B;  4OIN F;  3GOD A;  3N0T A;  4PFO A;  2A1D D;  2VAS A;  1J8M F;  3K66 A;  4NY3 A;  2Z15 A;  4AE4 A;  3K1H A;  5T3W A;  4OD4 A;  2OG2 A;  2FFH A;  3EHN A;  4X0R A;  4BJ1 A;  3PHF 2;  4HFK B;  1SZI A;  4HEA J;  5DS6 A;  1MMD A;  3F47 A;  3W2W A;  3SZR A;  3AG2 C;  1ZU4 A;  2Y3H A;  2PX3 A;  3EQL F;  3LNR A;  4LLC A;  4O7G A;  1Z5Z A;  2L81 A;  4DBR A;  4BJ5 A;  3S0X A;  3F46 A;  4CSA C;  3AG4 C;  3TD7 A;  2IXM A;  1D1C A;  3CZ6 A;  3EG9 A;  3EZI A;  2J0X A;  1N1C A;  1NU7 D;  3H65 A;  4U5D E;  2MYS A;  3X2Q C;  4C7O A;  1TWH A;  2A6E F;  4CS9 A;  3SEO A;  1Z6A A;  4Q5S F;  3B0P A;  1BR2 A;  3NDB B;  4ULW A;  1SF8 A;  5F5F A;  2J45 A;  4OIR F;  2V3C C;  2H7O A;  4G0H A;  1BR1 A;  3DM5 A;  4KC9 A;  3LS1 A;  2Q3T A;  1FFH A;  3EJN A;  4OIO F;  5B3S C;  2CNW D;  3K33 A;  2KQ9 A;  4DOZ A;  1JPN A;  2Y39 A;  5FCL A;  1D1A A;  3NG1 A;  4C3B A;  2W9Y A;  2NUP A;  1PCX A;  4MND A;  3LES A;  4JUR I;  3RYL A;  4H4K C;  3S29 A;  1NG1 A;  2XXA B;  4RDA A;  5KYN A;  2L9J A;  3N24 A;  3ABL C;  2IYL D;  2J9V A;  4DVY P;  2X51 A;  2R7U A;  3NRH A;  3ABM C;  3Q7L A;  1MNE A;  1WGW A;  4I1M A;  3RFY A;  2EIJ C;  3I5P A;  3Q6N A;  3LS0 A;  4U5B E;  2G3V A;  4YT5 A;  1V54 C;  4FES A;  4E7Z A;  1IZM A;  1ZHY A;  3B0U X;  3EH1 A;  5B1B C;  4AE4 B;  1MMG A;  2H7B A;  1TWG A;  4BJT A;  4EWC A;  2FGY A;  3K7D A;  3Q6M A;  4DVZ A;  4YT2 A;  2XL4 A;  1RJ9 A;  3DJN B;  4JCH A;  4LLE A;  3S28 A;  4XWJ A;  2KW3 C;  5HSW A;  3LLK A;  5D91 A;  3M1C B;  4O6M A;  3UR3 C;  5CI9 A;  2KJG A;  3KMI A;  4YJW A;  3UGP A;  1D0Y A;  3E9V A;  2A69 F;  5KYX A;  4KNV A;  5KYY A;  1KU2 A;  2DYS C;  5DS4 A;  3AQC A;  4BG0 A;  2C04 A;  2B0J A;  4FX5 A;  4IAO A;  4A2N B;  1LS1 A;  4PFP A;  1ZU5 A;  3POV A;  4LAC B;  4CS8 C;  2R7X A;  3EHM A;  2LSE A;  3L34 A;  5KYY B;  5KYX B;  1QLE C;  4MQ9 F;  4ZLD A;  3T6B A;  4O6N A;  3LAY A;  4U5H A;  1TKN A;  3AG3 C;  2Q9A A;  1ZHZ A;  4KI2 A;  3HTK C;  4JW1 A;  1VOM A;  2QY9 A;  3K1I C;  1RJ9 B;  1ST6 A;  2J7P A;  2ZXO A;  2ZPA A;  2H7V C;  4KBL A;  3OEO A;  3MX3 A;  2MWQ A;  3E70 C;  4LER A;  4J32 B;  2J46 A;  3T4R A;  4K0D A;  3UGO A;  3VYW A;  2J0W A;  3AQB A;  4CS7 A;  3NYM A;  2R7T A;  2IOQ A;  2WL8 A;  4ANJ A;  3RKO F;  2WVN A;  3Q7G A;  3B0V C;  5E2Q A;  3EG9 B;  2WZL A;  1VYI A;  2ZXW C;  4YT8 A;  2EIL C;  3HLZ A;  3W8H A;  4U5E E;  3O39 A;  2HV6 A;  4JZA A;  4O6Y A;  3IEE A;  3EH2 A;  4AK9 A;  3O6X A;  2J9U A;  1QZX A;  4RBN A;  2XXA A;  4IJJ A;  1D1B A;  2GFH A;  1SMY F;  4PJN A;  3DM9 B;  1V55 C;  3KKB A;  4PJM A;  1Z23 A;  1OCZ C;  1OCR C;  2C03 A;  4AX2 A;  4QDL A;  2NUP B;  3AG1 C;  2A68 F;  4CBE A;  1MND A;  3CQZ A;  2EIN C;  2R7Q A;  2Q9B A;  3I5Q A;  4C3D A;  2PX0 A;  3DD7 A;  2DGJ A;  2G62 A;  1J8Y F;  1FTS A;  3DAF A;  3WG7 C;  3X1O A;  5T1D B;  4JJF A;  3UMI A;  2Y69 C;  1OKK A;  2Q9C A;  3K6B A;  5F5H A;  3T6J A;  1Z3I X;  3N2Z B;  1PD1 A;  5D92 A;  3LJB A;  2PF4 E;  4BJ6 C;  4OD5 A;  1D0X A;  4IWB A;  2PFD A;  1O5H A;  4O79 A;  4C7O B;  1PD0 A;  4PK4 A;  2G3K A;  2YEV A;  2J9W A;  2P6V A;  5DVW A;  2NUT B;  4U5F E;  4CSA A;  4BJ6 A;  1W2W A;  1TWA A;  1Z63 A;  3EFO A;  2NG1 A;  4YN0 B;  1M56 C;  3UMK A;  3EGD B;  4OIP F;  4EBB A;  3EGX A;  2R7R A;  3ASO C;  4PJJ A;  3WOD F;  2QTV A;  5E3C A;  5EGY A;  2CNW A;  2EIK C;  4I1O B;  5L3V A;  3UNG C;  1BR4 A;  2WZF A;  4W8K A;  1VK5 A;  3VAY A;  3JYH A;  1M2V A;  2I8B A;  3V7O A;  2W4M A;  2IXN A;  3LEV A;  1LVK A;  2R7W A;  4P6I C;  2W4B A;  4QI2 A;  4XTK A;  3LLI A;  3GAN A;  3ZSU A;  3ZVR A;  4XLP F;  3NKD A;  2IXO A;  1IW7 F;  2ZXP A;  3DXJ F;  5KYW B;  3MLG A;  4B6I A;  4DBQ A;  3ASN C;  2WVQ A;  3NYL A;  4CS8 A;  5DLJ A;  3ZIB A;  3DJU B;  3FDQ A;  1VMA A;  1MMA A;  4F4B A;  3EGX B;  1OCO C;  2CDQ A;  2DYR C;  2ZXR A;  3OWT A;  4M63 A;  2Y3G A;  1NU9 C;  5B1A C;  5IY5 C;  1FMW A;  4JJG A;  3PMR A;  2M4E A;  3QZC A;  4G7O F;  4PJL A;  4CS9 C;  2YZS A;  4IRU A;  5DQT A;  4G7Z F;  1ZYR F;  4XLN F;  4N06 A;  1FMV A;  2A6H F;  3FAJ A;  1S7Z A;  4K7B A;  3DMD A;  3ECS A;  3RIP A;  3JCU Q;  3KH2 A;  1NZE A;  1D0Z A;  3JT1 A;  4YT4 A;  3SYN A;  4J30 B;  5DQZ A;  1OKK D;  2EIM C;  2XRH A;  2R7V A;  4JVS A;  4WJ0 A;  3W2V A;  1FFT C;  5KYU A;  3DZA A;  2W45 A;  3B9Q A;  3FHD A;  4Q7C A;  2O9X A;  2V26 A;  4U5G A;  2YHS A;  3S27 A;  4FWV A;  3I4U A;  1JPJ A;  1OCC C;  4I44 A;  4YWQ A;  3NYJ A;  3W8I A;  1MMN A;  4GYT A;  2R7O A;  2Y3D A;  2WVO A;  3EPV A;  5KYW A;  3QMK A;  3EGD A;  2D5R B;  2KNH A;  4G7H F;  4QI0 A;  4C3E A;  2Y3B A;  3EFO B;  3JSZ A;  3SP1 A;  5KYU B;  4CIH A;  3FVY A;  2P7V A;  5DS5 A;  2VH3 A;  5E3A A;  2VB6 A;  4U5C E;  1M2V B;  1ZHW A;  4GEH A;  1TR2 A;  5T3T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...