4I3ZB

Structure of pcdk2/cyclina bound to adp and 2 magnesium ions
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
257
structure length
257
Chain Sequence
b'VPDYQEDIHTYLREMEVKCKPKVGYMKRQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYSKKQVLRMEHLVLKVLAFDLAAPTVNQFLTQYFLHLQPANCKVESLAMFLGELSLIDADPYLKYLPSLIAGAAFHLALYTVTGQSWPESLAQQTGYTLESLKPCLVDLHQTYLKAPQHAQQSIREKYKHSKYHSVSLLNPPETLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cyclin-dependent kinase 2
publication title Price To Be Paid for Two-Metal Catalysis: Magnesium Ions That Accelerate Chemistry Unavoidably Limit Product Release from a Protein Kinase
pubmed rcsb
source organism Homo sapiens
molecule tags Transferase/cell cycle
total genus 98
structure length 257
sequence length 257
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF02984 Cyclin_C Cyclin, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 4i3zB01
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 4i3zB02
2WIPB 1H28B 4UN0A 5HBJB 1AISB 2C4GB 3EJ1B 1TFBA 5EFQB 1H1PB 3F5XB 2QDJA 4CFXB 1GUXB 1FINB 3QHWB 1C9BA 2WMAB 1H27B 2BKZB 4KRDB 4ELJA 2IW6B 4EOIB 2CJMB 3RGFB 4EOSB 2C5XB 4F6SB 3BLHB 2CCIB 3TNWB 4ROEA 4F6UB 5LQFB 2WIHB 5HQ0B 1H24B 1E9HB 2R7GA 2W9ZA 5IDNB 4BCJB 1XO2A 3BHVB 3M03A 3EIDB 4IMYB 2UZEB 1FVVB 4CXAB 4EOPB 5I5ZB 1VYWB 2PMIB 5HNBB 2UZBB 5HBEB 1OIUB 4CFWB 2W99A 2F2CA 4OR5B 4BCMD 4G6LB 4YOOA 4BCQD 1OIYB 3MIAB 1H25B 1OKWB 4YOSA 4RODA 4BCGB 4F7SB 2C5OB 2EUFA 1JKWA 1O9KB 1AD6A 3TN8B 2JGZB 4BCND 4BCOB 4CFNB 5IF1B 4YC3B 2WFYB 1H26B 2W2HA 2PHGA 1JSTB 1H1SB 1BU2A 2IVXA 2UZDB 4ELLA 3BLRB 4EOMB 4BCHB 3BHTB 3O0GD 2C6TB 4CFVB 4EONB 1GY3B 3MY1B 2IW8B 4BCIB 1G3NC 2W96A 1JOWA 5ACBA 3POMA 1OL2B 3DOGB 2PK9B 5L2WB 4NSTB 1JSUB 2B9RA 3MI9B 3TNIB 4CRLB 4ROCA 1N4MA 2PK2A 2UUEB 4FX3B 2BPMB 4EC8B 5HVYB 5IDPB 3LQ5B 1W98B 4BCKB 2C5NB 3TNHB 4BCMB 4BCPB 5ICPB 1GUXA 4EOOB 4BCQB 4EOKB 1VOLA 2C5VB 1KXUA 4BCFB 4CFUD 1QMZB 3MY5B 2G9XB 3QHRB 4BCNB 1PKDB 1H1RB 4EC9B 2WHBB 1URCB 1OI9B 4CFMB 1P5EB 3G33B 4II5B 1UNHD 4TTHA 4EORB 5HBHB 4EOJB 2V22B 1GH6B 2WPAB 2X1NB 4F70B 5LMKB 1D3UB 4F7LB 3BHUB 2IW9B 2WMBB 4YOZA 3K7AM 5FGKB 1OGUB 3BLQB 1OKVB 1H4LD 3DDPB 4F7JB 2WXVB 1OL1B 4EOLB 4OGRB 1UNGD 1O9KA 2I53A 3DDQB 1VINA 2WEVB 1UNLD 2CCHB 5BNJB 4CFUB 4I3ZB 2W9FA 3EOCB 1ZP2A 4Y72B 1H1QB 5CYIB 4EOQB 3H4CA 4F6WB 2I40B 2UZLB 4F7NB 4KRCB 5CEIB 1F5QB
chains in the Genus database with same CATH superfamily
5HBJB 5EFQB 2QDJA 3QZ9B 1FINB 1H27B 4EOIB 2C5XB 3TNWB 2CZ6B 2R7GA 3BHVB 3M03A 2UZEB 2WJ9A 3QWLA 4ZGDB 2PMIB 5HNBB 2UZBB 1UGRB 4YOOA 3MIAB 4F7SB 2JGZB 4BCOB 4CFNB 2KMGA 3VKGA 1JSTB 1H1SB 1AHJB 3BHTB 2DD4B 2IW8B 1JOWA 2CZ0B 4ZGEB 3MI9B 2PK2A 4FX3B 4EC8B 2IN3A 3TNHB 4BCMB 4EOOB 3PO3S 3X20B 1QMZB 2AHJB 5DQVA 1PKDB 1H1RB 3QYEA 2ZPIB 3X24B 2QQ8A 4CFMB 3G33B 4TTHA 1UNHD 4EORB 4HLQA 4EOJB 2WPAB 5LMKB 1D3UB 2ZZDB 4BY1X 3B57A 3K7AM 3DDPB 1OL1B 4EOLB 4OGRB 2CCHB 4AKHA 3HZJA 2BS2A 4EOQB 2I40B 2DD5B 1UGSB 1H28B 2C4GB 3EJ1B 1TFBA 3A8LB 3F5XB 2CZ1B 1C9BA 4HNUA 1FKMA 4KRDB 2IW6B 2ZPGB 5DQWA 2CCIB 5LQFB 4ROEA 2D0QB 3QYGB 1E9HB 5IDNB 4BCJB 1XO2A 4FM4B 4IMYB 1FVVB 1VYWB 2LW4A 5HBEB 1OIUB 4CFWB 1OIYB 2ZPBB 2G77A 4YOSA 1JKWA 1O9KB 1AD6A 3TN8B 4YC3B 2UZDB 3A8GB 2C6TB 4OB2B 3QZ5B 3A8MB 4OB1B 4BXXX 2PK9B 2ZPHB 2B9RA 3A8OB 4OB0B 3KHIA 5IDPB 2BPMB 1W98B 1GUXA 4BCQB 1VOLA 3QXEB 4BCFB 4CFUD 4HL4A 3MY5B 2G9XB 4BCNB 2WHBB 2CYZB 2V22B 1GH6B 4F7LB 3X28B 3TW7A 2ZPEB 3X25B 1E7PA 2WXVB 2QGSA 3DTOA 1UNLD 4M6VA 2ZPFB 3EOCB 3VYGB 4KRCB 3DL1A 1F5QB 4UN0A 4LOCA 1H1PB 4CFXB 1ENWA 3QYHB 3QHWB 4ELJA 2CJMB 4F6UB 2DXCB 2WIHB 2PJQA 1H24B 2W9ZA 3VYHB 4CXAB 3VKHA 4EOPB 3X26B 2W99A 2F2CA 4OR5B 4BCMD 4G6LB 1H25B 1OKWB 4RODA 2QF7A 2C5OB 5IF1B 3NDQA 2WFYB 2PHGA 2IVXA 3BLRB 4EOMB 4BCHB 4QSHA 3O0GD 4CFVB 4EONB 2DPPB 1GY3B 1IREB 4BCIB 5ACBA 2BS3A 3POMA 1OL2B 4JX6A 3TNIB 4ROCA 4OB3B 5EJCA 5HVYB 2C5NB 5ICPB 4EOKB 1KXUA 4HNVA 3BG5A 1OI9B 1UGPB 2QFZA 4II5B 3QYBA 4F70B 2IW9B 2WMBB 4YOZA 5FGKB 1OGUB 1OKVB 1H4LD 1UGQB 4Z6YA 1UNGD 3WVEB 3WVDB 3DDQB 1VINA 2KR6A 2WEVB 2ZCFB 2CZ7B 4JX4A 4I3ZB 2W9FA 1H1QB 4AI6A 2UZLB 2WIPB 3HO8A 1AISB 1GUXB 2BS4A 2WMAB 2BKZB 3RGFB 4EOSB 4F6SB 3BLHB 3HHTB 4HNTA 5HQ0B 4BY7X 3EIDB 3BG9A 4ZGJB 5I5ZB 2DMEA 4BCQD 4BBRM 1QLBA 4BCGB 2EUFA 4BCND 5IHYA 1H26B 2W2HA 4MFEA 4ELLA 1BU2A 4MIMA 3MY1B 2QDYB 1G3NC 2W96A 1V29B 3DOGB 3DJBA 5L2WB 4NSTB 1JSUB 4CRLB 4AKIA 1N4MA 2UUEB 3LQ5B 4NC6A 4BCKB 4BCPB 2C5VB 3BG3A 3A8HB 4MFDA 3QHRB 3GTMS 4EC9B 3HBLA 1URCB 1P5EB 5HBHB 2X1NB 4AKGA 3BHUB 3HB9A 3BLQB 4F7JB 4JX5A 3TW6A 1O9KA 2I53A 4BBSM 5BNJB 4CFUB 1ZP2A 4Y72B 1TD6A 5CYIB 2DXBB 3H4CA 4F6WB 4F7NB 5CEIB
chains in the Genus database with same CATH topology
2WIPB 1H28B 4UN0A 5HBJB 1AISB 2C4GB 3EJ1B 1TFBA 5EFQB 1H1PB 3F5XB 2QDJA 4CFXB 1GUXB 1FINB 3QHWB 1C9BA 2WMAB 1H27B 2BKZB 4KRDB 4ELJA 2IW6B 4EOIB 2CJMB 3RGFB 4EOSB 2C5XB 4F6SB 3BLHB 2CCIB 3TNWB 4ROEA 4F6UB 5LQFB 2WIHB 5HQ0B 1H24B 1E9HB 2R7GA 2W9ZA 5IDNB 4BCJB 1XO2A 3BHVB 3M03A 3EIDB 4IMYB 2UZEB 1FVVB 4CXAB 4EOPB 5I5ZB 1VYWB 2PMIB 5HNBB 2UZBB 5HBEB 1OIUB 4CFWB 2W99A 2F2CA 4OR5B 4BCMD 4G6LB 4YOOA 4BCQD 1OIYB 3MIAB 1H25B 1OKWB 4YOSA 4RODA 4BCGB 4F7SB 2C5OB 2EUFA 1JKWA 1O9KB 1AD6A 3TN8B 2JGZB 4BCND 4BCOB 4CFNB 5IF1B 4YC3B 2WFYB 1H26B 2W2HA 2PHGA 1JSTB 1H1SB 1BU2A 2IVXA 2UZDB 4ELLA 3BLRB 4EOMB 4BCHB 3BHTB 3O0GD 2C6TB 4CFVB 4EONB 1GY3B 3MY1B 2IW8B 4BCIB 1G3NC 2W96A 1JOWA 5ACBA 3POMA 1OL2B 3DOGB 2PK9B 5L2WB 4NSTB 1JSUB 2B9RA 3MI9B 3TNIB 4CRLB 4ROCA 1N4MA 2PK2A 2UUEB 4FX3B 2BPMB 4EC8B 5HVYB 5IDPB 3LQ5B 1W98B 4BCKB 2C5NB 3TNHB 4BCMB 4BCPB 5ICPB 1GUXA 4EOOB 4BCQB 4EOKB 1VOLA 2C5VB 1KXUA 4BCFB 4CFUD 1QMZB 3MY5B 2G9XB 3QHRB 4BCNB 1PKDB 1H1RB 4EC9B 2WHBB 1URCB 1OI9B 4CFMB 1P5EB 3G33B 4II5B 1UNHD 4TTHA 4EORB 5HBHB 4EOJB 2V22B 1GH6B 2WPAB 2X1NB 4F70B 5LMKB 1D3UB 4F7LB 3BHUB 2IW9B 2WMBB 4YOZA 3K7AM 5FGKB 1OGUB 3BLQB 1OKVB 1H4LD 3DDPB 4F7JB 2WXVB 1OL1B 4EOLB 4OGRB 1UNGD 1O9KA 2I53A 3DDQB 1VINA 2WEVB 1UNLD 2CCHB 5BNJB 4CFUB 4I3ZB 2W9FA 3EOCB 1ZP2A 4Y72B 1H1QB 5CYIB 4EOQB 3H4CA 4F6WB 2I40B 2UZLB 4F7NB 4KRCB 5CEIB 1F5QB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WIP B;  1H28 B;  4UN0 A;  5HBJ B;  1AIS B;  2C4G B;  3EJ1 B;  1TFB A;  5EFQ B;  1H1P B;  3F5X B;  2QDJ A;  4CFX B;  1GUX B;  1FIN B;  3QHW B;  1C9B A;  2WMA B;  1H27 B;  2BKZ B;  4KRD B;  4ELJ A;  2IW6 B;  4EOI B;  2CJM B;  3RGF B;  4EOS B;  2C5X B;  4F6S B;  3BLH B;  2CCI B;  3TNW B;  4ROE A;  4F6U B;  5LQF B;  2WIH B;  5HQ0 B;  1H24 B;  1E9H B;  2R7G A;  2W9Z A;  5IDN B;  4BCJ B;  1XO2 A;  3BHV B;  3M03 A;  3EID B;  4IMY B;  2UZE B;  1FVV B;  4CXA B;  4EOP B;  5I5Z B;  1VYW B;  2PMI B;  5HNB B;  2UZB B;  5HBE B;  1OIU B;  4CFW B;  2W99 A;  2F2C A;  4OR5 B;  4BCM D;  4G6L B;  4YOO A;  4BCQ D;  1OIY B;  3MIA B;  1H25 B;  1OKW B;  4YOS A;  4ROD A;  4BCG B;  4F7S B;  2C5O B;  2EUF A;  1JKW A;  1O9K B;  1AD6 A;  3TN8 B;  2JGZ B;  4BCN D;  4BCO B;  4CFN B;  5IF1 B;  4YC3 B;  2WFY B;  1H26 B;  2W2H A;  2PHG A;  1JST B;  1H1S B;  1BU2 A;  2IVX A;  2UZD B;  4ELL A;  3BLR B;  4EOM B;  4BCH B;  3BHT B;  3O0G D;  2C6T B;  4CFV B;  4EON B;  1GY3 B;  3MY1 B;  2IW8 B;  4BCI B;  1G3N C;  2W96 A;  1JOW A;  5ACB A;  3POM A;  1OL2 B;  3DOG B;  2PK9 B;  5L2W B;  4NST B;  1JSU B;  2B9R A;  3MI9 B;  3TNI B;  4CRL B;  4ROC A;  1N4M A;  2PK2 A;  2UUE B;  4FX3 B;  2BPM B;  4EC8 B;  5HVY B;  5IDP B;  3LQ5 B;  1W98 B;  4BCK B;  2C5N B;  3TNH B;  4BCM B;  4BCP B;  5ICP B;  1GUX A;  4EOO B;  4BCQ B;  4EOK B;  1VOL A;  2C5V B;  1KXU A;  4BCF B;  4CFU D;  1QMZ B;  3MY5 B;  2G9X B;  3QHR B;  4BCN B;  1PKD B;  1H1R B;  4EC9 B;  2WHB B;  1URC B;  1OI9 B;  4CFM B;  1P5E B;  3G33 B;  4II5 B;  1UNH D;  4TTH A;  4EOR B;  5HBH B;  4EOJ B;  2V22 B;  1GH6 B;  2WPA B;  2X1N B;  4F70 B;  5LMK B;  1D3U B;  4F7L B;  3BHU B;  2IW9 B;  2WMB B;  4YOZ A;  3K7A M;  5FGK B;  1OGU B;  3BLQ B;  1OKV B;  1H4L D;  3DDP B;  4F7J B;  2WXV B;  1OL1 B;  4EOL B;  4OGR B;  1UNG D;  1O9K A;  2I53 A;  3DDQ B;  1VIN A;  2WEV B;  1UNL D;  2CCH B;  5BNJ B;  4CFU B;  4I3Z B;  2W9F A;  3EOC B;  1ZP2 A;  4Y72 B;  1H1Q B;  5CYI B;  4EOQ B;  3H4C A;  4F6W B;  2I40 B;  2UZL B;  4F7N B;  4KRC B;  5CEI B;  1F5Q B; 
#chains in the Genus database with same CATH topology
 5HBJ B;  5EFQ B;  2QDJ A;  3QZ9 B;  1FIN B;  1H27 B;  4EOI B;  2C5X B;  3TNW B;  2CZ6 B;  2R7G A;  3BHV B;  3M03 A;  2UZE B;  2WJ9 A;  3QWL A;  4ZGD B;  2PMI B;  5HNB B;  2UZB B;  1UGR B;  4YOO A;  3MIA B;  4F7S B;  2JGZ B;  4BCO B;  4CFN B;  2KMG A;  3VKG A;  1JST B;  1H1S B;  1AHJ B;  3BHT B;  2DD4 B;  2IW8 B;  1JOW A;  2CZ0 B;  4ZGE B;  3MI9 B;  2PK2 A;  4FX3 B;  4EC8 B;  2IN3 A;  3TNH B;  4BCM B;  4EOO B;  3PO3 S;  3X20 B;  1QMZ B;  2AHJ B;  5DQV A;  1PKD B;  1H1R B;  3QYE A;  2ZPI B;  3X24 B;  2QQ8 A;  4CFM B;  3G33 B;  4TTH A;  1UNH D;  4EOR B;  4HLQ A;  4EOJ B;  2WPA B;  5LMK B;  1D3U B;  2ZZD B;  4BY1 X;  3B57 A;  3K7A M;  3DDP B;  1OL1 B;  4EOL B;  4OGR B;  2CCH B;  4AKH A;  3HZJ A;  2BS2 A;  4EOQ B;  2I40 B;  2DD5 B;  1UGS B;  1H28 B;  2C4G B;  3EJ1 B;  1TFB A;  3A8L B;  3F5X B;  2CZ1 B;  1C9B A;  4HNU A;  1FKM A;  4KRD B;  2IW6 B;  2ZPG B;  5DQW A;  2CCI B;  5LQF B;  4ROE A;  2D0Q B;  3QYG B;  1E9H B;  5IDN B;  4BCJ B;  1XO2 A;  4FM4 B;  4IMY B;  1FVV B;  1VYW B;  2LW4 A;  5HBE B;  1OIU B;  4CFW B;  1OIY B;  2ZPB B;  2G77 A;  4YOS A;  1JKW A;  1O9K B;  1AD6 A;  3TN8 B;  4YC3 B;  2UZD B;  3A8G B;  2C6T B;  4OB2 B;  3QZ5 B;  3A8M B;  4OB1 B;  4BXX X;  2PK9 B;  2ZPH B;  2B9R A;  3A8O B;  4OB0 B;  3KHI A;  5IDP B;  2BPM B;  1W98 B;  1GUX A;  4BCQ B;  1VOL A;  3QXE B;  4BCF B;  4CFU D;  4HL4 A;  3MY5 B;  2G9X B;  4BCN B;  2WHB B;  2CYZ B;  2V22 B;  1GH6 B;  4F7L B;  3X28 B;  3TW7 A;  2ZPE B;  3X25 B;  1E7P A;  2WXV B;  2QGS A;  3DTO A;  1UNL D;  4M6V A;  2ZPF B;  3EOC B;  3VYG B;  4KRC B;  3DL1 A;  1F5Q B;  4UN0 A;  4LOC A;  1H1P B;  4CFX B;  1ENW A;  3QYH B;  3QHW B;  4ELJ A;  2CJM B;  4F6U B;  2DXC B;  2WIH B;  2PJQ A;  1H24 B;  2W9Z A;  3VYH B;  4CXA B;  3VKH A;  4EOP B;  3X26 B;  2W99 A;  2F2C A;  4OR5 B;  4BCM D;  4G6L B;  1H25 B;  1OKW B;  4ROD A;  2QF7 A;  2C5O B;  5IF1 B;  3NDQ A;  2WFY B;  2PHG A;  2IVX A;  3BLR B;  4EOM B;  4BCH B;  4QSH A;  3O0G D;  4CFV B;  4EON B;  2DPP B;  1GY3 B;  1IRE B;  4BCI B;  5ACB A;  2BS3 A;  3POM A;  1OL2 B;  4JX6 A;  3TNI B;  4ROC A;  4OB3 B;  5EJC A;  5HVY B;  2C5N B;  5ICP B;  4EOK B;  1KXU A;  4HNV A;  3BG5 A;  1OI9 B;  1UGP B;  2QFZ A;  4II5 B;  3QYB A;  4F70 B;  2IW9 B;  2WMB B;  4YOZ A;  5FGK B;  1OGU B;  1OKV B;  1H4L D;  1UGQ B;  4Z6Y A;  1UNG D;  3WVE B;  3WVD B;  3DDQ B;  1VIN A;  2KR6 A;  2WEV B;  2ZCF B;  2CZ7 B;  4JX4 A;  4I3Z B;  2W9F A;  1H1Q B;  4AI6 A;  2UZL B;  2WIP B;  3HO8 A;  1AIS B;  1GUX B;  2BS4 A;  2WMA B;  2BKZ B;  3RGF B;  4EOS B;  4F6S B;  3BLH B;  3HHT B;  4HNT A;  5HQ0 B;  4BY7 X;  3EID B;  3BG9 A;  4ZGJ B;  5I5Z B;  2DME A;  4BCQ D;  4BBR M;  1QLB A;  4BCG B;  2EUF A;  4BCN D;  5IHY A;  1H26 B;  2W2H A;  4MFE A;  4ELL A;  1BU2 A;  4MIM A;  3MY1 B;  2QDY B;  1G3N C;  2W96 A;  1V29 B;  3DOG B;  3DJB A;  5L2W B;  4NST B;  1JSU B;  4CRL B;  4AKI A;  1N4M A;  2UUE B;  3LQ5 B;  4NC6 A;  4BCK B;  4BCP B;  2C5V B;  3BG3 A;  3A8H B;  4MFD A;  3QHR B;  3GTM S;  4EC9 B;  3HBL A;  1URC B;  1P5E B;  5HBH B;  2X1N B;  4AKG A;  3BHU B;  3HB9 A;  3BLQ B;  4F7J B;  4JX5 A;  3TW6 A;  1O9K A;  2I53 A;  4BBS M;  5BNJ B;  4CFU B;  1ZP2 A;  4Y72 B;  1TD6 A;  5CYI B;  2DXB B;  3H4C A;  4F6W B;  4F7N B;  5CEI B; 
#chains in the Genus database with same CATH homology
 2WIP B;  1H28 B;  4UN0 A;  5HBJ B;  1AIS B;  2C4G B;  3EJ1 B;  1TFB A;  5EFQ B;  1H1P B;  3F5X B;  2QDJ A;  4CFX B;  1GUX B;  1FIN B;  3QHW B;  1C9B A;  2WMA B;  1H27 B;  2BKZ B;  4KRD B;  4ELJ A;  2IW6 B;  4EOI B;  2CJM B;  3RGF B;  4EOS B;  2C5X B;  4F6S B;  3BLH B;  2CCI B;  3TNW B;  4ROE A;  4F6U B;  5LQF B;  2WIH B;  5HQ0 B;  1H24 B;  1E9H B;  2R7G A;  2W9Z A;  5IDN B;  4BCJ B;  1XO2 A;  3BHV B;  3M03 A;  3EID B;  4IMY B;  2UZE B;  1FVV B;  4CXA B;  4EOP B;  5I5Z B;  1VYW B;  2PMI B;  5HNB B;  2UZB B;  5HBE B;  1OIU B;  4CFW B;  2W99 A;  2F2C A;  4OR5 B;  4BCM D;  4G6L B;  4YOO A;  4BCQ D;  1OIY B;  3MIA B;  1H25 B;  1OKW B;  4YOS A;  4ROD A;  4BCG B;  4F7S B;  2C5O B;  2EUF A;  1JKW A;  1O9K B;  1AD6 A;  3TN8 B;  2JGZ B;  4BCN D;  4BCO B;  4CFN B;  5IF1 B;  4YC3 B;  2WFY B;  1H26 B;  2W2H A;  2PHG A;  1JST B;  1H1S B;  1BU2 A;  2IVX A;  2UZD B;  4ELL A;  3BLR B;  4EOM B;  4BCH B;  3BHT B;  3O0G D;  2C6T B;  4CFV B;  4EON B;  1GY3 B;  3MY1 B;  2IW8 B;  4BCI B;  1G3N C;  2W96 A;  1JOW A;  5ACB A;  3POM A;  1OL2 B;  3DOG B;  2PK9 B;  5L2W B;  4NST B;  1JSU B;  2B9R A;  3MI9 B;  3TNI B;  4CRL B;  4ROC A;  1N4M A;  2PK2 A;  2UUE B;  4FX3 B;  2BPM B;  4EC8 B;  5HVY B;  5IDP B;  3LQ5 B;  1W98 B;  4BCK B;  2C5N B;  3TNH B;  4BCM B;  4BCP B;  5ICP B;  1GUX A;  4EOO B;  4BCQ B;  4EOK B;  1VOL A;  2C5V B;  1KXU A;  4BCF B;  4CFU D;  1QMZ B;  3MY5 B;  2G9X B;  3QHR B;  4BCN B;  1PKD B;  1H1R B;  4EC9 B;  2WHB B;  1URC B;  1OI9 B;  4CFM B;  1P5E B;  3G33 B;  4II5 B;  1UNH D;  4TTH A;  4EOR B;  5HBH B;  4EOJ B;  2V22 B;  1GH6 B;  2WPA B;  2X1N B;  4F70 B;  5LMK B;  1D3U B;  4F7L B;  3BHU B;  2IW9 B;  2WMB B;  4YOZ A;  3K7A M;  5FGK B;  1OGU B;  3BLQ B;  1OKV B;  1H4L D;  3DDP B;  4F7J B;  2WXV B;  1OL1 B;  4EOL B;  4OGR B;  1UNG D;  1O9K A;  2I53 A;  3DDQ B;  1VIN A;  2WEV B;  1UNL D;  2CCH B;  5BNJ B;  4CFU B;  4I3Z B;  2W9F A;  3EOC B;  1ZP2 A;  4Y72 B;  1H1Q B;  5CYI B;  4EOQ B;  3H4C A;  4F6W B;  2I40 B;  2UZL B;  4F7N B;  4KRC B;  5CEI B;  1F5Q B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...