4I44A

Aer2 poly-hamp domains: v33g hamp1 inverted signaling mutant
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
160
structure length
160
Chain Sequence
GSHMGLFNAHAVAQQRADRIATLLQSFADGQLDTAGGEAPAPGYERLYDSLRALQRQLREQRAELQQVESLEAGLAEMSRQHEAGWIDQTIPAERLEGRAARIAKGVNELVAAHIAVKMKVVSVVTAYGQGNFEPLMDRLPGKKAQITEAIDGVRERLRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aerotaxis transducer Aer2
publication title HAMP Domain Conformers That Propagate Opposite Signals in Bacterial Chemoreceptors.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Signaling protein
total genus 61
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 2012-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18575 HAMP_N3 HAMP N-terminal domain 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1530 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4i44A00
4I3MA 3LNRA 4I44A
chains in the Genus database with same CATH superfamily
3EQLF 3AOUA 5JT4A 3AJMA 1Z3IX 4U9EA 3U8VA 3AGUA 2NSGA 3BRJA 3EFOA 2LCHA 2YZSA 2QTVA 4Z9HA 1Q0GA 3SP1A 5B1BC 3B71A 3JTLO 4I1OB 3ZQYA 5KYXB 2IBFA 2NPUA 4C7OA 5BQIA 2H7VC 1Z5ZA 1OKKD 3DKAA 4HFFB 2KSFA 5DS5A 3GEEA 1V54C 4YL3A 3TQOA 2J7PA 1R4TA 1T5OA 2J45A 2Q9AA 3WHNA 3GANA 4IAOA 1BBHA 4WABA 3RQEA 4EBKA 3C8GA 5AGFA 3DE9A 5JP7A 4FESA 2YEVA 2Q00A 3S0XA 5AC5A 4YK5A 3LNRA 2JPUA 3IHUA 4YL1A 4EIYA 3UMHA 3ZC4A 4X0RA 4IAQA 3O10A 2H7OA 3U3FA 1WWPA 2G3VA 1ZZPA 2DYSC 2R7TA 2IXMA 1CGNA 5L0FA 3DJNB 4F4BA 4OIPF 3RVZA 3FXHA 3Q6MA 3LLKA 1EKYA 1L7CA 1H6GA 3HNIA 2ZXWC 4IARA 4JURI 3HJCA 4MTGA 2EILC 3U9JA 4QI2A 2IM8A 3CQZA 3N0TA 4MVOA 2G62A 5A6BD 5KYYB 1YA9A 4QI0A 2R7WA 1ORYA 2C04A 4JVSA 1WASA 3B0UX 3SXZA 4RBNA 4CS8A 3EGXA 2R7UA 4U5HA 2MYSA 4XLNF 1RKEA 2IYLD 2L7AA 2WZGA 2KK1A 2X51A 1U89A 4IRUA 5CI8A 4ZLCA 3S84A 1OW8A 4MTFA 2YWAA 3JRTA 4MTOA 4U5BE 4XQ1A 4A2NB 5CIVA 3AG1C 2KYHA 2R7SA 2KW3C 3WG7C 3ZSUA 2EPMX 2QLAA 2NUTA 3W8IA 4YWQA 3T9OA 4I3MA 5BQGA 3DM9B 4CX9A 1MQVA 2CDQA 2M64A 4PJMA 1BR1A 3MX3A 1B68A 1OW6A 1XWJA 2WVNA 2HMZA 2LSEA 3ZWIA 2RSEB 4BJ6A 4CS9C 4PR9A 4YT5A 3RYLA 5GPGB 2M4EA 5A6JA 4OINF 3EPVA 4GQHA 4EBJA 5L0JA 4O79A 2V3CC 5FZTA 1ST6A 3EZHA 3CEXA 2JX0A 1LI7A 3T6BA 1ZVZA 2W9YA 3IQTA 4Z9IA 4EBBA 2YLDA 1ZYRF 3HNLA 1HMOA 1M56C 2E87A 1JPNA 4UDVA 1A41A 4PJJA 3CZ6A 4PK4A 1V55C 1VYIA 2AWCA 3K1IC 4JRZA 2WVQA 1D0YA 2Y3GA 2CYDA 3K66A 3ZG1A 3M1CB 1U0BB 4IB4A 4E0IA 4CBEA 4DBQA 3US6A 1Q0MA 2ASRA 2D4UA 1C03A 3H2UA 4D4XA 4LERA 4KI2A 3GWLA 4CSAA 4J7YA 3SXMA 4XEFA 3SZRA 1EI7A 4XPYA 4C7OB 1IW7F 4P6IC 2PNOA 1HY5A 2OCCC 4XTKA 2J0XA 2I15A 3DAFA 3C7JA 4XEKA 2W4BA 4DRJB 4LLEA 2GWWA 3C8GB 4DBRA 4NCQA 2XSEA 4BJ5A 2OG2A 2DB4A 2KQ9A 1D1CA 4MNDA 3R2PA 2J7PD 4MVQA 3RKOF 1GQAA 2YLIA 3K1HA 2CGEA 2WVOA 2JD3A 3NKEA 3DJUB 2A1DD 1LE2A 3QTHA 2KJGA 2A0BA 5DVWA 4H4KC 3TJ6A 3I5QA 1RJ9A 3C8GD 5JS5A 1M2OA 4ULWA 4BJTA 2LFDA 2OU6A 4CDYA 1FR0A 3FHDA 2WZLA 4IWBA 4A4AA 1YAUO 1C02A 3GODA 2ZXRA 4EUKB 2ZXOA 3I4UA 3JCUQ 2LFFA 3VF0A 1NU9C 5KYWA 3PHF2 4BPMA 2F22A 3IQ6A 3UR3C 3U2MA 4E17A 2HSQA 1HE9A 1LS4A 2ZD9A 3RVYA 4E7ZA 3EH1A 3V5XA 2AVKA 1QVXA 2CNWA 1TFOB 2WB7A 4BG0A 2YL7A 1LIHA 2GAQA 5EHHA 1Q0FA 1A0BA 3E70C 3EH2A 2KC3A 4NQFA 3B0VC 3FMSA 2XXAB 1JAFA 1RKEB 1EQ1A 1YA7O 3DZAA 4JJGA 5D92A 4NC3A 3TJ5A 1LE4A 3CSKA 4E7SA 4NTAA 5COFA 4YN0B 1YZCA 2OQMA 2NUTB 2YL3A 5TJ5E 1XZPA 2XS1A 2ZXPA 5B1AC 3JRMO 4L6RA 3B0PA 3DAGA 1FFHA 3HNJA 5A69A 1K04A 3UMKA 1TR2A 3HKKA 1XZQA 5KYNA 2BL2A 2QY9A 2EIJC 3K6BA 3TOLA 5L0IA 3ABKC 3JYYA 1ZHTA 4NY3A 4DJ9A 1QKRA 3FOOA 3MBGA 1S7ZA 2EPKX 2R7VA 2Q3TA 2B0HA 3V7OA 5HSWA 1V4AA 3O39A 5T3WA 3M4CA 3N2ZB 2C03A 5JSLA 2MHRA 1YZAA 4CIHA 1RKCA 1A7VA 1YYJA 3KPHA 1NFOA 3M15A 2GDCA 1ZHXA 2VASA 2HJMA 1YVIA 5E3CA 5L0HA 4MVMA 2EINC 1SZIA 2L6HA 3ZQVA 2Z15A 2AWYA 4JCZA 3Q7GA 3T6JA 1BZ4A 1SMYF 2G3KA 3C18A 4YT8A 4O6MA 2KNHA 2R03A 3U9MA 4U5GA 2A6EF 2I8BA 1QQ3A 4JW1A 2Q9CA 4O7GA 4CIPA 1G8XA 1MMNA 3NMKA 4JTAB 4I44A 2A68F 1EA8A 3OWTA 1FTSA 1PD0A 2L9JA 3GEHA 4NTFA 1MNEA 4MVSA 1T6IA 2HUJA 1Q0DA 3HNKA 2Y39A 3B9QA 3EG9B 3KMIA 2P6VA 1Z6AA 4QDLA 3WAQA 2FGYA 4KNWA 2HV7A 1OCOC 2PX0A 5JUAA 2XLWA 4ULVA 4U5CE 5D91A 3KKBA 5B3SC 3C8ZA 1YLMA 2DI3A 2P7VA 4Q4ZF 5F5HA 3RQFA 2XXAA 1JOGA 1RJ9B 3NKDA 1WN0A 3F46A 2V26A 3A9CA 1JPJA 1T6QA 1M57C 3ZTMA 1MMAA 1OCZC 5KYWB 3FOPA 3GM2A 4O6NA 5L3QA 4FX5A 5KYUA 2MWQA 4XPWA 3DMDA 2AP3A 3KYIA 2EIKC 1GS9A 3DD7A 3RFYA 4U5DE 2A69F 1C17M 4LLCA 2WZFA 1OXBA 1JRAA 2HJ3A 2YKZA 2NUPA 4KC9A 4N6HA 4Z9JA 2XM0A 3POVA 3JSEO 3AG4C 1CGOA 2IXOA 1NSGB 1CPRA 3SEOA 3FAPB 1DOWA 5AC4A 1FNTc 2NG1A 4PJNA 3LS0A 2CNWD 1FMVA 3HLZA 4WGZA 3ZTZA 1OR2A 2XLEA 1AEPA 2CW0F 1OXKA 3AG2C 2AU5A 1YARO 2J46A 1TWHA 3B29A 3W2VA 4E0HA 5L0DA 1CPQA 4CJGA 1AVOB 3FVYA 1AUEA 2VCCA 3NMJA 1H9GA 3DI5A 1VK5A 1KU2A 2EPNA 2IOQA 1LPEA 3DXJF 4MQ9F 1HE1A 1O5HA 3G4ZA 1M6TA 4MW8A 4LDRA 4WGYA 5COGA 1CGME 3IQ5A 3LEVA 2GFHA 2IXPA 4ONSA 4D4NA 4C3DA 1E86A 1HW2A 1I5NA 3QW0A 1T9KA 3G50A 4EKWA 2J9WA 2XLOA 4KBLA 1NFNA 3EG9A 2VB6A 4U5EE 4EWCA 3ECSA 3JYHA 1VLSA 2GA0A 1TWGA 2EIMC 4K0DA 4G7OF 4KNVA 2PFDA 3GM3A 1VYKA 4JCHA 2A6HF 3HTKC 4LACB 3U5SA 3SXKA 1UG7A 4OIQF 2UUHA 4CS8C 5DS4A 3NYLA 2YHSA 4ANJA 1Q0KA 1SYQA 2FAPB 5L0GA 4G7HF 1QLEC 2CCYA 2DGJA 2ICWG 3AGTA 1IZMA 1HW1A 3K33A 2R7XA 1D0XA 2BC5A 2XL6A 1G4US 4JTCB 1OQCA 2X0CA 3W8HA 3IQCA 1K05A 1Z63A 1NLXA 3IPMO 1VB5A 1O3UA 2HS5A 4JTDB 3QVYA 3UGPA 3F47A 1A7EA 1SR2A 1YYXA 4OIRF 1V74B 5EGYA 1LVKA 1QPUA 2YL1A 3W4YA 1K40A 3NG1A 1ZW2A 3O6XA 2EPOA 1Z7Qc 3EHMA 3C62A 3TULA 3JZ0A 2PX3A 4YL0A 1F1MA 2LIGA 4W8KA 3PDMP 3T6GB 1DOVA 4IJJA 2R25A 2OJQA 4M63A 4PJLA 2WL8A 3VYWA 1E83A 2J0WA 3EJNA 4MS2A 2J9UA 3GEIA 4AL0A 3SNHA 5KYUB 4GEHA 4PFPA 4DXWA 4AE4B 2PP4A 2Q9BA 2W45A 3MYFA 3NYJA 4DVZA 4CSAC 4GYTA 2NUPB 4HE8D 4I1MA 4JIOA 4AX2A 2YL0A 1KNYA 3O55A 1FMWA 5HV9A 4IGGA 1PV3A 2LP4A 3PMRA 1E84A 2R7RA 2OEXA 4JKVA 2R7OA 2TMVP 4XPXA 3ASNC 3ZDLA 1U6HA 5COMA 3UNGC 1I4YA 3KYJA 5T3TA 4BJ5C 1LI5A 1OCCC 3VAYA 4HFKB 4BJ1A 1ZW3A 1PD1A 2KGOA 2Q4FA 3AG3C 2Y3DA 5DQZA 1OR3A 5E3AA 4CS9A 3QVZA 2HZ8A 3OA1A 3FDQA 2XLDA 3X1OA 3LLIA 3JSZA 2R9RB 3ZVRA 3UGOA 4B6IA 1VTMP 3H65A 3N24A 3LNMB 4OIOF 2L6GA 3KH2A 2L81A 2R05A 1H7IA 1BR4A 3M79A 5K0IA 3LS1A 3M4BA 3MFNA 3E9VA 2H8AA 4E18A 1I4ZA 1ZU5A 2XLHA 3K1IA 4YT2A 1NBBA 1T01A 4FAPB 5JRAA 2W4MA 1M2VB 5A6AA 2J9VA 1VOMA 3L0IA 4C3EA 2VCBA 3A11A 4J7TA 2UUIA 4NTBA 2HV6A 4YT4A 3GORA 4JZAA 4JJFA 3RF3A 4G0HA 4LDQA 3TOMA 4RDAA 4CDAA 1LS1A 4O6YA 3KL4A 3LEOA 2J8WA 3ASOC 3MLGA 3RH3A 1G5ZA 2EPLX 3UMIA 4H54A 4Q5SF 1ZU4A 4BEJA 1NZEA 1Y6DA 2IXNA 2DYRC 3SYNA 5BQHA 2QE9A 4AE4A 1RXQA 3EGDB 1N1CA 3QZCA 1J8YF 3L8JA 3X2QC 3SXYA 4U5FE 5E2QA 2XL4A 5IY5C 1H9TA 4PFOA 3NDBB 1KTMA 4LDKA 1OCRC 2HFIA 5B3IA 4N6CA 4WJ0A 1BR2A 4G7ZF 1D1BA 3C63A 2NSFA 4G78A 5F28E 4CDVA 4CS7A 1GM5A 1WGWA 2HSBA 2P61A 1MNDA 1G4WR 2XLMA 3I5PA 3TD7A 3TK0A 5CI9A 2J9BA 2R7QA 1LM3B 3U0CA 4DOZA 1RMVA 3S29A 2H7BA 1T6UA 3W2WA 5FCLA 3U2LA 3DE8A 3Q6NA 5L3VA 1OKKA 1BDJB 3K7DA 3BEHA 1APCA 4FWVA 1TWCA 3ABLC 3RQGA 3S28A 2RD9A 1J8MF 3Q7LA 3OEOA 4N06A 1OW7A 2YLGA 3H2VA 4XWJA 1FFTC 1SF8A 2OKUA 2O9XA 3CAXA 3U8PA 4ER9A 4DRIB 1MMDA 1S05A 3ZIBA 2QUPA 3WODF 5DLJA 1TWAA 5KYXA 2PF4E 1R5ID 2XRHA 1W2WA 1Z23A 256BA 3EZIA 4J30B 5JVEA 3NMIA 4OD5A 3NRHA 4JE9A 4J32B 3RW0A 3EHNA 3AQCA 4RD9A 3J06A 3AQBA 1YJGA 4PACA 3VM6A 2ZPAA 4AL1A 1VMAA 3PCVA 4CJOA 3S9OA 2D5RB 1PCXA 3IEEA 1JMWA 1M2VA 4MW3A 1LKXA 3LJBA 4YJWA 1ZHYA 5DQTA 1A7DA 3EFOB 4N4WA 1JR8A 1Y4CA 1D0ZA 2QNLA 1ZHZA 3T4RA 3QW1A 3GWNA 3U3BA 3V5ZA 1QZXA 3LESA 3DWWA 1QSPA 4XEVA 5L0CA 1VLTA 2PBEA 4R32A 2Q7RA 4MVZA 3ABMC 1UFBA 5A6BA 2L6FA 3L1MA 3R7CA 5DS6A 3L8IA 3VRCA 4DRHB 2VH3A 3L34A 4DVYP 1D1AA 5BUOA 3EGDA 2LK4A 2Y69C 4MVRA 1E85A 3LAYA 3ITFA 3LUTB 1WOLA 2VC9A 1GGQA 4K1OA 4W8PA 5KYYA 2A0UA 3G4XA 4EHPA 2XL8A 2OOCA 2R02A 1HMDA 1NG1A 1WATA 2YQYA 3MYIA 5E33A 1TQGA 1WTYA 1O87A 2LQGA 2P1AA 3DM5A 1FAPB 4P9TA 4JEAA 2OEVA 1RCPA 4AK9A 3ATPA 1YDIA 4Q7CA 2LD6A 3GM1A 4OD4A 2B0JA 5F5FA 4JC7A 4C3BA 3RIPA 2XLVA 3FAJA 5A6KA 2VCAA 3S90A 4HEAJ 4U9DA 4JEBA 3S27A 2YVKA 4BEMJ 5JLIA 2XS8A 2OJED 4MVUA 2HKVA 1TFKB 5EK0A 4BJ6C 1TKNA 1E2XA 2FFHA 4P9FA 3QMKA 2Y3HA 2YRFA 2P0NA 2XM4A 2BE5F 5T1DB 4K7BA 3EGXB 4XLPF 3JT1A 1MMGA 1NU7D 3V5YA 2Y3BA 4ZLDA 2HMQA 2ETSA 1ORSC 3NYMA 1L3PA 1ZHWA 1ORJA
chains in the Genus database with same CATH topology
3EQLF 1Z3IX 3EFOA 2YZSA 3SP1A 2QTVA 5B1BC 4I1OB 5KYXB 4C7OA 2H7VC 1Z5ZA 1OKKD 4HFFB 5DS5A 1V54C 2J7PA 2J45A 2Q9AA 3GANA 4IAOA 4FESA 2YEVA 3S0XA 3LNRA 3UMHA 3ZC4A 4X0RA 2H7OA 2G3VA 2DYSC 2R7TA 2IXMA 3DJNB 4F4BA 4OIPF 3Q6MA 3LLKA 4JURI 2ZXWC 3HJCA 4QI2A 2EILC 3CQZA 3N0TA 2G62A 5KYYB 2R7WA 4QI0A 2C04A 4JVSA 3B0UX 4RBNA 4CS8A 3EGXA 2R7UA 4U5HA 2MYSA 4XLNF 2IYLD 2WZGA 5CI8A 2X51A 4IRUA 4ZLCA 4CIHA 3JRTA 4A2NB 3AG1C 2R7SA 2KW3C 3WG7C 3ZSUA 2NUTA 3W8IA 4YWQA 4I3MA 3DM9B 2CDQA 4PJMA 4U5BE 1BR1A 3MX3A 2WVNA 2LSEA 4CS9C 4YT5A 3RYLA 2M4EA 4OINF 3EPVA 2V3CC 4O79A 1ST6A 3EZHA 3T6BA 2W9YA 4EBBA 1ZYRF 1M56C 2E87A 1JPNA 4PJJA 3CZ6A 4PK4A 1V55C 1VYIA 3K1IC 2WVQA 1D0YA 2Y3GA 3K66A 3ZG1A 3M1CB 4CBEA 4DBQA 4LERA 4KI2A 4CSAA 3SZRA 4C7OB 1IW7F 4P6IC 2OCCC 4XTKA 2J0XA 3DAFA 2W4BA 4LLEA 4DBRA 4BJ5A 2XSEA 2OG2A 2KQ9A 1D1CA 4MNDA 2J7PD 3RKOF 3K1HA 2CGEA 2WVOA 2JD3A 3NKEA 3DJUB 2A1DD 5DVWA 2KJGA 4H4KC 3I5QA 1RJ9A 1M2OA 4ULWA 4BJTA 3FHDA 2WZLA 4IWBA 3GODA 2ZXRA 2ZXOA 3I4UA 3JCUQ 5KYWA 1NU9C 3PHF2 3UR3C 4E7ZA 3EH1A 2WB7A 2CNWA 4BG0A 5EHHA 3EH2A 3E70C 3B0VC 2XXAB 3DZAA 4JJGA 5D92A 3CSKA 4E7SA 4YN0B 2NUTB 2ZXPA 5B1AC 3B0PA 3DAGA 1FFHA 3UMKA 1TR2A 5KYNA 2QY9A 2EIJC 3K6BA 3ABKC 1ZHTA 4NY3A 1S7ZA 2R7VA 2Q3TA 3V7OA 5HSWA 3O39A 5T3WA 3N2ZB 2C03A 4DVZA 5E3CA 1ZHXA 2VASA 2EINC 1SZIA 2Z15A 3Q7GA 3T6JA 1SMYF 2G3KA 4YT8A 4O6MA 2KNHA 4U5GA 2A6EF 2I8BA 4JW1A 2Q9CA 4O7GA 1G8XA 1MMNA 4I44A 2A68F 3OWTA 1FTSA 1PD0A 2L9JA 1MNEA 2Y39A 3KMIA 3B9QA 3EG9B 2P6VA 1Z6AA 4QDLA 2FGYA 4KNWA 2HV7A 1OCOC 2PX0A 4U5CE 5D91A 3KKBA 5B3SC 2P7VA 4Q4ZF 5F5HA 2XXAA 1RJ9B 3NKDA 3F46A 2V26A 1JPJA 1M57C 1MMAA 1OCZC 5KYWB 4O6NA 5L3QA 4FX5A 5KYUA 2MWQA 3DMDA 2EIKC 3DD7A 3RFYA 4U5DE 2A69F 4LLCA 2WZFA 2NUPA 4KC9A 3POVA 3AG4C 2IXOA 3SEOA 2NG1A 4PJNA 3LS0A 2CNWD 3HLZA 1FMVA 2CW0F 3AG2C 2J46A 1TWHA 3W2VA 3FVYA 1VK5A 1KU2A 4MQ9F 2IOQA 4BJ6A 3DXJF 1O5HA 3LEVA 2GFHA 2IXPA 4C3DA 2J9WA 4KBLA 3EG9A 2VB6A 4U5EE 4EWCA 3ECSA 3JYHA 1TWGA 2EIMC 4K0DA 4G7OF 4KNVA 2PFDA 1VYKA 4JCHA 2A6HF 3HTKC 4LACB 4OIQF 4CS8C 5DS4A 3NYLA 2YHSA 4ANJA 4G7HF 1QLEC 2DGJA 1IZMA 3K33A 2R7XA 1D0XA 3W8HA 1Z63A 3UGPA 3F47A 4OIRF 5EGYA 1LVKA 3NG1A 3O6XA 3EHMA 2PX3A 4W8KA 4IJJA 4M63A 3VYWA 2WL8A 2J0WA 3EJNA 2J9UA 3SNHA 5KYUB 4GEHA 4PFPA 4AE4B 2PP4A 2Q9BA 2W45A 3NYJA 4CSAC 4GYTA 2NUPB 4HE8D 4I1MA 4AX2A 1FMWA 2R7RA 3PMRA 2R7OA 3ASNC 3UNGC 5T3TA 4BJ5C 1OCCC 3VAYA 4HFKB 4BJ1A 2KGOA 1PD1A 3AG3C 2Y3DA 5DQZA 5E3AA 4CS9A 3OA1A 3FDQA 3X1OA 3LLIA 3JSZA 3ZVRA 3UGOA 4B6IA 3H65A 3N24A 4OIOF 3KH2A 2L81A 1BR4A 3LS1A 3E9VA 1ZU5A 4YT2A 2W4MA 1M2VB 2J9VA 1VOMA 3L0IA 4C3EA 4YT4A 2HV6A 4JZAA 4JJFA 4G0HA 4RDAA 1LS1A 4O6YA 3KL4A 3ASOC 3MLGA 3RH3A 3UMIA 4Q5SF 1ZU4A 4BEJA 1NZEA 2IXNA 2DYRC 3SYNA 4AE4A 3EGDB 1N1CA 3QZCA 1J8YF 3X2QC 3NDBB 4U5FE 5E2QA 2XL4A 5IY5C 4PFOA 1OCRC 4WJ0A 4G7ZF 1BR2A 1D1BA 4CS7A 1WGWA 1MNDA 3TD7A 3I5PA 5CI9A 2R7QA 4DOZA 3S29A 2H7BA 3W2WA 5FCLA 3Q6NA 5L3VA 1OKKA 3K7DA 4FWVA 1TWCA 3ABLC 3S28A 1J8MF 3Q7LA 3OEOA 4N06A 4XWJA 1FFTC 1SF8A 2O9XA 1MMDA 3ZIBA 5KYXA 3WODF 5DLJA 1TWAA 2PF4E 2XRHA 1W2WA 1Z23A 3EZIA 4J30B 4OD5A 3NRHA 4J32B 3EHNA 3AQCA 4RD9A 3AQBA 2ZPAA 1VMAA 2D5RB 1PCXA 3IEEA 1M2VA 1LKXA 3LJBA 4YJWA 1ZHYA 5DQTA 3EFOB 1D0ZA 1ZHZA 3T4RA 1QZXA 3LESA 3ABMC 5DS6A 2VH3A 3L34A 4DVYP 1D1AA 5BUOA 3EGDA 2Y69C 3LAYA 3ITFA 5KYYA 1NG1A 5E33A 1O87A 3DM5A 4AK9A 4Q7CA 4OD4A 2B0JA 5F5FA 4C3BA 3RIPA 3FAJA 4HEAJ 3S27A 4BJ6C 1TKNA 2FFHA 3QMKA 2Y3HA 2BE5F 5T1DB 4K7BA 3EGXB 4XLPF 3JT1A 1MMGA 1NU7D 2Y3BA 4ZLDA 4PJLA 3NYMA 1ZHWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I3M A;  3LNR A;  4I44 A; 
#chains in the Genus database with same CATH topology
 3EQL F;  3AOU A;  5JT4 A;  3AJM A;  1Z3I X;  4U9E A;  3U8V A;  3AGU A;  2NSG A;  3BRJ A;  3EFO A;  2LCH A;  2YZS A;  2QTV A;  4Z9H A;  1Q0G A;  3SP1 A;  5B1B C;  3B71 A;  3JTL O;  4I1O B;  3ZQY A;  5KYX B;  2IBF A;  2NPU A;  4C7O A;  5BQI A;  2H7V C;  1Z5Z A;  1OKK D;  3DKA A;  4HFF B;  2KSF A;  5DS5 A;  3GEE A;  1V54 C;  4YL3 A;  3TQO A;  2J7P A;  1R4T A;  1T5O A;  2J45 A;  2Q9A A;  3WHN A;  3GAN A;  4IAO A;  1BBH A;  4WAB A;  3RQE A;  4EBK A;  3C8G A;  5AGF A;  3DE9 A;  5JP7 A;  4FES A;  2YEV A;  2Q00 A;  3S0X A;  5AC5 A;  4YK5 A;  3LNR A;  2JPU A;  3IHU A;  4YL1 A;  4EIY A;  3UMH A;  3ZC4 A;  4X0R A;  4IAQ A;  3O10 A;  2H7O A;  3U3F A;  1WWP A;  2G3V A;  1ZZP A;  2DYS C;  2R7T A;  2IXM A;  1CGN A;  5L0F A;  3DJN B;  4F4B A;  4OIP F;  3RVZ A;  3FXH A;  3Q6M A;  3LLK A;  1EKY A;  1L7C A;  1H6G A;  3HNI A;  2ZXW C;  4IAR A;  4JUR I;  3HJC A;  4MTG A;  2EIL C;  3U9J A;  4QI2 A;  2IM8 A;  3CQZ A;  3N0T A;  4MVO A;  2G62 A;  5A6B D;  5KYY B;  1YA9 A;  4QI0 A;  2R7W A;  1ORY A;  2C04 A;  4JVS A;  1WAS A;  3B0U X;  3SXZ A;  4RBN A;  4CS8 A;  3EGX A;  2R7U A;  4U5H A;  2MYS A;  4XLN F;  1RKE A;  2IYL D;  2L7A A;  2WZG A;  2KK1 A;  2X51 A;  1U89 A;  4IRU A;  5CI8 A;  4ZLC A;  3S84 A;  1OW8 A;  4MTF A;  2YWA A;  3JRT A;  4MTO A;  4U5B E;  4XQ1 A;  4A2N B;  5CIV A;  3AG1 C;  2KYH A;  2R7S A;  2KW3 C;  3WG7 C;  3ZSU A;  2EPM X;  2QLA A;  2NUT A;  3W8I A;  4YWQ A;  3T9O A;  4I3M A;  5BQG A;  3DM9 B;  4CX9 A;  1MQV A;  2CDQ A;  2M64 A;  4PJM A;  1BR1 A;  3MX3 A;  1B68 A;  1OW6 A;  1XWJ A;  2WVN A;  2HMZ A;  2LSE A;  3ZWI A;  2RSE B;  4BJ6 A;  4CS9 C;  4PR9 A;  4YT5 A;  3RYL A;  5GPG B;  2M4E A;  5A6J A;  4OIN F;  3EPV A;  4GQH A;  4EBJ A;  5L0J A;  4O79 A;  2V3C C;  5FZT A;  1ST6 A;  3EZH A;  3CEX A;  2JX0 A;  1LI7 A;  3T6B A;  1ZVZ A;  2W9Y A;  3IQT A;  4Z9I A;  4EBB A;  2YLD A;  1ZYR F;  3HNL A;  1HMO A;  1M56 C;  2E87 A;  1JPN A;  4UDV A;  1A41 A;  4PJJ A;  3CZ6 A;  4PK4 A;  1V55 C;  1VYI A;  2AWC A;  3K1I C;  4JRZ A;  2WVQ A;  1D0Y A;  2Y3G A;  2CYD A;  3K66 A;  3ZG1 A;  3M1C B;  1U0B B;  4IB4 A;  4E0I A;  4CBE A;  4DBQ A;  3US6 A;  1Q0M A;  2ASR A;  2D4U A;  1C03 A;  3H2U A;  4D4X A;  4LER A;  4KI2 A;  3GWL A;  4CSA A;  4J7Y A;  3SXM A;  4XEF A;  3SZR A;  1EI7 A;  4XPY A;  4C7O B;  1IW7 F;  4P6I C;  2PNO A;  1HY5 A;  2OCC C;  4XTK A;  2J0X A;  2I15 A;  3DAF A;  3C7J A;  4XEK A;  2W4B A;  4DRJ B;  4LLE A;  2GWW A;  3C8G B;  4DBR A;  4NCQ A;  2XSE A;  4BJ5 A;  2OG2 A;  2DB4 A;  2KQ9 A;  1D1C A;  4MND A;  3R2P A;  2J7P D;  4MVQ A;  3RKO F;  1GQA A;  2YLI A;  3K1H A;  2CGE A;  2WVO A;  2JD3 A;  3NKE A;  3DJU B;  2A1D D;  1LE2 A;  3QTH A;  2KJG A;  2A0B A;  5DVW A;  4H4K C;  3TJ6 A;  3I5Q A;  1RJ9 A;  3C8G D;  5JS5 A;  1M2O A;  4ULW A;  4BJT A;  2LFD A;  2OU6 A;  4CDY A;  1FR0 A;  3FHD A;  2WZL A;  4IWB A;  4A4A A;  1YAU O;  1C02 A;  3GOD A;  2ZXR A;  4EUK B;  2ZXO A;  3I4U A;  3JCU Q;  2LFF A;  3VF0 A;  1NU9 C;  5KYW A;  3PHF 2;  4BPM A;  2F22 A;  3IQ6 A;  3UR3 C;  3U2M A;  4E17 A;  2HSQ A;  1HE9 A;  1LS4 A;  2ZD9 A;  3RVY A;  4E7Z A;  3EH1 A;  3V5X A;  2AVK A;  1QVX A;  2CNW A;  1TFO B;  2WB7 A;  4BG0 A;  2YL7 A;  1LIH A;  2GAQ A;  5EHH A;  1Q0F A;  1A0B A;  3E70 C;  3EH2 A;  2KC3 A;  4NQF A;  3B0V C;  3FMS A;  2XXA B;  1JAF A;  1RKE B;  1EQ1 A;  1YA7 O;  3DZA A;  4JJG A;  5D92 A;  4NC3 A;  3TJ5 A;  1LE4 A;  3CSK A;  4E7S A;  4NTA A;  5COF A;  4YN0 B;  1YZC A;  2OQM A;  2NUT B;  2YL3 A;  5TJ5 E;  1XZP A;  2XS1 A;  2ZXP A;  5B1A C;  3JRM O;  4L6R A;  3B0P A;  3DAG A;  1FFH A;  3HNJ A;  5A69 A;  1K04 A;  3UMK A;  1TR2 A;  3HKK A;  1XZQ A;  5KYN A;  2BL2 A;  2QY9 A;  2EIJ C;  3K6B A;  3TOL A;  5L0I A;  3ABK C;  3JYY A;  1ZHT A;  4NY3 A;  4DJ9 A;  1QKR A;  3FOO A;  3MBG A;  1S7Z A;  2EPK X;  2R7V A;  2Q3T A;  2B0H A;  3V7O A;  5HSW A;  1V4A A;  3O39 A;  5T3W A;  3M4C A;  3N2Z B;  2C03 A;  5JSL A;  2MHR A;  1YZA A;  4CIH A;  1RKC A;  1A7V A;  1YYJ A;  3KPH A;  1NFO A;  3M15 A;  2GDC A;  1ZHX A;  2VAS A;  2HJM A;  1YVI A;  5E3C A;  5L0H A;  4MVM A;  2EIN C;  1SZI A;  2L6H A;  3ZQV A;  2Z15 A;  2AWY A;  4JCZ A;  3Q7G A;  3T6J A;  1BZ4 A;  1SMY F;  2G3K A;  3C18 A;  4YT8 A;  4O6M A;  2KNH A;  2R03 A;  3U9M A;  4U5G A;  2A6E F;  2I8B A;  1QQ3 A;  4JW1 A;  2Q9C A;  4O7G A;  4CIP A;  1G8X A;  1MMN A;  3NMK A;  4JTA B;  4I44 A;  2A68 F;  1EA8 A;  3OWT A;  1FTS A;  1PD0 A;  2L9J A;  3GEH A;  4NTF A;  1MNE A;  4MVS A;  1T6I A;  2HUJ A;  1Q0D A;  3HNK A;  2Y39 A;  3B9Q A;  3EG9 B;  3KMI A;  2P6V A;  1Z6A A;  4QDL A;  3WAQ A;  2FGY A;  4KNW A;  2HV7 A;  1OCO C;  2PX0 A;  5JUA A;  2XLW A;  4ULV A;  4U5C E;  5D91 A;  3KKB A;  5B3S C;  3C8Z A;  1YLM A;  2DI3 A;  2P7V A;  4Q4Z F;  5F5H A;  3RQF A;  2XXA A;  1JOG A;  1RJ9 B;  3NKD A;  1WN0 A;  3F46 A;  2V26 A;  3A9C A;  1JPJ A;  1T6Q A;  1M57 C;  3ZTM A;  1MMA A;  1OCZ C;  5KYW B;  3FOP A;  3GM2 A;  4O6N A;  5L3Q A;  4FX5 A;  5KYU A;  2MWQ A;  4XPW A;  3DMD A;  2AP3 A;  3KYI A;  2EIK C;  1GS9 A;  3DD7 A;  3RFY A;  4U5D E;  2A69 F;  1C17 M;  4LLC A;  2WZF A;  1OXB A;  1JRA A;  2HJ3 A;  2YKZ A;  2NUP A;  4KC9 A;  4N6H A;  4Z9J A;  2XM0 A;  3POV A;  3JSE O;  3AG4 C;  1CGO A;  2IXO A;  1NSG B;  1CPR A;  3SEO A;  3FAP B;  1DOW A;  5AC4 A;  1FNT c;  2NG1 A;  4PJN A;  3LS0 A;  2CNW D;  1FMV A;  3HLZ A;  4WGZ A;  3ZTZ A;  1OR2 A;  2XLE A;  1AEP A;  2CW0 F;  1OXK A;  3AG2 C;  2AU5 A;  1YAR O;  2J46 A;  1TWH A;  3B29 A;  3W2V A;  4E0H A;  5L0D A;  1CPQ A;  4CJG A;  1AVO B;  3FVY A;  1AUE A;  2VCC A;  3NMJ A;  1H9G A;  3DI5 A;  1VK5 A;  1KU2 A;  2EPN A;  2IOQ A;  1LPE A;  3DXJ F;  4MQ9 F;  1HE1 A;  1O5H A;  3G4Z A;  1M6T A;  4MW8 A;  4LDR A;  4WGY A;  5COG A;  1CGM E;  3IQ5 A;  3LEV A;  2GFH A;  2IXP A;  4ONS A;  4D4N A;  4C3D A;  1E86 A;  1HW2 A;  1I5N A;  3QW0 A;  1T9K A;  3G50 A;  4EKW A;  2J9W A;  2XLO A;  4KBL A;  1NFN A;  3EG9 A;  2VB6 A;  4U5E E;  4EWC A;  3ECS A;  3JYH A;  1VLS A;  2GA0 A;  1TWG A;  2EIM C;  4K0D A;  4G7O F;  4KNV A;  2PFD A;  3GM3 A;  1VYK A;  4JCH A;  2A6H F;  3HTK C;  4LAC B;  3U5S A;  3SXK A;  1UG7 A;  4OIQ F;  2UUH A;  4CS8 C;  5DS4 A;  3NYL A;  2YHS A;  4ANJ A;  1Q0K A;  1SYQ A;  2FAP B;  5L0G A;  4G7H F;  1QLE C;  2CCY A;  2DGJ A;  2ICW G;  3AGT A;  1IZM A;  1HW1 A;  3K33 A;  2R7X A;  1D0X A;  2BC5 A;  2XL6 A;  1G4U S;  4JTC B;  1OQC A;  2X0C A;  3W8H A;  3IQC A;  1K05 A;  1Z63 A;  1NLX A;  3IPM O;  1VB5 A;  1O3U A;  2HS5 A;  4JTD B;  3QVY A;  3UGP A;  3F47 A;  1A7E A;  1SR2 A;  1YYX A;  4OIR F;  1V74 B;  5EGY A;  1LVK A;  1QPU A;  2YL1 A;  3W4Y A;  1K40 A;  3NG1 A;  1ZW2 A;  3O6X A;  2EPO A;  1Z7Q c;  3EHM A;  3C62 A;  3TUL A;  3JZ0 A;  2PX3 A;  4YL0 A;  1F1M A;  2LIG A;  4W8K A;  3PDM P;  3T6G B;  1DOV A;  4IJJ A;  2R25 A;  2OJQ A;  4M63 A;  4PJL A;  2WL8 A;  3VYW A;  1E83 A;  2J0W A;  3EJN A;  4MS2 A;  2J9U A;  3GEI A;  4AL0 A;  3SNH A;  5KYU B;  4GEH A;  4PFP A;  4DXW A;  4AE4 B;  2PP4 A;  2Q9B A;  2W45 A;  3MYF A;  3NYJ A;  4DVZ A;  4CSA C;  4GYT A;  2NUP B;  4HE8 D;  4I1M A;  4JIO A;  4AX2 A;  2YL0 A;  1KNY A;  3O55 A;  1FMW A;  5HV9 A;  4IGG A;  1PV3 A;  2LP4 A;  3PMR A;  1E84 A;  2R7R A;  2OEX A;  4JKV A;  2R7O A;  2TMV P;  4XPX A;  3ASN C;  3ZDL A;  1U6H A;  5COM A;  3UNG C;  1I4Y A;  3KYJ A;  5T3T A;  4BJ5 C;  1LI5 A;  1OCC C;  3VAY A;  4HFK B;  4BJ1 A;  1ZW3 A;  1PD1 A;  2KGO A;  2Q4F A;  3AG3 C;  2Y3D A;  5DQZ A;  1OR3 A;  5E3A A;  4CS9 A;  3QVZ A;  2HZ8 A;  3OA1 A;  3FDQ A;  2XLD A;  3X1O A;  3LLI A;  3JSZ A;  2R9R B;  3ZVR A;  3UGO A;  4B6I A;  1VTM P;  3H65 A;  3N24 A;  3LNM B;  4OIO F;  2L6G A;  3KH2 A;  2L81 A;  2R05 A;  1H7I A;  1BR4 A;  3M79 A;  5K0I A;  3LS1 A;  3M4B A;  3MFN A;  3E9V A;  2H8A A;  4E18 A;  1I4Z A;  1ZU5 A;  2XLH A;  3K1I A;  4YT2 A;  1NBB A;  1T01 A;  4FAP B;  5JRA A;  2W4M A;  1M2V B;  5A6A A;  2J9V A;  1VOM A;  3L0I A;  4C3E A;  2VCB A;  3A11 A;  4J7T A;  2UUI A;  4NTB A;  2HV6 A;  4YT4 A;  3GOR A;  4JZA A;  4JJF A;  3RF3 A;  4G0H A;  4LDQ A;  3TOM A;  4RDA A;  4CDA A;  1LS1 A;  4O6Y A;  3KL4 A;  3LEO A;  2J8W A;  3ASO C;  3MLG A;  3RH3 A;  1G5Z A;  2EPL X;  3UMI A;  4H54 A;  4Q5S F;  1ZU4 A;  4BEJ A;  1NZE A;  1Y6D A;  2IXN A;  2DYR C;  3SYN A;  5BQH A;  2QE9 A;  4AE4 A;  1RXQ A;  3EGD B;  1N1C A;  3QZC A;  1J8Y F;  3L8J A;  3X2Q C;  3SXY A;  4U5F E;  5E2Q A;  2XL4 A;  5IY5 C;  1H9T A;  4PFO A;  3NDB B;  1KTM A;  4LDK A;  1OCR C;  2HFI A;  5B3I A;  4N6C A;  4WJ0 A;  1BR2 A;  4G7Z F;  1D1B A;  3C63 A;  2NSF A;  4G78 A;  5F28 E;  4CDV A;  4CS7 A;  1GM5 A;  1WGW A;  2HSB A;  2P61 A;  1MND A;  1G4W R;  2XLM A;  3I5P A;  3TD7 A;  3TK0 A;  5CI9 A;  2J9B A;  2R7Q A;  1LM3 B;  3U0C A;  4DOZ A;  1RMV A;  3S29 A;  2H7B A;  1T6U A;  3W2W A;  5FCL A;  3U2L A;  3DE8 A;  3Q6N A;  5L3V A;  1OKK A;  1BDJ B;  3K7D A;  3BEH A;  1APC A;  4FWV A;  1TWC A;  3ABL C;  3RQG A;  3S28 A;  2RD9 A;  1J8M F;  3Q7L A;  3OEO A;  4N06 A;  1OW7 A;  2YLG A;  3H2V A;  4XWJ A;  1FFT C;  1SF8 A;  2OKU A;  2O9X A;  3CAX A;  3U8P A;  4ER9 A;  4DRI B;  1MMD A;  1S05 A;  3ZIB A;  2QUP A;  3WOD F;  5DLJ A;  1TWA A;  5KYX A;  2PF4 E;  1R5I D;  2XRH A;  1W2W A;  1Z23 A;  256B A;  3EZI A;  4J30 B;  5JVE A;  3NMI A;  4OD5 A;  3NRH A;  4JE9 A;  4J32 B;  3RW0 A;  3EHN A;  3AQC A;  4RD9 A;  3J06 A;  3AQB A;  1YJG A;  4PAC A;  3VM6 A;  2ZPA A;  4AL1 A;  1VMA A;  3PCV A;  4CJO A;  3S9O A;  2D5R B;  1PCX A;  3IEE A;  1JMW A;  1M2V A;  4MW3 A;  1LKX A;  3LJB A;  4YJW A;  1ZHY A;  5DQT A;  1A7D A;  3EFO B;  4N4W A;  1JR8 A;  1Y4C A;  1D0Z A;  2QNL A;  1ZHZ A;  3T4R A;  3QW1 A;  3GWN A;  3U3B A;  3V5Z A;  1QZX A;  3LES A;  3DWW A;  1QSP A;  4XEV A;  5L0C A;  1VLT A;  2PBE A;  4R32 A;  2Q7R A;  4MVZ A;  3ABM C;  1UFB A;  5A6B A;  2L6F A;  3L1M A;  3R7C A;  5DS6 A;  3L8I A;  3VRC A;  4DRH B;  2VH3 A;  3L34 A;  4DVY P;  1D1A A;  5BUO A;  3EGD A;  2LK4 A;  2Y69 C;  4MVR A;  1E85 A;  3LAY A;  3ITF A;  3LUT B;  1WOL A;  2VC9 A;  1GGQ A;  4K1O A;  4W8P A;  5KYY A;  2A0U A;  3G4X A;  4EHP A;  2XL8 A;  2OOC A;  2R02 A;  1HMD A;  1NG1 A;  1WAT A;  2YQY A;  3MYI A;  5E33 A;  1TQG A;  1WTY A;  1O87 A;  2LQG A;  2P1A A;  3DM5 A;  1FAP B;  4P9T A;  4JEA A;  2OEV A;  1RCP A;  4AK9 A;  3ATP A;  1YDI A;  4Q7C A;  2LD6 A;  3GM1 A;  4OD4 A;  2B0J A;  5F5F A;  4JC7 A;  4C3B A;  3RIP A;  2XLV A;  3FAJ A;  5A6K A;  2VCA A;  3S90 A;  4HEA J;  4U9D A;  4JEB A;  3S27 A;  2YVK A;  4BEM J;  5JLI A;  2XS8 A;  2OJE D;  4MVU A;  2HKV A;  1TFK B;  5EK0 A;  4BJ6 C;  1TKN A;  1E2X A;  2FFH A;  4P9F A;  3QMK A;  2Y3H A;  2YRF A;  2P0N A;  2XM4 A;  2BE5 F;  5T1D B;  4K7B A;  3EGX B;  4XLP F;  3JT1 A;  1MMG A;  1NU7 D;  3V5Y A;  2Y3B A;  4ZLD A;  2HMQ A;  2ETS A;  1ORS C;  3NYM A;  1L3P A;  1ZHW A;  1ORJ A; 
#chains in the Genus database with same CATH homology
 3EQL F;  1Z3I X;  3EFO A;  2YZS A;  3SP1 A;  2QTV A;  5B1B C;  4I1O B;  5KYX B;  4C7O A;  2H7V C;  1Z5Z A;  1OKK D;  4HFF B;  5DS5 A;  1V54 C;  2J7P A;  2J45 A;  2Q9A A;  3GAN A;  4IAO A;  4FES A;  2YEV A;  3S0X A;  3LNR A;  3UMH A;  3ZC4 A;  4X0R A;  2H7O A;  2G3V A;  2DYS C;  2R7T A;  2IXM A;  3DJN B;  4F4B A;  4OIP F;  3Q6M A;  3LLK A;  4JUR I;  2ZXW C;  3HJC A;  4QI2 A;  2EIL C;  3CQZ A;  3N0T A;  2G62 A;  5KYY B;  2R7W A;  4QI0 A;  2C04 A;  4JVS A;  3B0U X;  4RBN A;  4CS8 A;  3EGX A;  2R7U A;  4U5H A;  2MYS A;  4XLN F;  2IYL D;  2WZG A;  5CI8 A;  2X51 A;  4IRU A;  4ZLC A;  4CIH A;  3JRT A;  4A2N B;  3AG1 C;  2R7S A;  2KW3 C;  3WG7 C;  3ZSU A;  2NUT A;  3W8I A;  4YWQ A;  4I3M A;  3DM9 B;  2CDQ A;  4PJM A;  4U5B E;  1BR1 A;  3MX3 A;  2WVN A;  2LSE A;  4CS9 C;  4YT5 A;  3RYL A;  2M4E A;  4OIN F;  3EPV A;  2V3C C;  4O79 A;  1ST6 A;  3EZH A;  3T6B A;  2W9Y A;  4EBB A;  1ZYR F;  1M56 C;  2E87 A;  1JPN A;  4PJJ A;  3CZ6 A;  4PK4 A;  1V55 C;  1VYI A;  3K1I C;  2WVQ A;  1D0Y A;  2Y3G A;  3K66 A;  3ZG1 A;  3M1C B;  4CBE A;  4DBQ A;  4LER A;  4KI2 A;  4CSA A;  3SZR A;  4C7O B;  1IW7 F;  4P6I C;  2OCC C;  4XTK A;  2J0X A;  3DAF A;  2W4B A;  4LLE A;  4DBR A;  4BJ5 A;  2XSE A;  2OG2 A;  2KQ9 A;  1D1C A;  4MND A;  2J7P D;  3RKO F;  3K1H A;  2CGE A;  2WVO A;  2JD3 A;  3NKE A;  3DJU B;  2A1D D;  5DVW A;  2KJG A;  4H4K C;  3I5Q A;  1RJ9 A;  1M2O A;  4ULW A;  4BJT A;  3FHD A;  2WZL A;  4IWB A;  3GOD A;  2ZXR A;  2ZXO A;  3I4U A;  3JCU Q;  5KYW A;  1NU9 C;  3PHF 2;  3UR3 C;  4E7Z A;  3EH1 A;  2WB7 A;  2CNW A;  4BG0 A;  5EHH A;  3EH2 A;  3E70 C;  3B0V C;  2XXA B;  3DZA A;  4JJG A;  5D92 A;  3CSK A;  4E7S A;  4YN0 B;  2NUT B;  2ZXP A;  5B1A C;  3B0P A;  3DAG A;  1FFH A;  3UMK A;  1TR2 A;  5KYN A;  2QY9 A;  2EIJ C;  3K6B A;  3ABK C;  1ZHT A;  4NY3 A;  1S7Z A;  2R7V A;  2Q3T A;  3V7O A;  5HSW A;  3O39 A;  5T3W A;  3N2Z B;  2C03 A;  4DVZ A;  5E3C A;  1ZHX A;  2VAS A;  2EIN C;  1SZI A;  2Z15 A;  3Q7G A;  3T6J A;  1SMY F;  2G3K A;  4YT8 A;  4O6M A;  2KNH A;  4U5G A;  2A6E F;  2I8B A;  4JW1 A;  2Q9C A;  4O7G A;  1G8X A;  1MMN A;  4I44 A;  2A68 F;  3OWT A;  1FTS A;  1PD0 A;  2L9J A;  1MNE A;  2Y39 A;  3KMI A;  3B9Q A;  3EG9 B;  2P6V A;  1Z6A A;  4QDL A;  2FGY A;  4KNW A;  2HV7 A;  1OCO C;  2PX0 A;  4U5C E;  5D91 A;  3KKB A;  5B3S C;  2P7V A;  4Q4Z F;  5F5H A;  2XXA A;  1RJ9 B;  3NKD A;  3F46 A;  2V26 A;  1JPJ A;  1M57 C;  1MMA A;  1OCZ C;  5KYW B;  4O6N A;  5L3Q A;  4FX5 A;  5KYU A;  2MWQ A;  3DMD A;  2EIK C;  3DD7 A;  3RFY A;  4U5D E;  2A69 F;  4LLC A;  2WZF A;  2NUP A;  4KC9 A;  3POV A;  3AG4 C;  2IXO A;  3SEO A;  2NG1 A;  4PJN A;  3LS0 A;  2CNW D;  3HLZ A;  1FMV A;  2CW0 F;  3AG2 C;  2J46 A;  1TWH A;  3W2V A;  3FVY A;  1VK5 A;  1KU2 A;  4MQ9 F;  2IOQ A;  4BJ6 A;  3DXJ F;  1O5H A;  3LEV A;  2GFH A;  2IXP A;  4C3D A;  2J9W A;  4KBL A;  3EG9 A;  2VB6 A;  4U5E E;  4EWC A;  3ECS A;  3JYH A;  1TWG A;  2EIM C;  4K0D A;  4G7O F;  4KNV A;  2PFD A;  1VYK A;  4JCH A;  2A6H F;  3HTK C;  4LAC B;  4OIQ F;  4CS8 C;  5DS4 A;  3NYL A;  2YHS A;  4ANJ A;  4G7H F;  1QLE C;  2DGJ A;  1IZM A;  3K33 A;  2R7X A;  1D0X A;  3W8H A;  1Z63 A;  3UGP A;  3F47 A;  4OIR F;  5EGY A;  1LVK A;  3NG1 A;  3O6X A;  3EHM A;  2PX3 A;  4W8K A;  4IJJ A;  4M63 A;  3VYW A;  2WL8 A;  2J0W A;  3EJN A;  2J9U A;  3SNH A;  5KYU B;  4GEH A;  4PFP A;  4AE4 B;  2PP4 A;  2Q9B A;  2W45 A;  3NYJ A;  4CSA C;  4GYT A;  2NUP B;  4HE8 D;  4I1M A;  4AX2 A;  1FMW A;  2R7R A;  3PMR A;  2R7O A;  3ASN C;  3UNG C;  5T3T A;  4BJ5 C;  1OCC C;  3VAY A;  4HFK B;  4BJ1 A;  2KGO A;  1PD1 A;  3AG3 C;  2Y3D A;  5DQZ A;  5E3A A;  4CS9 A;  3OA1 A;  3FDQ A;  3X1O A;  3LLI A;  3JSZ A;  3ZVR A;  3UGO A;  4B6I A;  3H65 A;  3N24 A;  4OIO F;  3KH2 A;  2L81 A;  1BR4 A;  3LS1 A;  3E9V A;  1ZU5 A;  4YT2 A;  2W4M A;  1M2V B;  2J9V A;  1VOM A;  3L0I A;  4C3E A;  4YT4 A;  2HV6 A;  4JZA A;  4JJF A;  4G0H A;  4RDA A;  1LS1 A;  4O6Y A;  3KL4 A;  3ASO C;  3MLG A;  3RH3 A;  3UMI A;  4Q5S F;  1ZU4 A;  4BEJ A;  1NZE A;  2IXN A;  2DYR C;  3SYN A;  4AE4 A;  3EGD B;  1N1C A;  3QZC A;  1J8Y F;  3X2Q C;  3NDB B;  4U5F E;  5E2Q A;  2XL4 A;  5IY5 C;  4PFO A;  1OCR C;  4WJ0 A;  4G7Z F;  1BR2 A;  1D1B A;  4CS7 A;  1WGW A;  1MND A;  3TD7 A;  3I5P A;  5CI9 A;  2R7Q A;  4DOZ A;  3S29 A;  2H7B A;  3W2W A;  5FCL A;  3Q6N A;  5L3V A;  1OKK A;  3K7D A;  4FWV A;  1TWC A;  3ABL C;  3S28 A;  1J8M F;  3Q7L A;  3OEO A;  4N06 A;  4XWJ A;  1FFT C;  1SF8 A;  2O9X A;  1MMD A;  3ZIB A;  5KYX A;  3WOD F;  5DLJ A;  1TWA A;  2PF4 E;  2XRH A;  1W2W A;  1Z23 A;  3EZI A;  4J30 B;  4OD5 A;  3NRH A;  4J32 B;  3EHN A;  3AQC A;  4RD9 A;  3AQB A;  2ZPA A;  1VMA A;  2D5R B;  1PCX A;  3IEE A;  1M2V A;  1LKX A;  3LJB A;  4YJW A;  1ZHY A;  5DQT A;  3EFO B;  1D0Z A;  1ZHZ A;  3T4R A;  1QZX A;  3LES A;  3ABM C;  5DS6 A;  2VH3 A;  3L34 A;  4DVY P;  1D1A A;  5BUO A;  3EGD A;  2Y69 C;  3LAY A;  3ITF A;  5KYY A;  1NG1 A;  5E33 A;  1O87 A;  3DM5 A;  4AK9 A;  4Q7C A;  4OD4 A;  2B0J A;  5F5F A;  4C3B A;  3RIP A;  3FAJ A;  4HEA J;  3S27 A;  4BJ6 C;  1TKN A;  2FFH A;  3QMK A;  2Y3H A;  2BE5 F;  5T1D B;  4K7B A;  3EGX B;  4XLP F;  3JT1 A;  1MMG A;  1NU7 D;  2Y3B A;  4ZLD A;  4PJL A;  3NYM A;  1ZHW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...