4I44A

Aer2 poly-hamp domains: v33g hamp1 inverted signaling mutant
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
160
structure length
160
Chain Sequence
b'GSHMGLFNAHAVAQQRADRIATLLQSFADGQLDTAGGEAPAPGYERLYDSLRALQRQLREQRAELQQVESLEAGLAEMSRQHEAGWIDQTIPAERLEGRAARIAKGVNELVAAHIAVKMKVVSVVTAYGQGNFEPLMDRLPGKKAQITEAIDGVRERLRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aerotaxis transducer Aer2
publication title HAMP Domain Conformers That Propagate Opposite Signals in Bacterial Chemoreceptors.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Signaling protein
total genus 61
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 2012-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18575 HAMP_N3 HAMP N-terminal domain 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1530 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4i44A00
4I3MA 4I44A 3LNRA
chains in the Genus database with same CATH superfamily
3DM5A 2WVNA 2DGJA 3FAJA 4E18A 1E85A 4XQ1A 2VH3A 5EK0A 5KYXB 1K04A 5JUAA 3C18A 3LS0A 4NTFA 1Z23A 1Q0FA 1IW7F 2CW0F 2ASRA 1YVIA 4AX2A 3T6GB 2NUTA 4QDLA 3EGDB 3L8IA 2GAQA 2HS5A 1AVOB 3HLZA 1UFBA 2WZFA 4HFKB 2R7QA 2OU6A 4OIRF 3UMKA 4FAPB 4ZLCA 1ORSC 1Z6AA 3CEXA 5DS4A 1Y6DA 3DE9A 2GWWA 2LP4A 2WB7A 2R25A 3RVZA 3WG7C 4JTDB 2CCYA 4MW3A 2LCHA 2XLVA 5HSWA 2MHRA 1YZAA 1GQAA 4WGYA 2HSQA 3ZTZA 3W8HA 2IBFA 4J30B 2PF4E 3AOUA 4H54A 3K7DA 2YLDA 1TQGA 1ZZPA 3GEIA 4JIOA 4JJFA 1ZW2A 4MVMA 2R7TA 1D1BA 1LE4A 2E87A 3FOOA 4MW8A 3TJ6A 3GM1A 1XZQA 1D1CA 1TKNA 2P0NA 3C63A 3C8GA 3M4CA 4I44A 4RDAA 3ZQVA 1NLXA 4C3EA 5L0JA 1RKEB 3NMKA 4PJJA 1YJGA 4NTAA 2EPOA 3BRJA 3CQZA 4XLNF 3LS1A 1MMNA 1LI7A 1NU7D 4QI2A 4CSAC 3NYLA 3ZTMA 1C03A 3PMRA 4Z9IA 3NYJA 5BUOA 2C04A 3HNIA 1NU9C 4JW1A 4XWJA 1T01A 3SXYA 1JAFA 1ZHZA 3A9CA 5FZTA 1A7EA 5COMA 3SYNA 4EBKA 3U2LA 4EHPA 3M79A 3JZ0A 4WGZA 2D4UA 4JE9A 3WODF 1LM3B 1Z3IX 1OR3A 2NUPB 3O10A 3B0UX 3K6BA 4MVZA 4YWQA 4C7OA 1V74B 2NG1A 1VB5A 5DVWA 4IAOA 1ZYRF 2YL1A 1OXKA 4IWBA 3E9VA 5GPGB 2XM4A 4MVOA 1OCZC 3FAPB 5DLJA 2LFDA 4U5FE 2A1DD 4JTAB 4YT5A 3UMHA 2J9UA 3I5PA 3ZWIA 2R7UA 2X0CA 2BE5F 2V26A 4BEJA 1M2OA 2KW3C 2PP4A 3S0XA 2KSFA 3TOLA 2Y3BA 3U2MA 1C17M 3SXKA 5A6AA 3M15A 1I4ZA 1NBBA 3L1MA 1YARO 3NKDA 2OQMA 3QZCA 4XPYA 3U3BA 2Y69C 1CPRA 2YL0A 1ZHYA 4ANJA 4C3DA 3KYJA 2V3CC 3RH3A 3F46A 1AUEA 3GANA 3JTLO 1JR8A 5KYYA 2HV6A 2NSGA 3U8PA 3EQLF 2IXOA 3EG9A 1TFKB 4OD4A 1N1CA 4DRJB 2CDQA 5B1AC 4K7BA 2YZSA 5JLIA 3R7CA 1T6IA 3V5XA 5DS6A 1OW7A 2ZXPA 1XZPA 3W2VA 2R9RB 1LVKA 3S29A 3EH1A 2XS1A 4K1OA 3TK0A 2P6VA 2DI3A 2L6GA 4MTFA 3UMIA 4CJGA 1Z5ZA 4OINF 1T6UA 1NZEA 2B0JA 3AGTA 3GODA 3V5YA 4O79A 5CI9A 1VTMP 1O5HA 1A41A 2H7OA 4JEBA 2L7AA 1U6HA 2VCBA 2TMVP 1WTYA 3JRMO 1TWAA 1H9GA 4P9FA 1RCPA 1WN0A 4CDVA 4YK5A 2CNWA 2YVKA 5L0HA 2H7VC 2GFHA 3LLKA 1Q0KA 4CS9A 1JMWA 5JS5A 5KYWB 2MWQA 2LQGA 2WVOA 5T1DB 3EZIA 4B6IA 4NCQA 4MVQA 3VM6A 4Z9JA 4U5GA 1WGWA 1T5OA 2CNWD 4JURI 3IEEA 3JCUQ 3U8VA 3S27A 1ZW3A 2EPNA 5F5HA 3CAXA 3JSEO 1VYKA 3LLIA 5L0GA 3EFOB 3VYWA 3VF0A 3EGDA 3U3FA 2W4BA 2ZD9A 5F28E 1HE9A 5CIVA 3W2WA 2R7WA 1TWHA 2WZLA 3L34A 3Q6NA 2IXNA 2LFFA 1YYXA 2EPKX 2FGYA 3AGUA 4PJNA 3HNKA 4JKVA 5JSLA 3AG4C 4XLPF 2W45A 1JPNA 2L81A 3G50A 3IQTA 1E2XA 2YKZA 3X2QC 2YWAA 1Z7Qc 4IRUA 1HE1A 1SF8A 4NQFA 4X0RA 2EILC 1EQ1A 1SZIA 2Q9AA 5B1BC 4J32B 3DD7A 4JJGA 4ONSA 3GM2A 1D0ZA 4U5CE 1PD1A 3DZAA 2YEVA 3LNRA 5A6BA 2XXAA 5BQIA 1JRAA 1M57C 2UUHA 2XS8A 1MNDA 2XSEA 3WHNA 4MTGA 4CS8A 1M2VA 5AGFA 5BQHA 5KYUB 3DI5A 1FAPB 1NG1A 1V4AA 1ZU5A 4FESA 4W8PA 5FCLA 3G4XA 1BBHA 4XPXA 3U9MA 4N6CA 4FX5A 5KYNA 5JP7A 5A6BD 4FWVA 1ORYA 2J9BA 3ABKC 1KU2A 2MYSA 2HFIA 2OOCA 5A6KA 4PJMA 2LD6A 2ZXWC 4DVZA 2R02A 3SNHA 4A2NB 4MTOA 2EINC 3CZ6A 2PBEA 3S90A 2RD9A 3NMJA 4I1OB 1Q0MA 1J8MF 1ZHWA 4U5EE 1NSGB 4U5DE 4DVYP 3PDMP 3TULA 2KJGA 4LDRA 4OIOF 5L0FA 2YLGA 1BDJB 1OW8A 1LS4A 2WL8A 1MMAA 1Y4CA 3TQOA 3RF3A 1VK5A 2ZXRA 3B0PA 2HJMA 2Q9CA 1HW1A 2QUPA 3HKKA 4GQHA 3DM9B 1YYJA 3GWLA 4LERA 2KK1A 1Q0DA 4KNWA 1R4TA 2ICWG 4IB4A 4XEKA 4YL0A 5CI8A 4CIPA 3EH2A 3KYIA 2X51A 2HKVA 4KNVA 4IARA 5JRAA 3A11A 3HJCA 3NDBB 2QTVA 3B71A 3B9QA 4CBEA 5COGA 5D92A 1DOWA 1QKRA 4O7GA 1SMYF 3QW0A 3KH2A 5B3IA 1LIHA 1KNYA 1S05A 2I15A 3KL4A 1HMDA 1RKCA 1ZVZA 3Q7LA 4RBNA 5A69A 2NUTB 3MX3A 4CS9C 1FTSA 3UR3C 2AWYA 2RSEB 4E0HA 3TOMA 2DB4A 1VMAA 3K1HA 3JYHA 3OWTA 4NY3A 4G7ZF 1MNEA 4Z9HA 4BJ6A 2J8WA 4AK9A 3FXHA 3LUTB 4NTBA 2LK4A 1JOGA 5F5FA 1LPEA 4G0HA 1W2WA 2B0HA 3ZG1A 2VB6A 4P6IC 3T6JA 1OR2A 3TD7A 1R5ID 1H6GA 4LDQA 2H8AA 2IXMA 3M1CB 1ZU4A 2JPUA 2AWCA 2XLMA 1PV3A 3T9OA 3HNLA 2DYRC 5T3TA 2A68F 4EIYA 1T9KA 1AEPA 4Q5SF 1O3UA 2J9VA 4ZLDA 3W4YA 3LEOA 1CPQA 1CGOA 2P61A 1E86A 1ST6A 3C8GB 4N4WA 4IJJA 3ZVRA 3IQ6A 4BJ1A 4E0IA 3EGXB 4F4BA 2FFHA 2VCCA 3PHF2 1IZMA 2XL4A 3IQCA 2EIJC 1S7ZA 1U89A 2R7OA 3IPMO 4K0DA 5E2QA 5DQTA 4CS8C 5L0IA 4D4XA 1D0XA 1OXBA 1C02A 1LKXA 1OKKA 1G5ZA 1H7IA 4IGGA 1FMVA 1A7DA 1YLMA 2P1AA 3C8ZA 4XEFA 3S9OA 3ZQYA 1QSPA 3HTKC 3N24A 1NFOA 2XRHA 4AL0A 5AC4A 1LE2A 1PD0A 1OKKD 2VASA 2YL3A 3AG3C 4YN0B 3RQFA 5L3VA 1FNTc 4PJLA 4QI0A 3LJBA 1RJ9A 1QVXA 4O6NA 3I5QA 4WABA 4YL1A 2C03A 2OEVA 2OJQA 1I5NA 3DAFA 3EFOA 4U5BE 1D1AA 3FOPA 4KC9A 2IOQA 3LEVA 3MLGA 3FDQA 3ASOC 4PFPA 3S84A 2WVQA 2XL6A 3EJNA 3LESA 1UG7A 3SP1A 3O55A 5EHHA 2KC3A 2KQ9A 5EGYA 4E17A 4DRIB 4G7OF 3KPHA 1VLTA 3AJMA 1TWGA 3DXJF 2A69F 4HE8D 3SXZA 5KYXA 2YL7A 3N2ZB 4CDYA 3ECSA 1G4WR 1CGNA 4XEVA 2WZGA 4ER9A 4E7SA 1B68A 1EA8A 3GEEA 1YA7O 1E84A 3TJ5A 1G4US 2IYLD 4PACA 3EZHA 1Q0GA 5KYYB 3ZC4A 3G4ZA 1HMOA 3V7OA 3S28A 1YAUO 2J7PA 3AQBA 1NFNA 3QTHA 1OW6A 1HW2A 1BR1A 3AG2C 3EHNA 4OD5A 3RYLA 1FFTC 4BJ6C 4GEHA 5D91A 2KNHA 4PK4A 1G8XA 4JVSA 3HNJA 2AP3A 2QE9A 2J7PD 1VOMA 3Q7GA 3RW0A 3ZSUA 5A6JA 1V54C 5E3AA 2XM0A 4R32A 3POVA 1APCA 1TFOB 2EPMX 2OCCC 1SR2A 4CS7A 3B0VC 1T6QA 2R03A 4NC3A 4P9TA 4KI2A 2HJ3A 4ULVA 3QMKA 2L9JA 1L7CA 3SEOA 4JRZA 3EHMA 4BJ5A 3ABLC 2IXPA 1VLSA 2IM8A 1FFHA 2NSFA 3B29A 5E33A 4E7ZA 1L3PA 3AQCA 2BL2A 3SZRA 3FVYA 1F1MA 2J9WA 3ITFA 4KBLA 2XLEA 1TWCA 4CX9A 1WASA 1RKEA 4Q7CA 4YT8A 2OJED 3X1OA 3BEHA 2R7VA 4JCHA 1QZXA 2NPUA 1MQVA 4LLCA 4MVRA 3RIPA 1M56C 3GWNA 4L6RA 3R2PA 3DJUB 2A0BA 2PNOA 2JD3A 3EPVA 3W8IA 3IQ5A 4EWCA 4CIHA 3PCVA 2YHSA 3U9JA 4AE4B 1A0BA 1ORJA 2XL8A 2GDCA 3JSZA 3DJNB 1MMDA 1XWJA 2VC9A 2G62A 1OCCC 2NUPA 3F47A 3DMDA 3RKOF 1J8YF 5JT4A 2DYSC 1WWPA 2EIMC 3H65A 2W4MA 3K1IA 2G3KA 2A6HF 2PX3A 3C62A 4BPMA 1KTMA 1K40A 2HMQA 4UDVA 2R7XA 3H2VA 2OKUA 2KGOA 1JPJA 3GEHA 3GM3A 2J0XA 3H2UA 2VCAA 3LAYA 1BR4A 4XPWA 4A4AA 5AC5A 2XXAB 2CGEA 3MFNA 4H4KC 4LACB 2QLAA 3O39A 4C3BA 1M2VB 2ZPAA 1QQ3A 1FMWA 2XLHA 3K33A 2Z15A 3VRCA 4JZAA 3DWWA 2W9YA 3KMIA 1GM5A 2R05A 4IAQA 1GS9A 4RD9A 3ASNC 3RQGA 1V55C 3EGXA 3ATPA 2QNLA 4G78A 2PX0A 3IHUA 3SXMA 3E70C 4DXWA 4EKWA 1U0BB 3DKAA 1H9TA 4PR9A 2OEXA 1HY5A 1OCRC 4XTKA 4EBBA 3ABMC 1WOLA 2PFDA 4U9DA 1OQCA 1YDIA 4PFOA 4MVSA 3AG1C 3C8GD 2J45A 1LS1A 3QW1A 4I3MA 4EBJA 3MYIA 4OIQF 1FR0A 5COFA 4U5HA 1QPUA 2O9XA 4O6YA 4CDAA 1D0YA 2YQYA 4GYTA 1WATA 5L3QA 2FAPB 3I4UA 2Q9BA 5TJ5E 3ZIBA 3OA1A 2LSEA 1CGME 2YLIA 2QY9A 2GA0A 4JCZA 4LDKA 2J46A 5L0DA 2Y3DA 2J0WA 3KKBA 4Q4ZF 4WJ0A 1RXQA 1YA9A 4M63A 1TR2A 1A7VA 4BJ5C 2Y3GA 3N0TA 2A0UA 4G7HF 1EKYA 1DOVA 2JX0A 3QVZA 3U0CA 2AU5A 2P7VA 2XLOA 1EI7A 2CYDA 2YRFA 4I1MA 3NG1A 3QVYA 2HSBA 4D4NA 3NRHA 5T3WA 5KYWA 3RVYA 2R7RA 2L6FA 1MMGA 1SYQA 2A6EF 2HUJA 2L6HA 4DJ9A 4JEAA 4JC7A 2G3VA 4O6MA 2ZXOA 2Y39A 1E83A 2OG2A 1OCOC 3U5SA 1LI5A 3JRTA 4N06A 4C7OB 2Q00A 1ZHTA 5HV9A 5DS5A 2F22A 4YT4A 4W8KA 4DBQA 5K0IA 4N6HA 1K05A 4DRHB 3K66A 1BR2A 1M6TA 3FHDA 3Q6MA 4BEMJ 1PCXA 2EIKC 3RFYA 2HV7A 4OIPF 4BJTA 2XLWA 2Q7RA 4DOZA 4DBRA 2H7BA 4HEAJ 3NMIA 3DE8A 4J7YA 2Q4FA 3NKEA 5L0CA 3K1IC 3UNGC 2LIGA 3GORA 4U9EA 3MYFA 1GGQA 4YL3A 3V5ZA 3J06A 3LNMB 2AVKA 3UGOA 3JT1A 1I4YA 5DQZA 3MBGA 5KYUA 3T6BA 3CSKA 3RQEA 3L8JA 3EG9B 4AL1A 3M4BA 2UUIA 2EPLX 2ETSA 4MS2A 4CJOA 3US6A 4CSAA 4LLEA 5BQGA 1VYIA 4MQ9F 4MVUA 2Q3TA 256BA 3ZDLA 1BZ4A 5E3CA 2XLDA 3NYMA 3UGPA 3T4RA 4YT2A 3WAQA 5JVEA 2I8BA 2M64A 1YZCA 1RJ9B 2R7SA 5B3SC 3VAYA 1Z63A 2M4EA 4HFFB 2Y3HA 3C7JA 4MNDA 1RMVA 4JTCB 1O87A 4EUKB 2KYHA 4YJWA 4J7TA 2D5RB 4ULWA 3DAGA 4AE4A 2HZ8A 5IY5C 1QLEC 3FMSA 2HMZA 3OEOA 3L0IA 4BG0A 1ZHXA 3JYYA 3O6XA 2BC5A
chains in the Genus database with same CATH topology
3DM5A 2WVNA 2DGJA 3FAJA 2VH3A 5KYXB 3LS0A 1Z23A 1IW7F 2CW0F 4AX2A 2NUTA 4QDLA 3EGDB 3HLZA 2WZFA 4HFKB 2R7QA 3UMKA 4OIRF 4ZLCA 1Z6AA 5DS4A 2WB7A 3WG7C 5HSWA 3W8HA 4J30B 2PF4E 3K7DA 4JJFA 2R7TA 1D1BA 2E87A 1D1CA 1TKNA 4RDAA 4I44A 4C3EA 4PJJA 3CQZA 4XLNF 3LS1A 1MMNA 1NU7D 4QI2A 4CSAC 3NYLA 3PMRA 3NYJA 5BUOA 2C04A 1NU9C 4JW1A 4XWJA 1ZHZA 3SYNA 3WODF 1Z3IX 2NUPB 3B0UX 4C7OA 3K6BA 4YWQA 2NG1A 5DVWA 4IAOA 1ZYRF 4IWBA 3E9VA 1OCZC 5DLJA 4U5FE 2A1DD 4YT5A 3UMHA 2J9UA 3I5PA 2R7UA 4BEJA 2BE5F 2V26A 1M2OA 2KW3C 2PP4A 3S0XA 2Y3BA 3QZCA 3NKDA 2Y69C 1ZHYA 4ANJA 4C3DA 2V3CC 3RH3A 3F46A 3GANA 5KYYA 2HV6A 3EQLF 2IXOA 3EG9A 4OD4A 1N1CA 2CDQA 5B1AC 4K7BA 2YZSA 5DS6A 2ZXPA 3W2VA 1LVKA 3EH1A 2P6VA 3UMIA 1Z5ZA 4OINF 1NZEA 2B0JA 3GODA 4O79A 5CI9A 1O5HA 2H7OA 1TWAA 2CNWA 2H7VC 2GFHA 3LLKA 4CS9A 5KYWB 2MWQA 2WVOA 5T1DB 3EZIA 4B6IA 4U5GA 1WGWA 2CNWD 4JURI 3IEEA 3JCUQ 4Q5SF 3S27A 5F5HA 1VYKA 3LLIA 3EFOB 3VYWA 3EGDA 2W4BA 3W2WA 2R7WA 1TWHA 2WZLA 3L34A 3Q6NA 2IXNA 4PJNA 4XLPF 2FGYA 3AG4C 2W45A 1JPNA 2L81A 3X2QC 4IRUA 1SF8A 4X0RA 2EILC 1SZIA 2Q9AA 5B1BC 4J32B 3DD7A 4JJGA 4U5CE 4G7HF 1D0ZA 1PD1A 3DZAA 2YEVA 3LNRA 2XXAA 1M57C 1MNDA 2XSEA 4CS8A 1M2VA 5KYUB 1NG1A 4FESA 1ZU5A 5FCLA 4FX5A 5KYNA 4FWVA 3ABKC 1KU2A 2MYSA 4PJMA 2ZXWC 4DVZA 3SNHA 4A2NB 2EINC 3CZ6A 4I1OB 1ZHWA 1J8MF 4U5EE 4DVYP 4U5DE 4OIOF 2KJGA 2WL8A 1MMAA 1VK5A 2ZXRA 3B0PA 2Q9CA 3DM9B 4LERA 4KNWA 5CI8A 3EH2A 2X51A 4KNVA 3HJCA 3NDBB 2QTVA 3B9QA 4CBEA 5D92A 4O7GA 1SMYF 3KH2A 3Q7LA 3KL4A 4RBNA 2NUTB 3MX3A 4CS9C 1FTSA 3UR3C 3K1HA 1VMAA 4G7ZF 3JYHA 3OWTA 4NY3A 1MNEA 4BJ6A 4AK9A 5F5FA 4G0HA 1W2WA 3ZG1A 2VB6A 4P6IC 3T6JA 3S29A 3TD7A 2IXMA 3M1CB 1ZU4A 2DYRC 5T3TA 2A68F 2J9VA 4ZLDA 1ST6A 3ZVRA 4IJJA 4BJ1A 3EGXB 4F4BA 2FFHA 3PHF2 1IZMA 2XL4A 4K0DA 2EIJC 1S7ZA 5E2QA 2R7OA 5DQTA 4CS8C 1D0XA 1LKXA 1OKKA 1FMVA 3HTKC 3N24A 2XRHA 1PD0A 1OKKD 2VASA 3AG3C 4YN0B 5L3VA 4PJLA 4QI0A 3LJBA 1RJ9A 4O6NA 3I5QA 2C03A 3DAFA 3EFOA 4U5BE 1D1AA 4KC9A 2IOQA 3LEVA 3MLGA 3FDQA 3ASOC 4PFPA 2WVQA 3EJNA 3LESA 3SP1A 5EHHA 2KQ9A 5EGYA 4G7OF 1TWGA 3DXJF 2A69F 4HE8D 5KYXA 3N2ZB 3ECSA 2WZGA 4E7SA 2IYLD 3EZHA 5KYYB 3ZC4A 3V7OA 3S28A 2J7PA 3AQBA 1BR1A 3AG2C 3EHNA 4OD5A 3RYLA 1FFTC 4BJ6C 4GEHA 5D91A 2KNHA 4PK4A 1G8XA 4JVSA 2J7PD 1VOMA 3Q7GA 3ZSUA 1V54C 5E3AA 3POVA 2OCCC 4CS7A 3B0VC 4KI2A 3QMKA 2L9JA 3SEOA 4BJ5A 3EHMA 3ABLC 2IXPA 1FFHA 5E33A 4E7ZA 3AQCA 3SZRA 3FVYA 2J9WA 3ITFA 4KBLA 1TWCA 4Q7CA 4YT8A 3X1OA 2R7VA 4JCHA 1QZXA 4LLCA 3RIPA 1M56C 3DJUB 3EPVA 3W8IA 2JD3A 4EWCA 4CIHA 2YHSA 4AE4B 3JSZA 3DJNB 1MMDA 2G62A 1OCCC 2NUPA 3F47A 3DMDA 3RKOF 1J8YF 2DYSC 2EIMC 3H65A 2W4MA 2G3KA 2A6HF 2PX3A 2R7XA 2KGOA 1JPJA 3LAYA 2J0XA 2XXAB 1BR4A 2CGEA 4H4KC 4LACB 3O39A 4C3BA 1M2VB 2ZPAA 3K33A 1FMWA 2Z15A 4JZAA 2W9YA 3KMIA 4RD9A 3ASNC 1V55C 3EGXA 2PX0A 3E70C 4XTKA 4EBBA 1OCRC 3ABMC 2PFDA 4PFOA 3AG1C 2J45A 1LS1A 4I3MA 4OIQF 4U5HA 2O9XA 4O6YA 1D0YA 4GYTA 5L3QA 3I4UA 2Q9BA 3ZIBA 3OA1A 2LSEA 2QY9A 2J46A 2Y3DA 2J0WA 3KKBA 4Q4ZF 4WJ0A 4M63A 1TR2A 4BJ5C 2Y3GA 3N0TA 2P7VA 4I1MA 3NG1A 2R7RA 3NRHA 5T3WA 5KYWA 1MMGA 2A6EF 2G3VA 4O6MA 2ZXOA 2Y39A 2OG2A 1OCOC 3JRTA 4N06A 4C7OB 1ZHTA 5DS5A 4YT4A 4W8KA 4DBQA 3K66A 1BR2A 3FHDA 3Q6MA 1PCXA 2EIKC 3RFYA 2HV7A 4OIPF 4BJTA 4DOZA 4DBRA 2H7BA 4HEAJ 3NKEA 3K1IC 3UNGC 3UGOA 3JT1A 5DQZA 5KYUA 3T6BA 3CSKA 3EG9B 4CSAA 4LLEA 1VYIA 4MQ9F 2Q3TA 5E3CA 3UGPA 3NYMA 3T4RA 4YT2A 2I8BA 2R7SA 1RJ9B 5B3SC 3VAYA 1Z63A 2M4EA 4HFFB 2Y3HA 4MNDA 1O87A 4YJWA 2D5RB 4ULWA 3DAGA 4AE4A 5IY5C 1QLEC 3OEOA 3L0IA 4BG0A 1ZHXA 3O6XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I3M A;  4I44 A;  3LNR A; 
#chains in the Genus database with same CATH topology
 3DM5 A;  2WVN A;  2DGJ A;  3FAJ A;  4E18 A;  1E85 A;  4XQ1 A;  2VH3 A;  5EK0 A;  5KYX B;  1K04 A;  5JUA A;  3C18 A;  3LS0 A;  4NTF A;  1Z23 A;  1Q0F A;  1IW7 F;  2CW0 F;  2ASR A;  1YVI A;  4AX2 A;  3T6G B;  2NUT A;  4QDL A;  3EGD B;  3L8I A;  2GAQ A;  2HS5 A;  1AVO B;  3HLZ A;  1UFB A;  2WZF A;  4HFK B;  2R7Q A;  2OU6 A;  4OIR F;  3UMK A;  4FAP B;  4ZLC A;  1ORS C;  1Z6A A;  3CEX A;  5DS4 A;  1Y6D A;  3DE9 A;  2GWW A;  2LP4 A;  2WB7 A;  2R25 A;  3RVZ A;  3WG7 C;  4JTD B;  2CCY A;  4MW3 A;  2LCH A;  2XLV A;  5HSW A;  2MHR A;  1YZA A;  1GQA A;  4WGY A;  2HSQ A;  3ZTZ A;  3W8H A;  2IBF A;  4J30 B;  2PF4 E;  3AOU A;  4H54 A;  3K7D A;  2YLD A;  1TQG A;  1ZZP A;  3GEI A;  4JIO A;  4JJF A;  1ZW2 A;  4MVM A;  2R7T A;  1D1B A;  1LE4 A;  2E87 A;  3FOO A;  4MW8 A;  3TJ6 A;  3GM1 A;  1XZQ A;  1D1C A;  1TKN A;  2P0N A;  3C63 A;  3C8G A;  3M4C A;  4I44 A;  4RDA A;  3ZQV A;  1NLX A;  4C3E A;  5L0J A;  1RKE B;  3NMK A;  4PJJ A;  1YJG A;  4NTA A;  2EPO A;  3BRJ A;  3CQZ A;  4XLN F;  3LS1 A;  1MMN A;  1LI7 A;  1NU7 D;  4QI2 A;  4CSA C;  3NYL A;  3ZTM A;  1C03 A;  3PMR A;  4Z9I A;  3NYJ A;  5BUO A;  2C04 A;  3HNI A;  1NU9 C;  4JW1 A;  4XWJ A;  1T01 A;  3SXY A;  1JAF A;  1ZHZ A;  3A9C A;  5FZT A;  1A7E A;  5COM A;  3SYN A;  4EBK A;  3U2L A;  4EHP A;  3M79 A;  3JZ0 A;  4WGZ A;  2D4U A;  4JE9 A;  3WOD F;  1LM3 B;  1Z3I X;  1OR3 A;  2NUP B;  3O10 A;  3B0U X;  3K6B A;  4MVZ A;  4YWQ A;  4C7O A;  1V74 B;  2NG1 A;  1VB5 A;  5DVW A;  4IAO A;  1ZYR F;  2YL1 A;  1OXK A;  4IWB A;  3E9V A;  5GPG B;  2XM4 A;  4MVO A;  1OCZ C;  3FAP B;  5DLJ A;  2LFD A;  4U5F E;  2A1D D;  4JTA B;  4YT5 A;  3UMH A;  2J9U A;  3I5P A;  3ZWI A;  2R7U A;  2X0C A;  2BE5 F;  2V26 A;  4BEJ A;  1M2O A;  2KW3 C;  2PP4 A;  3S0X A;  2KSF A;  3TOL A;  2Y3B A;  3U2M A;  1C17 M;  3SXK A;  5A6A A;  3M15 A;  1I4Z A;  1NBB A;  3L1M A;  1YAR O;  3NKD A;  2OQM A;  3QZC A;  4XPY A;  3U3B A;  2Y69 C;  1CPR A;  2YL0 A;  1ZHY A;  4ANJ A;  4C3D A;  3KYJ A;  2V3C C;  3RH3 A;  3F46 A;  1AUE A;  3GAN A;  3JTL O;  1JR8 A;  5KYY A;  2HV6 A;  2NSG A;  3U8P A;  3EQL F;  2IXO A;  3EG9 A;  1TFK B;  4OD4 A;  1N1C A;  4DRJ B;  2CDQ A;  5B1A C;  4K7B A;  2YZS A;  5JLI A;  3R7C A;  1T6I A;  3V5X A;  5DS6 A;  1OW7 A;  2ZXP A;  1XZP A;  3W2V A;  2R9R B;  1LVK A;  3S29 A;  3EH1 A;  2XS1 A;  4K1O A;  3TK0 A;  2P6V A;  2DI3 A;  2L6G A;  4MTF A;  3UMI A;  4CJG A;  1Z5Z A;  4OIN F;  1T6U A;  1NZE A;  2B0J A;  3AGT A;  3GOD A;  3V5Y A;  4O79 A;  5CI9 A;  1VTM P;  1O5H A;  1A41 A;  2H7O A;  4JEB A;  2L7A A;  1U6H A;  2VCB A;  2TMV P;  1WTY A;  3JRM O;  1TWA A;  1H9G A;  4P9F A;  1RCP A;  1WN0 A;  4CDV A;  4YK5 A;  2CNW A;  2YVK A;  5L0H A;  2H7V C;  2GFH A;  3LLK A;  1Q0K A;  4CS9 A;  1JMW A;  5JS5 A;  5KYW B;  2MWQ A;  2LQG A;  2WVO A;  5T1D B;  3EZI A;  4B6I A;  4NCQ A;  4MVQ A;  3VM6 A;  4Z9J A;  4U5G A;  1WGW A;  1T5O A;  2CNW D;  4JUR I;  3IEE A;  3JCU Q;  3U8V A;  3S27 A;  1ZW3 A;  2EPN A;  5F5H A;  3CAX A;  3JSE O;  1VYK A;  3LLI A;  5L0G A;  3EFO B;  3VYW A;  3VF0 A;  3EGD A;  3U3F A;  2W4B A;  2ZD9 A;  5F28 E;  1HE9 A;  5CIV A;  3W2W A;  2R7W A;  1TWH A;  2WZL A;  3L34 A;  3Q6N A;  2IXN A;  2LFF A;  1YYX A;  2EPK X;  2FGY A;  3AGU A;  4PJN A;  3HNK A;  4JKV A;  5JSL A;  3AG4 C;  4XLP F;  2W45 A;  1JPN A;  2L81 A;  3G50 A;  3IQT A;  1E2X A;  2YKZ A;  3X2Q C;  2YWA A;  1Z7Q c;  4IRU A;  1HE1 A;  1SF8 A;  4NQF A;  4X0R A;  2EIL C;  1EQ1 A;  1SZI A;  2Q9A A;  5B1B C;  4J32 B;  3DD7 A;  4JJG A;  4ONS A;  3GM2 A;  1D0Z A;  4U5C E;  1PD1 A;  3DZA A;  2YEV A;  3LNR A;  5A6B A;  2XXA A;  5BQI A;  1JRA A;  1M57 C;  2UUH A;  2XS8 A;  1MND A;  2XSE A;  3WHN A;  4MTG A;  4CS8 A;  1M2V A;  5AGF A;  5BQH A;  5KYU B;  3DI5 A;  1FAP B;  1NG1 A;  1V4A A;  1ZU5 A;  4FES A;  4W8P A;  5FCL A;  3G4X A;  1BBH A;  4XPX A;  3U9M A;  4N6C A;  4FX5 A;  5KYN A;  5JP7 A;  5A6B D;  4FWV A;  1ORY A;  2J9B A;  3ABK C;  1KU2 A;  2MYS A;  2HFI A;  2OOC A;  5A6K A;  4PJM A;  2LD6 A;  2ZXW C;  4DVZ A;  2R02 A;  3SNH A;  4A2N B;  4MTO A;  2EIN C;  3CZ6 A;  2PBE A;  3S90 A;  2RD9 A;  3NMJ A;  4I1O B;  1Q0M A;  1J8M F;  1ZHW A;  4U5E E;  1NSG B;  4U5D E;  4DVY P;  3PDM P;  3TUL A;  2KJG A;  4LDR A;  4OIO F;  5L0F A;  2YLG A;  1BDJ B;  1OW8 A;  1LS4 A;  2WL8 A;  1MMA A;  1Y4C A;  3TQO A;  3RF3 A;  1VK5 A;  2ZXR A;  3B0P A;  2HJM A;  2Q9C A;  1HW1 A;  2QUP A;  3HKK A;  4GQH A;  3DM9 B;  1YYJ A;  3GWL A;  4LER A;  2KK1 A;  1Q0D A;  4KNW A;  1R4T A;  2ICW G;  4IB4 A;  4XEK A;  4YL0 A;  5CI8 A;  4CIP A;  3EH2 A;  3KYI A;  2X51 A;  2HKV A;  4KNV A;  4IAR A;  5JRA A;  3A11 A;  3HJC A;  3NDB B;  2QTV A;  3B71 A;  3B9Q A;  4CBE A;  5COG A;  5D92 A;  1DOW A;  1QKR A;  4O7G A;  1SMY F;  3QW0 A;  3KH2 A;  5B3I A;  1LIH A;  1KNY A;  1S05 A;  2I15 A;  3KL4 A;  1HMD A;  1RKC A;  1ZVZ A;  3Q7L A;  4RBN A;  5A69 A;  2NUT B;  3MX3 A;  4CS9 C;  1FTS A;  3UR3 C;  2AWY A;  2RSE B;  4E0H A;  3TOM A;  2DB4 A;  1VMA A;  3K1H A;  3JYH A;  3OWT A;  4NY3 A;  4G7Z F;  1MNE A;  4Z9H A;  4BJ6 A;  2J8W A;  4AK9 A;  3FXH A;  3LUT B;  4NTB A;  2LK4 A;  1JOG A;  5F5F A;  1LPE A;  4G0H A;  1W2W A;  2B0H A;  3ZG1 A;  2VB6 A;  4P6I C;  3T6J A;  1OR2 A;  3TD7 A;  1R5I D;  1H6G A;  4LDQ A;  2H8A A;  2IXM A;  3M1C B;  1ZU4 A;  2JPU A;  2AWC A;  2XLM A;  1PV3 A;  3T9O A;  3HNL A;  2DYR C;  5T3T A;  2A68 F;  4EIY A;  1T9K A;  1AEP A;  4Q5S F;  1O3U A;  2J9V A;  4ZLD A;  3W4Y A;  3LEO A;  1CPQ A;  1CGO A;  2P61 A;  1E86 A;  1ST6 A;  3C8G B;  4N4W A;  4IJJ A;  3ZVR A;  3IQ6 A;  4BJ1 A;  4E0I A;  3EGX B;  4F4B A;  2FFH A;  2VCC A;  3PHF 2;  1IZM A;  2XL4 A;  3IQC A;  2EIJ C;  1S7Z A;  1U89 A;  2R7O A;  3IPM O;  4K0D A;  5E2Q A;  5DQT A;  4CS8 C;  5L0I A;  4D4X A;  1D0X A;  1OXB A;  1C02 A;  1LKX A;  1OKK A;  1G5Z A;  1H7I A;  4IGG A;  1FMV A;  1A7D A;  1YLM A;  2P1A A;  3C8Z A;  4XEF A;  3S9O A;  3ZQY A;  1QSP A;  3HTK C;  3N24 A;  1NFO A;  2XRH A;  4AL0 A;  5AC4 A;  1LE2 A;  1PD0 A;  1OKK D;  2VAS A;  2YL3 A;  3AG3 C;  4YN0 B;  3RQF A;  5L3V A;  1FNT c;  4PJL A;  4QI0 A;  3LJB A;  1RJ9 A;  1QVX A;  4O6N A;  3I5Q A;  4WAB A;  4YL1 A;  2C03 A;  2OEV A;  2OJQ A;  1I5N A;  3DAF A;  3EFO A;  4U5B E;  1D1A A;  3FOP A;  4KC9 A;  2IOQ A;  3LEV A;  3MLG A;  3FDQ A;  3ASO C;  4PFP A;  3S84 A;  2WVQ A;  2XL6 A;  3EJN A;  3LES A;  1UG7 A;  3SP1 A;  3O55 A;  5EHH A;  2KC3 A;  2KQ9 A;  5EGY A;  4E17 A;  4DRI B;  4G7O F;  3KPH A;  1VLT A;  3AJM A;  1TWG A;  3DXJ F;  2A69 F;  4HE8 D;  3SXZ A;  5KYX A;  2YL7 A;  3N2Z B;  4CDY A;  3ECS A;  1G4W R;  1CGN A;  4XEV A;  2WZG A;  4ER9 A;  4E7S A;  1B68 A;  1EA8 A;  3GEE A;  1YA7 O;  1E84 A;  3TJ5 A;  1G4U S;  2IYL D;  4PAC A;  3EZH A;  1Q0G A;  5KYY B;  3ZC4 A;  3G4Z A;  1HMO A;  3V7O A;  3S28 A;  1YAU O;  2J7P A;  3AQB A;  1NFN A;  3QTH A;  1OW6 A;  1HW2 A;  1BR1 A;  3AG2 C;  3EHN A;  4OD5 A;  3RYL A;  1FFT C;  4BJ6 C;  4GEH A;  5D91 A;  2KNH A;  4PK4 A;  1G8X A;  4JVS A;  3HNJ A;  2AP3 A;  2QE9 A;  2J7P D;  1VOM A;  3Q7G A;  3RW0 A;  3ZSU A;  5A6J A;  1V54 C;  5E3A A;  2XM0 A;  4R32 A;  3POV A;  1APC A;  1TFO B;  2EPM X;  2OCC C;  1SR2 A;  4CS7 A;  3B0V C;  1T6Q A;  2R03 A;  4NC3 A;  4P9T A;  4KI2 A;  2HJ3 A;  4ULV A;  3QMK A;  2L9J A;  1L7C A;  3SEO A;  4JRZ A;  3EHM A;  4BJ5 A;  3ABL C;  2IXP A;  1VLS A;  2IM8 A;  1FFH A;  2NSF A;  3B29 A;  5E33 A;  4E7Z A;  1L3P A;  3AQC A;  2BL2 A;  3SZR A;  3FVY A;  1F1M A;  2J9W A;  3ITF A;  4KBL A;  2XLE A;  1TWC A;  4CX9 A;  1WAS A;  1RKE A;  4Q7C A;  4YT8 A;  2OJE D;  3X1O A;  3BEH A;  2R7V A;  4JCH A;  1QZX A;  2NPU A;  1MQV A;  4LLC A;  4MVR A;  3RIP A;  1M56 C;  3GWN A;  4L6R A;  3R2P A;  3DJU B;  2A0B A;  2PNO A;  2JD3 A;  3EPV A;  3W8I A;  3IQ5 A;  4EWC A;  4CIH A;  3PCV A;  2YHS A;  3U9J A;  4AE4 B;  1A0B A;  1ORJ A;  2XL8 A;  2GDC A;  3JSZ A;  3DJN B;  1MMD A;  1XWJ A;  2VC9 A;  2G62 A;  1OCC C;  2NUP A;  3F47 A;  3DMD A;  3RKO F;  1J8Y F;  5JT4 A;  2DYS C;  1WWP A;  2EIM C;  3H65 A;  2W4M A;  3K1I A;  2G3K A;  2A6H F;  2PX3 A;  3C62 A;  4BPM A;  1KTM A;  1K40 A;  2HMQ A;  4UDV A;  2R7X A;  3H2V A;  2OKU A;  2KGO A;  1JPJ A;  3GEH A;  3GM3 A;  2J0X A;  3H2U A;  2VCA A;  3LAY A;  1BR4 A;  4XPW A;  4A4A A;  5AC5 A;  2XXA B;  2CGE A;  3MFN A;  4H4K C;  4LAC B;  2QLA A;  3O39 A;  4C3B A;  1M2V B;  2ZPA A;  1QQ3 A;  1FMW A;  2XLH A;  3K33 A;  2Z15 A;  3VRC A;  4JZA A;  3DWW A;  2W9Y A;  3KMI A;  1GM5 A;  2R05 A;  4IAQ A;  1GS9 A;  4RD9 A;  3ASN C;  3RQG A;  1V55 C;  3EGX A;  3ATP A;  2QNL A;  4G78 A;  2PX0 A;  3IHU A;  3SXM A;  3E70 C;  4DXW A;  4EKW A;  1U0B B;  3DKA A;  1H9T A;  4PR9 A;  2OEX A;  1HY5 A;  1OCR C;  4XTK A;  4EBB A;  3ABM C;  1WOL A;  2PFD A;  4U9D A;  1OQC A;  1YDI A;  4PFO A;  4MVS A;  3AG1 C;  3C8G D;  2J45 A;  1LS1 A;  3QW1 A;  4I3M A;  4EBJ A;  3MYI A;  4OIQ F;  1FR0 A;  5COF A;  4U5H A;  1QPU A;  2O9X A;  4O6Y A;  4CDA A;  1D0Y A;  2YQY A;  4GYT A;  1WAT A;  5L3Q A;  2FAP B;  3I4U A;  2Q9B A;  5TJ5 E;  3ZIB A;  3OA1 A;  2LSE A;  1CGM E;  2YLI A;  2QY9 A;  2GA0 A;  4JCZ A;  4LDK A;  2J46 A;  5L0D A;  2Y3D A;  2J0W A;  3KKB A;  4Q4Z F;  4WJ0 A;  1RXQ A;  1YA9 A;  4M63 A;  1TR2 A;  1A7V A;  4BJ5 C;  2Y3G A;  3N0T A;  2A0U A;  4G7H F;  1EKY A;  1DOV A;  2JX0 A;  3QVZ A;  3U0C A;  2AU5 A;  2P7V A;  2XLO A;  1EI7 A;  2CYD A;  2YRF A;  4I1M A;  3NG1 A;  3QVY A;  2HSB A;  4D4N A;  3NRH A;  5T3W A;  5KYW A;  3RVY A;  2R7R A;  2L6F A;  1MMG A;  1SYQ A;  2A6E F;  2HUJ A;  2L6H A;  4DJ9 A;  4JEA A;  4JC7 A;  2G3V A;  4O6M A;  2ZXO A;  2Y39 A;  1E83 A;  2OG2 A;  1OCO C;  3U5S A;  1LI5 A;  3JRT A;  4N06 A;  4C7O B;  2Q00 A;  1ZHT A;  5HV9 A;  5DS5 A;  2F22 A;  4YT4 A;  4W8K A;  4DBQ A;  5K0I A;  4N6H A;  1K05 A;  4DRH B;  3K66 A;  1BR2 A;  1M6T A;  3FHD A;  3Q6M A;  4BEM J;  1PCX A;  2EIK C;  3RFY A;  2HV7 A;  4OIP F;  4BJT A;  2XLW A;  2Q7R A;  4DOZ A;  4DBR A;  2H7B A;  4HEA J;  3NMI A;  3DE8 A;  4J7Y A;  2Q4F A;  3NKE A;  5L0C A;  3K1I C;  3UNG C;  2LIG A;  3GOR A;  4U9E A;  3MYF A;  1GGQ A;  4YL3 A;  3V5Z A;  3J06 A;  3LNM B;  2AVK A;  3UGO A;  3JT1 A;  1I4Y A;  5DQZ A;  3MBG A;  5KYU A;  3T6B A;  3CSK A;  3RQE A;  3L8J A;  3EG9 B;  4AL1 A;  3M4B A;  2UUI A;  2EPL X;  2ETS A;  4MS2 A;  4CJO A;  3US6 A;  4CSA A;  4LLE A;  5BQG A;  1VYI A;  4MQ9 F;  4MVU A;  2Q3T A;  256B A;  3ZDL A;  1BZ4 A;  5E3C A;  2XLD A;  3NYM A;  3UGP A;  3T4R A;  4YT2 A;  3WAQ A;  5JVE A;  2I8B A;  2M64 A;  1YZC A;  1RJ9 B;  2R7S A;  5B3S C;  3VAY A;  1Z63 A;  2M4E A;  4HFF B;  2Y3H A;  3C7J A;  4MND A;  1RMV A;  4JTC B;  1O87 A;  4EUK B;  2KYH A;  4YJW A;  4J7T A;  2D5R B;  4ULW A;  3DAG A;  4AE4 A;  2HZ8 A;  5IY5 C;  1QLE C;  3FMS A;  2HMZ A;  3OEO A;  3L0I A;  4BG0 A;  1ZHX A;  3JYY A;  3O6X A;  2BC5 A; 
#chains in the Genus database with same CATH homology
 3DM5 A;  2WVN A;  2DGJ A;  3FAJ A;  2VH3 A;  5KYX B;  3LS0 A;  1Z23 A;  1IW7 F;  2CW0 F;  4AX2 A;  2NUT A;  4QDL A;  3EGD B;  3HLZ A;  2WZF A;  4HFK B;  2R7Q A;  3UMK A;  4OIR F;  4ZLC A;  1Z6A A;  5DS4 A;  2WB7 A;  3WG7 C;  5HSW A;  3W8H A;  4J30 B;  2PF4 E;  3K7D A;  4JJF A;  2R7T A;  1D1B A;  2E87 A;  1D1C A;  1TKN A;  4RDA A;  4I44 A;  4C3E A;  4PJJ A;  3CQZ A;  4XLN F;  3LS1 A;  1MMN A;  1NU7 D;  4QI2 A;  4CSA C;  3NYL A;  3PMR A;  3NYJ A;  5BUO A;  2C04 A;  1NU9 C;  4JW1 A;  4XWJ A;  1ZHZ A;  3SYN A;  3WOD F;  1Z3I X;  2NUP B;  3B0U X;  4C7O A;  3K6B A;  4YWQ A;  2NG1 A;  5DVW A;  4IAO A;  1ZYR F;  4IWB A;  3E9V A;  1OCZ C;  5DLJ A;  4U5F E;  2A1D D;  4YT5 A;  3UMH A;  2J9U A;  3I5P A;  2R7U A;  4BEJ A;  2BE5 F;  2V26 A;  1M2O A;  2KW3 C;  2PP4 A;  3S0X A;  2Y3B A;  3QZC A;  3NKD A;  2Y69 C;  1ZHY A;  4ANJ A;  4C3D A;  2V3C C;  3RH3 A;  3F46 A;  3GAN A;  5KYY A;  2HV6 A;  3EQL F;  2IXO A;  3EG9 A;  4OD4 A;  1N1C A;  2CDQ A;  5B1A C;  4K7B A;  2YZS A;  5DS6 A;  2ZXP A;  3W2V A;  1LVK A;  3EH1 A;  2P6V A;  3UMI A;  1Z5Z A;  4OIN F;  1NZE A;  2B0J A;  3GOD A;  4O79 A;  5CI9 A;  1O5H A;  2H7O A;  1TWA A;  2CNW A;  2H7V C;  2GFH A;  3LLK A;  4CS9 A;  5KYW B;  2MWQ A;  2WVO A;  5T1D B;  3EZI A;  4B6I A;  4U5G A;  1WGW A;  2CNW D;  4JUR I;  3IEE A;  3JCU Q;  4Q5S F;  3S27 A;  5F5H A;  1VYK A;  3LLI A;  3EFO B;  3VYW A;  3EGD A;  2W4B A;  3W2W A;  2R7W A;  1TWH A;  2WZL A;  3L34 A;  3Q6N A;  2IXN A;  4PJN A;  4XLP F;  2FGY A;  3AG4 C;  2W45 A;  1JPN A;  2L81 A;  3X2Q C;  4IRU A;  1SF8 A;  4X0R A;  2EIL C;  1SZI A;  2Q9A A;  5B1B C;  4J32 B;  3DD7 A;  4JJG A;  4U5C E;  4G7H F;  1D0Z A;  1PD1 A;  3DZA A;  2YEV A;  3LNR A;  2XXA A;  1M57 C;  1MND A;  2XSE A;  4CS8 A;  1M2V A;  5KYU B;  1NG1 A;  4FES A;  1ZU5 A;  5FCL A;  4FX5 A;  5KYN A;  4FWV A;  3ABK C;  1KU2 A;  2MYS A;  4PJM A;  2ZXW C;  4DVZ A;  3SNH A;  4A2N B;  2EIN C;  3CZ6 A;  4I1O B;  1ZHW A;  1J8M F;  4U5E E;  4DVY P;  4U5D E;  4OIO F;  2KJG A;  2WL8 A;  1MMA A;  1VK5 A;  2ZXR A;  3B0P A;  2Q9C A;  3DM9 B;  4LER A;  4KNW A;  5CI8 A;  3EH2 A;  2X51 A;  4KNV A;  3HJC A;  3NDB B;  2QTV A;  3B9Q A;  4CBE A;  5D92 A;  4O7G A;  1SMY F;  3KH2 A;  3Q7L A;  3KL4 A;  4RBN A;  2NUT B;  3MX3 A;  4CS9 C;  1FTS A;  3UR3 C;  3K1H A;  1VMA A;  4G7Z F;  3JYH A;  3OWT A;  4NY3 A;  1MNE A;  4BJ6 A;  4AK9 A;  5F5F A;  4G0H A;  1W2W A;  3ZG1 A;  2VB6 A;  4P6I C;  3T6J A;  3S29 A;  3TD7 A;  2IXM A;  3M1C B;  1ZU4 A;  2DYR C;  5T3T A;  2A68 F;  2J9V A;  4ZLD A;  1ST6 A;  3ZVR A;  4IJJ A;  4BJ1 A;  3EGX B;  4F4B A;  2FFH A;  3PHF 2;  1IZM A;  2XL4 A;  4K0D A;  2EIJ C;  1S7Z A;  5E2Q A;  2R7O A;  5DQT A;  4CS8 C;  1D0X A;  1LKX A;  1OKK A;  1FMV A;  3HTK C;  3N24 A;  2XRH A;  1PD0 A;  1OKK D;  2VAS A;  3AG3 C;  4YN0 B;  5L3V A;  4PJL A;  4QI0 A;  3LJB A;  1RJ9 A;  4O6N A;  3I5Q A;  2C03 A;  3DAF A;  3EFO A;  4U5B E;  1D1A A;  4KC9 A;  2IOQ A;  3LEV A;  3MLG A;  3FDQ A;  3ASO C;  4PFP A;  2WVQ A;  3EJN A;  3LES A;  3SP1 A;  5EHH A;  2KQ9 A;  5EGY A;  4G7O F;  1TWG A;  3DXJ F;  2A69 F;  4HE8 D;  5KYX A;  3N2Z B;  3ECS A;  2WZG A;  4E7S A;  2IYL D;  3EZH A;  5KYY B;  3ZC4 A;  3V7O A;  3S28 A;  2J7P A;  3AQB A;  1BR1 A;  3AG2 C;  3EHN A;  4OD5 A;  3RYL A;  1FFT C;  4BJ6 C;  4GEH A;  5D91 A;  2KNH A;  4PK4 A;  1G8X A;  4JVS A;  2J7P D;  1VOM A;  3Q7G A;  3ZSU A;  1V54 C;  5E3A A;  3POV A;  2OCC C;  4CS7 A;  3B0V C;  4KI2 A;  3QMK A;  2L9J A;  3SEO A;  4BJ5 A;  3EHM A;  3ABL C;  2IXP A;  1FFH A;  5E33 A;  4E7Z A;  3AQC A;  3SZR A;  3FVY A;  2J9W A;  3ITF A;  4KBL A;  1TWC A;  4Q7C A;  4YT8 A;  3X1O A;  2R7V A;  4JCH A;  1QZX A;  4LLC A;  3RIP A;  1M56 C;  3DJU B;  3EPV A;  3W8I A;  2JD3 A;  4EWC A;  4CIH A;  2YHS A;  4AE4 B;  3JSZ A;  3DJN B;  1MMD A;  2G62 A;  1OCC C;  2NUP A;  3F47 A;  3DMD A;  3RKO F;  1J8Y F;  2DYS C;  2EIM C;  3H65 A;  2W4M A;  2G3K A;  2A6H F;  2PX3 A;  2R7X A;  2KGO A;  1JPJ A;  3LAY A;  2J0X A;  2XXA B;  1BR4 A;  2CGE A;  4H4K C;  4LAC B;  3O39 A;  4C3B A;  1M2V B;  2ZPA A;  3K33 A;  1FMW A;  2Z15 A;  4JZA A;  2W9Y A;  3KMI A;  4RD9 A;  3ASN C;  1V55 C;  3EGX A;  2PX0 A;  3E70 C;  4XTK A;  4EBB A;  1OCR C;  3ABM C;  2PFD A;  4PFO A;  3AG1 C;  2J45 A;  1LS1 A;  4I3M A;  4OIQ F;  4U5H A;  2O9X A;  4O6Y A;  1D0Y A;  4GYT A;  5L3Q A;  3I4U A;  2Q9B A;  3ZIB A;  3OA1 A;  2LSE A;  2QY9 A;  2J46 A;  2Y3D A;  2J0W A;  3KKB A;  4Q4Z F;  4WJ0 A;  4M63 A;  1TR2 A;  4BJ5 C;  2Y3G A;  3N0T A;  2P7V A;  4I1M A;  3NG1 A;  2R7R A;  3NRH A;  5T3W A;  5KYW A;  1MMG A;  2A6E F;  2G3V A;  4O6M A;  2ZXO A;  2Y39 A;  2OG2 A;  1OCO C;  3JRT A;  4N06 A;  4C7O B;  1ZHT A;  5DS5 A;  4YT4 A;  4W8K A;  4DBQ A;  3K66 A;  1BR2 A;  3FHD A;  3Q6M A;  1PCX A;  2EIK C;  3RFY A;  2HV7 A;  4OIP F;  4BJT A;  4DOZ A;  4DBR A;  2H7B A;  4HEA J;  3NKE A;  3K1I C;  3UNG C;  3UGO A;  3JT1 A;  5DQZ A;  5KYU A;  3T6B A;  3CSK A;  3EG9 B;  4CSA A;  4LLE A;  1VYI A;  4MQ9 F;  2Q3T A;  5E3C A;  3UGP A;  3NYM A;  3T4R A;  4YT2 A;  2I8B A;  2R7S A;  1RJ9 B;  5B3S C;  3VAY A;  1Z63 A;  2M4E A;  4HFF B;  2Y3H A;  4MND A;  1O87 A;  4YJW A;  2D5R B;  4ULW A;  3DAG A;  4AE4 A;  5IY5 C;  1QLE C;  3OEO A;  3L0I A;  4BG0 A;  1ZHX A;  3O6X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...