4I44A

Aer2 poly-hamp domains: v33g hamp1 inverted signaling mutant
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
160
structure length
160
Chain Sequence
GSHMGLFNAHAVAQQRADRIATLLQSFADGQLDTAGGEAPAPGYERLYDSLRALQRQLREQRAELQQVESLEAGLAEMSRQHEAGWIDQTIPAERLEGRAARIAKGVNELVAAHIAVKMKVVSVVTAYGQGNFEPLMDRLPGKKAQITEAIDGVRERLRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title HAMP Domain Conformers That Propagate Opposite Signals in Bacterial Chemoreceptors.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Signaling protein
molecule keywords Aerotaxis transducer Aer2
total genus 61
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 2012-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18575 HAMP_N3 HAMP N-terminal domain 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1530 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4i44A00
4I3MA 4I44A 3LNRA
chains in the Genus database with same CATH superfamily
3FOOA 3RF3A 1OR2A 1T6IA 3K1IA 3C8GD 1SZIA 2L6HA 3I5QA 2XLMA 3HJCA 5A6JA 3U2LA 5KYYA 3TK0A 1WASA 1GGQA 2KJGA 3BEHA 1KU2A 2M64A 3LLKA 1H7IA 3TJ6A 1NBBA 2VASA 4C7OA 3KYJA 4CS8C 4DBRA 1DOWA 1L3PA 5CI9A 2EIMC 1PV3A 1F1MA 1Y4CA 2LFFA 3GODA 5L0CA 2XS1A 2HJMA 3ABKC 4EKWA 3U2MA 3ZC4A 2ZXPA 3QMKA 4B6IA 4CS8A 1FNTc 4YL0A 3RQFA 2CW0F 2VB6A 3Q7GA 3W8IA 4K0DA 1L7CA 2HSQA 4U5DE 2QUPA 5GPGB 1YYXA 2W4MA 3F47A 3MYFA 5KYWB 1GS9A 4CDVA 1WTYA 2IYLD 3IEEA 1ZHXA 2X51A 3FMSA 2XLEA 3JSZA 1OXBA 2BE5F 1LE2A 1ZU5A 1ZZPA 3LNMB 5B1BC 4C3DA 4N06A 3WODF 1E86A 1RJ9B 2M4EA 2HMQA 1QPUA 3NMKA 1AEPA 3HTKC 2D4UA 4EBJA 2RD9A 1R5ID 3T6BA 2EPLX 2OJED 1TWAA 3FDQA 1RKCA 3KPHA 2J7PD 2ICWG 2G3KA 2HS5A 2L81A 1HE9A 2IXNA 4MTGA 1VB5A 2YKZA 3ABMC 2WL8A 3ITFA 1JPNA 2L9JA 3O55A 2P7VA 3LEOA 5COMA 4YT5A 4Z9JA 4E0IA 3C8GB 4YN0B 2R03A 3KKBA 3JCUQ 4GYTA 3EHMA 2QLAA 2KW3C 2IXPA 3M4CA 5T1DB 2J7PA 2KSFA 3O6XA 4LLCA 4CX9A 3POVA 1OCRC 2CNWD 2HUJA 2QNLA 1LM3B 3G4ZA 3NMJA 4P9FA 2XXAA 3ASNC 4JEBA 3DKAA 4JTCB 2WVNA 4LDRA 3GEIA 2ZXOA 2IBFA 3FVYA 4E17A 1YA9A 4XQ1A 4BJ5C 2WZFA 4MVMA 2NG1A 1ZYRF 2J45A 3A11A 1WATA 3GEHA 2YEVA 2DYSC 2UUHA 1V54C 1JPJA 1SMYF 1TFKB 1V74B 4LDKA 2PF4E 3AGTA 3OA1A 1ZHYA 5E3AA 1HW2A 3J06A 1D0ZA 1N1CA 2UUIA 4CS9A 4DJ9A 2B0HA 3IQ6A 4IAQA 1FMVA 5F5HA 5DQZA 4QI2A 2GAQA 2WVOA 3N0TA 3JRMO 1YYJA 2OKUA 4G0HA 3AQBA 1BDJB 4JVSA 1J8YF 4CJOA 1WN0A 5D92A 4AK9A 2XM0A 1D0YA 3MYIA 2XSEA 1EI7A 1LI5A 5B3SC 2IXOA 3DE8A 2P61A 1WWPA 2OEVA 2PX3A 3N2ZB 4G7OF 2CYDA 1WGWA 2Y3HA 4WABA 3RIPA 3AG2C 2ZPAA 3EZHA 2XLHA 3KYIA 2GFHA 1E2XA 3B71A 1OXKA 2HZ8A 4NTFA 3RVYA 1HY5A 2J9BA 2X0CA 3ZG1A 1E83A 2XLWA 3M4BA 2FFHA 5E33A 3Q6MA 1MNEA 5HSWA 2GDCA 3TD7A 2P6VA 2YRFA 3EH2A 1H6GA 2CCYA 2TMVP 4CSAA 4NTAA 4XTKA 3W4YA 2GA0A 1RJ9A 4N4WA 1M2OA 5JP7A 2QTVA 3IPMO 5K0IA 3MLGA 1LPEA 1BBHA 3LS0A 4U5BE 3S9OA 2G62A 1BR2A 3ZTMA 4CSAC 5JS5A 2OJQA 4IAOA 4C7OB 4Q5SF 3NYMA 4JJFA 3JYYA 4JTAB 4AL1A 4C3EA 3ECSA 4A4AA 1MNDA 3O10A 1Y6DA 5DS6A 1WOLA 1HMDA 5HV9A 3OWTA 1MMGA 1B68A 1RMVA 5KYNA 1CGME 2L6GA 3LESA 4GEHA 4MTOA 1T5OA 2R7TA 4JC7A 5COFA 3NKDA 1C17M 3T6GB 5A6BD 4Q4ZF 1QKRA 3TULA 4J7TA 4O6NA 1HMOA 3GM1A 2J0XA 1Q0KA 3TOLA 4EBBA 5KYYB 2CGEA 3VAYA 1OCOC 2A0UA 3LUTB 3HNKA 1A41A 2LFDA 5KYUB 1TQGA 2EPOA 1FFHA 1NG1A 4NQFA 1BR4A 2RSEB 1TR2A 3DXJF 4HFFB 3LJBA 4J30B 2G3VA 3N24A 3IQTA 1NSGB 4YJWA 4I1OB 1MMDA 2J9VA 5A6BA 1W2WA 3OEOA 4X0RA 4ER9A 1D0XA 1K05A 3WG7C 4DRHB 2R05A 2YZSA 4CS7A 2L7AA 4MS2A 2Q00A 3RW0A 1LE4A 5AGFA 4MVRA 2XL4A 4MW3A 3R2PA 2R7VA 5BUOA 4OIQF 3S28A 3ZQYA 3JYHA 3JZ0A 5A6AA 1RKEA 1CGNA 2P0NA 2Q3TA 4G7ZF 3S29A 2DYRC 3CEXA 3FOPA 1Z7Qc 256BA 2A6HF 2EIJC 3B0VC 4DVZA 4JCZA 3ZIBA 4DVYP 1VOMA 3L34A 3I4UA 2VC9A 4MNDA 1G5ZA 1YDIA 3BRJA 2YQYA 4JRZA 4G7HF 4IRUA 4BJTA 3SZRA 1VMAA 4CS9C 4R32A 3S90A 1EQ1A 4XEVA 2PP4A 3X1OA 1KNYA 1Q0DA 2PNOA 4PR9A 2Q9AA 4D4XA 3G4XA 1H9TA 3EG9B 2GWWA 4JJGA 1M6TA 2KQ9A 3E70C 3W8HA 1QZXA 1U6HA 2I8BA 4E7SA 1PD0A 2WVQA 3KMIA 4OIPF 2NPUA 4YWQA 1LS1A 1OCCC 3UGOA 2Y69C 3RYLA 4Z9HA 2JPUA 4BEJA 5B1AC 4OD4A 1KTMA 4MTFA 2V3CC 3NYJA 4U9DA 1U89A 1OQCA 4C3BA 1AVOB 3DAFA 2I15A 1D1BA 1ORJA 1OW8A 4NC3A 4U5HA 2LQGA 1JR8A 1TKNA 2A1DD 3GORA 4JCHA 3UGPA 2ZXWC 1VTMP 4MVOA 4IJJA 3HLZA 1LI7A 1OW6A 4HFKB 3V5ZA 4BJ6A 4BJ1A 1E85A 3NRHA 3VM6A 3ZQVA 4EBKA 4YL3A 3IHUA 3RQGA 5E3CA 3VF0A 2J46A 2H7BA 1A7DA 1FMWA 1YLMA 2CNWA 3EGDB 3S27A 4YL1A 4YK5A 1ZW3A 2A68F 5FZTA 3V7OA 2AWYA 2LIGA 3E9VA 1QQ3A 3EPVA 3K1IC 3PMRA 3UMKA 3L1MA 4E7ZA 3IQCA 1G4WR 5AC4A 2J0WA 2E87A 3NYLA 2H7OA 4FX5A 1XZPA 1T6QA 4DXWA 3H2VA 3SXYA 1JOGA 2HV6A 2NUTB 4XEFA 5BQHA 3S0XA 4LLEA 1V4AA 4ULWA 4NY3A 4I44A 4GQHA 4PJLA 4CDAA 4OIOF 2NUTA 3IQ5A 5JVEA 1G4US 5COGA 5KYWA 2EPNA 1AUEA 2EPKX 2KNHA 3MBGA 1M57C 3DM5A 3C8ZA 4IWBA 1JMWA 4O6MA 5T3TA 4CIPA 2LK4A 2YLGA 4AE4A 2W4BA 1R4TA 2Q9BA 2Q7RA 1QLEC 4LACB 3Q7LA 3WAQA 4F4BA 3U3FA 4PJMA 3T6JA 2WZGA 2XLDA 1S7ZA 5KYXA 3L8JA 3TOMA 2BC5A 4XLNF 3U8PA 3CQZA 4ANJA 3VYWA 5JUAA 3DD7A 1OR3A 3X2QC 1VK5A 3U9MA 5T3WA 2HFIA 3H2UA 4M63A 3C62A 3FXHA 4MQ9F 4JURI 4W8PA 4AE4B 3NDBB 1CGOA 2LCHA 2NSGA 2ZXRA 4W8KA 3FHDA 3A9CA 1C02A 3AGUA 3MFNA 3TJ5A 4EHPA 2HJ3A 1YA7O 1TWCA 1GQAA 1APCA 1T9KA 2XL6A 1IZMA 4XLPF 3CAXA 3DZAA 4PJJA 1BZ4A 3M1CB 3Q6NA 5BQIA 2Y3GA 4YT4A 5DS4A 2DB4A 4IGGA 2AWCA 1OCZC 1ORSC 1YVIA 1G8XA 1PD1A 3QW0A 4N6CA 3QVZA 2OU6A 4A2NB 3U5SA 2QY9A 3ABLC 4MVUA 2HSBA 2R7SA 4KC9A 1VLSA 2BL2A 2MYSA 2R25A 4PFPA 2PFDA 3B0PA 4PK4A 3S84A 4WGYA 3DM9B 2XS8A 2EIKC 2XLVA 3SP1A 2YL1A 2F22A 3TQOA 4O6YA 2IXMA 4HEAJ 1FR0A 3L0IA 3WHNA 3K33A 3AJMA 4WJ0A 2EILC 2KC3A 3ASOC 1QSPA 3M79A 5F5FA 4BEMJ 1LKXA 1Z5ZA 1Q0FA 4FAPB 4ZLDA 1Z3IX 5JLIA 1E84A 2JD3A 1Q0GA 3NKEA 3ZVRA 2D5RB 4MW8A 5E2QA 3EJNA 4U5EE 2YLDA 4P9TA 3KL4A 2R7UA 5AC5A 3PDMP 4K7BA 3U9JA 3ZTZA 1T01A 2H8AA 1I4ZA 4U5FE 5L3QA 1A7VA 3LS1A 4PACA 3RKOF 1T6UA 2A69F 4JKVA 3G50A 3EGXA 1HW1A 3U8VA 4MVSA 1O3UA 3QW1A 3ATPA 4O79A 5L0DA 5DS5A 3U0CA 3HNJA 3ZWIA 4XPWA 1O5HA 4IB4A 3PCVA 2AP3A 2IM8A 2OEXA 4IARA 4U5GA 3CSKA 3GM2A 2EPMX 3RVZA 3K6BA 1M2VB 4OIRF 5JT4A 2LP4A 4NTBA 2YL7A 2ZD9A 1UFBA 4DRIB 3FAPB 2R7QA 1I5NA 1C03A 4MVQA 5L0FA 1J8MF 2A0BA 3PHF2 2EINC 1M56C 2PBEA 5BQGA 5DLJA 1ORYA 1NZEA 1ZU4A 4JTDB 1YJGA 4KI2A 3CZ6A 2Y3BA 3EFOA 4MVZA 4QDLA 1Q0MA 1O87A 2J8WA 2YWAA 3NG1A 3SXMA 4E18A 1M2VA 1OKKA 1YZCA 4KNVA 3AQCA 4E0HA 4J7YA 1UG7A 1LVKA 4Z9IA 3NMIA 3JSEO 3EG9A 3O39A 4PFOA 4EIYA 2DGJA 2XLOA 2KYHA 3UMIA 2XM4A 3RH3A 2WB7A 5CIVA 3QTHA 2XL8A 3ZSUA 3K7DA 1D1CA 3DWWA 4PJNA 1FTSA 4G78A 2Y3DA 2VCAA 1BR1A 2R02A 2YL0A 1OKKD 3C18A 3M15A 1A0BA 1ST6A 3LEVA 3EZIA 2JX0A 2XRHA 4XPXA 4CDYA 1ZHTA 3B29A 4YT8A 2R9RB 3US6A 4JEAA 3DI5A 4D4NA 3I5PA 5A6KA 1V55C 1EKYA 1CPRA 2YLIA 3C7JA 3GEEA 1NFNA 3HNIA 5DVWA 4CIHA 3GANA 1DOVA 1Z6AA 4XWJA 1IW7F 3R7CA 1Z23A 2FAPB 5JSLA 4CBEA 2FGYA 1XWJA 3GWLA 4CJGA 5FCLA 2AVKA 1OW7A 1VLTA 2ASRA 3EGDA 4LDQA 3F46A 5CI8A 1U0BB 1K40A 3V5YA 3EH1A 2B0JA 3SNHA 4J32B 5B3IA 2R7WA 2HV7A 3AOUA 3RFYA 2IOQA 4DBQA 3GM3A 4I3MA 5KYXB 1MQVA 3K1HA 1SF8A 2ETSA 3L8IA 2R7OA 3AG1C 4DOZA 2MHRA 1ZHWA 2NUPA 1LIHA 3JT1A 3UR3C 1TWGA 2L6FA 5EGYA 3RQEA 1Z63A 5L0IA 2MWQA 2HKVA 4K1OA 2NUPB 1RCPA 3ZDLA 1NLXA 1ZVZA 4DRJB 4JZAA 2R7RA 1JAFA 4QI0A 4RDAA 2H7VC 4Q7CA 3K66A 1YZAA 3W2WA 2P1AA 5D91A 5A69A 3HNLA 2Y39A 4ZLCA 2LSEA 4U5CE 4WGZA 1CPQA 4I1MA 4ULVA 1H9GA 1MMNA 2AU5A 1JRAA 3EFOB 3GWNA 3H65A 1PCXA 2XXAB 3UMHA 5IY5C 4BPMA 1RXQA 4NCQA 4LERA 2R7XA 2A6EF 1NFOA 2J9UA 2KGOA 2OQMA 2W9YA 4L6RA 4XPYA 3SYNA 3HKKA 1NU7D 1ZW2A 2QE9A 3MX3A 1QVXA 2C03A 2DI3A 2YVKA 3SXZA 3VRCA 1ZHZA 3EHNA 3FAJA 2OOCA 4BJ5A 1NU9C 5DQTA 1SR2A 2J9WA 1GM5A 1VYIA 2LD6A 4OD5A 4RBNA 1SYQA 3JTLO 1YARO 5F28E 3T4RA 5L0JA 1RKEB 4UDVA 4BJ6C 4AX2A 1XZQA 3DJUB 4JIOA 4U9EA 4FWVA 4EUKB 3DAGA 1I4YA 5L0GA 4EWCA 4XEKA 2YHSA 2CDQA 1K04A 2YL3A 1FFTC 2VCCA 1LS4A 3EGXB 3DJNB 4KNWA 3T9OA 3UNGC 4AL0A 2Q9CA 2W45A 2Z15A 3LAYA 4JW1A 4P6IC 2VCBA 2O9XA 2PX0A 2OG2A 4RD9A 5L0HA 2V26A 1TWHA 3DMDA 1S05A 3QZCA 3SXKA 4BG0A 4OINF 3B9QA 1VYKA 3V5XA 1HE1A 4H54A 4YT2A 2WZLA 3LLIA 1A7EA 2Q4FA 3C8GA 5EHHA 1D1AA 1EA8A 3EQLF 3C63A 3B0UX 3AG4C 5KYUA 2NSFA 4HE8D 4JE9A 4ONSA 4O7GA 1FAPB 3KH2A 4KBLA 3SEOA 3W2VA 1MMAA 1TFOB 1YAUO 5L3VA 5JRAA 4N6HA 2HMZA 2KK1A 2VH3A 3JRTA 4FESA 3DE9A 3QVYA 4H4KC 3LNRA 5TJ5E 3AG3C 2C04A 3U3BA 5EK0A 2OCCC
chains in the Genus database with same CATH topology
3I5QA 1SZIA 3HJCA 5KYYA 2KJGA 1KU2A 3LLKA 2VASA 4C7OA 4DBRA 5CI9A 2EIMC 3GODA 3ABKC 3ZC4A 2ZXPA 3QMKA 4B6IA 4CS8A 2CW0F 2VB6A 3Q7GA 3W8IA 4K0DA 4U5DE 2W4MA 3F47A 5KYWB 2IYLD 3IEEA 1ZHXA 2X51A 3JSZA 2BE5F 1ZU5A 4C3DA 5B1BC 4N06A 3WODF 1RJ9B 2M4EA 3HTKC 3T6BA 1TWAA 3FDQA 2J7PD 2G3KA 2L81A 2IXNA 3ABMC 2WL8A 3ITFA 1JPNA 2L9JA 2P7VA 4YT5A 4YN0B 3KKBA 3JCUQ 4GYTA 3EHMA 4CS8C 2KW3C 2IXPA 5T1DB 2J7PA 3O6XA 4LLCA 3POVA 1OCRC 2CNWD 2XXAA 3ASNC 2WVNA 2ZXOA 3FVYA 4BJ5C 2WZFA 2NG1A 1ZYRF 2J45A 2YEVA 2DYSC 1V54C 1JPJA 1SMYF 2PF4E 3OA1A 5E3AA 1ZHYA 1D0ZA 1N1CA 4CS9A 1FMVA 5F5HA 5DQZA 4QI2A 2WVOA 3N0TA 4G0HA 3AQBA 4JVSA 1J8YF 5D92A 4AK9A 1D0YA 2XSEA 5B3SC 2IXOA 2PX3A 3N2ZB 4G7OF 1WGWA 2Y3HA 3RIPA 3AG2C 2ZPAA 3EZHA 2GFHA 3ZG1A 2FFHA 5E33A 3Q6MA 1MNEA 5HSWA 3TD7A 2P6VA 3EH2A 4CSAA 4XTKA 1RJ9A 1M2OA 2QTVA 3MLGA 3LS0A 4U5BE 2G62A 1BR2A 4CSAC 4IAOA 4C7OB 4Q5SF 3NYMA 4JJFA 4C3EA 3ECSA 1MNDA 5DS6A 3OWTA 1MMGA 5KYNA 3LESA 4GEHA 2R7TA 3NKDA 1Z63A 4Q4ZF 4O6NA 5KYYB 2J0XA 4EBBA 2CGEA 3VAYA 1OCOC 5KYUB 1FFHA 1NG1A 1BR4A 1TR2A 3DXJF 4HFFB 3LJBA 4J30B 2G3VA 3N24A 4YJWA 4I1OB 1MMDA 2J9VA 1W2WA 3OEOA 4X0RA 1D0XA 3WG7C 2YZSA 4CS7A 2XL4A 2R7VA 5BUOA 4OIQF 3S28A 3JYHA 2Q3TA 4G7ZF 3S29A 2DYRC 2A6HF 2EIJC 3B0VC 4DVZA 3ZIBA 4DVYP 1VOMA 3L34A 3I4UA 4MNDA 4G7HF 4IRUA 4BJTA 3SZRA 1VMAA 4CS9C 2PP4A 3X1OA 2Q9AA 3EG9B 4JJGA 3W8HA 2KQ9A 3E70C 1QZXA 2I8BA 4E7SA 1PD0A 2WVQA 3KMIA 4OIPF 4YWQA 1LS1A 1OCCC 3UGOA 2Y69C 3RYLA 4BEJA 5B1AC 4OD4A 2V3CC 3NYJA 4C3BA 3DAFA 1D1BA 4U5HA 1TKNA 2A1DD 4JCHA 3UGPA 2ZXWC 4IJJA 3HLZA 4HFKB 4BJ6A 4BJ1A 3NRHA 5E3CA 2J46A 2H7BA 2CNWA 1FMWA 3S27A 3EGDB 2A68F 3V7OA 3K1IC 3E9VA 3UMKA 3EPVA 3PMRA 4E7ZA 2J0WA 2E87A 3NYLA 2H7OA 4FX5A 2HV6A 2NUTB 3S0XA 4LLEA 4ULWA 4NY3A 4I44A 4PJLA 4OIOF 2NUTA 5KYWA 4IWBA 2KNHA 4O6MA 1M57C 3DM5A 5T3TA 4AE4A 2W4BA 2Q9BA 1QLEC 4LACB 3Q7LA 4F4BA 4PJMA 3T6JA 2WZGA 1S7ZA 5KYXA 4ANJA 4XLNF 3CQZA 3VYWA 3DD7A 3X2QC 1VK5A 5T3WA 4M63A 4MQ9F 4JURI 4AE4B 3NDBB 2ZXRA 4W8KA 3FHDA 1TWCA 1IZMA 4XLPF 3DZAA 4PJJA 3Q6NA 3M1CB 2Y3GA 4YT4A 5DS4A 1OCZC 1G8XA 1PD1A 4A2NB 2QY9A 3ABLC 2R7SA 4KC9A 2MYSA 4PK4A 4PFPA 2PFDA 3B0PA 3DM9B 2EIKC 3SP1A 4O6YA 2IXMA 4HEAJ 3L0IA 3K33A 4WJ0A 2EILC 3ASOC 5F5FA 1LKXA 1Z5ZA 4ZLDA 1Z3IX 2JD3A 3NKEA 3ZVRA 2D5RB 5E2QA 3EJNA 4U5EE 3KL4A 2R7UA 4K7BA 4U5FE 5L3QA 3LS1A 3RKOF 2A69F 3EGXA 4O79A 5DS5A 1O5HA 4U5GA 3CSKA 3K6BA 1M2VB 4OIRF 2R7QA 1J8MF 3PHF2 2EINC 1M56C 5DLJA 1NZEA 1ZU4A 4KI2A 3CZ6A 2Y3BA 3EFOA 4QDLA 3NG1A 1O87A 1M2VA 1OKKA 4KNVA 3AQCA 1LVKA 3EG9A 3O39A 4PFOA 2DGJA 3UMIA 3RH3A 2WB7A 3ZSUA 3K7DA 1D1CA 4PJNA 1FTSA 2Y3DA 1BR1A 1OKKD 1ST6A 3LEVA 3EZIA 2XRHA 1ZHTA 4YT8A 3I5PA 1V55C 5DVWA 4CIHA 3GANA 1Z6AA 4XWJA 1IW7F 1Z23A 4CBEA 2FGYA 5FCLA 3EGDA 5CI8A 3F46A 3EH1A 2B0JA 3SNHA 4J32B 2R7WA 2HV7A 3RFYA 2IOQA 4DBQA 4I3MA 5KYXB 3K1HA 1SF8A 2R7OA 3AG1C 4DOZA 3UR3C 1ZHWA 2NUPA 3JT1A 1TWGA 5EGYA 2MWQA 2NUPB 4JZAA 2R7RA 4QI0A 4RDAA 2H7VC 4Q7CA 3K66A 3W2WA 5D91A 2Y39A 4ZLCA 2LSEA 4U5CE 4I1MA 1MMNA 3EFOB 3H65A 1PCXA 2XXAB 3UMHA 5IY5C 4LERA 2R7XA 2A6EF 2J9UA 2KGOA 2W9YA 3SYNA 1NU7D 3MX3A 2C03A 1ZHZA 3EHNA 3FAJA 4BJ5A 5DQTA 1NU9C 2J9WA 1VYIA 4OD5A 4RBNA 3T4RA 4BJ6C 4AX2A 3DJUB 4FWVA 3DAGA 4EWCA 2YHSA 2CDQA 1FFTC 3EGXB 4KNWA 3DJNB 3UNGC 2Q9CA 2W45A 2Z15A 3LAYA 4JW1A 4P6IC 2O9XA 2PX0A 2OG2A 4RD9A 2V26A 1TWHA 3DMDA 3QZCA 4BG0A 4OINF 3B9QA 1VYKA 4YT2A 2WZLA 3LLIA 5EHHA 3EQLF 1D1AA 3B0UX 3AG4C 5KYUA 4HE8D 4O7GA 3KH2A 4KBLA 3SEOA 3W2VA 1MMAA 5L3VA 3JRTA 4FESA 2VH3A 4H4KC 3LNRA 3AG3C 2C04A 2OCCC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I3M A;  4I44 A;  3LNR A; 
#chains in the Genus database with same CATH topology
 3FOO A;  3RF3 A;  1OR2 A;  1T6I A;  3K1I A;  3C8G D;  1SZI A;  2L6H A;  3I5Q A;  2XLM A;  3HJC A;  5A6J A;  3U2L A;  5KYY A;  3TK0 A;  1WAS A;  1GGQ A;  2KJG A;  3BEH A;  1KU2 A;  2M64 A;  3LLK A;  1H7I A;  3TJ6 A;  1NBB A;  2VAS A;  4C7O A;  3KYJ A;  4CS8 C;  4DBR A;  1DOW A;  1L3P A;  5CI9 A;  2EIM C;  1PV3 A;  1F1M A;  1Y4C A;  2LFF A;  3GOD A;  5L0C A;  2XS1 A;  2HJM A;  3ABK C;  4EKW A;  3U2M A;  3ZC4 A;  2ZXP A;  3QMK A;  4B6I A;  4CS8 A;  1FNT c;  4YL0 A;  3RQF A;  2CW0 F;  2VB6 A;  3Q7G A;  3W8I A;  4K0D A;  1L7C A;  2HSQ A;  4U5D E;  2QUP A;  5GPG B;  1YYX A;  2W4M A;  3F47 A;  3MYF A;  5KYW B;  1GS9 A;  4CDV A;  1WTY A;  2IYL D;  3IEE A;  1ZHX A;  2X51 A;  3FMS A;  2XLE A;  3JSZ A;  1OXB A;  2BE5 F;  1LE2 A;  1ZU5 A;  1ZZP A;  3LNM B;  5B1B C;  4C3D A;  4N06 A;  3WOD F;  1E86 A;  1RJ9 B;  2M4E A;  2HMQ A;  1QPU A;  3NMK A;  1AEP A;  3HTK C;  2D4U A;  4EBJ A;  2RD9 A;  1R5I D;  3T6B A;  2EPL X;  2OJE D;  1TWA A;  3FDQ A;  1RKC A;  3KPH A;  2J7P D;  2ICW G;  2G3K A;  2HS5 A;  2L81 A;  1HE9 A;  2IXN A;  4MTG A;  1VB5 A;  2YKZ A;  3ABM C;  2WL8 A;  3ITF A;  1JPN A;  2L9J A;  3O55 A;  2P7V A;  3LEO A;  5COM A;  4YT5 A;  4Z9J A;  4E0I A;  3C8G B;  4YN0 B;  2R03 A;  3KKB A;  3JCU Q;  4GYT A;  3EHM A;  2QLA A;  2KW3 C;  2IXP A;  3M4C A;  5T1D B;  2J7P A;  2KSF A;  3O6X A;  4LLC A;  4CX9 A;  3POV A;  1OCR C;  2CNW D;  2HUJ A;  2QNL A;  1LM3 B;  3G4Z A;  3NMJ A;  4P9F A;  2XXA A;  3ASN C;  4JEB A;  3DKA A;  4JTC B;  2WVN A;  4LDR A;  3GEI A;  2ZXO A;  2IBF A;  3FVY A;  4E17 A;  1YA9 A;  4XQ1 A;  4BJ5 C;  2WZF A;  4MVM A;  2NG1 A;  1ZYR F;  2J45 A;  3A11 A;  1WAT A;  3GEH A;  2YEV A;  2DYS C;  2UUH A;  1V54 C;  1JPJ A;  1SMY F;  1TFK B;  1V74 B;  4LDK A;  2PF4 E;  3AGT A;  3OA1 A;  1ZHY A;  5E3A A;  1HW2 A;  3J06 A;  1D0Z A;  1N1C A;  2UUI A;  4CS9 A;  4DJ9 A;  2B0H A;  3IQ6 A;  4IAQ A;  1FMV A;  5F5H A;  5DQZ A;  4QI2 A;  2GAQ A;  2WVO A;  3N0T A;  3JRM O;  1YYJ A;  2OKU A;  4G0H A;  3AQB A;  1BDJ B;  4JVS A;  1J8Y F;  4CJO A;  1WN0 A;  5D92 A;  4AK9 A;  2XM0 A;  1D0Y A;  3MYI A;  2XSE A;  1EI7 A;  1LI5 A;  5B3S C;  2IXO A;  3DE8 A;  2P61 A;  1WWP A;  2OEV A;  2PX3 A;  3N2Z B;  4G7O F;  2CYD A;  1WGW A;  2Y3H A;  4WAB A;  3RIP A;  3AG2 C;  2ZPA A;  3EZH A;  2XLH A;  3KYI A;  2GFH A;  1E2X A;  3B71 A;  1OXK A;  2HZ8 A;  4NTF A;  3RVY A;  1HY5 A;  2J9B A;  2X0C A;  3ZG1 A;  1E83 A;  2XLW A;  3M4B A;  2FFH A;  5E33 A;  3Q6M A;  1MNE A;  5HSW A;  2GDC A;  3TD7 A;  2P6V A;  2YRF A;  3EH2 A;  1H6G A;  2CCY A;  2TMV P;  4CSA A;  4NTA A;  4XTK A;  3W4Y A;  2GA0 A;  1RJ9 A;  4N4W A;  1M2O A;  5JP7 A;  2QTV A;  3IPM O;  5K0I A;  3MLG A;  1LPE A;  1BBH A;  3LS0 A;  4U5B E;  3S9O A;  2G62 A;  1BR2 A;  3ZTM A;  4CSA C;  5JS5 A;  2OJQ A;  4IAO A;  4C7O B;  4Q5S F;  3NYM A;  4JJF A;  3JYY A;  4JTA B;  4AL1 A;  4C3E A;  3ECS A;  4A4A A;  1MND A;  3O10 A;  1Y6D A;  5DS6 A;  1WOL A;  1HMD A;  5HV9 A;  3OWT A;  1MMG A;  1B68 A;  1RMV A;  5KYN A;  1CGM E;  2L6G A;  3LES A;  4GEH A;  4MTO A;  1T5O A;  2R7T A;  4JC7 A;  5COF A;  3NKD A;  1C17 M;  3T6G B;  5A6B D;  4Q4Z F;  1QKR A;  3TUL A;  4J7T A;  4O6N A;  1HMO A;  3GM1 A;  2J0X A;  1Q0K A;  3TOL A;  4EBB A;  5KYY B;  2CGE A;  3VAY A;  1OCO C;  2A0U A;  3LUT B;  3HNK A;  1A41 A;  2LFD A;  5KYU B;  1TQG A;  2EPO A;  1FFH A;  1NG1 A;  4NQF A;  1BR4 A;  2RSE B;  1TR2 A;  3DXJ F;  4HFF B;  3LJB A;  4J30 B;  2G3V A;  3N24 A;  3IQT A;  1NSG B;  4YJW A;  4I1O B;  1MMD A;  2J9V A;  5A6B A;  1W2W A;  3OEO A;  4X0R A;  4ER9 A;  1D0X A;  1K05 A;  3WG7 C;  4DRH B;  2R05 A;  2YZS A;  4CS7 A;  2L7A A;  4MS2 A;  2Q00 A;  3RW0 A;  1LE4 A;  5AGF A;  4MVR A;  2XL4 A;  4MW3 A;  3R2P A;  2R7V A;  5BUO A;  4OIQ F;  3S28 A;  3ZQY A;  3JYH A;  3JZ0 A;  5A6A A;  1RKE A;  1CGN A;  2P0N A;  2Q3T A;  4G7Z F;  3S29 A;  2DYR C;  3CEX A;  3FOP A;  1Z7Q c;  256B A;  2A6H F;  2EIJ C;  3B0V C;  4DVZ A;  4JCZ A;  3ZIB A;  4DVY P;  1VOM A;  3L34 A;  3I4U A;  2VC9 A;  4MND A;  1G5Z A;  1YDI A;  3BRJ A;  2YQY A;  4JRZ A;  4G7H F;  4IRU A;  4BJT A;  3SZR A;  1VMA A;  4CS9 C;  4R32 A;  3S90 A;  1EQ1 A;  4XEV A;  2PP4 A;  3X1O A;  1KNY A;  1Q0D A;  2PNO A;  4PR9 A;  2Q9A A;  4D4X A;  3G4X A;  1H9T A;  3EG9 B;  2GWW A;  4JJG A;  1M6T A;  2KQ9 A;  3E70 C;  3W8H A;  1QZX A;  1U6H A;  2I8B A;  4E7S A;  1PD0 A;  2WVQ A;  3KMI A;  4OIP F;  2NPU A;  4YWQ A;  1LS1 A;  1OCC C;  3UGO A;  2Y69 C;  3RYL A;  4Z9H A;  2JPU A;  4BEJ A;  5B1A C;  4OD4 A;  1KTM A;  4MTF A;  2V3C C;  3NYJ A;  4U9D A;  1U89 A;  1OQC A;  4C3B A;  1AVO B;  3DAF A;  2I15 A;  1D1B A;  1ORJ A;  1OW8 A;  4NC3 A;  4U5H A;  2LQG A;  1JR8 A;  1TKN A;  2A1D D;  3GOR A;  4JCH A;  3UGP A;  2ZXW C;  1VTM P;  4MVO A;  4IJJ A;  3HLZ A;  1LI7 A;  1OW6 A;  4HFK B;  3V5Z A;  4BJ6 A;  4BJ1 A;  1E85 A;  3NRH A;  3VM6 A;  3ZQV A;  4EBK A;  4YL3 A;  3IHU A;  3RQG A;  5E3C A;  3VF0 A;  2J46 A;  2H7B A;  1A7D A;  1FMW A;  1YLM A;  2CNW A;  3EGD B;  3S27 A;  4YL1 A;  4YK5 A;  1ZW3 A;  2A68 F;  5FZT A;  3V7O A;  2AWY A;  2LIG A;  3E9V A;  1QQ3 A;  3EPV A;  3K1I C;  3PMR A;  3UMK A;  3L1M A;  4E7Z A;  3IQC A;  1G4W R;  5AC4 A;  2J0W A;  2E87 A;  3NYL A;  2H7O A;  4FX5 A;  1XZP A;  1T6Q A;  4DXW A;  3H2V A;  3SXY A;  1JOG A;  2HV6 A;  2NUT B;  4XEF A;  5BQH A;  3S0X A;  4LLE A;  1V4A A;  4ULW A;  4NY3 A;  4I44 A;  4GQH A;  4PJL A;  4CDA A;  4OIO F;  2NUT A;  3IQ5 A;  5JVE A;  1G4U S;  5COG A;  5KYW A;  2EPN A;  1AUE A;  2EPK X;  2KNH A;  3MBG A;  1M57 C;  3DM5 A;  3C8Z A;  4IWB A;  1JMW A;  4O6M A;  5T3T A;  4CIP A;  2LK4 A;  2YLG A;  4AE4 A;  2W4B A;  1R4T A;  2Q9B A;  2Q7R A;  1QLE C;  4LAC B;  3Q7L A;  3WAQ A;  4F4B A;  3U3F A;  4PJM A;  3T6J A;  2WZG A;  2XLD A;  1S7Z A;  5KYX A;  3L8J A;  3TOM A;  2BC5 A;  4XLN F;  3U8P A;  3CQZ A;  4ANJ A;  3VYW A;  5JUA A;  3DD7 A;  1OR3 A;  3X2Q C;  1VK5 A;  3U9M A;  5T3W A;  2HFI A;  3H2U A;  4M63 A;  3C62 A;  3FXH A;  4MQ9 F;  4JUR I;  4W8P A;  4AE4 B;  3NDB B;  1CGO A;  2LCH A;  2NSG A;  2ZXR A;  4W8K A;  3FHD A;  3A9C A;  1C02 A;  3AGU A;  3MFN A;  3TJ5 A;  4EHP A;  2HJ3 A;  1YA7 O;  1TWC A;  1GQA A;  1APC A;  1T9K A;  2XL6 A;  1IZM A;  4XLP F;  3CAX A;  3DZA A;  4PJJ A;  1BZ4 A;  3M1C B;  3Q6N A;  5BQI A;  2Y3G A;  4YT4 A;  5DS4 A;  2DB4 A;  4IGG A;  2AWC A;  1OCZ C;  1ORS C;  1YVI A;  1G8X A;  1PD1 A;  3QW0 A;  4N6C A;  3QVZ A;  2OU6 A;  4A2N B;  3U5S A;  2QY9 A;  3ABL C;  4MVU A;  2HSB A;  2R7S A;  4KC9 A;  1VLS A;  2BL2 A;  2MYS A;  2R25 A;  4PFP A;  2PFD A;  3B0P A;  4PK4 A;  3S84 A;  4WGY A;  3DM9 B;  2XS8 A;  2EIK C;  2XLV A;  3SP1 A;  2YL1 A;  2F22 A;  3TQO A;  4O6Y A;  2IXM A;  4HEA J;  1FR0 A;  3L0I A;  3WHN A;  3K33 A;  3AJM A;  4WJ0 A;  2EIL C;  2KC3 A;  3ASO C;  1QSP A;  3M79 A;  5F5F A;  4BEM J;  1LKX A;  1Z5Z A;  1Q0F A;  4FAP B;  4ZLD A;  1Z3I X;  5JLI A;  1E84 A;  2JD3 A;  1Q0G A;  3NKE A;  3ZVR A;  2D5R B;  4MW8 A;  5E2Q A;  3EJN A;  4U5E E;  2YLD A;  4P9T A;  3KL4 A;  2R7U A;  5AC5 A;  3PDM P;  4K7B A;  3U9J A;  3ZTZ A;  1T01 A;  2H8A A;  1I4Z A;  4U5F E;  5L3Q A;  1A7V A;  3LS1 A;  4PAC A;  3RKO F;  1T6U A;  2A69 F;  4JKV A;  3G50 A;  3EGX A;  1HW1 A;  3U8V A;  4MVS A;  1O3U A;  3QW1 A;  3ATP A;  4O79 A;  5L0D A;  5DS5 A;  3U0C A;  3HNJ A;  3ZWI A;  4XPW A;  1O5H A;  4IB4 A;  3PCV A;  2AP3 A;  2IM8 A;  2OEX A;  4IAR A;  4U5G A;  3CSK A;  3GM2 A;  2EPM X;  3RVZ A;  3K6B A;  1M2V B;  4OIR F;  5JT4 A;  2LP4 A;  4NTB A;  2YL7 A;  2ZD9 A;  1UFB A;  4DRI B;  3FAP B;  2R7Q A;  1I5N A;  1C03 A;  4MVQ A;  5L0F A;  1J8M F;  2A0B A;  3PHF 2;  2EIN C;  1M56 C;  2PBE A;  5BQG A;  5DLJ A;  1ORY A;  1NZE A;  1ZU4 A;  4JTD B;  1YJG A;  4KI2 A;  3CZ6 A;  2Y3B A;  3EFO A;  4MVZ A;  4QDL A;  1Q0M A;  1O87 A;  2J8W A;  2YWA A;  3NG1 A;  3SXM A;  4E18 A;  1M2V A;  1OKK A;  1YZC A;  4KNV A;  3AQC A;  4E0H A;  4J7Y A;  1UG7 A;  1LVK A;  4Z9I A;  3NMI A;  3JSE O;  3EG9 A;  3O39 A;  4PFO A;  4EIY A;  2DGJ A;  2XLO A;  2KYH A;  3UMI A;  2XM4 A;  3RH3 A;  2WB7 A;  5CIV A;  3QTH A;  2XL8 A;  3ZSU A;  3K7D A;  1D1C A;  3DWW A;  4PJN A;  1FTS A;  4G78 A;  2Y3D A;  2VCA A;  1BR1 A;  2R02 A;  2YL0 A;  1OKK D;  3C18 A;  3M15 A;  1A0B A;  1ST6 A;  3LEV A;  3EZI A;  2JX0 A;  2XRH A;  4XPX A;  4CDY A;  1ZHT A;  3B29 A;  4YT8 A;  2R9R B;  3US6 A;  4JEA A;  3DI5 A;  4D4N A;  3I5P A;  5A6K A;  1V55 C;  1EKY A;  1CPR A;  2YLI A;  3C7J A;  3GEE A;  1NFN A;  3HNI A;  5DVW A;  4CIH A;  3GAN A;  1DOV A;  1Z6A A;  4XWJ A;  1IW7 F;  3R7C A;  1Z23 A;  2FAP B;  5JSL A;  4CBE A;  2FGY A;  1XWJ A;  3GWL A;  4CJG A;  5FCL A;  2AVK A;  1OW7 A;  1VLT A;  2ASR A;  3EGD A;  4LDQ A;  3F46 A;  5CI8 A;  1U0B B;  1K40 A;  3V5Y A;  3EH1 A;  2B0J A;  3SNH A;  4J32 B;  5B3I A;  2R7W A;  2HV7 A;  3AOU A;  3RFY A;  2IOQ A;  4DBQ A;  3GM3 A;  4I3M A;  5KYX B;  1MQV A;  3K1H A;  1SF8 A;  2ETS A;  3L8I A;  2R7O A;  3AG1 C;  4DOZ A;  2MHR A;  1ZHW A;  2NUP A;  1LIH A;  3JT1 A;  3UR3 C;  1TWG A;  2L6F A;  5EGY A;  3RQE A;  1Z63 A;  5L0I A;  2MWQ A;  2HKV A;  4K1O A;  2NUP B;  1RCP A;  3ZDL A;  1NLX A;  1ZVZ A;  4DRJ B;  4JZA A;  2R7R A;  1JAF A;  4QI0 A;  4RDA A;  2H7V C;  4Q7C A;  3K66 A;  1YZA A;  3W2W A;  2P1A A;  5D91 A;  5A69 A;  3HNL A;  2Y39 A;  4ZLC A;  2LSE A;  4U5C E;  4WGZ A;  1CPQ A;  4I1M A;  4ULV A;  1H9G A;  1MMN A;  2AU5 A;  1JRA A;  3EFO B;  3GWN A;  3H65 A;  1PCX A;  2XXA B;  3UMH A;  5IY5 C;  4BPM A;  1RXQ A;  4NCQ A;  4LER A;  2R7X A;  2A6E F;  1NFO A;  2J9U A;  2KGO A;  2OQM A;  2W9Y A;  4L6R A;  4XPY A;  3SYN A;  3HKK A;  1NU7 D;  1ZW2 A;  2QE9 A;  3MX3 A;  1QVX A;  2C03 A;  2DI3 A;  2YVK A;  3SXZ A;  3VRC A;  1ZHZ A;  3EHN A;  3FAJ A;  2OOC A;  4BJ5 A;  1NU9 C;  5DQT A;  1SR2 A;  2J9W A;  1GM5 A;  1VYI A;  2LD6 A;  4OD5 A;  4RBN A;  1SYQ A;  3JTL O;  1YAR O;  5F28 E;  3T4R A;  5L0J A;  1RKE B;  4UDV A;  4BJ6 C;  4AX2 A;  1XZQ A;  3DJU B;  4JIO A;  4U9E A;  4FWV A;  4EUK B;  3DAG A;  1I4Y A;  5L0G A;  4EWC A;  4XEK A;  2YHS A;  2CDQ A;  1K04 A;  2YL3 A;  1FFT C;  2VCC A;  1LS4 A;  3EGX B;  3DJN B;  4KNW A;  3T9O A;  3UNG C;  4AL0 A;  2Q9C A;  2W45 A;  2Z15 A;  3LAY A;  4JW1 A;  4P6I C;  2VCB A;  2O9X A;  2PX0 A;  2OG2 A;  4RD9 A;  5L0H A;  2V26 A;  1TWH A;  3DMD A;  1S05 A;  3QZC A;  3SXK A;  4BG0 A;  4OIN F;  3B9Q A;  1VYK A;  3V5X A;  1HE1 A;  4H54 A;  4YT2 A;  2WZL A;  3LLI A;  1A7E A;  2Q4F A;  3C8G A;  5EHH A;  1D1A A;  1EA8 A;  3EQL F;  3C63 A;  3B0U X;  3AG4 C;  5KYU A;  2NSF A;  4HE8 D;  4JE9 A;  4ONS A;  4O7G A;  1FAP B;  3KH2 A;  4KBL A;  3SEO A;  3W2V A;  1MMA A;  1TFO B;  1YAU O;  5L3V A;  5JRA A;  4N6H A;  2HMZ A;  2KK1 A;  2VH3 A;  3JRT A;  4FES A;  3DE9 A;  3QVY A;  4H4K C;  3LNR A;  5TJ5 E;  3AG3 C;  2C04 A;  3U3B A;  5EK0 A;  2OCC C; 
#chains in the Genus database with same CATH homology
 3I5Q A;  1SZI A;  3HJC A;  5KYY A;  2KJG A;  1KU2 A;  3LLK A;  2VAS A;  4C7O A;  4DBR A;  5CI9 A;  2EIM C;  3GOD A;  3ABK C;  3ZC4 A;  2ZXP A;  3QMK A;  4B6I A;  4CS8 A;  2CW0 F;  2VB6 A;  3Q7G A;  3W8I A;  4K0D A;  4U5D E;  2W4M A;  3F47 A;  5KYW B;  2IYL D;  3IEE A;  1ZHX A;  2X51 A;  3JSZ A;  2BE5 F;  1ZU5 A;  4C3D A;  5B1B C;  4N06 A;  3WOD F;  1RJ9 B;  2M4E A;  3HTK C;  3T6B A;  1TWA A;  3FDQ A;  2J7P D;  2G3K A;  2L81 A;  2IXN A;  3ABM C;  2WL8 A;  3ITF A;  1JPN A;  2L9J A;  2P7V A;  4YT5 A;  4YN0 B;  3KKB A;  3JCU Q;  4GYT A;  3EHM A;  4CS8 C;  2KW3 C;  2IXP A;  5T1D B;  2J7P A;  3O6X A;  4LLC A;  3POV A;  1OCR C;  2CNW D;  2XXA A;  3ASN C;  2WVN A;  2ZXO A;  3FVY A;  4BJ5 C;  2WZF A;  2NG1 A;  1ZYR F;  2J45 A;  2YEV A;  2DYS C;  1V54 C;  1JPJ A;  1SMY F;  2PF4 E;  3OA1 A;  5E3A A;  1ZHY A;  1D0Z A;  1N1C A;  4CS9 A;  1FMV A;  5F5H A;  5DQZ A;  4QI2 A;  2WVO A;  3N0T A;  4G0H A;  3AQB A;  4JVS A;  1J8Y F;  5D92 A;  4AK9 A;  1D0Y A;  2XSE A;  5B3S C;  2IXO A;  2PX3 A;  3N2Z B;  4G7O F;  1WGW A;  2Y3H A;  3RIP A;  3AG2 C;  2ZPA A;  3EZH A;  2GFH A;  3ZG1 A;  2FFH A;  5E33 A;  3Q6M A;  1MNE A;  5HSW A;  3TD7 A;  2P6V A;  3EH2 A;  4CSA A;  4XTK A;  1RJ9 A;  1M2O A;  2QTV A;  3MLG A;  3LS0 A;  4U5B E;  2G62 A;  1BR2 A;  4CSA C;  4IAO A;  4C7O B;  4Q5S F;  3NYM A;  4JJF A;  4C3E A;  3ECS A;  1MND A;  5DS6 A;  3OWT A;  1MMG A;  5KYN A;  3LES A;  4GEH A;  2R7T A;  3NKD A;  1Z63 A;  4Q4Z F;  4O6N A;  5KYY B;  2J0X A;  4EBB A;  2CGE A;  3VAY A;  1OCO C;  5KYU B;  1FFH A;  1NG1 A;  1BR4 A;  1TR2 A;  3DXJ F;  4HFF B;  3LJB A;  4J30 B;  2G3V A;  3N24 A;  4YJW A;  4I1O B;  1MMD A;  2J9V A;  1W2W A;  3OEO A;  4X0R A;  1D0X A;  3WG7 C;  2YZS A;  4CS7 A;  2XL4 A;  2R7V A;  5BUO A;  4OIQ F;  3S28 A;  3JYH A;  2Q3T A;  4G7Z F;  3S29 A;  2DYR C;  2A6H F;  2EIJ C;  3B0V C;  4DVZ A;  3ZIB A;  4DVY P;  1VOM A;  3L34 A;  3I4U A;  4MND A;  4G7H F;  4IRU A;  4BJT A;  3SZR A;  1VMA A;  4CS9 C;  2PP4 A;  3X1O A;  2Q9A A;  3EG9 B;  4JJG A;  3W8H A;  2KQ9 A;  3E70 C;  1QZX A;  2I8B A;  4E7S A;  1PD0 A;  2WVQ A;  3KMI A;  4OIP F;  4YWQ A;  1LS1 A;  1OCC C;  3UGO A;  2Y69 C;  3RYL A;  4BEJ A;  5B1A C;  4OD4 A;  2V3C C;  3NYJ A;  4C3B A;  3DAF A;  1D1B A;  4U5H A;  1TKN A;  2A1D D;  4JCH A;  3UGP A;  2ZXW C;  4IJJ A;  3HLZ A;  4HFK B;  4BJ6 A;  4BJ1 A;  3NRH A;  5E3C A;  2J46 A;  2H7B A;  2CNW A;  1FMW A;  3S27 A;  3EGD B;  2A68 F;  3V7O A;  3K1I C;  3E9V A;  3UMK A;  3EPV A;  3PMR A;  4E7Z A;  2J0W A;  2E87 A;  3NYL A;  2H7O A;  4FX5 A;  2HV6 A;  2NUT B;  3S0X A;  4LLE A;  4ULW A;  4NY3 A;  4I44 A;  4PJL A;  4OIO F;  2NUT A;  5KYW A;  4IWB A;  2KNH A;  4O6M A;  1M57 C;  3DM5 A;  5T3T A;  4AE4 A;  2W4B A;  2Q9B A;  1QLE C;  4LAC B;  3Q7L A;  4F4B A;  4PJM A;  3T6J A;  2WZG A;  1S7Z A;  5KYX A;  4ANJ A;  4XLN F;  3CQZ A;  3VYW A;  3DD7 A;  3X2Q C;  1VK5 A;  5T3W A;  4M63 A;  4MQ9 F;  4JUR I;  4AE4 B;  3NDB B;  2ZXR A;  4W8K A;  3FHD A;  1TWC A;  1IZM A;  4XLP F;  3DZA A;  4PJJ A;  3Q6N A;  3M1C B;  2Y3G A;  4YT4 A;  5DS4 A;  1OCZ C;  1G8X A;  1PD1 A;  4A2N B;  2QY9 A;  3ABL C;  2R7S A;  4KC9 A;  2MYS A;  4PK4 A;  4PFP A;  2PFD A;  3B0P A;  3DM9 B;  2EIK C;  3SP1 A;  4O6Y A;  2IXM A;  4HEA J;  3L0I A;  3K33 A;  4WJ0 A;  2EIL C;  3ASO C;  5F5F A;  1LKX A;  1Z5Z A;  4ZLD A;  1Z3I X;  2JD3 A;  3NKE A;  3ZVR A;  2D5R B;  5E2Q A;  3EJN A;  4U5E E;  3KL4 A;  2R7U A;  4K7B A;  4U5F E;  5L3Q A;  3LS1 A;  3RKO F;  2A69 F;  3EGX A;  4O79 A;  5DS5 A;  1O5H A;  4U5G A;  3CSK A;  3K6B A;  1M2V B;  4OIR F;  2R7Q A;  1J8M F;  3PHF 2;  2EIN C;  1M56 C;  5DLJ A;  1NZE A;  1ZU4 A;  4KI2 A;  3CZ6 A;  2Y3B A;  3EFO A;  4QDL A;  3NG1 A;  1O87 A;  1M2V A;  1OKK A;  4KNV A;  3AQC A;  1LVK A;  3EG9 A;  3O39 A;  4PFO A;  2DGJ A;  3UMI A;  3RH3 A;  2WB7 A;  3ZSU A;  3K7D A;  1D1C A;  4PJN A;  1FTS A;  2Y3D A;  1BR1 A;  1OKK D;  1ST6 A;  3LEV A;  3EZI A;  2XRH A;  1ZHT A;  4YT8 A;  3I5P A;  1V55 C;  5DVW A;  4CIH A;  3GAN A;  1Z6A A;  4XWJ A;  1IW7 F;  1Z23 A;  4CBE A;  2FGY A;  5FCL A;  3EGD A;  5CI8 A;  3F46 A;  3EH1 A;  2B0J A;  3SNH A;  4J32 B;  2R7W A;  2HV7 A;  3RFY A;  2IOQ A;  4DBQ A;  4I3M A;  5KYX B;  3K1H A;  1SF8 A;  2R7O A;  3AG1 C;  4DOZ A;  3UR3 C;  1ZHW A;  2NUP A;  3JT1 A;  1TWG A;  5EGY A;  2MWQ A;  2NUP B;  4JZA A;  2R7R A;  4QI0 A;  4RDA A;  2H7V C;  4Q7C A;  3K66 A;  3W2W A;  5D91 A;  2Y39 A;  4ZLC A;  2LSE A;  4U5C E;  4I1M A;  1MMN A;  3EFO B;  3H65 A;  1PCX A;  2XXA B;  3UMH A;  5IY5 C;  4LER A;  2R7X A;  2A6E F;  2J9U A;  2KGO A;  2W9Y A;  3SYN A;  1NU7 D;  3MX3 A;  2C03 A;  1ZHZ A;  3EHN A;  3FAJ A;  4BJ5 A;  5DQT A;  1NU9 C;  2J9W A;  1VYI A;  4OD5 A;  4RBN A;  3T4R A;  4BJ6 C;  4AX2 A;  3DJU B;  4FWV A;  3DAG A;  4EWC A;  2YHS A;  2CDQ A;  1FFT C;  3EGX B;  4KNW A;  3DJN B;  3UNG C;  2Q9C A;  2W45 A;  2Z15 A;  3LAY A;  4JW1 A;  4P6I C;  2O9X A;  2PX0 A;  2OG2 A;  4RD9 A;  2V26 A;  1TWH A;  3DMD A;  3QZC A;  4BG0 A;  4OIN F;  3B9Q A;  1VYK A;  4YT2 A;  2WZL A;  3LLI A;  5EHH A;  3EQL F;  1D1A A;  3B0U X;  3AG4 C;  5KYU A;  4HE8 D;  4O7G A;  3KH2 A;  4KBL A;  3SEO A;  3W2V A;  1MMA A;  5L3V A;  3JRT A;  4FES A;  2VH3 A;  4H4K C;  3LNR A;  3AG3 C;  2C04 A;  2OCC C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...