4I44A

Aer2 poly-hamp domains: v33g hamp1 inverted signaling mutant
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
160
structure length
160
Chain Sequence
GSHMGLFNAHAVAQQRADRIATLLQSFADGQLDTAGGEAPAPGYERLYDSLRALQRQLREQRAELQQVESLEAGLAEMSRQHEAGWIDQTIPAERLEGRAARIAKGVNELVAAHIAVKMKVVSVVTAYGQGNFEPLMDRLPGKKAQITEAIDGVRERLRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aerotaxis transducer Aer2
publication title HAMP Domain Conformers That Propagate Opposite Signals in Bacterial Chemoreceptors.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Signaling protein
total genus 61
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 2012-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18575 HAMP_N3 HAMP N-terminal domain 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1530 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4i44A00
4I44A 3LNRA 4I3MA
chains in the Genus database with same CATH superfamily
1B68A 2UUIA 2CW0F 4JURI 4XPXA 1V74B 3GM3A 4WABA 3LEVA 3EG9A 2EPLX 4CDVA 3L8IA 1SYQA 2Q3TA 2Y3GA 2R7TA 4E0IA 3RFYA 2Y3BA 3EZHA 2GDCA 3RH3A 1A7VA 1GGQA 1NZEA 4AL1A 3EQLF 2JD3A 4GYTA 5E33A 1E83A 4EWCA 3C7JA 3BEHA 4QI0A 2AWYA 1Q0FA 2YLDA 1QLEC 3LUTB 4NY3A 3RYLA 2A68F 3TOLA 1FMWA 2XM4A 1C02A 4ER9A 2O9XA 2KYHA 4JJGA 2R7SA 5JRAA 4HEAJ 1A0BA 2YLGA 2RSEB 3C8GB 3EPVA 3V5YA 3B0VC 4MTFA 5K0IA 2BC5A 1WTYA 1S7ZA 4IGGA 5JSLA 2J8WA 4CX9A 3H65A 2EINC 1FTSA 2EPKX 2KGOA 3C63A 3L34A 4EBJA 1MMAA 2DYSC 3FOPA 5KYUA 1SR2A 4HFFB 4K1OA 3FXHA 3LAYA 1IZMA 2W9YA 2YEVA 2OJED 2EIJC 3AG2C 3NMIA 2YKZA 5T1DB 2R7XA 2Q00A 4BPMA 4XEKA 3S0XA 5L0DA 3EHMA 1TWGA 2YL3A 3DKAA 4GEHA 3B0PA 2ZXWC 3LLIA 3UR3C 4CS8A 4LDQA 3ZVRA 2KW3C 4ANJA 4A4AA 4C7OA 5BQGA 2Q7RA 3NYLA 2HS5A 1MNEA 4XPYA 3RQFA 2P61A 5EHHA 3JSEO 2EIKC 2IYLD 1OXBA 2KK1A 3H2UA 4IRUA 3EG9B 3U2MA 3FHDA 4FX5A 1ZW3A 2LFFA 4D4XA 2E87A 3EGXA 2EPMX 2VB6A 1YA9A 1V4AA 2FAPB 2VCCA 3V5ZA 4BJ5A 3UGPA 5DS6A 1NFOA 2MYSA 2Q4FA 4ONSA 3QW1A 1LE4A 1HW2A 2L9JA 3AQBA 3F47A 3TK0A 3KH2A 1WWPA 2IXPA 3SYNA 2A1DD 3M79A 4U5FE 3IQ5A 1FMVA 1WATA 1Z23A 3FVYA 3T6BA 1RXQA 2BL2A 2M4EA 4YT8A 2HSBA 5CIVA 4OINF 4G7HF 4OIQF 2XS1A 1A7DA 1G5ZA 1D1BA 1QZXA 4CS7A 3MYIA 5KYUB 2H7VC 2Y3DA 4C3BA 1L7CA 2CNWD 1OW8A 4FAPB 4MVQA 1JPNA 5L3VA 2R05A 2J9BA 3MBGA 4I44A 4I1OB 4YT5A 5HV9A 1E85A 4L6RA 1OCRC 1T9KA 1LI7A 3G4XA 4CS9C 4OD5A 1OR2A 1YYJA 4G7ZF 1LPEA 4CSAC 3ITFA 4KNWA 3C18A 2CYDA 5A6JA 4C7OB 5TJ5E 2YL1A 2UUHA 3GM1A 4BEJA 3EH2A 1K40A 5KYWA 5FZTA 3LLKA 1AVOB 4Q4ZF 1QQ3A 4YL0A 4BJTA 4JW1A 3O55A 4B6IA 1ST6A 4YT4A 3EGXB 5FCLA 4IJJA 3Q7LA 1I4YA 4PJMA 4DJ9A 3ZDLA 5L0CA 1XWJA 3S29A 2JPUA 2ZXOA 1ZZPA 1M2OA 4G7OF 1RCPA 4KBLA 4P6IC 4NQFA 4PFPA 3RVYA 1U6HA 1ZHTA 2DI3A 1T6IA 4HE8D 3RKOF 1OCOC 2AWCA 4E17A 4EBKA 1HMDA 2G62A 3LEOA 3G4ZA 4JRZA 4CJGA 5AC5A 1J8MF 2M64A 5JS5A 1BR4A 2KJGA 2NSFA 4AL0A 1G4US 4O6NA 4N6CA 2OEVA 4XLNF 2Q9CA 4EHPA 5BQIA 3AGUA 1Q0GA 4DVZA 2LFDA 4J7TA 4PK4A 3JRTA 2HJ3A 3K7DA 3WODF 1V54C 3HNIA 5CI8A 2A0BA 2KQ9A 4OIRF 3UNGC 4BG0A 1EQ1A 3BRJA 4G78A 1Q0DA 1UFBA 1AEPA 2LIGA 4PACA 2C04A 4FWVA 2LP4A 4Z9JA 2I8BA 1A41A 1O5HA 2MWQA 3LNMB 3M4CA 1M56C 2OKUA 4JEBA 3W4YA 2L6GA 2OOCA 1TKNA 3EZIA 2A6HF 2WZFA 5KYWB 3GODA 1NBBA 3VRCA 2VASA 2WVOA 2ZXPA 5DVWA 2J7PA 1ORYA 1T5OA 3W2VA 2XLDA 1G4WR 1U89A 4JJFA 3O10A 3JT1A 1FFHA 2IM8A 3PDMP 5A6BD 2NG1A 3GEEA 2IXOA 4G0HA 4KC9A 4LDKA 1YYXA 1HY5A 1YAUO 2ETSA 2W45A 1F1MA 5B1AC 4D4NA 5A6AA 1MQVA 1U0BB 3AGTA 1DOVA 3SEOA 4KNVA 3ASNC 2Z15A 1I5NA 1T01A 2R25A 3AG1C 3K1IC 4IARA 3MLGA 5BQHA 1ZVZA 4PJNA 4MVZA 4OIOF 2QE9A 2D4UA 2Y3HA 3ZG1A 3ABMC 3NG1A 4XTKA 1CGOA 1Y4CA 2W4MA 1JRAA 1HMOA 4PR9A 3TOMA 1ORJA 3VAYA 3ZC4A 1FAPB 2XSEA 5E3AA 4O79A 2XLMA 5F5FA 1FNTc 1WN0A 1PD0A 1C17M 3B71A 3L0IA 3FDQA 2PX0A 2XLEA 3CQZA 3M15A 1HW1A 4YL1A 2XXAA 2LSEA 5JT4A 2HFIA 4U5GA 1ZHWA 1RJ9A 2YZSA 2XLHA 3DAGA 4AK9A 4JEAA 5COMA 1XZQA 1DOWA 3U0CA 1YA7O 2P0NA 3T9OA 1KTMA 2KC3A 2L6FA 4AE4A 1QPUA 2AP3A 3A11A 4BJ1A 5JVEA 3JSZA 4IAQA 4P9TA 1OW6A 2QUPA 4ULVA 5KYXA 3E70C 4MVMA 2J9WA 3J06A 2L6HA 2IOQA 1D0ZA 2XS8A 3K66A 2XXAB 1Y6DA 2Q9AA 4U9EA 2HMZA 3LS0A 2R7RA 1O3UA 4CDYA 5L0IA 1Z6AA 3FOOA 5COGA 3OA1A 3N0TA 1KNYA 4MVRA 3U5SA 3GORA 2HJMA 1D0XA 3AJMA 1E84A 2IBFA 1ZW2A 3HNLA 1TFOB 5E2QA 4N06A 4CBEA 5GPGB 5L0HA 3TULA 3I4UA 1OCZC 4JCHA 3AQCA 3ZQVA 3SXKA 4MNDA 3MFNA 5COFA 4CIHA 2R7OA 1OW7A 4K7BA 3SP1A 4ZLDA 2IXNA 5T3TA 3U8PA 5D92A 3EFOA 3CZ6A 2I15A 3VF0A 4EUKB 3DJUB 3N2ZB 4GQHA 1Z7Qc 2HSQA 3DAFA 4BJ6C 4Q5SF 1VTMP 3G50A 4PFOA 1TR2A 2DB4A 2D5RB 1M2VA 3VM6A 2WZLA 1M57C 2YHSA 3B9QA 2AVKA 1R5ID 1M6TA 1RJ9B 3E9VA 2B0HA 2J9VA 1VLSA 2WVQA 3FAJA 3OEOA 4MW8A 4R32A 4U9DA 2J0WA 2NSGA 5JP7A 3U9MA 2R9RB 4ULWA 2CGEA 4PJJA 4XEVA 2IXMA 1BR1A 1YDIA 1TWHA 2YVKA 3R2PA 3W8HA 4AE4B 1NG1A 4E7SA 2R7VA 1D1AA 4U5EE 1Q0MA 4XPWA 3RF3A 4JIOA 1ZHXA 2LQGA 1OQCA 3KPHA 2MHRA 2R02A 3ECSA 3JZ0A 5IY5C 2VCAA 5KYXB 1UG7A 3O39A 3ZTMA 3ZWIA 2R7WA 3KKBA 2Y39A 1YZAA 3LNRA 5B1BC 3TQOA 3NYJA 5E3CA 1J8YF 3DD7A 5D91A 3ABKC 5F5HA 1ZYRF 3EGDA 1SMYF 2A6EF 2P7VA 3NKDA 3PCVA 1ZU5A 2A69F 3I5QA 3T4RA 4YK5A 4N6HA 3OWTA 3HJCA 4A2NB 1NLXA 2CNWA 2YL0A 3C8GD 5L3QA 2YWAA 1XZPA 1YVIA 3UMKA 3EH1A 3AOUA 3RW0A 2J9UA 3DXJF 1Q0KA 1QVXA 3EFOB 3SXYA 4O6YA 4J32B 4C3DA 4DVYP 2XL6A 4EKWA 3UGOA 1YJGA 4FESA 5B3SC 3DM9B 1CPQA 3EJNA 4J30B 5A69A 3I5PA 3KYIA 4CS9A 1D0YA 3ATPA 4IAOA 2GA0A 1M2VB 3PMRA 3WAQA 4DRIB 1OR3A 5JUAA 4CSAA 1GQAA 1FR0A 1GS9A 5L0GA 1D1CA 3JYHA 3SNHA 2PFDA 1H7IA 3S9OA 2HZ8A 1YARO 1QKRA 3K6BA 4MVSA 3PHF2 4CIPA 1VK5A 2QNLA 2Y69C 3C62A 3QZCA 2XLOA 3DI5A 1VMAA 4DRHB 1LM3B 3M1CB 1NU7D 3NMKA 1E2XA 2V26A 3NKEA 3NRHA 4N4WA 3K1HA 4WGYA 2DYRC 3WHNA 2R7QA 1CGME 2LD6A 2OEXA 3A9CA 3EGDB 4DRJB 1MNDA 1YLMA 5T3WA 3UMHA 4DBQA 2R7UA 3N24A 2OCCC 3NDBB 3DE9A 4E18A 2ASRA 2FGYA 4PJLA 4H4KC 1WOLA 3NMJA 4F4BA 4Q7CA 1PCXA 2XLWA 2PNOA 2QY9A 3U3FA 1H9GA 5DQZA 2R03A 5DS5A 4OIPF 2CDQA 2ICWG 2EILC 1VYKA 5CI9A 2HMQA 4O6MA 2Q9BA 2PP4A 4JTAB 4U5HA 3L8JA 1PD1A 3IHUA 4KI2A 3RVZA 3QW0A 5KYNA 3EHNA 3JRMO 3ABLC 2YQYA 1LI5A 2P6VA 3L1MA 3TJ6A 3CAXA 3W8IA 3ASOC 4JCZA 4RDAA 4CS8C 3Q6MA 2YL7A 1CGNA 1WASA 2H7OA 4YWQA 1BBHA 1MMDA 2HUJA 1RKEA 4I3MA 4JTDB 1MMGA 1ZHZA 4LLEA 4MVUA 2XL4A 5DQTA 5AC4A 1T6QA 3RQEA 3JYYA 1H6GA 5A6BA 2V3CC 4NCQA 2F22A 3DMDA 3MX3A 4BJ5C 4DBRA 1LKXA 1R4TA 3HNJA 5B3IA 1EKYA 2C03A 1JAFA 4NTAA 4WGZA 3TD7A 4JC7A 1H9TA 1LE2A 3HTKC 4C3EA 3IEEA 4MS2A 5DS4A 4RD9A 3Q7GA 2LCHA 3IQTA 1LS4A 4Z9HA 3K1IA 3IQCA 1OKKD 2ZXRA 3CSKA 5KYYA 1BZ4A 1NFNA 3GEIA 2XL8A 3LESA 4W8KA 4U5CE 1JR8A 1HE9A 1W2WA 3R7CA 4XQ1A 2WVNA 4MQ9F 3ZQYA 5DLJA 1TWAA 2J45A 1TFKB 2JX0A 3V5XA 3QMKA 2KSFA 3T6GB 2GFHA 2L7AA 2WB7A 4JKVA 3U2LA 1AUEA 2CCYA 2EPNA 1CPRA 1IW7F 1Z5ZA 1EA8A 1VOMA 2FFHA 3AG3C 3DE8A 1KU2A 1SF8A 2PF4E 4CJOA 5A6KA 2PBEA 1VB5A 3KYJA 3HKKA 1RKEB 2LK4A 3DJNB 4M63A 3SZRA 3GANA 3UMIA 2EIMC 1Z3IX 3B29A 4YL3A 2X0CA 2DGJA 3DWWA 1YZCA 4K0DA 3HNKA 1BDJB 2B0JA 2G3KA 4JE9A 1OKKA 1RKCA 1Z63A 3GM2A 3VYWA 1K04A 2H8AA 4J7YA 3QVZA 2J46A 4DOZA 1OCCC 1ZU4A 2OJQA 3FMSA 4OD4A 3ZTZA 1TWCA 4JVSA 5BUOA 2A0UA 3S90A 2NUPA 3AG4C 3C8ZA 4IB4A 1GM5A 1JOGA 1I4ZA 3QVYA 2ZD9A 1LIHA 5JLIA 5KYYB 4QI2A 3GWLA 4E0HA 3T6JA 3ZIBA 2GWWA 2L81A 4Z9IA 3DM5A 4IWBA 4LACB 4E7ZA 1WGWA 3ZSUA 2VC9A 5L0JA 2PX3A 2HKVA 4CDAA 3S27A 1VLTA 3U9JA 1JMWA 2EPOA 3MYFA 1A7EA 2NUTA 2W4BA 4YT2A 2TMVP 1N1CA 2YRFA 3K33A 3US6A 2QTVA 3HLZA 2XRHA 4MTOA 4BJ6A 4RBNA 2HV6A 3S84A 2ZPAA 3U3BA 2X51A 3X1OA 4QDLA 4O7GA 2VCBA 4JZAA 1S05A 2OG2A 1FFTC 3FAPB 3GEHA 4MVOA 2VH3A 1MMNA 2BE5F 2WZGA 4MTGA 4HFKB 1L3PA 2NPUA 1SZIA 1VYIA 1HE1A 4W8PA 4XLPF 2OU6A 3SXZA 3IQ6A 4YJWA 1JPJA 3LJBA 4NC3A 3H2VA 2OQMA 1QSPA 2J7PD 2RD9A 3DZAA 1G8XA 2QLAA 3RQGA 3WG7C 1V55C 3LS1A 3JTLO 5HSWA 4LLCA 3GWNA 1TQGA 3JCUQ 3O6XA 3Q6NA 3TJ5A 3SXMA 4DXWA 4AX2A 1OXKA 1T6UA 4EBBA 4P9FA 3V7OA 5EGYA 2XM0A 4NTFA 2AU5A 3NYMA 3IPMO 1ZHYA 2NUPB 3X2QC 2P1AA 3C8GA 2KNHA 1NU9C 5AGFA 3B0UX 1BR2A 1NSGB 1K05A 2WL8A 3M4BA 1APCA 256BA 4H54A 1EI7A 4EIYA 4ZLCA 4WJ0A 4LDRA 5L0FA 3S28A 2J0XA 1ORSC 3CEXA 1PV3A 3RIPA 1C03A 4MW3A 3W2WA 3QTHA 3U8VA 4I1MA 2YLIA 4XEFA 4XWJA 3KMIA 4BEMJ 5F28E 1LVKA 2NUTB 4X0RA 3POVA 1O87A 4NTBA 4U5DE 4U5BE 3F46A 2H7BA 1RMVA 1LS1A 2G3VA 4JTCB 4YN0B 4UDVA 4LERA 3KL4A 2XLVA 1E86A 2HV7A 5EK0A 2GAQA
chains in the Genus database with same CATH topology
2CW0F 4JURI 3LEVA 3EG9A 2R7TA 2Q3TA 2Y3GA 3RFYA 2Y3BA 3EZHA 3RH3A 1NZEA 3EQLF 2JD3A 4GYTA 5E33A 4EWCA 4QI0A 1QLEC 4NY3A 3RYLA 2A68F 1FMWA 2O9XA 4JJGA 2R7SA 4HEAJ 3EPVA 3B0VC 1S7ZA 3H65A 2EINC 1FTSA 2KGOA 3L34A 1MMAA 2DYSC 5KYUA 4HFFB 3LAYA 1IZMA 2W9YA 2YEVA 2EIJC 3AG2C 5T1DB 2R7XA 3S0XA 3EHMA 1TWGA 4GEHA 3B0PA 2ZXWC 3LLIA 3UR3C 4CS8A 3ZVRA 4ANJA 2KW3C 4C7OA 3NYLA 1MNEA 5EHHA 2EIKC 2IYLD 4IRUA 3EG9B 3FHDA 4FX5A 2E87A 3EGXA 2VB6A 4BJ5A 3UGPA 5DS6A 2MYSA 2L9JA 3AQBA 3F47A 3KH2A 2IXPA 3SYNA 2A1DD 4U5FE 1FMVA 1Z23A 3FVYA 3T6BA 2M4EA 4YT8A 4OINF 4G7HF 4OIQF 1QZXA 1D1BA 4CS7A 5KYUB 2H7VC 2Y3DA 2CNWD 1JPNA 5L3VA 4I1OB 4I44A 4YT5A 1OCRC 4CS9C 4OD5A 4G7ZF 4CSAC 3ITFA 4KNWA 4C7OB 4BEJA 3EH2A 5KYWA 3LLKA 4Q4ZF 4BJTA 4JW1A 4B6IA 1ST6A 4YT4A 3EGXB 5FCLA 4IJJA 3Q7LA 4PJMA 3S29A 2ZXOA 1M2OA 4G7OF 4KBLA 4P6IC 4PFPA 1ZHTA 4HE8D 3RKOF 1OCOC 2G62A 1J8MF 1BR4A 2KJGA 4O6NA 4XLNF 2Q9CA 4DVZA 4PK4A 3JRTA 3K7DA 3WODF 1V54C 5CI8A 3UNGC 2KQ9A 4OIRF 4BG0A 2C04A 4FWVA 2I8BA 1O5HA 2MWQA 1M56C 1TKNA 3EZIA 2A6HF 2WZFA 5KYWB 3GODA 2VASA 2WVOA 2ZXPA 5DVWA 2J7PA 3W2VA 4JJFA 3JT1A 1FFHA 2NG1A 2IXOA 4G0HA 4KC9A 2XXAA 2W45A 5B1AC 3SEOA 4KNVA 3ASNC 2Z15A 3AG1C 3K1IC 3MLGA 4PJNA 4OIOF 2Y3HA 3ZG1A 3ABMC 3NG1A 4XTKA 2W4MA 5DS4A 3VAYA 3ZC4A 2XSEA 5E3AA 5F5FA 1PD0A 3L0IA 3FDQA 2PX0A 3CQZA 2LSEA 4U5GA 1ZHWA 1RJ9A 2YZSA 3DAGA 4AK9A 4AE4A 4BJ1A 3JSZA 5KYXA 3E70C 2J9WA 2IOQA 1D0ZA 3K66A 2XXAB 2Q9AA 3LS0A 2R7RA 1Z6AA 3OA1A 3N0TA 1D0XA 4CBEA 5E2QA 4N06A 3I4UA 1OCZC 4JCHA 3AQCA 4MNDA 4CIHA 2R7OA 4K7BA 3SP1A 4ZLDA 2IXNA 5T3TA 5D92A 3EFOA 3CZ6A 3DJUB 3N2ZB 3DAFA 4Q5SF 4PFOA 1TR2A 2D5RB 1M2VA 2WZLA 1M57C 2YHSA 3B9QA 3E9VA 4BJ6C 1RJ9B 4U5EE 3FAJA 2J9VA 2WVQA 3OEOA 4C3BA 2J0WA 4ULWA 2CGEA 4PJJA 2IXMA 1BR1A 1TWHA 4AE4B 3W8HA 1NG1A 4E7SA 2R7VA 1D1AA 1ZHXA 3ECSA 5IY5C 5KYXB 3O39A 2R7WA 3KKBA 2Y39A 5B1BC 3LNRA 3NYJA 5E3CA 1J8YF 3DD7A 5D91A 3ABKC 5F5HA 1ZYRF 3EGDA 1SMYF 2A6EF 2P7VA 3NKDA 1ZU5A 2A69F 3I5QA 3T4RA 3OWTA 3HJCA 4A2NB 2CNWA 5L3QA 3UMKA 3EH1A 2J9UA 3DXJF 4C3DA 3EFOB 3UGOA 4O6YA 4J32B 4DVYP 4FESA 5B3SC 3DM9B 3EJNA 4J30B 3I5PA 4CS9A 1D0YA 4IAOA 1M2VB 3PMRA 4CSAA 1D1CA 3JYHA 3SNHA 2PFDA 3K6BA 3PHF2 1VK5A 3QZCA 2Y69C 1VMAA 3M1CB 1NU7D 2V26A 3NKEA 3NRHA 3K1HA 2DYRC 2R7QA 3EGDB 1MNDA 5T3WA 3UMHA 4DBQA 2R7UA 3N24A 2OCCC 3NDBB 2FGYA 4PJLA 4H4KC 4F4BA 4Q7CA 1PCXA 4OIPF 2QY9A 5DS5A 2CDQA 2EILC 1VYKA 5CI9A 4O6MA 2Q9BA 2PP4A 4U5HA 1PD1A 4KI2A 5KYNA 3EHNA 3ABLC 2P6VA 3W8IA 3ASOC 4CS8C 4RDAA 3Q6MA 2H7OA 4YWQA 1MMDA 4O79A 5DQTA 4I3MA 1MMGA 1ZHZA 4LLEA 2XL4A 2V3CC 3DMDA 4DBRA 3MX3A 4BJ5C 1LKXA 2C03A 3TD7A 3HTKC 4C3EA 3IEEA 4RD9A 3Q7GA 2ZXRA 1OKKD 3CSKA 5KYYA 3LESA 4W8KA 4U5CE 1W2WA 2WVNA 4MQ9F 5DLJA 1TWAA 2J45A 3QMKA 2GFHA 2WB7A 1IW7F 1Z5ZA 2FFHA 1VOMA 3AG3C 1KU2A 1SF8A 2PF4E 3W2WA 3SZRA 3DJNB 4M63A 3GANA 3UMIA 2EIMC 1Z3IX 2DGJA 4K0DA 2B0JA 2G3KA 1OKKA 1Z63A 3VYWA 2J46A 4DOZA 1OCCC 1ZU4A 4OD4A 1TWCA 4JVSA 5BUOA 2NUPA 3AG4C 5KYYB 4QI2A 3T6JA 3ZIBA 2L81A 3DM5A 4IWBA 4LACB 4E7ZA 1WGWA 3ZSUA 2PX3A 3S27A 4YT2A 2NUTA 2W4BA 1N1CA 3K33A 2QTVA 3HLZA 2XRHA 4BJ6A 4RBNA 2HV6A 2ZPAA 2X51A 3X1OA 4QDLA 4O7GA 4JZAA 2OG2A 1FFTC 2VH3A 1MMNA 2BE5F 2WZGA 4HFKB 1SZIA 1VYIA 4XLPF 4YJWA 1JPJA 3LJBA 5DQZA 3DZAA 2J7PD 3WG7C 1G8XA 1V55C 3LS1A 5HSWA 4LLCA 3Q6NA 3JCUQ 3O6XA 4AX2A 4EBBA 3V7OA 5EGYA 3NYMA 1ZHYA 2NUPB 3X2QC 2KNHA 1NU9C 3B0UX 1BR2A 2WL8A 4ZLCA 4WJ0A 3S28A 2J0XA 3RIPA 4I1MA 4XWJA 3KMIA 1LVKA 2NUTB 4X0RA 3POVA 1O87A 4U5BE 4U5DE 3F46A 2H7BA 1LS1A 2G3VA 4YN0B 4LERA 3KL4A 2HV7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I44 A;  3LNR A;  4I3M A; 
#chains in the Genus database with same CATH topology
 1B68 A;  2UUI A;  2CW0 F;  4JUR I;  4XPX A;  1V74 B;  3GM3 A;  4WAB A;  3LEV A;  3EG9 A;  2EPL X;  4CDV A;  3L8I A;  1SYQ A;  2Q3T A;  2Y3G A;  2R7T A;  4E0I A;  3RFY A;  2Y3B A;  3EZH A;  2GDC A;  3RH3 A;  1A7V A;  1GGQ A;  1NZE A;  4AL1 A;  3EQL F;  2JD3 A;  4GYT A;  5E33 A;  1E83 A;  4EWC A;  3C7J A;  3BEH A;  4QI0 A;  2AWY A;  1Q0F A;  2YLD A;  1QLE C;  3LUT B;  4NY3 A;  3RYL A;  2A68 F;  3TOL A;  1FMW A;  2XM4 A;  1C02 A;  4ER9 A;  2O9X A;  2KYH A;  4JJG A;  2R7S A;  5JRA A;  4HEA J;  1A0B A;  2YLG A;  2RSE B;  3C8G B;  3EPV A;  3V5Y A;  3B0V C;  4MTF A;  5K0I A;  2BC5 A;  1WTY A;  1S7Z A;  4IGG A;  5JSL A;  2J8W A;  4CX9 A;  3H65 A;  2EIN C;  1FTS A;  2EPK X;  2KGO A;  3C63 A;  3L34 A;  4EBJ A;  1MMA A;  2DYS C;  3FOP A;  5KYU A;  1SR2 A;  4HFF B;  4K1O A;  3FXH A;  3LAY A;  1IZM A;  2W9Y A;  2YEV A;  2OJE D;  2EIJ C;  3AG2 C;  3NMI A;  2YKZ A;  5T1D B;  2R7X A;  2Q00 A;  4BPM A;  4XEK A;  3S0X A;  5L0D A;  3EHM A;  1TWG A;  2YL3 A;  3DKA A;  4GEH A;  3B0P A;  2ZXW C;  3LLI A;  3UR3 C;  4CS8 A;  4LDQ A;  3ZVR A;  2KW3 C;  4ANJ A;  4A4A A;  4C7O A;  5BQG A;  2Q7R A;  3NYL A;  2HS5 A;  1MNE A;  4XPY A;  3RQF A;  2P61 A;  5EHH A;  3JSE O;  2EIK C;  2IYL D;  1OXB A;  2KK1 A;  3H2U A;  4IRU A;  3EG9 B;  3U2M A;  3FHD A;  4FX5 A;  1ZW3 A;  2LFF A;  4D4X A;  2E87 A;  3EGX A;  2EPM X;  2VB6 A;  1YA9 A;  1V4A A;  2FAP B;  2VCC A;  3V5Z A;  4BJ5 A;  3UGP A;  5DS6 A;  1NFO A;  2MYS A;  2Q4F A;  4ONS A;  3QW1 A;  1LE4 A;  1HW2 A;  2L9J A;  3AQB A;  3F47 A;  3TK0 A;  3KH2 A;  1WWP A;  2IXP A;  3SYN A;  2A1D D;  3M79 A;  4U5F E;  3IQ5 A;  1FMV A;  1WAT A;  1Z23 A;  3FVY A;  3T6B A;  1RXQ A;  2BL2 A;  2M4E A;  4YT8 A;  2HSB A;  5CIV A;  4OIN F;  4G7H F;  4OIQ F;  2XS1 A;  1A7D A;  1G5Z A;  1D1B A;  1QZX A;  4CS7 A;  3MYI A;  5KYU B;  2H7V C;  2Y3D A;  4C3B A;  1L7C A;  2CNW D;  1OW8 A;  4FAP B;  4MVQ A;  1JPN A;  5L3V A;  2R05 A;  2J9B A;  3MBG A;  4I44 A;  4I1O B;  4YT5 A;  5HV9 A;  1E85 A;  4L6R A;  1OCR C;  1T9K A;  1LI7 A;  3G4X A;  4CS9 C;  4OD5 A;  1OR2 A;  1YYJ A;  4G7Z F;  1LPE A;  4CSA C;  3ITF A;  4KNW A;  3C18 A;  2CYD A;  5A6J A;  4C7O B;  5TJ5 E;  2YL1 A;  2UUH A;  3GM1 A;  4BEJ A;  3EH2 A;  1K40 A;  5KYW A;  5FZT A;  3LLK A;  1AVO B;  4Q4Z F;  1QQ3 A;  4YL0 A;  4BJT A;  4JW1 A;  3O55 A;  4B6I A;  1ST6 A;  4YT4 A;  3EGX B;  5FCL A;  4IJJ A;  3Q7L A;  1I4Y A;  4PJM A;  4DJ9 A;  3ZDL A;  5L0C A;  1XWJ A;  3S29 A;  2JPU A;  2ZXO A;  1ZZP A;  1M2O A;  4G7O F;  1RCP A;  4KBL A;  4P6I C;  4NQF A;  4PFP A;  3RVY A;  1U6H A;  1ZHT A;  2DI3 A;  1T6I A;  4HE8 D;  3RKO F;  1OCO C;  2AWC A;  4E17 A;  4EBK A;  1HMD A;  2G62 A;  3LEO A;  3G4Z A;  4JRZ A;  4CJG A;  5AC5 A;  1J8M F;  2M64 A;  5JS5 A;  1BR4 A;  2KJG A;  2NSF A;  4AL0 A;  1G4U S;  4O6N A;  4N6C A;  2OEV A;  4XLN F;  2Q9C A;  4EHP A;  5BQI A;  3AGU A;  1Q0G A;  4DVZ A;  2LFD A;  4J7T A;  4PK4 A;  3JRT A;  2HJ3 A;  3K7D A;  3WOD F;  1V54 C;  3HNI A;  5CI8 A;  2A0B A;  2KQ9 A;  4OIR F;  3UNG C;  4BG0 A;  1EQ1 A;  3BRJ A;  4G78 A;  1Q0D A;  1UFB A;  1AEP A;  2LIG A;  4PAC A;  2C04 A;  4FWV A;  2LP4 A;  4Z9J A;  2I8B A;  1A41 A;  1O5H A;  2MWQ A;  3LNM B;  3M4C A;  1M56 C;  2OKU A;  4JEB A;  3W4Y A;  2L6G A;  2OOC A;  1TKN A;  3EZI A;  2A6H F;  2WZF A;  5KYW B;  3GOD A;  1NBB A;  3VRC A;  2VAS A;  2WVO A;  2ZXP A;  5DVW A;  2J7P A;  1ORY A;  1T5O A;  3W2V A;  2XLD A;  1G4W R;  1U89 A;  4JJF A;  3O10 A;  3JT1 A;  1FFH A;  2IM8 A;  3PDM P;  5A6B D;  2NG1 A;  3GEE A;  2IXO A;  4G0H A;  4KC9 A;  4LDK A;  1YYX A;  1HY5 A;  1YAU O;  2ETS A;  2W45 A;  1F1M A;  5B1A C;  4D4N A;  5A6A A;  1MQV A;  1U0B B;  3AGT A;  1DOV A;  3SEO A;  4KNV A;  3ASN C;  2Z15 A;  1I5N A;  1T01 A;  2R25 A;  3AG1 C;  3K1I C;  4IAR A;  3MLG A;  5BQH A;  1ZVZ A;  4PJN A;  4MVZ A;  4OIO F;  2QE9 A;  2D4U A;  2Y3H A;  3ZG1 A;  3ABM C;  3NG1 A;  4XTK A;  1CGO A;  1Y4C A;  2W4M A;  1JRA A;  1HMO A;  4PR9 A;  3TOM A;  1ORJ A;  3VAY A;  3ZC4 A;  1FAP B;  2XSE A;  5E3A A;  4O79 A;  2XLM A;  5F5F A;  1FNT c;  1WN0 A;  1PD0 A;  1C17 M;  3B71 A;  3L0I A;  3FDQ A;  2PX0 A;  2XLE A;  3CQZ A;  3M15 A;  1HW1 A;  4YL1 A;  2XXA A;  2LSE A;  5JT4 A;  2HFI A;  4U5G A;  1ZHW A;  1RJ9 A;  2YZS A;  2XLH A;  3DAG A;  4AK9 A;  4JEA A;  5COM A;  1XZQ A;  1DOW A;  3U0C A;  1YA7 O;  2P0N A;  3T9O A;  1KTM A;  2KC3 A;  2L6F A;  4AE4 A;  1QPU A;  2AP3 A;  3A11 A;  4BJ1 A;  5JVE A;  3JSZ A;  4IAQ A;  4P9T A;  1OW6 A;  2QUP A;  4ULV A;  5KYX A;  3E70 C;  4MVM A;  2J9W A;  3J06 A;  2L6H A;  2IOQ A;  1D0Z A;  2XS8 A;  3K66 A;  2XXA B;  1Y6D A;  2Q9A A;  4U9E A;  2HMZ A;  3LS0 A;  2R7R A;  1O3U A;  4CDY A;  5L0I A;  1Z6A A;  3FOO A;  5COG A;  3OA1 A;  3N0T A;  1KNY A;  4MVR A;  3U5S A;  3GOR A;  2HJM A;  1D0X A;  3AJM A;  1E84 A;  2IBF A;  1ZW2 A;  3HNL A;  1TFO B;  5E2Q A;  4N06 A;  4CBE A;  5GPG B;  5L0H A;  3TUL A;  3I4U A;  1OCZ C;  4JCH A;  3AQC A;  3ZQV A;  3SXK A;  4MND A;  3MFN A;  5COF A;  4CIH A;  2R7O A;  1OW7 A;  4K7B A;  3SP1 A;  4ZLD A;  2IXN A;  5T3T A;  3U8P A;  5D92 A;  3EFO A;  3CZ6 A;  2I15 A;  3VF0 A;  4EUK B;  3DJU B;  3N2Z B;  4GQH A;  1Z7Q c;  2HSQ A;  3DAF A;  4BJ6 C;  4Q5S F;  1VTM P;  3G50 A;  4PFO A;  1TR2 A;  2DB4 A;  2D5R B;  1M2V A;  3VM6 A;  2WZL A;  1M57 C;  2YHS A;  3B9Q A;  2AVK A;  1R5I D;  1M6T A;  1RJ9 B;  3E9V A;  2B0H A;  2J9V A;  1VLS A;  2WVQ A;  3FAJ A;  3OEO A;  4MW8 A;  4R32 A;  4U9D A;  2J0W A;  2NSG A;  5JP7 A;  3U9M A;  2R9R B;  4ULW A;  2CGE A;  4PJJ A;  4XEV A;  2IXM A;  1BR1 A;  1YDI A;  1TWH A;  2YVK A;  3R2P A;  3W8H A;  4AE4 B;  1NG1 A;  4E7S A;  2R7V A;  1D1A A;  4U5E E;  1Q0M A;  4XPW A;  3RF3 A;  4JIO A;  1ZHX A;  2LQG A;  1OQC A;  3KPH A;  2MHR A;  2R02 A;  3ECS A;  3JZ0 A;  5IY5 C;  2VCA A;  5KYX B;  1UG7 A;  3O39 A;  3ZTM A;  3ZWI A;  2R7W A;  3KKB A;  2Y39 A;  1YZA A;  3LNR A;  5B1B C;  3TQO A;  3NYJ A;  5E3C A;  1J8Y F;  3DD7 A;  5D91 A;  3ABK C;  5F5H A;  1ZYR F;  3EGD A;  1SMY F;  2A6E F;  2P7V A;  3NKD A;  3PCV A;  1ZU5 A;  2A69 F;  3I5Q A;  3T4R A;  4YK5 A;  4N6H A;  3OWT A;  3HJC A;  4A2N B;  1NLX A;  2CNW A;  2YL0 A;  3C8G D;  5L3Q A;  2YWA A;  1XZP A;  1YVI A;  3UMK A;  3EH1 A;  3AOU A;  3RW0 A;  2J9U A;  3DXJ F;  1Q0K A;  1QVX A;  3EFO B;  3SXY A;  4O6Y A;  4J32 B;  4C3D A;  4DVY P;  2XL6 A;  4EKW A;  3UGO A;  1YJG A;  4FES A;  5B3S C;  3DM9 B;  1CPQ A;  3EJN A;  4J30 B;  5A69 A;  3I5P A;  3KYI A;  4CS9 A;  1D0Y A;  3ATP A;  4IAO A;  2GA0 A;  1M2V B;  3PMR A;  3WAQ A;  4DRI B;  1OR3 A;  5JUA A;  4CSA A;  1GQA A;  1FR0 A;  1GS9 A;  5L0G A;  1D1C A;  3JYH A;  3SNH A;  2PFD A;  1H7I A;  3S9O A;  2HZ8 A;  1YAR O;  1QKR A;  3K6B A;  4MVS A;  3PHF 2;  4CIP A;  1VK5 A;  2QNL A;  2Y69 C;  3C62 A;  3QZC A;  2XLO A;  3DI5 A;  1VMA A;  4DRH B;  1LM3 B;  3M1C B;  1NU7 D;  3NMK A;  1E2X A;  2V26 A;  3NKE A;  3NRH A;  4N4W A;  3K1H A;  4WGY A;  2DYR C;  3WHN A;  2R7Q A;  1CGM E;  2LD6 A;  2OEX A;  3A9C A;  3EGD B;  4DRJ B;  1MND A;  1YLM A;  5T3W A;  3UMH A;  4DBQ A;  2R7U A;  3N24 A;  2OCC C;  3NDB B;  3DE9 A;  4E18 A;  2ASR A;  2FGY A;  4PJL A;  4H4K C;  1WOL A;  3NMJ A;  4F4B A;  4Q7C A;  1PCX A;  2XLW A;  2PNO A;  2QY9 A;  3U3F A;  1H9G A;  5DQZ A;  2R03 A;  5DS5 A;  4OIP F;  2CDQ A;  2ICW G;  2EIL C;  1VYK A;  5CI9 A;  2HMQ A;  4O6M A;  2Q9B A;  2PP4 A;  4JTA B;  4U5H A;  3L8J A;  1PD1 A;  3IHU A;  4KI2 A;  3RVZ A;  3QW0 A;  5KYN A;  3EHN A;  3JRM O;  3ABL C;  2YQY A;  1LI5 A;  2P6V A;  3L1M A;  3TJ6 A;  3CAX A;  3W8I A;  3ASO C;  4JCZ A;  4RDA A;  4CS8 C;  3Q6M A;  2YL7 A;  1CGN A;  1WAS A;  2H7O A;  4YWQ A;  1BBH A;  1MMD A;  2HUJ A;  1RKE A;  4I3M A;  4JTD B;  1MMG A;  1ZHZ A;  4LLE A;  4MVU A;  2XL4 A;  5DQT A;  5AC4 A;  1T6Q A;  3RQE A;  3JYY A;  1H6G A;  5A6B A;  2V3C C;  4NCQ A;  2F22 A;  3DMD A;  3MX3 A;  4BJ5 C;  4DBR A;  1LKX A;  1R4T A;  3HNJ A;  5B3I A;  1EKY A;  2C03 A;  1JAF A;  4NTA A;  4WGZ A;  3TD7 A;  4JC7 A;  1H9T A;  1LE2 A;  3HTK C;  4C3E A;  3IEE A;  4MS2 A;  5DS4 A;  4RD9 A;  3Q7G A;  2LCH A;  3IQT A;  1LS4 A;  4Z9H A;  3K1I A;  3IQC A;  1OKK D;  2ZXR A;  3CSK A;  5KYY A;  1BZ4 A;  1NFN A;  3GEI A;  2XL8 A;  3LES A;  4W8K A;  4U5C E;  1JR8 A;  1HE9 A;  1W2W A;  3R7C A;  4XQ1 A;  2WVN A;  4MQ9 F;  3ZQY A;  5DLJ A;  1TWA A;  2J45 A;  1TFK B;  2JX0 A;  3V5X A;  3QMK A;  2KSF A;  3T6G B;  2GFH A;  2L7A A;  2WB7 A;  4JKV A;  3U2L A;  1AUE A;  2CCY A;  2EPN A;  1CPR A;  1IW7 F;  1Z5Z A;  1EA8 A;  1VOM A;  2FFH A;  3AG3 C;  3DE8 A;  1KU2 A;  1SF8 A;  2PF4 E;  4CJO A;  5A6K A;  2PBE A;  1VB5 A;  3KYJ A;  3HKK A;  1RKE B;  2LK4 A;  3DJN B;  4M63 A;  3SZR A;  3GAN A;  3UMI A;  2EIM C;  1Z3I X;  3B29 A;  4YL3 A;  2X0C A;  2DGJ A;  3DWW A;  1YZC A;  4K0D A;  3HNK A;  1BDJ B;  2B0J A;  2G3K A;  4JE9 A;  1OKK A;  1RKC A;  1Z63 A;  3GM2 A;  3VYW A;  1K04 A;  2H8A A;  4J7Y A;  3QVZ A;  2J46 A;  4DOZ A;  1OCC C;  1ZU4 A;  2OJQ A;  3FMS A;  4OD4 A;  3ZTZ A;  1TWC A;  4JVS A;  5BUO A;  2A0U A;  3S90 A;  2NUP A;  3AG4 C;  3C8Z A;  4IB4 A;  1GM5 A;  1JOG A;  1I4Z A;  3QVY A;  2ZD9 A;  1LIH A;  5JLI A;  5KYY B;  4QI2 A;  3GWL A;  4E0H A;  3T6J A;  3ZIB A;  2GWW A;  2L81 A;  4Z9I A;  3DM5 A;  4IWB A;  4LAC B;  4E7Z A;  1WGW A;  3ZSU A;  2VC9 A;  5L0J A;  2PX3 A;  2HKV A;  4CDA A;  3S27 A;  1VLT A;  3U9J A;  1JMW A;  2EPO A;  3MYF A;  1A7E A;  2NUT A;  2W4B A;  4YT2 A;  2TMV P;  1N1C A;  2YRF A;  3K33 A;  3US6 A;  2QTV A;  3HLZ A;  2XRH A;  4MTO A;  4BJ6 A;  4RBN A;  2HV6 A;  3S84 A;  2ZPA A;  3U3B A;  2X51 A;  3X1O A;  4QDL A;  4O7G A;  2VCB A;  4JZA A;  1S05 A;  2OG2 A;  1FFT C;  3FAP B;  3GEH A;  4MVO A;  2VH3 A;  1MMN A;  2BE5 F;  2WZG A;  4MTG A;  4HFK B;  1L3P A;  2NPU A;  1SZI A;  1VYI A;  1HE1 A;  4W8P A;  4XLP F;  2OU6 A;  3SXZ A;  3IQ6 A;  4YJW A;  1JPJ A;  3LJB A;  4NC3 A;  3H2V A;  2OQM A;  1QSP A;  2J7P D;  2RD9 A;  3DZA A;  1G8X A;  2QLA A;  3RQG A;  3WG7 C;  1V55 C;  3LS1 A;  3JTL O;  5HSW A;  4LLC A;  3GWN A;  1TQG A;  3JCU Q;  3O6X A;  3Q6N A;  3TJ5 A;  3SXM A;  4DXW A;  4AX2 A;  1OXK A;  1T6U A;  4EBB A;  4P9F A;  3V7O A;  5EGY A;  2XM0 A;  4NTF A;  2AU5 A;  3NYM A;  3IPM O;  1ZHY A;  2NUP B;  3X2Q C;  2P1A A;  3C8G A;  2KNH A;  1NU9 C;  5AGF A;  3B0U X;  1BR2 A;  1NSG B;  1K05 A;  2WL8 A;  3M4B A;  1APC A;  256B A;  4H54 A;  1EI7 A;  4EIY A;  4ZLC A;  4WJ0 A;  4LDR A;  5L0F A;  3S28 A;  2J0X A;  1ORS C;  3CEX A;  1PV3 A;  3RIP A;  1C03 A;  4MW3 A;  3W2W A;  3QTH A;  3U8V A;  4I1M A;  2YLI A;  4XEF A;  4XWJ A;  3KMI A;  4BEM J;  5F28 E;  1LVK A;  2NUT B;  4X0R A;  3POV A;  1O87 A;  4NTB A;  4U5D E;  4U5B E;  3F46 A;  2H7B A;  1RMV A;  1LS1 A;  2G3V A;  4JTC B;  4YN0 B;  4UDV A;  4LER A;  3KL4 A;  2XLV A;  1E86 A;  2HV7 A;  5EK0 A;  2GAQ A; 
#chains in the Genus database with same CATH homology
 2CW0 F;  4JUR I;  3LEV A;  3EG9 A;  2R7T A;  2Q3T A;  2Y3G A;  3RFY A;  2Y3B A;  3EZH A;  3RH3 A;  1NZE A;  3EQL F;  2JD3 A;  4GYT A;  5E33 A;  4EWC A;  4QI0 A;  1QLE C;  4NY3 A;  3RYL A;  2A68 F;  1FMW A;  2O9X A;  4JJG A;  2R7S A;  4HEA J;  3EPV A;  3B0V C;  1S7Z A;  3H65 A;  2EIN C;  1FTS A;  2KGO A;  3L34 A;  1MMA A;  2DYS C;  5KYU A;  4HFF B;  3LAY A;  1IZM A;  2W9Y A;  2YEV A;  2EIJ C;  3AG2 C;  5T1D B;  2R7X A;  3S0X A;  3EHM A;  1TWG A;  4GEH A;  3B0P A;  2ZXW C;  3LLI A;  3UR3 C;  4CS8 A;  3ZVR A;  4ANJ A;  2KW3 C;  4C7O A;  3NYL A;  1MNE A;  5EHH A;  2EIK C;  2IYL D;  4IRU A;  3EG9 B;  3FHD A;  4FX5 A;  2E87 A;  3EGX A;  2VB6 A;  4BJ5 A;  3UGP A;  5DS6 A;  2MYS A;  2L9J A;  3AQB A;  3F47 A;  3KH2 A;  2IXP A;  3SYN A;  2A1D D;  4U5F E;  1FMV A;  1Z23 A;  3FVY A;  3T6B A;  2M4E A;  4YT8 A;  4OIN F;  4G7H F;  4OIQ F;  1QZX A;  1D1B A;  4CS7 A;  5KYU B;  2H7V C;  2Y3D A;  2CNW D;  1JPN A;  5L3V A;  4I1O B;  4I44 A;  4YT5 A;  1OCR C;  4CS9 C;  4OD5 A;  4G7Z F;  4CSA C;  3ITF A;  4KNW A;  4C7O B;  4BEJ A;  3EH2 A;  5KYW A;  3LLK A;  4Q4Z F;  4BJT A;  4JW1 A;  4B6I A;  1ST6 A;  4YT4 A;  3EGX B;  5FCL A;  4IJJ A;  3Q7L A;  4PJM A;  3S29 A;  2ZXO A;  1M2O A;  4G7O F;  4KBL A;  4P6I C;  4PFP A;  1ZHT A;  4HE8 D;  3RKO F;  1OCO C;  2G62 A;  1J8M F;  1BR4 A;  2KJG A;  4O6N A;  4XLN F;  2Q9C A;  4DVZ A;  4PK4 A;  3JRT A;  3K7D A;  3WOD F;  1V54 C;  5CI8 A;  3UNG C;  2KQ9 A;  4OIR F;  4BG0 A;  2C04 A;  4FWV A;  2I8B A;  1O5H A;  2MWQ A;  1M56 C;  1TKN A;  3EZI A;  2A6H F;  2WZF A;  5KYW B;  3GOD A;  2VAS A;  2WVO A;  2ZXP A;  5DVW A;  2J7P A;  3W2V A;  4JJF A;  3JT1 A;  1FFH A;  2NG1 A;  2IXO A;  4G0H A;  4KC9 A;  2XXA A;  2W45 A;  5B1A C;  3SEO A;  4KNV A;  3ASN C;  2Z15 A;  3AG1 C;  3K1I C;  3MLG A;  4PJN A;  4OIO F;  2Y3H A;  3ZG1 A;  3ABM C;  3NG1 A;  4XTK A;  2W4M A;  5DS4 A;  3VAY A;  3ZC4 A;  2XSE A;  5E3A A;  5F5F A;  1PD0 A;  3L0I A;  3FDQ A;  2PX0 A;  3CQZ A;  2LSE A;  4U5G A;  1ZHW A;  1RJ9 A;  2YZS A;  3DAG A;  4AK9 A;  4AE4 A;  4BJ1 A;  3JSZ A;  5KYX A;  3E70 C;  2J9W A;  2IOQ A;  1D0Z A;  3K66 A;  2XXA B;  2Q9A A;  3LS0 A;  2R7R A;  1Z6A A;  3OA1 A;  3N0T A;  1D0X A;  4CBE A;  5E2Q A;  4N06 A;  3I4U A;  1OCZ C;  4JCH A;  3AQC A;  4MND A;  4CIH A;  2R7O A;  4K7B A;  3SP1 A;  4ZLD A;  2IXN A;  5T3T A;  5D92 A;  3EFO A;  3CZ6 A;  3DJU B;  3N2Z B;  3DAF A;  4Q5S F;  4PFO A;  1TR2 A;  2D5R B;  1M2V A;  2WZL A;  1M57 C;  2YHS A;  3B9Q A;  3E9V A;  4BJ6 C;  1RJ9 B;  4U5E E;  3FAJ A;  2J9V A;  2WVQ A;  3OEO A;  4C3B A;  2J0W A;  4ULW A;  2CGE A;  4PJJ A;  2IXM A;  1BR1 A;  1TWH A;  4AE4 B;  3W8H A;  1NG1 A;  4E7S A;  2R7V A;  1D1A A;  1ZHX A;  3ECS A;  5IY5 C;  5KYX B;  3O39 A;  2R7W A;  3KKB A;  2Y39 A;  5B1B C;  3LNR A;  3NYJ A;  5E3C A;  1J8Y F;  3DD7 A;  5D91 A;  3ABK C;  5F5H A;  1ZYR F;  3EGD A;  1SMY F;  2A6E F;  2P7V A;  3NKD A;  1ZU5 A;  2A69 F;  3I5Q A;  3T4R A;  3OWT A;  3HJC A;  4A2N B;  2CNW A;  5L3Q A;  3UMK A;  3EH1 A;  2J9U A;  3DXJ F;  4C3D A;  3EFO B;  3UGO A;  4O6Y A;  4J32 B;  4DVY P;  4FES A;  5B3S C;  3DM9 B;  3EJN A;  4J30 B;  3I5P A;  4CS9 A;  1D0Y A;  4IAO A;  1M2V B;  3PMR A;  4CSA A;  1D1C A;  3JYH A;  3SNH A;  2PFD A;  3K6B A;  3PHF 2;  1VK5 A;  3QZC A;  2Y69 C;  1VMA A;  3M1C B;  1NU7 D;  2V26 A;  3NKE A;  3NRH A;  3K1H A;  2DYR C;  2R7Q A;  3EGD B;  1MND A;  5T3W A;  3UMH A;  4DBQ A;  2R7U A;  3N24 A;  2OCC C;  3NDB B;  2FGY A;  4PJL A;  4H4K C;  4F4B A;  4Q7C A;  1PCX A;  4OIP F;  2QY9 A;  5DS5 A;  2CDQ A;  2EIL C;  1VYK A;  5CI9 A;  4O6M A;  2Q9B A;  2PP4 A;  4U5H A;  1PD1 A;  4KI2 A;  5KYN A;  3EHN A;  3ABL C;  2P6V A;  3W8I A;  3ASO C;  4CS8 C;  4RDA A;  3Q6M A;  2H7O A;  4YWQ A;  1MMD A;  4O79 A;  5DQT A;  4I3M A;  1MMG A;  1ZHZ A;  4LLE A;  2XL4 A;  2V3C C;  3DMD A;  4DBR A;  3MX3 A;  4BJ5 C;  1LKX A;  2C03 A;  3TD7 A;  3HTK C;  4C3E A;  3IEE A;  4RD9 A;  3Q7G A;  2ZXR A;  1OKK D;  3CSK A;  5KYY A;  3LES A;  4W8K A;  4U5C E;  1W2W A;  2WVN A;  4MQ9 F;  5DLJ A;  1TWA A;  2J45 A;  3QMK A;  2GFH A;  2WB7 A;  1IW7 F;  1Z5Z A;  2FFH A;  1VOM A;  3AG3 C;  1KU2 A;  1SF8 A;  2PF4 E;  3W2W A;  3SZR A;  3DJN B;  4M63 A;  3GAN A;  3UMI A;  2EIM C;  1Z3I X;  2DGJ A;  4K0D A;  2B0J A;  2G3K A;  1OKK A;  1Z63 A;  3VYW A;  2J46 A;  4DOZ A;  1OCC C;  1ZU4 A;  4OD4 A;  1TWC A;  4JVS A;  5BUO A;  2NUP A;  3AG4 C;  5KYY B;  4QI2 A;  3T6J A;  3ZIB A;  2L81 A;  3DM5 A;  4IWB A;  4LAC B;  4E7Z A;  1WGW A;  3ZSU A;  2PX3 A;  3S27 A;  4YT2 A;  2NUT A;  2W4B A;  1N1C A;  3K33 A;  2QTV A;  3HLZ A;  2XRH A;  4BJ6 A;  4RBN A;  2HV6 A;  2ZPA A;  2X51 A;  3X1O A;  4QDL A;  4O7G A;  4JZA A;  2OG2 A;  1FFT C;  2VH3 A;  1MMN A;  2BE5 F;  2WZG A;  4HFK B;  1SZI A;  1VYI A;  4XLP F;  4YJW A;  1JPJ A;  3LJB A;  5DQZ A;  3DZA A;  2J7P D;  3WG7 C;  1G8X A;  1V55 C;  3LS1 A;  5HSW A;  4LLC A;  3Q6N A;  3JCU Q;  3O6X A;  4AX2 A;  4EBB A;  3V7O A;  5EGY A;  3NYM A;  1ZHY A;  2NUP B;  3X2Q C;  2KNH A;  1NU9 C;  3B0U X;  1BR2 A;  2WL8 A;  4ZLC A;  4WJ0 A;  3S28 A;  2J0X A;  3RIP A;  4I1M A;  4XWJ A;  3KMI A;  1LVK A;  2NUT B;  4X0R A;  3POV A;  1O87 A;  4U5B E;  4U5D E;  3F46 A;  2H7B A;  1LS1 A;  2G3V A;  4YN0 B;  4LER A;  3KL4 A;  2HV7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...