4I4OA

Bel beta-trefoil apo crystal form 1
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
146
structure length
146
Chain Sequence
VNFPNIPAEGVQFRLRARDTGYVIYSRTENPPLVWQYNGPPYDDQLFTLIYGTGPRKNLYAIKSVPNGRVLFSRTSASPYVGNIAGDGTYNDNWFQFIQDDNDPNSFRIYNLASDTVLYSRTTADPKFGNFTGAKYDDQLWHFELV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BEL beta-trefoil
publication title BEL {beta}-trefoil: A novel lectin with antineoplastic properties in king bolete (Boletus edulis) mushrooms.
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 41
structure length 146
sequence length 146
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 4i4oA00
2BEBA 2P39A 1RZOB 1V6WA 1T4QA 1E0OA 2Y9XE 3IAGC 3OJ2A 5F8WA 3BAGA 3P53A 3WA1A 3PMEA 2DRZA 5D63A 4FGFA 4D0ZA 1YXWA 1MD6A 4JRAA 1G9AA 1Q1UA 3V0BA 1S0BA 3BAHA 1AVUA 1AXMA 4ZFUB 4LO1A 4IY8A 1TOOA 3VT2A 4AN6A 3V0AB 1TWEA 4LO0A 2ZQOA 4HJJA 3S8JA 1BASA 3UJ4A 1CVSA 3TC2A 2ZQNA 3AJ5A 2MLLB 1DZCA 1V6UA 3FJFA 3N0KA 4ZKTB 4D8HA 4L4IA 4LO3C 2K8RA 3MALA 1BLDA 3I29B 3AKGA 3NBCA 4EEEB 3ZX7A 3CQAA 1RMLA 3A21A 4HR6C 1SR4A 1A8DA 4IONA 2ERMA 3FJ8A 4QBVA 4I4VA 3O5WB 4F34A 1IOBA 4ZGRB 1W3AA 1D0HA 1YBIA 2Z48A 5D62A 2DRYA 2VXRA 4QO3A 1DQGA 1Z0HA 3BAUA 2AAIB 1JTCA 2DREA 2ZR1B 4I96A 4JKXB 4P0LA 5EHAA 2D20A 1JT4A 1PUUB 3FJDA 4LO7B 1TFMB 2VLCA 4ZOTA 2FO1A 4J2XA 5FNWA 5BQUA 1PZZA 3OGGA 2D22A 4OWLA 1L2HA 3O4CA 4Z9WB 5G00A 2NP0A 2Q9XA 3HBWA 3BB2A 2GZBA 3ZXDA 5EC5A 1G9CA 2DS0A 2KKIA 3O44A 1HIBA 3O49A 4R6UB 1SZ6B 3FUQA 4I3NA 1S0CA 5FZYA 4KBBA 1EVTA 1IRPA 1I1BA 2D7RA 1YTOA 3BADA 3E8LC 1HWPB 4HA2A 3BAOA 1M2TB 1HCEA 4G9NA 4I1BA 5DUYA 3EF2A 4D0TA 1JT3A 3UJ0A 3ILAA 3VT1A 1QQLA 1FMZA 4GAIA 5BXSA 2FFVA 1ISXA 3IIRA 4A7KA 3N7LA 1DJSB 4ZFWB 2RQ9A 1W3GA 5JLVA 1TWMA 3P6IA 3BA5A 3RMXA 3BTAA 4JKQA 1FV3A 4I2SA 4L4HA 1XZZA 3ZC8A 3ZC9A 3CRGA 1CE7B 4KEKA 2LIEA 3Q7YA 1ISWA 4CJMA 4OEGA 3FJBA 4LO7C 3WMVA 3RSJA 1DIWA 2HWMA 4GOYA 4IZXA 1G82A 1QQKA 4G6MA 4I4QA 1V6XA 4LO3A 4OUJA 3WMUA 1JY0A 4II0A 3N7KA 3S8KA 1RG8A 1DQOA 1YYNA 2KI6B 1G9BA 2D24A 3T8SA 4DCKC 3Q7WA 3KMVA 3CA4A 2VXTI 4J23B 3VWCA 4X38A 2K43A 4USPA 1G9DA 3QR5A 1FQ9A 4OEEA 3WO2A 1P63A 2VSEA 3A23A 4KEIA 3F62B 4P0KA 1PC8B 3FUOA 1IHKA 4QKRA 1BLAA 3B9UA 3AJ6A 3AZVA 3O4AA 1KNMA 3H6QA 3O3QA 4A7YA 3PG0A 5BOWA 3MPPG 5EG6C 1HWNB 3V0BB 3NBNA 4P0JA 1FN0A 2X2TA 3POKA 5FNXA 5JMCA 4Q9PA 1Q03A 4I0YA 1FWVA 2M49A 3IM7A 1IRAX 4GP0A 3SNVA 3BRFA 4GP3A 1K5VA 1NZKA 4QBCA 1DFQA 3H6RA 1WBCA 3AKHA 3CU1B 3PUBA 3I2AA 4G1RA 1IJTA 2WRYA 1HKNA 3R4SA 3HMYA 1Z4SA 1EV2A 3HALA 4X3AA 1IILA 1FMMS 1JT7A 1HWOB 1S0FA 4PC4A 4OWJA 1BFCA 3AH2A 4A7ZA 2D1ZA 3NBEA 3WO3A 1AVXB 4J2SA 1ABRB 5HPZA 1JQZA 4JP0A 5BXRA 4IQPA 4Q9GA 4I4SA 2VU9A 3D7WB 2Y9FA 2WBCA 3HOMA 3BA7A 4LO8B 2L5XA 1K5UA 5BXTA 5FZZA 4I4UA 3RTIB 4ZLBB 1BA7A 3C9ZA 4LO1C 3CA6A 2E4MC 1OQLB 3IM6A 4QKSA 4I4RA 2D43A 1TTUA 2VSAA 1S0LA 2NYYA 3AH4A 2MIBA 3OJMA 3FJIA 3FJJA 4ZA3B 1EPWA 2Y9WC 4OW4A 41BIA 1V6VA 2HWAA 3O4OA 2F2FC 5B2HA 1R8NA 3AKFA 3I2XA 6I1BA 4ZBVB 2RSTA 4EB2B 1HWMB 2Y9GA 1BFBA 2NZ9A 2FFUA 4FVVA 2R9KB 3F1RA 1W3FA 3CA0A 4QD2B 1Q04A 3JRRA 4WBCA 3O4DA 2AXMA 1DLLA 3CRHA 3N7MA 2X2SA 3R4UA 2YUGA 2I1BA 3WO4A 3NJ5A 1AVAC 2Q3NB 4DEPA 4EKXB 3CA3A 4I1EA 3FGMA 1HCDA 1XYFA 1S0EA 2J3PA 9ILBA 1T9FA 1FV2A 4Z8SB 4JAWA 2FDBM 1JLXA 3N7JA 4GAFA 4XKIA 4G9MA 3RTJB 3W9TA 1II4A 1XHBA 2NTDA 2KH2A 3CAHA 4P6AA 1MC9A 4G6JA 5DVHA 3LTQA 1UPSA 4XFUA 4LO2C 3UD8A 4JPZA 2KI4A 4ISQA 3VSFA 3O4BA 2AFGA 2ESUA 3Q7XA 2GO2A 2HZ9A 3CRIA 4AN7B 5BP5C 1ISYA 1J0SA 3BA4A 3OJVA 2K4AB 3WINC 3JUTA 1S0DA 3FJEA 3QYDA 2ET2A 1R8OA 4I4XA 2QYIB 2P23A 3HSMA 4GOVA 2RG9B 3AKIA 2VUAA 4JQ0A 4QD2C 3K1XA 1M16A 3V0AA 2BFHA 4I4PA 4I6IA 1TP0A 1AVWB 4IHZA 2D44A 2E4MA 3A22A 3NBDA 1DZDA 2IWTB 1XG6A 2HW9A 3A07A 4IZEA 5F8YA 3FFZA 2XOAA 3UD7A 4XFTA 5DZUA 3ZXGA 1ISVA 21BIA 2NVHA 3H6RB 3AH1A 1WD3A 1AF9A 1F31A 2MC2A 4KEJA 1QXMA 1ONKB 5DSSB 1ILR1 2F2FA 4EFPA 4F83A 3VUOA 2QN4A 7I1BA 3CA5A 1YF8B 2LIQA 2FGFA 3BRDA 2IHOA 4QALA 4I4OA 3FJKA 4OWKA 4H9WA 4IY9A 1EYLA 1BFGA 5E24E 4X39A 3FJAA 4ZFYB 4J2YA 4ISRA 2F8XC 4Q91A 2KLLA 3PHZA 3VEQA 4EFRA 4I8MA 3OGFA 1PWAA 3FJ9A 4USOA 5I1BA 1RY7A 3HN1A 4QC4A 3FJHA 4LO0C 5BXPA 4TLPA 1ISZA 3OBRA 3IM5A 3AZWA 2AQZA 2UUSA 1NUNA 4LO2A 4J2KA 4I37A 1I1EA 4EFQA 31BIA 3BX1C 1ITBA 2D7IA 3LLPA 4DENA 3BRGC 3VSZA 3UD9A 5BP5A 1DFCA 4KC3A 1N4KA 1Z2VA 4X37A 1SR4C 4OEFA 1JLYA 2NM1A 3WINA 5F90A 3H6SE 1FGAA 1JT5A 1TIEA 1PUMB 4I7IA 1AFCA 4I4YA 4YOLA 1S0GA 3FJCA 1BARA 4IYBA 1GGPB 1WBAA 5BQUC 5F8SA 5GAQA 1WD4A 1FWUA 2D23A 3P6JA 3BAVA 1IT0A 3OBTA 1BFFA 3UDAA 3VT0A 8I1BA 5FZUA 4ENDA 5BVPI 3V79C 4H04A 3RMYA 3CA1A 4XFSA 5D61A 1VCLA 3BAQA 2Z49A 2BEAA
chains in the Genus database with same CATH superfamily
2BEBA 2P39A 1RZOB 1V6WA 1T4QA 1E0OA 2Y9XE 3IAGC 3OJ2A 5F8WA 3BAGA 3P53A 3WA1A 3PMEA 2DRZA 5D63A 4FGFA 4D0ZA 1YXWA 1MD6A 4JRAA 1G9AA 1Q1UA 3V0BA 1S0BA 3BAHA 1AVUA 1AXMA 4ZFUB 4LO1A 4IY8A 1TOOA 3VT2A 4AN6A 3V0AB 1TWEA 4LO0A 2ZQOA 4HJJA 3S8JA 1BASA 3UJ4A 1CVSA 3TC2A 2ZQNA 3AJ5A 2MLLB 1DZCA 1V6UA 3FJFA 3N0KA 4ZKTB 4D8HA 4L4IA 4LO3C 2K8RA 3MALA 1BLDA 3I29B 3AKGA 3NBCA 2NS2A 4EEEB 3ZX7A 3CQAA 1RMLA 3A21A 4HR6C 1SR4A 1A8DA 4IONA 2ERMA 3FJ8A 4QBVA 4I4VA 3O5WB 4MZHA 4F34A 1IOBA 4ZGRB 1W3AA 1D0HA 1YBIA 2Z48A 5D62A 2DRYA 2VXRA 4QO3A 1DQGA 1Z0HA 3BAUA 2AAIB 1JTCA 2DREA 2ZR1B 4I96A 4JKXB 4P0LA 5EHAA 2D20A 1JT4A 1PUUB 3FJDA 4LO7B 1TFMB 2VLCA 4ZOTA 2FO1A 4J2XA 5FNWA 5BQUA 1PZZA 3OGGA 2D22A 4OWLA 1L2HA 3O4CA 4Z9WB 5G00A 2NP0A 2Q9XA 3HBWA 3BB2A 2GZBA 3ZXDA 5EC5A 1G9CA 2DS0A 2KKIA 3O44A 1HIBA 3O49A 4R6UB 1SZ6B 3FUQA 4I3NA 1S0CA 5FZYA 4KBBA 1EVTA 1IRPA 1I1BA 2D7RA 1YTOA 3BADA 3E8LC 1HWPB 4HA2A 3BAOA 1M2TB 1HCEA 4G9NA 4I1BA 5DUYA 3EF2A 4D0TA 1JT3A 3UJ0A 3ILAA 3VT1A 1QQLA 4UY4A 1FMZA 4GAIA 5BXSA 2FFVA 1ISXA 3IIRA 4A7KA 3N7LA 1DJSB 4ZFWB 2RQ9A 1W3GA 5JLVA 1TWMA 3P6IA 3BA5A 3RMXA 3BTAA 4JKQA 1FV3A 4I2SA 4L4HA 1XZZA 3ZC8A 3ZC9A 3CRGA 1CE7B 4KEKA 2LIEA 3Q7YA 1ISWA 4CJMA 4OEGA 3FJBA 4LO7C 3WMVA 3RSJA 1DIWA 2HWMA 4GOYA 4IZXA 1G82A 1QQKA 4G6MA 4I4QA 1V6XA 4LO3A 4OUJA 3WMUA 1JY0A 4II0A 3N7KA 3S8KA 1RG8A 1DQOA 1YYNA 2KI6B 1G9BA 2D24A 3T8SA 4DCKC 3Q7WA 3KMVA 3CA4A 2VXTI 4J23B 3VWCA 4X38A 2K43A 4USPA 1G9DA 3QR5A 1FQ9A 4OEEA 3WO2A 1P63A 2VSEA 3A23A 4KEIA 3F62B 4P0KA 1PC8B 3FUOA 1IHKA 4QKRA 1BLAA 3B9UA 3AJ6A 3AZVA 3O4AA 1KNMA 3H6QA 3O3QA 4A7YA 3PG0A 5BOWA 3MPPG 5EG6C 1HWNB 3V0BB 3NBNA 4P0JA 1FN0A 2X2TA 3POKA 5FNXA 5JMCA 4Q9PA 1Q03A 4I0YA 1FWVA 2M49A 3IM7A 1IRAX 4GP0A 3SNVA 3BRFA 4GP3A 1K5VA 1NZKA 4QBCA 1DFQA 3H6RA 1WBCA 3AKHA 3CU1B 3PUBA 3I2AA 4G1RA 1IJTA 2WRYA 1HKNA 3R4SA 3HMYA 1Z4SA 4MZGB 1EV2A 3HALA 4X3AA 1IILA 1FMMS 1JT7A 1HWOB 1S0FA 4PC4A 4OWJA 1BFCA 3AH2A 4A7ZA 2D1ZA 3NBEA 3WO3A 1AVXB 4J2SA 1ABRB 5HPZA 1JQZA 4JP0A 5BXRA 4IQPA 4Q9GA 4I4SA 2VU9A 3D7WB 2Y9FA 2WBCA 3HOMA 3BA7A 4LO8B 2L5XA 1K5UA 5BXTA 5FZZA 4I4UA 3RTIB 4ZLBB 1BA7A 3C9ZA 4LO1C 3CA6A 2E4MC 1OQLB 3IM6A 4QKSA 4I4RA 2D43A 1TTUA 2VSAA 1S0LA 2NYYA 3AH4A 2MIBA 3OJMA 3FJIA 3FJJA 4ZA3B 1EPWA 2Y9WC 4OW4A 41BIA 1V6VA 2HWAA 3O4OA 2F2FC 5B2HA 1R8NA 3AKFA 3I2XA 6I1BA 4ZBVB 2RSTA 4EB2B 1HWMB 2Y9GA 1BFBA 2NZ9A 2FFUA 4FVVA 2R9KB 3F1RA 1W3FA 3CA0A 4QD2B 1Q04A 3JRRA 4WBCA 3O4DA 2AXMA 1DLLA 3CRHA 3N7MA 2X2SA 3R4UA 2YUGA 2I1BA 3WO4A 4H75A 3NJ5A 1AVAC 2Q3NB 4DEPA 4EKXB 3CA3A 4I1EA 4MZFB 3FGMA 1HCDA 1XYFA 1S0EA 2J3PA 9ILBA 1T9FA 1FV2A 4Z8SB 4JAWA 2FDBM 1JLXA 3N7JA 4GAFA 4XKIA 4G9MA 3RTJB 3W9TA 1II4A 1XHBA 2NTDA 2KH2A 3CAHA 4P6AA 1MC9A 4G6JA 5DVHA 3LTQA 1UPSA 4XFUA 4LO2C 3UD8A 4JPZA 2KI4A 4ISQA 3VSFA 3O4BA 2AFGA 2ESUA 3Q7XA 2GO2A 2HZ9A 3CRIA 4AN7B 5BP5C 1ISYA 1J0SA 3BA4A 3OJVA 2K4AB 3WINC 3JUTA 1S0DA 3FJEA 3QYDA 2ET2A 1R8OA 4I4XA 2QYIB 2P23A 3HSMA 4GOVA 2RG9B 3AKIA 2VUAA 4JQ0A 4QD2C 3K1XA 1M16A 3V0AA 2BFHA 4I4PA 4I6IA 1TP0A 1AVWB 4IHZA 2D44A 2E4MA 3A22A 3NBDA 1DZDA 2IWTB 1XG6A 2HW9A 3A07A 4IZEA 5F8YA 3FFZA 2XOAA 3UD7A 4XFTA 5DZUA 3ZXGA 1ISVA 21BIA 2NVHA 3H6RB 3AH1A 1WD3A 1AF9A 1F31A 2MC2A 4KEJA 1QXMA 1ONKB 5DSSB 1ILR1 2F2FA 4EFPA 4F83A 3VUOA 2QN4A 7I1BA 3CA5A 1YF8B 2LIQA 2FGFA 3BRDA 2IHOA 4QALA 4I4OA 3FJKA 4OWKA 4H9WA 4IY9A 1EYLA 1BFGA 5E24E 4X39A 3FJAA 4ZFYB 4J2YA 4ISRA 2F8XC 4Q91A 2KLLA 3PHZA 3VEQA 4EFRA 4I8MA 3OGFA 1PWAA 3FJ9A 4USOA 5I1BA 1RY7A 3HN1A 4QC4A 3FJHA 4LO0C 5BXPA 4TLPA 1ISZA 3OBRA 3IM5A 3AZWA 2AQZA 2UUSA 1NUNA 4LO2A 4J2KA 4I37A 1I1EA 4EFQA 31BIA 3BX1C 1ITBA 2D7IA 3LLPA 4DENA 3BRGC 3VSZA 3UD9A 5BP5A 1DFCA 4KC3A 1N4KA 1Z2VA 4X37A 1SR4C 4OEFA 1JLYA 2NM1A 3WINA 5F90A 3H6SE 1FGAA 1JT5A 1TIEA 1PUMB 4I7IA 1AFCA 4I4YA 4YOLA 1S0GA 3FJCA 1BARA 4IYBA 1GGPB 1WBAA 5BQUC 5F8SA 5GAQA 1WD4A 1FWUA 2D23A 3P6JA 3BAVA 1IT0A 3OBTA 1BFFA 3UDAA 3VT0A 8I1BA 5FZUA 4ENDA 5BVPI 3V79C 4H04A 3RMYA 3CA1A 4XFSA 5D61A 1VCLA 3BAQA 2Z49A 2BEAA
chains in the Genus database with same CATH topology
2BEBA 2P39A 1RZOB 1V6WA 1T4QA 1E0OA 2Y9XE 3IAGC 3OJ2A 5F8WA 3BAGA 3P53A 3WA1A 3PMEA 2DRZA 5D63A 4FGFA 4D0ZA 1YXWA 1MD6A 4JRAA 1G9AA 1Q1UA 3V0BA 1S0BA 3BAHA 1AVUA 1AXMA 4ZFUB 4LO1A 4IY8A 1TOOA 3VT2A 4AN6A 3V0AB 1TWEA 4LO0A 2ZQOA 4HJJA 3S8JA 1BASA 3UJ4A 1CVSA 3TC2A 2ZQNA 3AJ5A 2MLLB 1DZCA 1V6UA 3FJFA 3N0KA 4ZKTB 4D8HA 4L4IA 4LO3C 2K8RA 3MALA 1BLDA 3I29B 3AKGA 3NBCA 2NS2A 4EEEB 3ZX7A 3CQAA 1RMLA 3A21A 4HR6C 1SR4A 1A8DA 4IONA 2ERMA 3FJ8A 4QBVA 4I4VA 3O5WB 4MZHA 4F34A 1IOBA 4ZGRB 1W3AA 1D0HA 1YBIA 2Z48A 5D62A 2DRYA 2VXRA 4QO3A 1DQGA 1Z0HA 3BAUA 2AAIB 1JTCA 2DREA 2ZR1B 4I96A 4JKXB 4P0LA 5EHAA 2D20A 1JT4A 1PUUB 3FJDA 4LO7B 1TFMB 2VLCA 4ZOTA 2FO1A 4J2XA 5FNWA 5BQUA 1PZZA 3OGGA 2D22A 4OWLA 1L2HA 3O4CA 4Z9WB 5G00A 2NP0A 2Q9XA 3HBWA 3BB2A 2GZBA 3ZXDA 5EC5A 1G9CA 2DS0A 2KKIA 3O44A 1HIBA 3O49A 4R6UB 1SZ6B 3FUQA 4I3NA 1S0CA 5FZYA 4KBBA 1EVTA 1IRPA 1I1BA 2D7RA 1YTOA 3BADA 3E8LC 1HWPB 4HA2A 3BAOA 1M2TB 1HCEA 4G9NA 4I1BA 5DUYA 3EF2A 4D0TA 1JT3A 3UJ0A 3ILAA 3VT1A 1QQLA 4UY4A 1FMZA 4GAIA 5BXSA 2FFVA 1ISXA 3IIRA 4A7KA 3N7LA 1DJSB 4ZFWB 2RQ9A 1W3GA 5JLVA 1TWMA 3P6IA 3BA5A 3RMXA 3BTAA 4JKQA 1FV3A 4I2SA 4L4HA 1XZZA 3ZC8A 3ZC9A 3CRGA 1CE7B 4KEKA 2LIEA 3Q7YA 1ISWA 4CJMA 4OEGA 3FJBA 4LO7C 3WMVA 3RSJA 1DIWA 2HWMA 4GOYA 4IZXA 1G82A 1QQKA 4G6MA 4I4QA 1V6XA 4LO3A 4OUJA 3WMUA 1JY0A 4II0A 3N7KA 3S8KA 1RG8A 1DQOA 1YYNA 2KI6B 1G9BA 2D24A 3T8SA 4DCKC 3Q7WA 3KMVA 3CA4A 2VXTI 4J23B 3VWCA 4X38A 2K43A 4USPA 1G9DA 3QR5A 1FQ9A 4OEEA 3WO2A 1P63A 2VSEA 3A23A 4KEIA 3F62B 4P0KA 1PC8B 3FUOA 1IHKA 4QKRA 1BLAA 3B9UA 3AJ6A 3AZVA 3O4AA 1KNMA 3H6QA 3O3QA 4A7YA 3PG0A 5BOWA 3MPPG 5EG6C 1HWNB 3V0BB 3NBNA 4P0JA 1FN0A 2X2TA 3POKA 5FNXA 5JMCA 4Q9PA 1Q03A 4I0YA 1FWVA 2M49A 3IM7A 1IRAX 4GP0A 3SNVA 3BRFA 4GP3A 1K5VA 1NZKA 4QBCA 1DFQA 3H6RA 1WBCA 3AKHA 3CU1B 3PUBA 3I2AA 4G1RA 1IJTA 2WRYA 1HKNA 3R4SA 3HMYA 1Z4SA 4MZGB 1EV2A 3HALA 4X3AA 1IILA 1FMMS 1JT7A 1HWOB 1S0FA 4PC4A 4OWJA 1BFCA 3AH2A 4A7ZA 2D1ZA 3NBEA 3WO3A 1AVXB 4J2SA 1ABRB 5HPZA 1JQZA 4JP0A 5BXRA 4IQPA 4Q9GA 4I4SA 2VU9A 3D7WB 2Y9FA 2WBCA 3HOMA 3BA7A 4LO8B 2L5XA 1K5UA 5BXTA 5FZZA 4I4UA 3RTIB 4ZLBB 1BA7A 3C9ZA 4LO1C 3CA6A 2E4MC 1OQLB 3IM6A 4QKSA 4I4RA 2D43A 1TTUA 2VSAA 1S0LA 2NYYA 3AH4A 2MIBA 3OJMA 3FJIA 3FJJA 4ZA3B 1EPWA 2Y9WC 4OW4A 41BIA 1V6VA 2HWAA 3O4OA 2F2FC 5B2HA 1R8NA 3AKFA 3I2XA 6I1BA 4ZBVB 2RSTA 4EB2B 1HWMB 2Y9GA 1BFBA 2NZ9A 2FFUA 4FVVA 2R9KB 3F1RA 1W3FA 3CA0A 4QD2B 1Q04A 3JRRA 4WBCA 3O4DA 2AXMA 1DLLA 3CRHA 3N7MA 2X2SA 3R4UA 2YUGA 2I1BA 3WO4A 4H75A 3NJ5A 1AVAC 2Q3NB 4DEPA 4EKXB 3CA3A 4I1EA 4MZFB 3FGMA 1HCDA 1XYFA 1S0EA 2J3PA 9ILBA 1T9FA 1FV2A 4Z8SB 4JAWA 2FDBM 1JLXA 3N7JA 4GAFA 4XKIA 4G9MA 3RTJB 3W9TA 1II4A 1XHBA 2NTDA 2KH2A 3CAHA 4P6AA 1MC9A 4G6JA 5DVHA 3LTQA 1UPSA 4XFUA 4LO2C 3UD8A 4JPZA 2KI4A 4ISQA 3VSFA 3O4BA 2AFGA 2ESUA 3Q7XA 2GO2A 2HZ9A 3CRIA 4AN7B 5BP5C 1ISYA 1J0SA 3BA4A 3OJVA 2K4AB 3WINC 3JUTA 1S0DA 3FJEA 3QYDA 2ET2A 1R8OA 4I4XA 2QYIB 2P23A 3HSMA 4GOVA 2RG9B 3AKIA 2VUAA 4JQ0A 4QD2C 3K1XA 1M16A 3V0AA 2BFHA 4I4PA 4I6IA 1TP0A 1AVWB 4IHZA 2D44A 2E4MA 3A22A 3NBDA 1DZDA 2IWTB 1XG6A 2HW9A 3A07A 4IZEA 5F8YA 3FFZA 2XOAA 3UD7A 4XFTA 5DZUA 3ZXGA 1ISVA 21BIA 2NVHA 3H6RB 3AH1A 1WD3A 1AF9A 1F31A 2MC2A 4KEJA 1QXMA 1ONKB 5DSSB 1ILR1 2F2FA 4EFPA 4F83A 3VUOA 2QN4A 7I1BA 3CA5A 1YF8B 2LIQA 2FGFA 3BRDA 2IHOA 4QALA 4I4OA 3FJKA 4OWKA 4H9WA 4IY9A 1EYLA 1BFGA 5E24E 4X39A 3FJAA 4ZFYB 4J2YA 4ISRA 2F8XC 4Q91A 2KLLA 3PHZA 3VEQA 4EFRA 4I8MA 3OGFA 1PWAA 3FJ9A 4USOA 5I1BA 1RY7A 3HN1A 4QC4A 3FJHA 4LO0C 5BXPA 4TLPA 1ISZA 3OBRA 3IM5A 3AZWA 2AQZA 2UUSA 1NUNA 4LO2A 4J2KA 4I37A 1I1EA 4EFQA 31BIA 3BX1C 1ITBA 2D7IA 3LLPA 4DENA 3BRGC 3VSZA 3UD9A 5BP5A 1DFCA 4KC3A 1N4KA 1Z2VA 4X37A 1SR4C 4OEFA 1JLYA 2NM1A 3WINA 5F90A 3H6SE 1FGAA 1JT5A 1TIEA 1PUMB 4I7IA 1AFCA 4I4YA 4YOLA 1S0GA 3FJCA 1BARA 4IYBA 1GGPB 1WBAA 5BQUC 5F8SA 5GAQA 1WD4A 1FWUA 2D23A 3P6JA 3BAVA 1IT0A 3OBTA 1BFFA 3UDAA 3VT0A 8I1BA 5FZUA 4ENDA 5BVPI 3V79C 4H04A 3RMYA 3CA1A 4XFSA 5D61A 1VCLA 3BAQA 2Z49A 2BEAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BEB A;  2P39 A;  1RZO B;  1V6W A;  1T4Q A;  1E0O A;  2Y9X E;  3IAG C;  3OJ2 A;  5F8W A;  3BAG A;  3P53 A;  3WA1 A;  3PME A;  2DRZ A;  5D63 A;  4FGF A;  4D0Z A;  1YXW A;  1MD6 A;  4JRA A;  1G9A A;  1Q1U A;  3V0B A;  1S0B A;  3BAH A;  1AVU A;  1AXM A;  4ZFU B;  4LO1 A;  4IY8 A;  1TOO A;  3VT2 A;  4AN6 A;  3V0A B;  1TWE A;  4LO0 A;  2ZQO A;  4HJJ A;  3S8J A;  1BAS A;  3UJ4 A;  1CVS A;  3TC2 A;  2ZQN A;  3AJ5 A;  2MLL B;  1DZC A;  1V6U A;  3FJF A;  3N0K A;  4ZKT B;  4D8H A;  4L4I A;  4LO3 C;  2K8R A;  3MAL A;  1BLD A;  3I29 B;  3AKG A;  3NBC A;  4EEE B;  3ZX7 A;  3CQA A;  1RML A;  3A21 A;  4HR6 C;  1SR4 A;  1A8D A;  4ION A;  2ERM A;  3FJ8 A;  4QBV A;  4I4V A;  3O5W B;  4F34 A;  1IOB A;  4ZGR B;  1W3A A;  1D0H A;  1YBI A;  2Z48 A;  5D62 A;  2DRY A;  2VXR A;  4QO3 A;  1DQG A;  1Z0H A;  3BAU A;  2AAI B;  1JTC A;  2DRE A;  2ZR1 B;  4I96 A;  4JKX B;  4P0L A;  5EHA A;  2D20 A;  1JT4 A;  1PUU B;  3FJD A;  4LO7 B;  1TFM B;  2VLC A;  4ZOT A;  2FO1 A;  4J2X A;  5FNW A;  5BQU A;  1PZZ A;  3OGG A;  2D22 A;  4OWL A;  1L2H A;  3O4C A;  4Z9W B;  5G00 A;  2NP0 A;  2Q9X A;  3HBW A;  3BB2 A;  2GZB A;  3ZXD A;  5EC5 A;  1G9C A;  2DS0 A;  2KKI A;  3O44 A;  1HIB A;  3O49 A;  4R6U B;  1SZ6 B;  3FUQ A;  4I3N A;  1S0C A;  5FZY A;  4KBB A;  1EVT A;  1IRP A;  1I1B A;  2D7R A;  1YTO A;  3BAD A;  3E8L C;  1HWP B;  4HA2 A;  3BAO A;  1M2T B;  1HCE A;  4G9N A;  4I1B A;  5DUY A;  3EF2 A;  4D0T A;  1JT3 A;  3UJ0 A;  3ILA A;  3VT1 A;  1QQL A;  1FMZ A;  4GAI A;  5BXS A;  2FFV A;  1ISX A;  3IIR A;  4A7K A;  3N7L A;  1DJS B;  4ZFW B;  2RQ9 A;  1W3G A;  5JLV A;  1TWM A;  3P6I A;  3BA5 A;  3RMX A;  3BTA A;  4JKQ A;  1FV3 A;  4I2S A;  4L4H A;  1XZZ A;  3ZC8 A;  3ZC9 A;  3CRG A;  1CE7 B;  4KEK A;  2LIE A;  3Q7Y A;  1ISW A;  4CJM A;  4OEG A;  3FJB A;  4LO7 C;  3WMV A;  3RSJ A;  1DIW A;  2HWM A;  4GOY A;  4IZX A;  1G82 A;  1QQK A;  4G6M A;  4I4Q A;  1V6X A;  4LO3 A;  4OUJ A;  3WMU A;  1JY0 A;  4II0 A;  3N7K A;  3S8K A;  1RG8 A;  1DQO A;  1YYN A;  2KI6 B;  1G9B A;  2D24 A;  3T8S A;  4DCK C;  3Q7W A;  3KMV A;  3CA4 A;  2VXT I;  4J23 B;  3VWC A;  4X38 A;  2K43 A;  4USP A;  1G9D A;  3QR5 A;  1FQ9 A;  4OEE A;  3WO2 A;  1P63 A;  2VSE A;  3A23 A;  4KEI A;  3F62 B;  4P0K A;  1PC8 B;  3FUO A;  1IHK A;  4QKR A;  1BLA A;  3B9U A;  3AJ6 A;  3AZV A;  3O4A A;  1KNM A;  3H6Q A;  3O3Q A;  4A7Y A;  3PG0 A;  5BOW A;  3MPP G;  5EG6 C;  1HWN B;  3V0B B;  3NBN A;  4P0J A;  1FN0 A;  2X2T A;  3POK A;  5FNX A;  5JMC A;  4Q9P A;  1Q03 A;  4I0Y A;  1FWV A;  2M49 A;  3IM7 A;  1IRA X;  4GP0 A;  3SNV A;  3BRF A;  4GP3 A;  1K5V A;  1NZK A;  4QBC A;  1DFQ A;  3H6R A;  1WBC A;  3AKH A;  3CU1 B;  3PUB A;  3I2A A;  4G1R A;  1IJT A;  2WRY A;  1HKN A;  3R4S A;  3HMY A;  1Z4S A;  1EV2 A;  3HAL A;  4X3A A;  1IIL A;  1FMM S;  1JT7 A;  1HWO B;  1S0F A;  4PC4 A;  4OWJ A;  1BFC A;  3AH2 A;  4A7Z A;  2D1Z A;  3NBE A;  3WO3 A;  1AVX B;  4J2S A;  1ABR B;  5HPZ A;  1JQZ A;  4JP0 A;  5BXR A;  4IQP A;  4Q9G A;  4I4S A;  2VU9 A;  3D7W B;  2Y9F A;  2WBC A;  3HOM A;  3BA7 A;  4LO8 B;  2L5X A;  1K5U A;  5BXT A;  5FZZ A;  4I4U A;  3RTI B;  4ZLB B;  1BA7 A;  3C9Z A;  4LO1 C;  3CA6 A;  2E4M C;  1OQL B;  3IM6 A;  4QKS A;  4I4R A;  2D43 A;  1TTU A;  2VSA A;  1S0L A;  2NYY A;  3AH4 A;  2MIB A;  3OJM A;  3FJI A;  3FJJ A;  4ZA3 B;  1EPW A;  2Y9W C;  4OW4 A;  41BI A;  1V6V A;  2HWA A;  3O4O A;  2F2F C;  5B2H A;  1R8N A;  3AKF A;  3I2X A;  6I1B A;  4ZBV B;  2RST A;  4EB2 B;  1HWM B;  2Y9G A;  1BFB A;  2NZ9 A;  2FFU A;  4FVV A;  2R9K B;  3F1R A;  1W3F A;  3CA0 A;  4QD2 B;  1Q04 A;  3JRR A;  4WBC A;  3O4D A;  2AXM A;  1DLL A;  3CRH A;  3N7M A;  2X2S A;  3R4U A;  2YUG A;  2I1B A;  3WO4 A;  3NJ5 A;  1AVA C;  2Q3N B;  4DEP A;  4EKX B;  3CA3 A;  4I1E A;  3FGM A;  1HCD A;  1XYF A;  1S0E A;  2J3P A;  9ILB A;  1T9F A;  1FV2 A;  4Z8S B;  4JAW A;  2FDB M;  1JLX A;  3N7J A;  4GAF A;  4XKI A;  4G9M A;  3RTJ B;  3W9T A;  1II4 A;  1XHB A;  2NTD A;  2KH2 A;  3CAH A;  4P6A A;  1MC9 A;  4G6J A;  5DVH A;  3LTQ A;  1UPS A;  4XFU A;  4LO2 C;  3UD8 A;  4JPZ A;  2KI4 A;  4ISQ A;  3VSF A;  3O4B A;  2AFG A;  2ESU A;  3Q7X A;  2GO2 A;  2HZ9 A;  3CRI A;  4AN7 B;  5BP5 C;  1ISY A;  1J0S A;  3BA4 A;  3OJV A;  2K4A B;  3WIN C;  3JUT A;  1S0D A;  3FJE A;  3QYD A;  2ET2 A;  1R8O A;  4I4X A;  2QYI B;  2P23 A;  3HSM A;  4GOV A;  2RG9 B;  3AKI A;  2VUA A;  4JQ0 A;  4QD2 C;  3K1X A;  1M16 A;  3V0A A;  2BFH A;  4I4P A;  4I6I A;  1TP0 A;  1AVW B;  4IHZ A;  2D44 A;  2E4M A;  3A22 A;  3NBD A;  1DZD A;  2IWT B;  1XG6 A;  2HW9 A;  3A07 A;  4IZE A;  5F8Y A;  3FFZ A;  2XOA A;  3UD7 A;  4XFT A;  5DZU A;  3ZXG A;  1ISV A;  21BI A;  2NVH A;  3H6R B;  3AH1 A;  1WD3 A;  1AF9 A;  1F31 A;  2MC2 A;  4KEJ A;  1QXM A;  1ONK B;  5DSS B;  1ILR 1;  2F2F A;  4EFP A;  4F83 A;  3VUO A;  2QN4 A;  7I1B A;  3CA5 A;  1YF8 B;  2LIQ A;  2FGF A;  3BRD A;  2IHO A;  4QAL A;  4I4O A;  3FJK A;  4OWK A;  4H9W A;  4IY9 A;  1EYL A;  1BFG A;  5E24 E;  4X39 A;  3FJA A;  4ZFY B;  4J2Y A;  4ISR A;  2F8X C;  4Q91 A;  2KLL A;  3PHZ A;  3VEQ A;  4EFR A;  4I8M A;  3OGF A;  1PWA A;  3FJ9 A;  4USO A;  5I1B A;  1RY7 A;  3HN1 A;  4QC4 A;  3FJH A;  4LO0 C;  5BXP A;  4TLP A;  1ISZ A;  3OBR A;  3IM5 A;  3AZW A;  2AQZ A;  2UUS A;  1NUN A;  4LO2 A;  4J2K A;  4I37 A;  1I1E A;  4EFQ A;  31BI A;  3BX1 C;  1ITB A;  2D7I A;  3LLP A;  4DEN A;  3BRG C;  3VSZ A;  3UD9 A;  5BP5 A;  1DFC A;  4KC3 A;  1N4K A;  1Z2V A;  4X37 A;  1SR4 C;  4OEF A;  1JLY A;  2NM1 A;  3WIN A;  5F90 A;  3H6S E;  1FGA A;  1JT5 A;  1TIE A;  1PUM B;  4I7I A;  1AFC A;  4I4Y A;  4YOL A;  1S0G A;  3FJC A;  1BAR A;  4IYB A;  1GGP B;  1WBA A;  5BQU C;  5F8S A;  5GAQ A;  1WD4 A;  1FWU A;  2D23 A;  3P6J A;  3BAV A;  1IT0 A;  3OBT A;  1BFF A;  3UDA A;  3VT0 A;  8I1B A;  5FZU A;  4END A;  5BVP I;  3V79 C;  4H04 A;  3RMY A;  3CA1 A;  4XFS A;  5D61 A;  1VCL A;  3BAQ A;  2Z49 A;  2BEA A; 
#chains in the Genus database with same CATH topology
 2BEB A;  2P39 A;  1RZO B;  1V6W A;  1T4Q A;  1E0O A;  2Y9X E;  3IAG C;  3OJ2 A;  5F8W A;  3BAG A;  3P53 A;  3WA1 A;  3PME A;  2DRZ A;  5D63 A;  4FGF A;  4D0Z A;  1YXW A;  1MD6 A;  4JRA A;  1G9A A;  1Q1U A;  3V0B A;  1S0B A;  3BAH A;  1AVU A;  1AXM A;  4ZFU B;  4LO1 A;  4IY8 A;  1TOO A;  3VT2 A;  4AN6 A;  3V0A B;  1TWE A;  4LO0 A;  2ZQO A;  4HJJ A;  3S8J A;  1BAS A;  3UJ4 A;  1CVS A;  3TC2 A;  2ZQN A;  3AJ5 A;  2MLL B;  1DZC A;  1V6U A;  3FJF A;  3N0K A;  4ZKT B;  4D8H A;  4L4I A;  4LO3 C;  2K8R A;  3MAL A;  1BLD A;  3I29 B;  3AKG A;  3NBC A;  2NS2 A;  4EEE B;  3ZX7 A;  3CQA A;  1RML A;  3A21 A;  4HR6 C;  1SR4 A;  1A8D A;  4ION A;  2ERM A;  3FJ8 A;  4QBV A;  4I4V A;  3O5W B;  4MZH A;  4F34 A;  1IOB A;  4ZGR B;  1W3A A;  1D0H A;  1YBI A;  2Z48 A;  5D62 A;  2DRY A;  2VXR A;  4QO3 A;  1DQG A;  1Z0H A;  3BAU A;  2AAI B;  1JTC A;  2DRE A;  2ZR1 B;  4I96 A;  4JKX B;  4P0L A;  5EHA A;  2D20 A;  1JT4 A;  1PUU B;  3FJD A;  4LO7 B;  1TFM B;  2VLC A;  4ZOT A;  2FO1 A;  4J2X A;  5FNW A;  5BQU A;  1PZZ A;  3OGG A;  2D22 A;  4OWL A;  1L2H A;  3O4C A;  4Z9W B;  5G00 A;  2NP0 A;  2Q9X A;  3HBW A;  3BB2 A;  2GZB A;  3ZXD A;  5EC5 A;  1G9C A;  2DS0 A;  2KKI A;  3O44 A;  1HIB A;  3O49 A;  4R6U B;  1SZ6 B;  3FUQ A;  4I3N A;  1S0C A;  5FZY A;  4KBB A;  1EVT A;  1IRP A;  1I1B A;  2D7R A;  1YTO A;  3BAD A;  3E8L C;  1HWP B;  4HA2 A;  3BAO A;  1M2T B;  1HCE A;  4G9N A;  4I1B A;  5DUY A;  3EF2 A;  4D0T A;  1JT3 A;  3UJ0 A;  3ILA A;  3VT1 A;  1QQL A;  4UY4 A;  1FMZ A;  4GAI A;  5BXS A;  2FFV A;  1ISX A;  3IIR A;  4A7K A;  3N7L A;  1DJS B;  4ZFW B;  2RQ9 A;  1W3G A;  5JLV A;  1TWM A;  3P6I A;  3BA5 A;  3RMX A;  3BTA A;  4JKQ A;  1FV3 A;  4I2S A;  4L4H A;  1XZZ A;  3ZC8 A;  3ZC9 A;  3CRG A;  1CE7 B;  4KEK A;  2LIE A;  3Q7Y A;  1ISW A;  4CJM A;  4OEG A;  3FJB A;  4LO7 C;  3WMV A;  3RSJ A;  1DIW A;  2HWM A;  4GOY A;  4IZX A;  1G82 A;  1QQK A;  4G6M A;  4I4Q A;  1V6X A;  4LO3 A;  4OUJ A;  3WMU A;  1JY0 A;  4II0 A;  3N7K A;  3S8K A;  1RG8 A;  1DQO A;  1YYN A;  2KI6 B;  1G9B A;  2D24 A;  3T8S A;  4DCK C;  3Q7W A;  3KMV A;  3CA4 A;  2VXT I;  4J23 B;  3VWC A;  4X38 A;  2K43 A;  4USP A;  1G9D A;  3QR5 A;  1FQ9 A;  4OEE A;  3WO2 A;  1P63 A;  2VSE A;  3A23 A;  4KEI A;  3F62 B;  4P0K A;  1PC8 B;  3FUO A;  1IHK A;  4QKR A;  1BLA A;  3B9U A;  3AJ6 A;  3AZV A;  3O4A A;  1KNM A;  3H6Q A;  3O3Q A;  4A7Y A;  3PG0 A;  5BOW A;  3MPP G;  5EG6 C;  1HWN B;  3V0B B;  3NBN A;  4P0J A;  1FN0 A;  2X2T A;  3POK A;  5FNX A;  5JMC A;  4Q9P A;  1Q03 A;  4I0Y A;  1FWV A;  2M49 A;  3IM7 A;  1IRA X;  4GP0 A;  3SNV A;  3BRF A;  4GP3 A;  1K5V A;  1NZK A;  4QBC A;  1DFQ A;  3H6R A;  1WBC A;  3AKH A;  3CU1 B;  3PUB A;  3I2A A;  4G1R A;  1IJT A;  2WRY A;  1HKN A;  3R4S A;  3HMY A;  1Z4S A;  4MZG B;  1EV2 A;  3HAL A;  4X3A A;  1IIL A;  1FMM S;  1JT7 A;  1HWO B;  1S0F A;  4PC4 A;  4OWJ A;  1BFC A;  3AH2 A;  4A7Z A;  2D1Z A;  3NBE A;  3WO3 A;  1AVX B;  4J2S A;  1ABR B;  5HPZ A;  1JQZ A;  4JP0 A;  5BXR A;  4IQP A;  4Q9G A;  4I4S A;  2VU9 A;  3D7W B;  2Y9F A;  2WBC A;  3HOM A;  3BA7 A;  4LO8 B;  2L5X A;  1K5U A;  5BXT A;  5FZZ A;  4I4U A;  3RTI B;  4ZLB B;  1BA7 A;  3C9Z A;  4LO1 C;  3CA6 A;  2E4M C;  1OQL B;  3IM6 A;  4QKS A;  4I4R A;  2D43 A;  1TTU A;  2VSA A;  1S0L A;  2NYY A;  3AH4 A;  2MIB A;  3OJM A;  3FJI A;  3FJJ A;  4ZA3 B;  1EPW A;  2Y9W C;  4OW4 A;  41BI A;  1V6V A;  2HWA A;  3O4O A;  2F2F C;  5B2H A;  1R8N A;  3AKF A;  3I2X A;  6I1B A;  4ZBV B;  2RST A;  4EB2 B;  1HWM B;  2Y9G A;  1BFB A;  2NZ9 A;  2FFU A;  4FVV A;  2R9K B;  3F1R A;  1W3F A;  3CA0 A;  4QD2 B;  1Q04 A;  3JRR A;  4WBC A;  3O4D A;  2AXM A;  1DLL A;  3CRH A;  3N7M A;  2X2S A;  3R4U A;  2YUG A;  2I1B A;  3WO4 A;  4H75 A;  3NJ5 A;  1AVA C;  2Q3N B;  4DEP A;  4EKX B;  3CA3 A;  4I1E A;  4MZF B;  3FGM A;  1HCD A;  1XYF A;  1S0E A;  2J3P A;  9ILB A;  1T9F A;  1FV2 A;  4Z8S B;  4JAW A;  2FDB M;  1JLX A;  3N7J A;  4GAF A;  4XKI A;  4G9M A;  3RTJ B;  3W9T A;  1II4 A;  1XHB A;  2NTD A;  2KH2 A;  3CAH A;  4P6A A;  1MC9 A;  4G6J A;  5DVH A;  3LTQ A;  1UPS A;  4XFU A;  4LO2 C;  3UD8 A;  4JPZ A;  2KI4 A;  4ISQ A;  3VSF A;  3O4B A;  2AFG A;  2ESU A;  3Q7X A;  2GO2 A;  2HZ9 A;  3CRI A;  4AN7 B;  5BP5 C;  1ISY A;  1J0S A;  3BA4 A;  3OJV A;  2K4A B;  3WIN C;  3JUT A;  1S0D A;  3FJE A;  3QYD A;  2ET2 A;  1R8O A;  4I4X A;  2QYI B;  2P23 A;  3HSM A;  4GOV A;  2RG9 B;  3AKI A;  2VUA A;  4JQ0 A;  4QD2 C;  3K1X A;  1M16 A;  3V0A A;  2BFH A;  4I4P A;  4I6I A;  1TP0 A;  1AVW B;  4IHZ A;  2D44 A;  2E4M A;  3A22 A;  3NBD A;  1DZD A;  2IWT B;  1XG6 A;  2HW9 A;  3A07 A;  4IZE A;  5F8Y A;  3FFZ A;  2XOA A;  3UD7 A;  4XFT A;  5DZU A;  3ZXG A;  1ISV A;  21BI A;  2NVH A;  3H6R B;  3AH1 A;  1WD3 A;  1AF9 A;  1F31 A;  2MC2 A;  4KEJ A;  1QXM A;  1ONK B;  5DSS B;  1ILR 1;  2F2F A;  4EFP A;  4F83 A;  3VUO A;  2QN4 A;  7I1B A;  3CA5 A;  1YF8 B;  2LIQ A;  2FGF A;  3BRD A;  2IHO A;  4QAL A;  4I4O A;  3FJK A;  4OWK A;  4H9W A;  4IY9 A;  1EYL A;  1BFG A;  5E24 E;  4X39 A;  3FJA A;  4ZFY B;  4J2Y A;  4ISR A;  2F8X C;  4Q91 A;  2KLL A;  3PHZ A;  3VEQ A;  4EFR A;  4I8M A;  3OGF A;  1PWA A;  3FJ9 A;  4USO A;  5I1B A;  1RY7 A;  3HN1 A;  4QC4 A;  3FJH A;  4LO0 C;  5BXP A;  4TLP A;  1ISZ A;  3OBR A;  3IM5 A;  3AZW A;  2AQZ A;  2UUS A;  1NUN A;  4LO2 A;  4J2K A;  4I37 A;  1I1E A;  4EFQ A;  31BI A;  3BX1 C;  1ITB A;  2D7I A;  3LLP A;  4DEN A;  3BRG C;  3VSZ A;  3UD9 A;  5BP5 A;  1DFC A;  4KC3 A;  1N4K A;  1Z2V A;  4X37 A;  1SR4 C;  4OEF A;  1JLY A;  2NM1 A;  3WIN A;  5F90 A;  3H6S E;  1FGA A;  1JT5 A;  1TIE A;  1PUM B;  4I7I A;  1AFC A;  4I4Y A;  4YOL A;  1S0G A;  3FJC A;  1BAR A;  4IYB A;  1GGP B;  1WBA A;  5BQU C;  5F8S A;  5GAQ A;  1WD4 A;  1FWU A;  2D23 A;  3P6J A;  3BAV A;  1IT0 A;  3OBT A;  1BFF A;  3UDA A;  3VT0 A;  8I1B A;  5FZU A;  4END A;  5BVP I;  3V79 C;  4H04 A;  3RMY A;  3CA1 A;  4XFS A;  5D61 A;  1VCL A;  3BAQ A;  2Z49 A;  2BEA A; 
#chains in the Genus database with same CATH homology
 2BEB A;  2P39 A;  1RZO B;  1V6W A;  1T4Q A;  1E0O A;  2Y9X E;  3IAG C;  3OJ2 A;  5F8W A;  3BAG A;  3P53 A;  3WA1 A;  3PME A;  2DRZ A;  5D63 A;  4FGF A;  4D0Z A;  1YXW A;  1MD6 A;  4JRA A;  1G9A A;  1Q1U A;  3V0B A;  1S0B A;  3BAH A;  1AVU A;  1AXM A;  4ZFU B;  4LO1 A;  4IY8 A;  1TOO A;  3VT2 A;  4AN6 A;  3V0A B;  1TWE A;  4LO0 A;  2ZQO A;  4HJJ A;  3S8J A;  1BAS A;  3UJ4 A;  1CVS A;  3TC2 A;  2ZQN A;  3AJ5 A;  2MLL B;  1DZC A;  1V6U A;  3FJF A;  3N0K A;  4ZKT B;  4D8H A;  4L4I A;  4LO3 C;  2K8R A;  3MAL A;  1BLD A;  3I29 B;  3AKG A;  3NBC A;  2NS2 A;  4EEE B;  3ZX7 A;  3CQA A;  1RML A;  3A21 A;  4HR6 C;  1SR4 A;  1A8D A;  4ION A;  2ERM A;  3FJ8 A;  4QBV A;  4I4V A;  3O5W B;  4MZH A;  4F34 A;  1IOB A;  4ZGR B;  1W3A A;  1D0H A;  1YBI A;  2Z48 A;  5D62 A;  2DRY A;  2VXR A;  4QO3 A;  1DQG A;  1Z0H A;  3BAU A;  2AAI B;  1JTC A;  2DRE A;  2ZR1 B;  4I96 A;  4JKX B;  4P0L A;  5EHA A;  2D20 A;  1JT4 A;  1PUU B;  3FJD A;  4LO7 B;  1TFM B;  2VLC A;  4ZOT A;  2FO1 A;  4J2X A;  5FNW A;  5BQU A;  1PZZ A;  3OGG A;  2D22 A;  4OWL A;  1L2H A;  3O4C A;  4Z9W B;  5G00 A;  2NP0 A;  2Q9X A;  3HBW A;  3BB2 A;  2GZB A;  3ZXD A;  5EC5 A;  1G9C A;  2DS0 A;  2KKI A;  3O44 A;  1HIB A;  3O49 A;  4R6U B;  1SZ6 B;  3FUQ A;  4I3N A;  1S0C A;  5FZY A;  4KBB A;  1EVT A;  1IRP A;  1I1B A;  2D7R A;  1YTO A;  3BAD A;  3E8L C;  1HWP B;  4HA2 A;  3BAO A;  1M2T B;  1HCE A;  4G9N A;  4I1B A;  5DUY A;  3EF2 A;  4D0T A;  1JT3 A;  3UJ0 A;  3ILA A;  3VT1 A;  1QQL A;  4UY4 A;  1FMZ A;  4GAI A;  5BXS A;  2FFV A;  1ISX A;  3IIR A;  4A7K A;  3N7L A;  1DJS B;  4ZFW B;  2RQ9 A;  1W3G A;  5JLV A;  1TWM A;  3P6I A;  3BA5 A;  3RMX A;  3BTA A;  4JKQ A;  1FV3 A;  4I2S A;  4L4H A;  1XZZ A;  3ZC8 A;  3ZC9 A;  3CRG A;  1CE7 B;  4KEK A;  2LIE A;  3Q7Y A;  1ISW A;  4CJM A;  4OEG A;  3FJB A;  4LO7 C;  3WMV A;  3RSJ A;  1DIW A;  2HWM A;  4GOY A;  4IZX A;  1G82 A;  1QQK A;  4G6M A;  4I4Q A;  1V6X A;  4LO3 A;  4OUJ A;  3WMU A;  1JY0 A;  4II0 A;  3N7K A;  3S8K A;  1RG8 A;  1DQO A;  1YYN A;  2KI6 B;  1G9B A;  2D24 A;  3T8S A;  4DCK C;  3Q7W A;  3KMV A;  3CA4 A;  2VXT I;  4J23 B;  3VWC A;  4X38 A;  2K43 A;  4USP A;  1G9D A;  3QR5 A;  1FQ9 A;  4OEE A;  3WO2 A;  1P63 A;  2VSE A;  3A23 A;  4KEI A;  3F62 B;  4P0K A;  1PC8 B;  3FUO A;  1IHK A;  4QKR A;  1BLA A;  3B9U A;  3AJ6 A;  3AZV A;  3O4A A;  1KNM A;  3H6Q A;  3O3Q A;  4A7Y A;  3PG0 A;  5BOW A;  3MPP G;  5EG6 C;  1HWN B;  3V0B B;  3NBN A;  4P0J A;  1FN0 A;  2X2T A;  3POK A;  5FNX A;  5JMC A;  4Q9P A;  1Q03 A;  4I0Y A;  1FWV A;  2M49 A;  3IM7 A;  1IRA X;  4GP0 A;  3SNV A;  3BRF A;  4GP3 A;  1K5V A;  1NZK A;  4QBC A;  1DFQ A;  3H6R A;  1WBC A;  3AKH A;  3CU1 B;  3PUB A;  3I2A A;  4G1R A;  1IJT A;  2WRY A;  1HKN A;  3R4S A;  3HMY A;  1Z4S A;  4MZG B;  1EV2 A;  3HAL A;  4X3A A;  1IIL A;  1FMM S;  1JT7 A;  1HWO B;  1S0F A;  4PC4 A;  4OWJ A;  1BFC A;  3AH2 A;  4A7Z A;  2D1Z A;  3NBE A;  3WO3 A;  1AVX B;  4J2S A;  1ABR B;  5HPZ A;  1JQZ A;  4JP0 A;  5BXR A;  4IQP A;  4Q9G A;  4I4S A;  2VU9 A;  3D7W B;  2Y9F A;  2WBC A;  3HOM A;  3BA7 A;  4LO8 B;  2L5X A;  1K5U A;  5BXT A;  5FZZ A;  4I4U A;  3RTI B;  4ZLB B;  1BA7 A;  3C9Z A;  4LO1 C;  3CA6 A;  2E4M C;  1OQL B;  3IM6 A;  4QKS A;  4I4R A;  2D43 A;  1TTU A;  2VSA A;  1S0L A;  2NYY A;  3AH4 A;  2MIB A;  3OJM A;  3FJI A;  3FJJ A;  4ZA3 B;  1EPW A;  2Y9W C;  4OW4 A;  41BI A;  1V6V A;  2HWA A;  3O4O A;  2F2F C;  5B2H A;  1R8N A;  3AKF A;  3I2X A;  6I1B A;  4ZBV B;  2RST A;  4EB2 B;  1HWM B;  2Y9G A;  1BFB A;  2NZ9 A;  2FFU A;  4FVV A;  2R9K B;  3F1R A;  1W3F A;  3CA0 A;  4QD2 B;  1Q04 A;  3JRR A;  4WBC A;  3O4D A;  2AXM A;  1DLL A;  3CRH A;  3N7M A;  2X2S A;  3R4U A;  2YUG A;  2I1B A;  3WO4 A;  4H75 A;  3NJ5 A;  1AVA C;  2Q3N B;  4DEP A;  4EKX B;  3CA3 A;  4I1E A;  4MZF B;  3FGM A;  1HCD A;  1XYF A;  1S0E A;  2J3P A;  9ILB A;  1T9F A;  1FV2 A;  4Z8S B;  4JAW A;  2FDB M;  1JLX A;  3N7J A;  4GAF A;  4XKI A;  4G9M A;  3RTJ B;  3W9T A;  1II4 A;  1XHB A;  2NTD A;  2KH2 A;  3CAH A;  4P6A A;  1MC9 A;  4G6J A;  5DVH A;  3LTQ A;  1UPS A;  4XFU A;  4LO2 C;  3UD8 A;  4JPZ A;  2KI4 A;  4ISQ A;  3VSF A;  3O4B A;  2AFG A;  2ESU A;  3Q7X A;  2GO2 A;  2HZ9 A;  3CRI A;  4AN7 B;  5BP5 C;  1ISY A;  1J0S A;  3BA4 A;  3OJV A;  2K4A B;  3WIN C;  3JUT A;  1S0D A;  3FJE A;  3QYD A;  2ET2 A;  1R8O A;  4I4X A;  2QYI B;  2P23 A;  3HSM A;  4GOV A;  2RG9 B;  3AKI A;  2VUA A;  4JQ0 A;  4QD2 C;  3K1X A;  1M16 A;  3V0A A;  2BFH A;  4I4P A;  4I6I A;  1TP0 A;  1AVW B;  4IHZ A;  2D44 A;  2E4M A;  3A22 A;  3NBD A;  1DZD A;  2IWT B;  1XG6 A;  2HW9 A;  3A07 A;  4IZE A;  5F8Y A;  3FFZ A;  2XOA A;  3UD7 A;  4XFT A;  5DZU A;  3ZXG A;  1ISV A;  21BI A;  2NVH A;  3H6R B;  3AH1 A;  1WD3 A;  1AF9 A;  1F31 A;  2MC2 A;  4KEJ A;  1QXM A;  1ONK B;  5DSS B;  1ILR 1;  2F2F A;  4EFP A;  4F83 A;  3VUO A;  2QN4 A;  7I1B A;  3CA5 A;  1YF8 B;  2LIQ A;  2FGF A;  3BRD A;  2IHO A;  4QAL A;  4I4O A;  3FJK A;  4OWK A;  4H9W A;  4IY9 A;  1EYL A;  1BFG A;  5E24 E;  4X39 A;  3FJA A;  4ZFY B;  4J2Y A;  4ISR A;  2F8X C;  4Q91 A;  2KLL A;  3PHZ A;  3VEQ A;  4EFR A;  4I8M A;  3OGF A;  1PWA A;  3FJ9 A;  4USO A;  5I1B A;  1RY7 A;  3HN1 A;  4QC4 A;  3FJH A;  4LO0 C;  5BXP A;  4TLP A;  1ISZ A;  3OBR A;  3IM5 A;  3AZW A;  2AQZ A;  2UUS A;  1NUN A;  4LO2 A;  4J2K A;  4I37 A;  1I1E A;  4EFQ A;  31BI A;  3BX1 C;  1ITB A;  2D7I A;  3LLP A;  4DEN A;  3BRG C;  3VSZ A;  3UD9 A;  5BP5 A;  1DFC A;  4KC3 A;  1N4K A;  1Z2V A;  4X37 A;  1SR4 C;  4OEF A;  1JLY A;  2NM1 A;  3WIN A;  5F90 A;  3H6S E;  1FGA A;  1JT5 A;  1TIE A;  1PUM B;  4I7I A;  1AFC A;  4I4Y A;  4YOL A;  1S0G A;  3FJC A;  1BAR A;  4IYB A;  1GGP B;  1WBA A;  5BQU C;  5F8S A;  5GAQ A;  1WD4 A;  1FWU A;  2D23 A;  3P6J A;  3BAV A;  1IT0 A;  3OBT A;  1BFF A;  3UDA A;  3VT0 A;  8I1B A;  5FZU A;  4END A;  5BVP I;  3V79 C;  4H04 A;  3RMY A;  3CA1 A;  4XFS A;  5D61 A;  1VCL A;  3BAQ A;  2Z49 A;  2BEA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...