4I4OA

Bel beta-trefoil apo crystal form 1
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
146
structure length
146
Chain Sequence
b'VNFPNIPAEGVQFRLRARDTGYVIYSRTENPPLVWQYNGPPYDDQLFTLIYGTGPRKNLYAIKSVPNGRVLFSRTSASPYVGNIAGDGTYNDNWFQFIQDDNDPNSFRIYNLASDTVLYSRTTADPKFGNFTGAKYDDQLWHFELV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BEL beta-trefoil
publication title BEL {beta}-trefoil: A novel lectin with antineoplastic properties in king bolete (Boletus edulis) mushrooms.
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 41
structure length 146
sequence length 146
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 4i4oA00
1PUMB 1IHKA 4QO3A 3BX1C 2MIBA 2X2TA 4J23B 2QYIB 5BVPI 5BOWA 1SR4C 2Q9XA 5FZUA 5BXSA 3A22A 3LLPA 4JP0A 3AKFA 4QC4A 1TFMB 3NBEA 4Z9WB 1IOBA 1IJTA 4LO3A 4EFQA 3T8SA 3IM5A 4R6UB 4X38A 1ISVA 1DQOA 3BADA 4D0TA 2K43A 2KH2A 4GOYA 3NJ5A 3O3QA 4LO2C 5HPZA 3E8LC 3BAGA 3BAQA 3H6SE 2BEAA 3IM6A 2ERMA 1FMZA 4I4PA 1PZZA 3AZVA 5DUYA 4I4SA 4ISRA 3ZC8A 1N4KA 3BA7A 2F2FC 3O4AA 2KLLA 2DRZA 3HN1A 4Q9GA 1TP0A 1S0CA 3CA5A 3FJHA 2LIQA 3WINC 3VT0A 1I1EA 4X37A 5D61A 4II0A 1T4QA 3PG0A 3FJKA 3WMVA 1OQLB 4OUJA 4QD2C 1DFQA 1TIEA 5B2HA 3C9ZA 3LTQA 4H04A 4ZBVB 3V79C 3KMVA 1FN0A 4DENA 1TTUA 1QXMA 3FJ9A 4I3NA 3FJ8A 1G9AA 3RMYA 3AJ5A 1EYLA 1TWEA 1BLDA 2NZ9A 3OBTA 4ZGRB 1G9CA 2D7IA 4WBCA 3BAHA 2FDBM 2AXMA 3RMXA 4GP3A 5FNXA 3HBWA 4LO0C 4EB2B 4KEJA 4OEFA 2KI6B 1BFFA 1EPWA 4HR6C 2D23A 3FJBA 1S0LA 5EC5A 2ET2A 5BP5C 2FO1A 2E4MC 4HA2A 2DS0A 2VXTI 3O44A 2VSEA 4H9WA 4G6MA 4L4HA 5BQUA 4I4UA 4OEEA 2R9KB 3CRHA 1BFCA 2J3PA 1XZZA 3OGFA 3NBCA 3AKIA 1HIBA 1XG6A 3WO3A 1JLXA 1S0FA 3O4CA 3CAHA 4A7ZA 2FGFA 1BARA 4G9NA 2NP0A 1YBIA 4LO1C 1WD3A 4I37A 4GOVA 3CRIA 2D44A 4F83A 1ISWA 3S8KA 1Q1UA 1YYNA 1JT3A 3FUQA 1QQLA 4JPZA 4LO7C 3AH2A 1HWNB 3NBNA 2F8XC 4ZA3B 2AQZA 1EV2A 3FJAA 1QQKA 2NM1A 3Q7YA 3POKA 1DIWA 3FJDA 4IONA 1ISZA 1IILA 4I1BA 4J2SA 1CE7B 4J2KA 2Y9FA 1IRPA 4Z8SB 3N7KA 3AZWA 4A7YA 3ILAA 3UD7A 3I29B 1R8OA 4KEIA 3OJ2A 4I4VA 8I1BA 1DJSB 1F31A 4GP0A 5JMCA 3H6RA 2YUGA 3WMUA 4OWKA 3H6RB 4QKRA 3MALA 3AKHA 2HWMA 4JQ0A 3W9TA 3IM7A 2MLLB 5DSSB 2FFUA 3AKGA 4I4RA 1J0SA 1EVTA 1HKNA 3FJCA 2WBCA 3RSJA 4QKSA 4FVVA 1II4A 3FFZA 3ZC9A 3CA1A 3R4SA 5I1BA 2HWAA 2Z48A 5FNWA 3WO4A 2VSAA 2LIEA 2BFHA 4IZXA 3HMYA 4I96A 1FGAA 1DZDA 1WD4A 3BAUA 3Q7WA 2HW9A 1AF9A 4GAFA 3WA1A 1FV2A 5F8WA 2VLCA 1Z2VA 2P23A 4ZLBB 3B9UA 1S0BA 1HWMB 2NYYA 31BIA 4IY9A 3N7LA 1YF8B 2VU9A 4X39A 2KI4A 1ILR1 5EHAA 1JT4A 1K5UA 3BRDA 2ESUA 2Y9XE 3A21A 4IHZA 2RG9B 1T9FA 3CU1B 3VT1A 4USPA 1HCEA 2Y9GA 4J2XA 4X3AA 1FV3A 5E24E 1ONKB 2IHOA 5D63A 3P6IA 1FWVA 1D0HA 2QN4A 1UPSA 1G9BA 4ENDA 3A23A 2Q3NB 1DFCA 4KBBA 4JRAA 4OWJA 3O4BA 1S0EA 3Q7XA 4KC3A 1W3GA 1YXWA 4IZEA 3UJ4A 1SR4A 4FGFA 3NBDA 1YTOA 4F34A 3UD9A 2ZQOA 4I4XA 3F62B 4D0ZA 3VUOA 3FJIA 4CJMA 2I1BA 1Q03A 1AVUA 9ILBA 4PC4A 1RY7A 4TLPA 1A8DA 4OWLA 3F1RA 1PUUB 2ZR1B 1BASA 2RSTA 1ABRB 4EFRA 2XOAA 4LO3C 2IWTB 2KKIA 1W3AA 2ZQNA 3BB2A 4G6JA 1K5VA 3ZX7A 1FQ9A 4QBCA 5DZUA 3PMEA 3UD8A 1JT5A 7I1BA 1FWUA 3V0AA 1AVXB 5FZYA 1Z0HA 3BAOA 3UJ0A 3CA6A 1PC8B 3FJFA 3V0AB 2D24A 2F2FA 4JAWA 2DRYA 1S0DA 2NTDA 3HSMA 4ZFYB 3CQAA 3HALA 2D22A 41BIA 3WINA 4QALA 1AXMA 2WRYA 2D7RA 1JQZA 4I2SA 3S8JA 1V6VA 1NUNA 4AN6A 3PHZA 3CA4A 5BXRA 1E0OA 4QD2B 4P0KA 4YOLA 4P6AA 1BLAA 2Z49A 1HCDA 2D20A 5DVHA 1L2HA 5BXTA 1W3FA 1PWAA 2AAIB 2K8RA 3OJVA 1BA7A 3UDAA 4GAIA 4QBVA 3FJJA 4I7IA 2L5XA 1S0GA 2HZ9A 3CA3A 2AFGA 4LO0A 5F8SA 3O49A 1AFCA 1RZOB 21BIA 1JY0A 3WO2A 3VSZA 1CVSA 1ISYA 1JTCA 2D43A 5JLVA 3V0BA 1ISXA 3N0KA 3RTJB 3BA4A 2K4AB 5BP5A 2E4MA 5EG6C 3V0BB 3OJMA 4JKQA 4G9MA 1MD6A 1WBAA 5G00A 2GZBA 5F90A 3RTIB 1WBCA 5BXPA 1M2TB 4XKIA 3VT2A 3JUTA 1JT7A 4DEPA 5BQUC 1BFGA 2Y9WC 2GO2A 4I1EA 3BAVA 1R8NA 3FGMA 4LO8B 4LO1A 1TOOA 3ZXDA 1JLYA 3D7WB 3FJEA 4EEEB 4P0JA 4IQPA 4Q9PA 3ZXGA 2NVHA 4ZFUB 1V6WA 3QR5A 3CRGA 4XFTA 3O5WB 5D62A 5GAQA 6I1BA 3AJ6A 4OEGA 2M49A 4LO7B 1KNMA 1AVWB 3BRFA 2D1ZA 2UUSA 4EFPA 1DLLA 4AN7B 1IRAX 3N7JA 4D8HA 1ITBA 3R4UA 4IY8A 4ZOTA 1DZCA 3I2XA 4XFUA 3MPPG 2BEBA 4ISQA 3BRGC 4G1RA 2X2SA 4EKXB 1IT0A 4L4IA 1HWOB 3A07A 4IYBA 3H6QA 3I2AA 1V6XA 5FZZA 1VCLA 3AH4A 1GGPB 1SZ6B 3QYDA 2MC2A 3TC2A 4P0LA 1XYFA 3OBRA 1HWPB 3IAGC 4I0YA 3O4OA 2VXRA 5F8YA 1AVAC 1RMLA 3BTAA 4I4QA 4LO2A 4USOA 3FUOA 1V6UA 4I6IA 3JRRA 1XHBA 1P63A 1BFBA 3VSFA 1G82A 4I4YA 1TWMA 1NZKA 3P6JA 2RQ9A 4A7KA 1I1BA 1FMMS 1Q04A 3K1XA 3AH1A 4ZFWB 3HOMA 4I4OA 2FFVA 4XFSA 2DREA 3PUBA 4Q91A 3N7MA 4OW4A 1DQGA 2P39A 3IIRA 4I8MA 3EF2A 3VEQA 3CA0A 1RG8A 3OGGA 1Z4SA 3P53A 3VWCA 4KEKA 1M16A 4HJJA 3BA5A 3SNVA 4DCKC 4JKXB 1MC9A 4ZKTB 4J2YA 3O4DA 1G9DA 2VUAA
chains in the Genus database with same CATH superfamily
1PUMB 1IHKA 4QO3A 3BX1C 2MIBA 2X2TA 4J23B 2QYIB 5BVPI 5BOWA 1SR4C 2Q9XA 5FZUA 5BXSA 3A22A 3LLPA 4JP0A 3AKFA 4QC4A 1TFMB 3NBEA 4Z9WB 1IOBA 1IJTA 4LO3A 4EFQA 3T8SA 3IM5A 4R6UB 4X38A 1ISVA 1DQOA 3BADA 4D0TA 2K43A 2KH2A 4GOYA 3NJ5A 3O3QA 4LO2C 5HPZA 3E8LC 3BAGA 3BAQA 3H6SE 2BEAA 3IM6A 2ERMA 1FMZA 4I4PA 1PZZA 3AZVA 5DUYA 4I4SA 4ISRA 3ZC8A 1N4KA 3BA7A 2F2FC 3O4AA 2KLLA 2DRZA 3HN1A 4Q9GA 1TP0A 1S0CA 3CA5A 3FJHA 2LIQA 3WINC 3VT0A 1I1EA 4X37A 5D61A 4II0A 1T4QA 3PG0A 3FJKA 3WMVA 1OQLB 4OUJA 4QD2C 1DFQA 1TIEA 5B2HA 3C9ZA 3LTQA 4H04A 4ZBVB 3V79C 3KMVA 1FN0A 4DENA 1TTUA 1QXMA 3FJ9A 4I3NA 3FJ8A 1G9AA 3RMYA 3AJ5A 1EYLA 1TWEA 1BLDA 2NZ9A 3OBTA 4ZGRB 1G9CA 2D7IA 4WBCA 3BAHA 2FDBM 2AXMA 3RMXA 4GP3A 5FNXA 3HBWA 4LO0C 4EB2B 4KEJA 4OEFA 2KI6B 1BFFA 1EPWA 4MZFB 4HR6C 2D23A 3FJBA 1S0LA 5EC5A 2ET2A 5BP5C 2FO1A 2E4MC 4HA2A 2DS0A 2VXTI 3O44A 2VSEA 4H9WA 4G6MA 4L4HA 5BQUA 4I4UA 4OEEA 2R9KB 3CRHA 1BFCA 2J3PA 1XZZA 3OGFA 3NBCA 3AKIA 1HIBA 1XG6A 3WO3A 1JLXA 1S0FA 3O4CA 3CAHA 4A7ZA 2FGFA 1BARA 4G9NA 2NP0A 1YBIA 4LO1C 1WD3A 4I37A 4GOVA 3CRIA 2D44A 4F83A 1ISWA 3S8KA 1Q1UA 1YYNA 1JT3A 3FUQA 1QQLA 4JPZA 4LO7C 3AH2A 1HWNB 3NBNA 2F8XC 4ZA3B 2AQZA 1EV2A 3FJAA 1QQKA 2NM1A 3Q7YA 3POKA 1DIWA 3FJDA 4IONA 1ISZA 1IILA 4I1BA 4J2SA 4UY4A 1CE7B 4J2KA 2Y9FA 1IRPA 4Z8SB 3N7KA 3AZWA 4A7YA 3ILAA 3UD7A 3I29B 1R8OA 4KEIA 3OJ2A 4I4VA 8I1BA 1DJSB 1F31A 4GP0A 5JMCA 3H6RA 2YUGA 3WMUA 4OWKA 3H6RB 4QKRA 3MALA 3AKHA 2HWMA 4JQ0A 3W9TA 3IM7A 2MLLB 5DSSB 2FFUA 3AKGA 4I4RA 1J0SA 1EVTA 1HKNA 3FJCA 2WBCA 3RSJA 4QKSA 4FVVA 1II4A 3FFZA 3ZC9A 3CA1A 3R4SA 5I1BA 2HWAA 2Z48A 5FNWA 3WO4A 2VSAA 2LIEA 2BFHA 4IZXA 3HMYA 4I96A 1FGAA 1DZDA 1WD4A 3BAUA 3Q7WA 2HW9A 1AF9A 4GAFA 3WA1A 1FV2A 5F8WA 2VLCA 1Z2VA 2P23A 4ZLBB 3B9UA 1S0BA 1HWMB 2NYYA 31BIA 4IY9A 3N7LA 1YF8B 2VU9A 4X39A 2KI4A 1ILR1 5EHAA 1JT4A 1K5UA 3BRDA 2ESUA 2Y9XE 3A21A 4IHZA 2RG9B 1T9FA 3CU1B 3VT1A 4USPA 1HCEA 2Y9GA 4J2XA 4X3AA 1FV3A 5E24E 1ONKB 2IHOA 4MZHA 5D63A 3P6IA 1FWVA 1D0HA 2QN4A 4MZGB 1UPSA 1G9BA 4ENDA 3A23A 2Q3NB 1DFCA 4KBBA 4JRAA 4OWJA 3O4BA 1S0EA 3Q7XA 4KC3A 1W3GA 1YXWA 4IZEA 3UJ4A 1SR4A 4FGFA 3NBDA 1YTOA 4F34A 3UD9A 2ZQOA 4I4XA 3F62B 4D0ZA 3VUOA 3FJIA 4CJMA 2I1BA 1Q03A 2NS2A 1AVUA 9ILBA 4PC4A 1RY7A 4TLPA 1A8DA 4OWLA 3F1RA 1PUUB 2ZR1B 1BASA 2RSTA 1ABRB 4EFRA 2XOAA 4LO3C 2IWTB 2KKIA 1W3AA 2ZQNA 3BB2A 4G6JA 1K5VA 3ZX7A 1FQ9A 4QBCA 5DZUA 3PMEA 3UD8A 1JT5A 7I1BA 1FWUA 3V0AA 1AVXB 5FZYA 1Z0HA 3BAOA 3UJ0A 3CA6A 1PC8B 3FJFA 3V0AB 2D24A 2F2FA 4JAWA 2DRYA 1S0DA 2NTDA 3HSMA 4ZFYB 3CQAA 3HALA 2D22A 41BIA 3WINA 4QALA 1AXMA 2WRYA 2D7RA 1JQZA 4I2SA 3S8JA 1V6VA 1NUNA 4AN6A 3PHZA 3CA4A 5BXRA 1E0OA 4QD2B 4P0KA 4YOLA 4P6AA 1BLAA 2Z49A 1HCDA 2D20A 5DVHA 1L2HA 5BXTA 1W3FA 1PWAA 2AAIB 2K8RA 3OJVA 1BA7A 3UDAA 4GAIA 4QBVA 3FJJA 4I7IA 2L5XA 1S0GA 2HZ9A 3CA3A 2AFGA 4LO0A 5F8SA 3O49A 1AFCA 1RZOB 21BIA 1JY0A 3WO2A 3VSZA 1CVSA 1ISYA 1JTCA 2D43A 5JLVA 3V0BA 1ISXA 3N0KA 3RTJB 3BA4A 2K4AB 5BP5A 2E4MA 5EG6C 3V0BB 3OJMA 4JKQA 4G9MA 1MD6A 1WBAA 5G00A 2GZBA 5F90A 3RTIB 1WBCA 5BXPA 1M2TB 4XKIA 3VT2A 3JUTA 1JT7A 4DEPA 5BQUC 1BFGA 2Y9WC 2GO2A 4I1EA 3BAVA 1R8NA 3FGMA 4LO8B 4LO1A 1TOOA 3ZXDA 1JLYA 3D7WB 3FJEA 4EEEB 4P0JA 4IQPA 4Q9PA 3ZXGA 2NVHA 4ZFUB 1V6WA 3QR5A 3CRGA 4XFTA 3O5WB 5D62A 5GAQA 6I1BA 3AJ6A 4OEGA 2M49A 4LO7B 1KNMA 1AVWB 3BRFA 2D1ZA 2UUSA 4EFPA 1DLLA 4AN7B 1IRAX 3N7JA 4D8HA 1ITBA 3R4UA 4IY8A 4ZOTA 1DZCA 3I2XA 4XFUA 3MPPG 2BEBA 4ISQA 3BRGC 4G1RA 2X2SA 4EKXB 1IT0A 4L4IA 1HWOB 3A07A 4IYBA 3H6QA 3I2AA 1V6XA 5FZZA 1VCLA 3AH4A 1GGPB 1SZ6B 3QYDA 2MC2A 3TC2A 4P0LA 1XYFA 3OBRA 1HWPB 3IAGC 4I0YA 3O4OA 2VXRA 5F8YA 1AVAC 1RMLA 3BTAA 4I4QA 4LO2A 4USOA 3FUOA 1V6UA 4I6IA 3JRRA 1XHBA 1P63A 1BFBA 3VSFA 1G82A 4I4YA 1TWMA 1NZKA 3P6JA 2RQ9A 4A7KA 1I1BA 1FMMS 1Q04A 3K1XA 3AH1A 4ZFWB 3HOMA 4I4OA 2FFVA 4XFSA 2DREA 3PUBA 4Q91A 3N7MA 4OW4A 1DQGA 2P39A 3IIRA 4I8MA 3EF2A 3VEQA 4H75A 3CA0A 1RG8A 3OGGA 1Z4SA 3P53A 3VWCA 4KEKA 1M16A 4HJJA 3BA5A 3SNVA 4DCKC 4JKXB 1MC9A 4ZKTB 4J2YA 3O4DA 1G9DA 2VUAA
chains in the Genus database with same CATH topology
1PUMB 1IHKA 4QO3A 3BX1C 2MIBA 2X2TA 4J23B 2QYIB 5BVPI 5BOWA 1SR4C 2Q9XA 5FZUA 5BXSA 3A22A 3LLPA 4JP0A 3AKFA 4QC4A 1TFMB 3NBEA 4Z9WB 1IOBA 1IJTA 4LO3A 4EFQA 3T8SA 3IM5A 4R6UB 4X38A 1ISVA 1DQOA 3BADA 4D0TA 2K43A 2KH2A 4GOYA 3NJ5A 3O3QA 4LO2C 5HPZA 3E8LC 3BAGA 3BAQA 3H6SE 2BEAA 3IM6A 2ERMA 1FMZA 4I4PA 1PZZA 3AZVA 5DUYA 4I4SA 4ISRA 3ZC8A 1N4KA 3BA7A 2F2FC 3O4AA 2KLLA 2DRZA 3HN1A 4Q9GA 1TP0A 1S0CA 3CA5A 3FJHA 2LIQA 3WINC 3VT0A 1I1EA 4X37A 5D61A 4II0A 1T4QA 3PG0A 3FJKA 3WMVA 1OQLB 4OUJA 4QD2C 1DFQA 1TIEA 5B2HA 3C9ZA 3LTQA 4H04A 4ZBVB 3V79C 3KMVA 1FN0A 4DENA 1TTUA 1QXMA 3FJ9A 4I3NA 3FJ8A 1G9AA 3RMYA 3AJ5A 1EYLA 1TWEA 1BLDA 2NZ9A 3OBTA 4ZGRB 1G9CA 2D7IA 4WBCA 3BAHA 2FDBM 2AXMA 3RMXA 4GP3A 5FNXA 3HBWA 4LO0C 4EB2B 4KEJA 4OEFA 2KI6B 1BFFA 1EPWA 4MZFB 4HR6C 2D23A 3FJBA 1S0LA 5EC5A 2ET2A 5BP5C 2FO1A 2E4MC 4HA2A 2DS0A 2VXTI 3O44A 2VSEA 4H9WA 4G6MA 4L4HA 5BQUA 4I4UA 4OEEA 2R9KB 3CRHA 1BFCA 2J3PA 1XZZA 3OGFA 3NBCA 3AKIA 1HIBA 1XG6A 3WO3A 1JLXA 1S0FA 3O4CA 3CAHA 4A7ZA 2FGFA 1BARA 4G9NA 2NP0A 1YBIA 4LO1C 1WD3A 4I37A 4GOVA 3CRIA 2D44A 4F83A 1ISWA 3S8KA 1Q1UA 1YYNA 1JT3A 3FUQA 1QQLA 4JPZA 4LO7C 3AH2A 1HWNB 3NBNA 2F8XC 4ZA3B 2AQZA 1EV2A 3FJAA 1QQKA 2NM1A 3Q7YA 3POKA 1DIWA 3FJDA 4IONA 1ISZA 1IILA 4I1BA 4J2SA 4UY4A 1CE7B 4J2KA 2Y9FA 1IRPA 4Z8SB 3N7KA 3AZWA 4A7YA 3ILAA 3UD7A 3I29B 1R8OA 4KEIA 3OJ2A 4I4VA 8I1BA 1DJSB 1F31A 4GP0A 5JMCA 3H6RA 2YUGA 3WMUA 4OWKA 3H6RB 4QKRA 3MALA 3AKHA 2HWMA 4JQ0A 3W9TA 3IM7A 2MLLB 5DSSB 2FFUA 3AKGA 4I4RA 1J0SA 1EVTA 1HKNA 3FJCA 2WBCA 3RSJA 4QKSA 4FVVA 1II4A 3FFZA 3ZC9A 3CA1A 3R4SA 5I1BA 2HWAA 2Z48A 5FNWA 3WO4A 2VSAA 2LIEA 2BFHA 4IZXA 3HMYA 4I96A 1FGAA 1DZDA 1WD4A 3BAUA 3Q7WA 2HW9A 1AF9A 4GAFA 3WA1A 1FV2A 5F8WA 2VLCA 1Z2VA 2P23A 4ZLBB 3B9UA 1S0BA 1HWMB 2NYYA 31BIA 4IY9A 3N7LA 1YF8B 2VU9A 4X39A 2KI4A 1ILR1 5EHAA 1JT4A 1K5UA 3BRDA 2ESUA 2Y9XE 3A21A 4IHZA 2RG9B 1T9FA 3CU1B 3VT1A 4USPA 1HCEA 2Y9GA 4J2XA 4X3AA 1FV3A 5E24E 1ONKB 2IHOA 4MZHA 5D63A 3P6IA 1FWVA 1D0HA 2QN4A 4MZGB 1UPSA 1G9BA 4ENDA 3A23A 2Q3NB 1DFCA 4KBBA 4JRAA 4OWJA 3O4BA 1S0EA 3Q7XA 4KC3A 1W3GA 1YXWA 4IZEA 3UJ4A 1SR4A 4FGFA 3NBDA 1YTOA 4F34A 3UD9A 2ZQOA 4I4XA 3F62B 4D0ZA 3VUOA 3FJIA 4CJMA 2I1BA 1Q03A 2NS2A 1AVUA 9ILBA 4PC4A 1RY7A 4TLPA 1A8DA 4OWLA 3F1RA 1PUUB 2ZR1B 1BASA 2RSTA 1ABRB 4EFRA 2XOAA 4LO3C 2IWTB 2KKIA 1W3AA 2ZQNA 3BB2A 4G6JA 1K5VA 3ZX7A 1FQ9A 4QBCA 5DZUA 3PMEA 3UD8A 1JT5A 7I1BA 1FWUA 3V0AA 1AVXB 5FZYA 1Z0HA 3BAOA 3UJ0A 3CA6A 1PC8B 3FJFA 3V0AB 2D24A 2F2FA 4JAWA 2DRYA 1S0DA 2NTDA 3HSMA 4ZFYB 3CQAA 3HALA 2D22A 41BIA 3WINA 4QALA 1AXMA 2WRYA 2D7RA 1JQZA 4I2SA 3S8JA 1V6VA 1NUNA 4AN6A 3PHZA 3CA4A 5BXRA 1E0OA 4QD2B 4P0KA 4YOLA 4P6AA 1BLAA 2Z49A 1HCDA 2D20A 5DVHA 1L2HA 5BXTA 1W3FA 1PWAA 2AAIB 2K8RA 3OJVA 1BA7A 3UDAA 4GAIA 4QBVA 3FJJA 4I7IA 2L5XA 1S0GA 2HZ9A 3CA3A 2AFGA 4LO0A 5F8SA 3O49A 1AFCA 1RZOB 21BIA 1JY0A 3WO2A 3VSZA 1CVSA 1ISYA 1JTCA 2D43A 5JLVA 3V0BA 1ISXA 3N0KA 3RTJB 3BA4A 2K4AB 5BP5A 2E4MA 5EG6C 3V0BB 3OJMA 4JKQA 4G9MA 1MD6A 1WBAA 5G00A 2GZBA 5F90A 3RTIB 1WBCA 5BXPA 1M2TB 4XKIA 3VT2A 3JUTA 1JT7A 4DEPA 5BQUC 1BFGA 2Y9WC 2GO2A 4I1EA 3BAVA 1R8NA 3FGMA 4LO8B 4LO1A 1TOOA 3ZXDA 1JLYA 3D7WB 3FJEA 4EEEB 4P0JA 4IQPA 4Q9PA 3ZXGA 2NVHA 4ZFUB 1V6WA 3QR5A 3CRGA 4XFTA 3O5WB 5D62A 5GAQA 6I1BA 3AJ6A 4OEGA 2M49A 4LO7B 1KNMA 1AVWB 3BRFA 2D1ZA 2UUSA 4EFPA 1DLLA 4AN7B 1IRAX 3N7JA 4D8HA 1ITBA 3R4UA 4IY8A 4ZOTA 1DZCA 3I2XA 4XFUA 3MPPG 2BEBA 4ISQA 3BRGC 4G1RA 2X2SA 4EKXB 1IT0A 4L4IA 1HWOB 3A07A 4IYBA 3H6QA 3I2AA 1V6XA 5FZZA 1VCLA 3AH4A 1GGPB 1SZ6B 3QYDA 2MC2A 3TC2A 4P0LA 1XYFA 3OBRA 1HWPB 3IAGC 4I0YA 3O4OA 2VXRA 5F8YA 1AVAC 1RMLA 3BTAA 4I4QA 4LO2A 4USOA 3FUOA 1V6UA 4I6IA 3JRRA 1XHBA 1P63A 1BFBA 3VSFA 1G82A 4I4YA 1TWMA 1NZKA 3P6JA 2RQ9A 4A7KA 1I1BA 1FMMS 1Q04A 3K1XA 3AH1A 4ZFWB 3HOMA 4I4OA 2FFVA 4XFSA 2DREA 3PUBA 4Q91A 3N7MA 4OW4A 1DQGA 2P39A 3IIRA 4I8MA 3EF2A 3VEQA 4H75A 3CA0A 1RG8A 3OGGA 1Z4SA 3P53A 3VWCA 4KEKA 1M16A 4HJJA 3BA5A 3SNVA 4DCKC 4JKXB 1MC9A 4ZKTB 4J2YA 3O4DA 1G9DA 2VUAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PUM B;  1IHK A;  4QO3 A;  3BX1 C;  2MIB A;  2X2T A;  4J23 B;  2QYI B;  5BVP I;  5BOW A;  1SR4 C;  2Q9X A;  5FZU A;  5BXS A;  3A22 A;  3LLP A;  4JP0 A;  3AKF A;  4QC4 A;  1TFM B;  3NBE A;  4Z9W B;  1IOB A;  1IJT A;  4LO3 A;  4EFQ A;  3T8S A;  3IM5 A;  4R6U B;  4X38 A;  1ISV A;  1DQO A;  3BAD A;  4D0T A;  2K43 A;  2KH2 A;  4GOY A;  3NJ5 A;  3O3Q A;  4LO2 C;  5HPZ A;  3E8L C;  3BAG A;  3BAQ A;  3H6S E;  2BEA A;  3IM6 A;  2ERM A;  1FMZ A;  4I4P A;  1PZZ A;  3AZV A;  5DUY A;  4I4S A;  4ISR A;  3ZC8 A;  1N4K A;  3BA7 A;  2F2F C;  3O4A A;  2KLL A;  2DRZ A;  3HN1 A;  4Q9G A;  1TP0 A;  1S0C A;  3CA5 A;  3FJH A;  2LIQ A;  3WIN C;  3VT0 A;  1I1E A;  4X37 A;  5D61 A;  4II0 A;  1T4Q A;  3PG0 A;  3FJK A;  3WMV A;  1OQL B;  4OUJ A;  4QD2 C;  1DFQ A;  1TIE A;  5B2H A;  3C9Z A;  3LTQ A;  4H04 A;  4ZBV B;  3V79 C;  3KMV A;  1FN0 A;  4DEN A;  1TTU A;  1QXM A;  3FJ9 A;  4I3N A;  3FJ8 A;  1G9A A;  3RMY A;  3AJ5 A;  1EYL A;  1TWE A;  1BLD A;  2NZ9 A;  3OBT A;  4ZGR B;  1G9C A;  2D7I A;  4WBC A;  3BAH A;  2FDB M;  2AXM A;  3RMX A;  4GP3 A;  5FNX A;  3HBW A;  4LO0 C;  4EB2 B;  4KEJ A;  4OEF A;  2KI6 B;  1BFF A;  1EPW A;  4HR6 C;  2D23 A;  3FJB A;  1S0L A;  5EC5 A;  2ET2 A;  5BP5 C;  2FO1 A;  2E4M C;  4HA2 A;  2DS0 A;  2VXT I;  3O44 A;  2VSE A;  4H9W A;  4G6M A;  4L4H A;  5BQU A;  4I4U A;  4OEE A;  2R9K B;  3CRH A;  1BFC A;  2J3P A;  1XZZ A;  3OGF A;  3NBC A;  3AKI A;  1HIB A;  1XG6 A;  3WO3 A;  1JLX A;  1S0F A;  3O4C A;  3CAH A;  4A7Z A;  2FGF A;  1BAR A;  4G9N A;  2NP0 A;  1YBI A;  4LO1 C;  1WD3 A;  4I37 A;  4GOV A;  3CRI A;  2D44 A;  4F83 A;  1ISW A;  3S8K A;  1Q1U A;  1YYN A;  1JT3 A;  3FUQ A;  1QQL A;  4JPZ A;  4LO7 C;  3AH2 A;  1HWN B;  3NBN A;  2F8X C;  4ZA3 B;  2AQZ A;  1EV2 A;  3FJA A;  1QQK A;  2NM1 A;  3Q7Y A;  3POK A;  1DIW A;  3FJD A;  4ION A;  1ISZ A;  1IIL A;  4I1B A;  4J2S A;  1CE7 B;  4J2K A;  2Y9F A;  1IRP A;  4Z8S B;  3N7K A;  3AZW A;  4A7Y A;  3ILA A;  3UD7 A;  3I29 B;  1R8O A;  4KEI A;  3OJ2 A;  4I4V A;  8I1B A;  1DJS B;  1F31 A;  4GP0 A;  5JMC A;  3H6R A;  2YUG A;  3WMU A;  4OWK A;  3H6R B;  4QKR A;  3MAL A;  3AKH A;  2HWM A;  4JQ0 A;  3W9T A;  3IM7 A;  2MLL B;  5DSS B;  2FFU A;  3AKG A;  4I4R A;  1J0S A;  1EVT A;  1HKN A;  3FJC A;  2WBC A;  3RSJ A;  4QKS A;  4FVV A;  1II4 A;  3FFZ A;  3ZC9 A;  3CA1 A;  3R4S A;  5I1B A;  2HWA A;  2Z48 A;  5FNW A;  3WO4 A;  2VSA A;  2LIE A;  2BFH A;  4IZX A;  3HMY A;  4I96 A;  1FGA A;  1DZD A;  1WD4 A;  3BAU A;  3Q7W A;  2HW9 A;  1AF9 A;  4GAF A;  3WA1 A;  1FV2 A;  5F8W A;  2VLC A;  1Z2V A;  2P23 A;  4ZLB B;  3B9U A;  1S0B A;  1HWM B;  2NYY A;  31BI A;  4IY9 A;  3N7L A;  1YF8 B;  2VU9 A;  4X39 A;  2KI4 A;  1ILR 1;  5EHA A;  1JT4 A;  1K5U A;  3BRD A;  2ESU A;  2Y9X E;  3A21 A;  4IHZ A;  2RG9 B;  1T9F A;  3CU1 B;  3VT1 A;  4USP A;  1HCE A;  2Y9G A;  4J2X A;  4X3A A;  1FV3 A;  5E24 E;  1ONK B;  2IHO A;  5D63 A;  3P6I A;  1FWV A;  1D0H A;  2QN4 A;  1UPS A;  1G9B A;  4END A;  3A23 A;  2Q3N B;  1DFC A;  4KBB A;  4JRA A;  4OWJ A;  3O4B A;  1S0E A;  3Q7X A;  4KC3 A;  1W3G A;  1YXW A;  4IZE A;  3UJ4 A;  1SR4 A;  4FGF A;  3NBD A;  1YTO A;  4F34 A;  3UD9 A;  2ZQO A;  4I4X A;  3F62 B;  4D0Z A;  3VUO A;  3FJI A;  4CJM A;  2I1B A;  1Q03 A;  1AVU A;  9ILB A;  4PC4 A;  1RY7 A;  4TLP A;  1A8D A;  4OWL A;  3F1R A;  1PUU B;  2ZR1 B;  1BAS A;  2RST A;  1ABR B;  4EFR A;  2XOA A;  4LO3 C;  2IWT B;  2KKI A;  1W3A A;  2ZQN A;  3BB2 A;  4G6J A;  1K5V A;  3ZX7 A;  1FQ9 A;  4QBC A;  5DZU A;  3PME A;  3UD8 A;  1JT5 A;  7I1B A;  1FWU A;  3V0A A;  1AVX B;  5FZY A;  1Z0H A;  3BAO A;  3UJ0 A;  3CA6 A;  1PC8 B;  3FJF A;  3V0A B;  2D24 A;  2F2F A;  4JAW A;  2DRY A;  1S0D A;  2NTD A;  3HSM A;  4ZFY B;  3CQA A;  3HAL A;  2D22 A;  41BI A;  3WIN A;  4QAL A;  1AXM A;  2WRY A;  2D7R A;  1JQZ A;  4I2S A;  3S8J A;  1V6V A;  1NUN A;  4AN6 A;  3PHZ A;  3CA4 A;  5BXR A;  1E0O A;  4QD2 B;  4P0K A;  4YOL A;  4P6A A;  1BLA A;  2Z49 A;  1HCD A;  2D20 A;  5DVH A;  1L2H A;  5BXT A;  1W3F A;  1PWA A;  2AAI B;  2K8R A;  3OJV A;  1BA7 A;  3UDA A;  4GAI A;  4QBV A;  3FJJ A;  4I7I A;  2L5X A;  1S0G A;  2HZ9 A;  3CA3 A;  2AFG A;  4LO0 A;  5F8S A;  3O49 A;  1AFC A;  1RZO B;  21BI A;  1JY0 A;  3WO2 A;  3VSZ A;  1CVS A;  1ISY A;  1JTC A;  2D43 A;  5JLV A;  3V0B A;  1ISX A;  3N0K A;  3RTJ B;  3BA4 A;  2K4A B;  5BP5 A;  2E4M A;  5EG6 C;  3V0B B;  3OJM A;  4JKQ A;  4G9M A;  1MD6 A;  1WBA A;  5G00 A;  2GZB A;  5F90 A;  3RTI B;  1WBC A;  5BXP A;  1M2T B;  4XKI A;  3VT2 A;  3JUT A;  1JT7 A;  4DEP A;  5BQU C;  1BFG A;  2Y9W C;  2GO2 A;  4I1E A;  3BAV A;  1R8N A;  3FGM A;  4LO8 B;  4LO1 A;  1TOO A;  3ZXD A;  1JLY A;  3D7W B;  3FJE A;  4EEE B;  4P0J A;  4IQP A;  4Q9P A;  3ZXG A;  2NVH A;  4ZFU B;  1V6W A;  3QR5 A;  3CRG A;  4XFT A;  3O5W B;  5D62 A;  5GAQ A;  6I1B A;  3AJ6 A;  4OEG A;  2M49 A;  4LO7 B;  1KNM A;  1AVW B;  3BRF A;  2D1Z A;  2UUS A;  4EFP A;  1DLL A;  4AN7 B;  1IRA X;  3N7J A;  4D8H A;  1ITB A;  3R4U A;  4IY8 A;  4ZOT A;  1DZC A;  3I2X A;  4XFU A;  3MPP G;  2BEB A;  4ISQ A;  3BRG C;  4G1R A;  2X2S A;  4EKX B;  1IT0 A;  4L4I A;  1HWO B;  3A07 A;  4IYB A;  3H6Q A;  3I2A A;  1V6X A;  5FZZ A;  1VCL A;  3AH4 A;  1GGP B;  1SZ6 B;  3QYD A;  2MC2 A;  3TC2 A;  4P0L A;  1XYF A;  3OBR A;  1HWP B;  3IAG C;  4I0Y A;  3O4O A;  2VXR A;  5F8Y A;  1AVA C;  1RML A;  3BTA A;  4I4Q A;  4LO2 A;  4USO A;  3FUO A;  1V6U A;  4I6I A;  3JRR A;  1XHB A;  1P63 A;  1BFB A;  3VSF A;  1G82 A;  4I4Y A;  1TWM A;  1NZK A;  3P6J A;  2RQ9 A;  4A7K A;  1I1B A;  1FMM S;  1Q04 A;  3K1X A;  3AH1 A;  4ZFW B;  3HOM A;  4I4O A;  2FFV A;  4XFS A;  2DRE A;  3PUB A;  4Q91 A;  3N7M A;  4OW4 A;  1DQG A;  2P39 A;  3IIR A;  4I8M A;  3EF2 A;  3VEQ A;  3CA0 A;  1RG8 A;  3OGG A;  1Z4S A;  3P53 A;  3VWC A;  4KEK A;  1M16 A;  4HJJ A;  3BA5 A;  3SNV A;  4DCK C;  4JKX B;  1MC9 A;  4ZKT B;  4J2Y A;  3O4D A;  1G9D A;  2VUA A; 
#chains in the Genus database with same CATH topology
 1PUM B;  1IHK A;  4QO3 A;  3BX1 C;  2MIB A;  2X2T A;  4J23 B;  2QYI B;  5BVP I;  5BOW A;  1SR4 C;  2Q9X A;  5FZU A;  5BXS A;  3A22 A;  3LLP A;  4JP0 A;  3AKF A;  4QC4 A;  1TFM B;  3NBE A;  4Z9W B;  1IOB A;  1IJT A;  4LO3 A;  4EFQ A;  3T8S A;  3IM5 A;  4R6U B;  4X38 A;  1ISV A;  1DQO A;  3BAD A;  4D0T A;  2K43 A;  2KH2 A;  4GOY A;  3NJ5 A;  3O3Q A;  4LO2 C;  5HPZ A;  3E8L C;  3BAG A;  3BAQ A;  3H6S E;  2BEA A;  3IM6 A;  2ERM A;  1FMZ A;  4I4P A;  1PZZ A;  3AZV A;  5DUY A;  4I4S A;  4ISR A;  3ZC8 A;  1N4K A;  3BA7 A;  2F2F C;  3O4A A;  2KLL A;  2DRZ A;  3HN1 A;  4Q9G A;  1TP0 A;  1S0C A;  3CA5 A;  3FJH A;  2LIQ A;  3WIN C;  3VT0 A;  1I1E A;  4X37 A;  5D61 A;  4II0 A;  1T4Q A;  3PG0 A;  3FJK A;  3WMV A;  1OQL B;  4OUJ A;  4QD2 C;  1DFQ A;  1TIE A;  5B2H A;  3C9Z A;  3LTQ A;  4H04 A;  4ZBV B;  3V79 C;  3KMV A;  1FN0 A;  4DEN A;  1TTU A;  1QXM A;  3FJ9 A;  4I3N A;  3FJ8 A;  1G9A A;  3RMY A;  3AJ5 A;  1EYL A;  1TWE A;  1BLD A;  2NZ9 A;  3OBT A;  4ZGR B;  1G9C A;  2D7I A;  4WBC A;  3BAH A;  2FDB M;  2AXM A;  3RMX A;  4GP3 A;  5FNX A;  3HBW A;  4LO0 C;  4EB2 B;  4KEJ A;  4OEF A;  2KI6 B;  1BFF A;  1EPW A;  4MZF B;  4HR6 C;  2D23 A;  3FJB A;  1S0L A;  5EC5 A;  2ET2 A;  5BP5 C;  2FO1 A;  2E4M C;  4HA2 A;  2DS0 A;  2VXT I;  3O44 A;  2VSE A;  4H9W A;  4G6M A;  4L4H A;  5BQU A;  4I4U A;  4OEE A;  2R9K B;  3CRH A;  1BFC A;  2J3P A;  1XZZ A;  3OGF A;  3NBC A;  3AKI A;  1HIB A;  1XG6 A;  3WO3 A;  1JLX A;  1S0F A;  3O4C A;  3CAH A;  4A7Z A;  2FGF A;  1BAR A;  4G9N A;  2NP0 A;  1YBI A;  4LO1 C;  1WD3 A;  4I37 A;  4GOV A;  3CRI A;  2D44 A;  4F83 A;  1ISW A;  3S8K A;  1Q1U A;  1YYN A;  1JT3 A;  3FUQ A;  1QQL A;  4JPZ A;  4LO7 C;  3AH2 A;  1HWN B;  3NBN A;  2F8X C;  4ZA3 B;  2AQZ A;  1EV2 A;  3FJA A;  1QQK A;  2NM1 A;  3Q7Y A;  3POK A;  1DIW A;  3FJD A;  4ION A;  1ISZ A;  1IIL A;  4I1B A;  4J2S A;  4UY4 A;  1CE7 B;  4J2K A;  2Y9F A;  1IRP A;  4Z8S B;  3N7K A;  3AZW A;  4A7Y A;  3ILA A;  3UD7 A;  3I29 B;  1R8O A;  4KEI A;  3OJ2 A;  4I4V A;  8I1B A;  1DJS B;  1F31 A;  4GP0 A;  5JMC A;  3H6R A;  2YUG A;  3WMU A;  4OWK A;  3H6R B;  4QKR A;  3MAL A;  3AKH A;  2HWM A;  4JQ0 A;  3W9T A;  3IM7 A;  2MLL B;  5DSS B;  2FFU A;  3AKG A;  4I4R A;  1J0S A;  1EVT A;  1HKN A;  3FJC A;  2WBC A;  3RSJ A;  4QKS A;  4FVV A;  1II4 A;  3FFZ A;  3ZC9 A;  3CA1 A;  3R4S A;  5I1B A;  2HWA A;  2Z48 A;  5FNW A;  3WO4 A;  2VSA A;  2LIE A;  2BFH A;  4IZX A;  3HMY A;  4I96 A;  1FGA A;  1DZD A;  1WD4 A;  3BAU A;  3Q7W A;  2HW9 A;  1AF9 A;  4GAF A;  3WA1 A;  1FV2 A;  5F8W A;  2VLC A;  1Z2V A;  2P23 A;  4ZLB B;  3B9U A;  1S0B A;  1HWM B;  2NYY A;  31BI A;  4IY9 A;  3N7L A;  1YF8 B;  2VU9 A;  4X39 A;  2KI4 A;  1ILR 1;  5EHA A;  1JT4 A;  1K5U A;  3BRD A;  2ESU A;  2Y9X E;  3A21 A;  4IHZ A;  2RG9 B;  1T9F A;  3CU1 B;  3VT1 A;  4USP A;  1HCE A;  2Y9G A;  4J2X A;  4X3A A;  1FV3 A;  5E24 E;  1ONK B;  2IHO A;  4MZH A;  5D63 A;  3P6I A;  1FWV A;  1D0H A;  2QN4 A;  4MZG B;  1UPS A;  1G9B A;  4END A;  3A23 A;  2Q3N B;  1DFC A;  4KBB A;  4JRA A;  4OWJ A;  3O4B A;  1S0E A;  3Q7X A;  4KC3 A;  1W3G A;  1YXW A;  4IZE A;  3UJ4 A;  1SR4 A;  4FGF A;  3NBD A;  1YTO A;  4F34 A;  3UD9 A;  2ZQO A;  4I4X A;  3F62 B;  4D0Z A;  3VUO A;  3FJI A;  4CJM A;  2I1B A;  1Q03 A;  2NS2 A;  1AVU A;  9ILB A;  4PC4 A;  1RY7 A;  4TLP A;  1A8D A;  4OWL A;  3F1R A;  1PUU B;  2ZR1 B;  1BAS A;  2RST A;  1ABR B;  4EFR A;  2XOA A;  4LO3 C;  2IWT B;  2KKI A;  1W3A A;  2ZQN A;  3BB2 A;  4G6J A;  1K5V A;  3ZX7 A;  1FQ9 A;  4QBC A;  5DZU A;  3PME A;  3UD8 A;  1JT5 A;  7I1B A;  1FWU A;  3V0A A;  1AVX B;  5FZY A;  1Z0H A;  3BAO A;  3UJ0 A;  3CA6 A;  1PC8 B;  3FJF A;  3V0A B;  2D24 A;  2F2F A;  4JAW A;  2DRY A;  1S0D A;  2NTD A;  3HSM A;  4ZFY B;  3CQA A;  3HAL A;  2D22 A;  41BI A;  3WIN A;  4QAL A;  1AXM A;  2WRY A;  2D7R A;  1JQZ A;  4I2S A;  3S8J A;  1V6V A;  1NUN A;  4AN6 A;  3PHZ A;  3CA4 A;  5BXR A;  1E0O A;  4QD2 B;  4P0K A;  4YOL A;  4P6A A;  1BLA A;  2Z49 A;  1HCD A;  2D20 A;  5DVH A;  1L2H A;  5BXT A;  1W3F A;  1PWA A;  2AAI B;  2K8R A;  3OJV A;  1BA7 A;  3UDA A;  4GAI A;  4QBV A;  3FJJ A;  4I7I A;  2L5X A;  1S0G A;  2HZ9 A;  3CA3 A;  2AFG A;  4LO0 A;  5F8S A;  3O49 A;  1AFC A;  1RZO B;  21BI A;  1JY0 A;  3WO2 A;  3VSZ A;  1CVS A;  1ISY A;  1JTC A;  2D43 A;  5JLV A;  3V0B A;  1ISX A;  3N0K A;  3RTJ B;  3BA4 A;  2K4A B;  5BP5 A;  2E4M A;  5EG6 C;  3V0B B;  3OJM A;  4JKQ A;  4G9M A;  1MD6 A;  1WBA A;  5G00 A;  2GZB A;  5F90 A;  3RTI B;  1WBC A;  5BXP A;  1M2T B;  4XKI A;  3VT2 A;  3JUT A;  1JT7 A;  4DEP A;  5BQU C;  1BFG A;  2Y9W C;  2GO2 A;  4I1E A;  3BAV A;  1R8N A;  3FGM A;  4LO8 B;  4LO1 A;  1TOO A;  3ZXD A;  1JLY A;  3D7W B;  3FJE A;  4EEE B;  4P0J A;  4IQP A;  4Q9P A;  3ZXG A;  2NVH A;  4ZFU B;  1V6W A;  3QR5 A;  3CRG A;  4XFT A;  3O5W B;  5D62 A;  5GAQ A;  6I1B A;  3AJ6 A;  4OEG A;  2M49 A;  4LO7 B;  1KNM A;  1AVW B;  3BRF A;  2D1Z A;  2UUS A;  4EFP A;  1DLL A;  4AN7 B;  1IRA X;  3N7J A;  4D8H A;  1ITB A;  3R4U A;  4IY8 A;  4ZOT A;  1DZC A;  3I2X A;  4XFU A;  3MPP G;  2BEB A;  4ISQ A;  3BRG C;  4G1R A;  2X2S A;  4EKX B;  1IT0 A;  4L4I A;  1HWO B;  3A07 A;  4IYB A;  3H6Q A;  3I2A A;  1V6X A;  5FZZ A;  1VCL A;  3AH4 A;  1GGP B;  1SZ6 B;  3QYD A;  2MC2 A;  3TC2 A;  4P0L A;  1XYF A;  3OBR A;  1HWP B;  3IAG C;  4I0Y A;  3O4O A;  2VXR A;  5F8Y A;  1AVA C;  1RML A;  3BTA A;  4I4Q A;  4LO2 A;  4USO A;  3FUO A;  1V6U A;  4I6I A;  3JRR A;  1XHB A;  1P63 A;  1BFB A;  3VSF A;  1G82 A;  4I4Y A;  1TWM A;  1NZK A;  3P6J A;  2RQ9 A;  4A7K A;  1I1B A;  1FMM S;  1Q04 A;  3K1X A;  3AH1 A;  4ZFW B;  3HOM A;  4I4O A;  2FFV A;  4XFS A;  2DRE A;  3PUB A;  4Q91 A;  3N7M A;  4OW4 A;  1DQG A;  2P39 A;  3IIR A;  4I8M A;  3EF2 A;  3VEQ A;  4H75 A;  3CA0 A;  1RG8 A;  3OGG A;  1Z4S A;  3P53 A;  3VWC A;  4KEK A;  1M16 A;  4HJJ A;  3BA5 A;  3SNV A;  4DCK C;  4JKX B;  1MC9 A;  4ZKT B;  4J2Y A;  3O4D A;  1G9D A;  2VUA A; 
#chains in the Genus database with same CATH homology
 1PUM B;  1IHK A;  4QO3 A;  3BX1 C;  2MIB A;  2X2T A;  4J23 B;  2QYI B;  5BVP I;  5BOW A;  1SR4 C;  2Q9X A;  5FZU A;  5BXS A;  3A22 A;  3LLP A;  4JP0 A;  3AKF A;  4QC4 A;  1TFM B;  3NBE A;  4Z9W B;  1IOB A;  1IJT A;  4LO3 A;  4EFQ A;  3T8S A;  3IM5 A;  4R6U B;  4X38 A;  1ISV A;  1DQO A;  3BAD A;  4D0T A;  2K43 A;  2KH2 A;  4GOY A;  3NJ5 A;  3O3Q A;  4LO2 C;  5HPZ A;  3E8L C;  3BAG A;  3BAQ A;  3H6S E;  2BEA A;  3IM6 A;  2ERM A;  1FMZ A;  4I4P A;  1PZZ A;  3AZV A;  5DUY A;  4I4S A;  4ISR A;  3ZC8 A;  1N4K A;  3BA7 A;  2F2F C;  3O4A A;  2KLL A;  2DRZ A;  3HN1 A;  4Q9G A;  1TP0 A;  1S0C A;  3CA5 A;  3FJH A;  2LIQ A;  3WIN C;  3VT0 A;  1I1E A;  4X37 A;  5D61 A;  4II0 A;  1T4Q A;  3PG0 A;  3FJK A;  3WMV A;  1OQL B;  4OUJ A;  4QD2 C;  1DFQ A;  1TIE A;  5B2H A;  3C9Z A;  3LTQ A;  4H04 A;  4ZBV B;  3V79 C;  3KMV A;  1FN0 A;  4DEN A;  1TTU A;  1QXM A;  3FJ9 A;  4I3N A;  3FJ8 A;  1G9A A;  3RMY A;  3AJ5 A;  1EYL A;  1TWE A;  1BLD A;  2NZ9 A;  3OBT A;  4ZGR B;  1G9C A;  2D7I A;  4WBC A;  3BAH A;  2FDB M;  2AXM A;  3RMX A;  4GP3 A;  5FNX A;  3HBW A;  4LO0 C;  4EB2 B;  4KEJ A;  4OEF A;  2KI6 B;  1BFF A;  1EPW A;  4MZF B;  4HR6 C;  2D23 A;  3FJB A;  1S0L A;  5EC5 A;  2ET2 A;  5BP5 C;  2FO1 A;  2E4M C;  4HA2 A;  2DS0 A;  2VXT I;  3O44 A;  2VSE A;  4H9W A;  4G6M A;  4L4H A;  5BQU A;  4I4U A;  4OEE A;  2R9K B;  3CRH A;  1BFC A;  2J3P A;  1XZZ A;  3OGF A;  3NBC A;  3AKI A;  1HIB A;  1XG6 A;  3WO3 A;  1JLX A;  1S0F A;  3O4C A;  3CAH A;  4A7Z A;  2FGF A;  1BAR A;  4G9N A;  2NP0 A;  1YBI A;  4LO1 C;  1WD3 A;  4I37 A;  4GOV A;  3CRI A;  2D44 A;  4F83 A;  1ISW A;  3S8K A;  1Q1U A;  1YYN A;  1JT3 A;  3FUQ A;  1QQL A;  4JPZ A;  4LO7 C;  3AH2 A;  1HWN B;  3NBN A;  2F8X C;  4ZA3 B;  2AQZ A;  1EV2 A;  3FJA A;  1QQK A;  2NM1 A;  3Q7Y A;  3POK A;  1DIW A;  3FJD A;  4ION A;  1ISZ A;  1IIL A;  4I1B A;  4J2S A;  4UY4 A;  1CE7 B;  4J2K A;  2Y9F A;  1IRP A;  4Z8S B;  3N7K A;  3AZW A;  4A7Y A;  3ILA A;  3UD7 A;  3I29 B;  1R8O A;  4KEI A;  3OJ2 A;  4I4V A;  8I1B A;  1DJS B;  1F31 A;  4GP0 A;  5JMC A;  3H6R A;  2YUG A;  3WMU A;  4OWK A;  3H6R B;  4QKR A;  3MAL A;  3AKH A;  2HWM A;  4JQ0 A;  3W9T A;  3IM7 A;  2MLL B;  5DSS B;  2FFU A;  3AKG A;  4I4R A;  1J0S A;  1EVT A;  1HKN A;  3FJC A;  2WBC A;  3RSJ A;  4QKS A;  4FVV A;  1II4 A;  3FFZ A;  3ZC9 A;  3CA1 A;  3R4S A;  5I1B A;  2HWA A;  2Z48 A;  5FNW A;  3WO4 A;  2VSA A;  2LIE A;  2BFH A;  4IZX A;  3HMY A;  4I96 A;  1FGA A;  1DZD A;  1WD4 A;  3BAU A;  3Q7W A;  2HW9 A;  1AF9 A;  4GAF A;  3WA1 A;  1FV2 A;  5F8W A;  2VLC A;  1Z2V A;  2P23 A;  4ZLB B;  3B9U A;  1S0B A;  1HWM B;  2NYY A;  31BI A;  4IY9 A;  3N7L A;  1YF8 B;  2VU9 A;  4X39 A;  2KI4 A;  1ILR 1;  5EHA A;  1JT4 A;  1K5U A;  3BRD A;  2ESU A;  2Y9X E;  3A21 A;  4IHZ A;  2RG9 B;  1T9F A;  3CU1 B;  3VT1 A;  4USP A;  1HCE A;  2Y9G A;  4J2X A;  4X3A A;  1FV3 A;  5E24 E;  1ONK B;  2IHO A;  4MZH A;  5D63 A;  3P6I A;  1FWV A;  1D0H A;  2QN4 A;  4MZG B;  1UPS A;  1G9B A;  4END A;  3A23 A;  2Q3N B;  1DFC A;  4KBB A;  4JRA A;  4OWJ A;  3O4B A;  1S0E A;  3Q7X A;  4KC3 A;  1W3G A;  1YXW A;  4IZE A;  3UJ4 A;  1SR4 A;  4FGF A;  3NBD A;  1YTO A;  4F34 A;  3UD9 A;  2ZQO A;  4I4X A;  3F62 B;  4D0Z A;  3VUO A;  3FJI A;  4CJM A;  2I1B A;  1Q03 A;  2NS2 A;  1AVU A;  9ILB A;  4PC4 A;  1RY7 A;  4TLP A;  1A8D A;  4OWL A;  3F1R A;  1PUU B;  2ZR1 B;  1BAS A;  2RST A;  1ABR B;  4EFR A;  2XOA A;  4LO3 C;  2IWT B;  2KKI A;  1W3A A;  2ZQN A;  3BB2 A;  4G6J A;  1K5V A;  3ZX7 A;  1FQ9 A;  4QBC A;  5DZU A;  3PME A;  3UD8 A;  1JT5 A;  7I1B A;  1FWU A;  3V0A A;  1AVX B;  5FZY A;  1Z0H A;  3BAO A;  3UJ0 A;  3CA6 A;  1PC8 B;  3FJF A;  3V0A B;  2D24 A;  2F2F A;  4JAW A;  2DRY A;  1S0D A;  2NTD A;  3HSM A;  4ZFY B;  3CQA A;  3HAL A;  2D22 A;  41BI A;  3WIN A;  4QAL A;  1AXM A;  2WRY A;  2D7R A;  1JQZ A;  4I2S A;  3S8J A;  1V6V A;  1NUN A;  4AN6 A;  3PHZ A;  3CA4 A;  5BXR A;  1E0O A;  4QD2 B;  4P0K A;  4YOL A;  4P6A A;  1BLA A;  2Z49 A;  1HCD A;  2D20 A;  5DVH A;  1L2H A;  5BXT A;  1W3F A;  1PWA A;  2AAI B;  2K8R A;  3OJV A;  1BA7 A;  3UDA A;  4GAI A;  4QBV A;  3FJJ A;  4I7I A;  2L5X A;  1S0G A;  2HZ9 A;  3CA3 A;  2AFG A;  4LO0 A;  5F8S A;  3O49 A;  1AFC A;  1RZO B;  21BI A;  1JY0 A;  3WO2 A;  3VSZ A;  1CVS A;  1ISY A;  1JTC A;  2D43 A;  5JLV A;  3V0B A;  1ISX A;  3N0K A;  3RTJ B;  3BA4 A;  2K4A B;  5BP5 A;  2E4M A;  5EG6 C;  3V0B B;  3OJM A;  4JKQ A;  4G9M A;  1MD6 A;  1WBA A;  5G00 A;  2GZB A;  5F90 A;  3RTI B;  1WBC A;  5BXP A;  1M2T B;  4XKI A;  3VT2 A;  3JUT A;  1JT7 A;  4DEP A;  5BQU C;  1BFG A;  2Y9W C;  2GO2 A;  4I1E A;  3BAV A;  1R8N A;  3FGM A;  4LO8 B;  4LO1 A;  1TOO A;  3ZXD A;  1JLY A;  3D7W B;  3FJE A;  4EEE B;  4P0J A;  4IQP A;  4Q9P A;  3ZXG A;  2NVH A;  4ZFU B;  1V6W A;  3QR5 A;  3CRG A;  4XFT A;  3O5W B;  5D62 A;  5GAQ A;  6I1B A;  3AJ6 A;  4OEG A;  2M49 A;  4LO7 B;  1KNM A;  1AVW B;  3BRF A;  2D1Z A;  2UUS A;  4EFP A;  1DLL A;  4AN7 B;  1IRA X;  3N7J A;  4D8H A;  1ITB A;  3R4U A;  4IY8 A;  4ZOT A;  1DZC A;  3I2X A;  4XFU A;  3MPP G;  2BEB A;  4ISQ A;  3BRG C;  4G1R A;  2X2S A;  4EKX B;  1IT0 A;  4L4I A;  1HWO B;  3A07 A;  4IYB A;  3H6Q A;  3I2A A;  1V6X A;  5FZZ A;  1VCL A;  3AH4 A;  1GGP B;  1SZ6 B;  3QYD A;  2MC2 A;  3TC2 A;  4P0L A;  1XYF A;  3OBR A;  1HWP B;  3IAG C;  4I0Y A;  3O4O A;  2VXR A;  5F8Y A;  1AVA C;  1RML A;  3BTA A;  4I4Q A;  4LO2 A;  4USO A;  3FUO A;  1V6U A;  4I6I A;  3JRR A;  1XHB A;  1P63 A;  1BFB A;  3VSF A;  1G82 A;  4I4Y A;  1TWM A;  1NZK A;  3P6J A;  2RQ9 A;  4A7K A;  1I1B A;  1FMM S;  1Q04 A;  3K1X A;  3AH1 A;  4ZFW B;  3HOM A;  4I4O A;  2FFV A;  4XFS A;  2DRE A;  3PUB A;  4Q91 A;  3N7M A;  4OW4 A;  1DQG A;  2P39 A;  3IIR A;  4I8M A;  3EF2 A;  3VEQ A;  4H75 A;  3CA0 A;  1RG8 A;  3OGG A;  1Z4S A;  3P53 A;  3VWC A;  4KEK A;  1M16 A;  4HJJ A;  3BA5 A;  3SNV A;  4DCK C;  4JKX B;  1MC9 A;  4ZKT B;  4J2Y A;  3O4D A;  1G9D A;  2VUA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...