4I4RA

Bel beta-trefoil apo crystal form 4
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
146
structure length
146
Chain Sequence
b'VNFPNIPAEGVQFRLRARDTGYVIYSRTENPPLVWQYNGPPYDDQLFTLIYGTGPRKNLYAIKSVPNGRVLFSRTSASPYVGNIAGDGTYNDNWFQFIQDDNDPNSFRIYNLASDTVLYSRTTADPKFGNFTGAKYDDQLWHFELV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BEL-beta trefoil
publication title BEL {beta}-trefoil: A novel lectin with antineoplastic properties in king bolete (Boletus edulis) mushrooms.
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 39
structure length 146
sequence length 146
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-11-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 4i4rA00
3VT1A 3EF2A 1IHKA 4ZFWB 1DQOA 2RSTA 4Q91A 1AXMA 2AQZA 1ISYA 3RMXA 4A7ZA 1W3GA 1XHBA 3CAHA 3VT2A 5BVPI 2KLLA 1M2TB 3MPPG 2K8RA 1JT3A 3VSFA 3O5WB 1ISWA 3POKA 4I4SA 3RTJB 1WBCA 3BAHA 1HWOB 1JQZA 3WINA 4KEJA 4ZFUB 4I1BA 4ZA3B 2HW9A 1I1BA 3AKHA 4II0A 2MIBA 1V6UA 1BFGA 1HWMB 3CRHA 2F2FA 4D8HA 3ZXGA 3VEQA 1FN0A 4ZFYB 3NBCA 4I2SA 2DRZA 1ILR1 2MLLB 4GOYA 1S0LA 1NUNA 2ERMA 4QBCA 1G82A 2ET2A 4GOVA 1WD4A 2NM1A 4JPZA 1NZKA 4QKSA 2D20A 7I1BA 3FJKA 1R8NA 3OJMA 1DFCA 2NTDA 1QXMA 5FNXA 2MC2A 3UD7A 1FV3A 3HMYA 4XFTA 3V0BB 4DENA 3VSZA 3CRGA 3BRGC 4OW4A 4QD2B 4HA2A 2L5XA 1II4A 1YTOA 4OEEA 1EV2A 1TOOA 4KEKA 5GAQA 2Y9GA 4LO1C 3N7KA 1BASA 5JMCA 4X3AA 3ZXDA 3H6RB 1FQ9A 4DEPA 2HWAA 4XFSA 1W3AA 3AJ5A 3CQAA 1ISXA 4QD2C 5DVHA 1JT7A 3D7WB 4QALA 1RY7A 1HWPB 1W3FA 1ISZA 5BOWA 4D0ZA 2D1ZA 2BEAA 1RMLA 3F62B 3NBEA 3B9UA 3A07A 2F8XC 4ZOTA 2P39A 8I1BA 1CE7B 4J2XA 3PUBA 3TC2A 2NP0A 1QQKA 3A21A 4I4UA 3N0KA 4X37A 2LIEA 4Z9WB 3Q7YA 1ITBA 4ISRA 1HWNB 1SR4C 1TIEA 1YYNA 1TWMA 2AAIB 3BB2A 3NBDA 5B2HA 1FGAA 2VLCA 3WO2A 3Q7WA 3AKFA 3PG0A 1YBIA 4LO2C 3I29B 1DJSB 3WMVA 2VSEA 2QYIB 1IOBA 5EC5A 5BQUC 1TP0A 3CA6A 3IAGC 2KI6B 3CA4A 3FJHA 4TLPA 4LO1A 3AJ6A 2WBCA 3N7LA 4LO7B 1BARA 1HCEA 3BA4A 3AKIA 3IM5A 2M49A 4I4OA 3FJJA 3Q7XA 5FZYA 1T4QA 4JAWA 5EHAA 2HWMA 4LO0C 1N4KA 3S8KA 4IHZA 9ILBA 4LO7C 3H6RA 4OWKA 4P0JA 2KI4A 3WA1A 4I4XA 4H9WA 3FJIA 4I4RA 4L4IA 2RG9B 4X38A 2IHOA 4EB2B 4IY9A 4KC3A 1I1EA 1E0OA 1JLYA 3H6SE 2RQ9A 4D0TA 3BA5A 3PMEA 4X39A 4G1RA 2VU9A 4IZEA 3IIRA 5I1BA 4P0LA 5BXTA 5D61A 2KH2A 1PZZA 3HOMA 1Q03A 1VCLA 3IM7A 4LO3C 1JT4A 3IM6A 3H6QA 1G9BA 2E4MA 3UDAA 2DRYA 1V6VA 5EG6C 1SR4A 3O44A 4GP3A 1DZDA 4I4QA 3FUOA 4QO3A 4JRAA 3HSMA 1EYLA 2P23A 1WBAA 4ZBVB 3LTQA 5G00A 3V0AB 5BXSA 5JLVA 2I1BA 1P63A 1PUMB 1G9AA 4EFRA 1AVXB 3O4BA 3S8JA 4QBVA 1OQLB 3P6IA 2Y9WC 4I4YA 3QYDA 1S0EA 4G9MA 4IY8A 2WRYA 1QQLA 4OEFA 1V6XA 2DREA 1SZ6B 1Z0HA 4AN7B 3W9TA 3CU1B 1F31A 4OUJA 4KEIA 2ZQNA 5F8SA 4PC4A 1IILA 3ZX7A 3C9ZA 2GZBA 4I8MA 2R9KB 3UJ0A 4JP0A 1EPWA 4I37A 3VT0A 5D63A 3BAGA 2AXMA 1L2HA 1K5VA 4XKIA 2VXRA 3N7JA 3FFZA 3JRRA 2ZR1B 4I1EA 1PUUB 4I96A 1ONKB 1ABRB 2VUAA 3A22A 3BX1C 4JKXB 4R6UB 3BA7A 5F8WA 3P6JA 2HZ9A 4A7KA 1JY0A 3KMVA 4ZKTB 3VWCA 1HKNA 4I4VA 3K1XA 2FGFA 3OBRA 2D7RA 2J3PA 4P0KA 3AH2A 4KBBA 1S0CA 4GAIA 3WINC 4OEGA 5FZZA 1FWUA 1XG6A 1FMMS 2FDBM 1IJTA 4Z8SB 6I1BA 1PWAA 5DZUA 3NBNA 2BFHA 5BXRA 1D0HA 3BAVA 3OJVA 5F8YA 4GAFA 1HIBA 5D62A 4CJMA 2F2FC 3O3QA 4H04A 1AVUA 3HBWA 1TFMB 3V0BA 1RG8A 31BIA 2ZQOA 4I3NA 4I7IA 5BP5C 1JLXA 3CA3A 3LLPA 3FJ9A 2LIQA 2K43A 1Q04A 2NVHA 5E24E 1FMZA 2FFUA 3RTIB 1XZZA 4IZXA 3QR5A 1AF9A 1DLLA 4EFQA 1K5UA 2D23A 2Z48A 3CRIA 2YUGA 2AFGA 4IYBA 1HCDA 4J2KA 4Q9GA 3VUOA 2Y9XE 2QN4A 3PHZA 3CA0A 3JUTA 3O4DA 3FJAA 1A8DA 4HJJA 3AH4A 1DFQA 2DS0A 4XFUA 1FWVA 3CA5A 3O4OA 3HN1A 3T8SA 1IT0A 21BIA 1G9DA 4AN6A 4OWLA 4GP0A 41BIA 1IRPA 5DUYA 3WO3A 1DZCA 3FJFA 1Z4SA 4I0YA 4IONA 1KNMA 4IQPA 3BAOA 1AVWB 4Q9PA 2Q3NB 1CVSA 3E8LC 4OWJA 4LO2A 4QC4A 3OBTA 3AH1A 3F1RA 1M16A 2UUSA 5BXPA 2D44A 4ENDA 1TTUA 2VXTI 5BQUA 3UJ4A 3O49A 2FO1A 1BLAA 3ZC9A 3BADA 3FJEA 2NZ9A 1J0SA 1S0GA 5BP5A 2X2SA 3P53A 3CA1A 4JQ0A 4L4HA 5DSSB 2FFVA 1AFCA 4LO0A 2D22A 3OGFA 5F90A 1YF8B 4EFPA 3OGGA 4EEEB 3BRDA 2BEBA 4I6IA 3FJ8A 3SNVA 1UPSA 2VSAA 1GGPB 2XOAA 3O4AA 3OJ2A 3FJDA 1TWEA 3HALA 4WBCA 4I4PA 4QKRA 3UD8A 1WD3A 4ZLBB 1PC8B 1IRAX 1V6WA 3UD9A 4P6AA 4F34A 5HPZA 3FGMA 4A7YA 2K4AB 4LO3A 4EKXB 1G9CA 3R4UA 4YOLA 2D24A 3BAUA 2KKIA 1BFFA 1FV2A 3AZVA 3I2AA 1Z2VA 1Q1UA 4G6MA 3A23A 3NJ5A 4ZGRB 1DIWA 1JTCA 1XYFA 1ISVA 3AZWA 4ISQA 3I2XA 1MC9A 1EVTA 4DCKC 3O4CA 4G9NA 1JT5A 3AKGA 4LO8B 3FJCA 4G6JA 2Q9XA 2D43A 1T9FA 3RSJA 1DQGA 1MD6A 4FVVA 2Y9FA 5FZUA 3ILAA 3V0AA 4F83A 3MALA 1AVAC 3ZC8A 4J2SA 1BFCA 4JKQA 4FGFA 3N7MA 3RMYA 5FNWA 3WO4A 2D7IA 2NYYA 2E4MC 2X2TA 1BLDA 2ESUA 1S0DA 4USPA 1BFBA 3FJBA 2Z49A 4J23B 3BRFA 3R4SA 1S0BA 1R8OA 2GO2A 1S0FA 3V79C 3FUQA 3BTAA 4USOA 1YXWA 3BAQA 1RZOB 4J2YA 1BA7A 4HR6C 2IWTB 3WMUA
chains in the Genus database with same CATH superfamily
3VT1A 3EF2A 1IHKA 4ZFWB 1DQOA 2RSTA 4Q91A 1AXMA 2AQZA 1ISYA 3RMXA 4A7ZA 4MZGB 1W3GA 1XHBA 3CAHA 3VT2A 5BVPI 2KLLA 1M2TB 3MPPG 2K8RA 1JT3A 3VSFA 3O5WB 1ISWA 3POKA 4I4SA 3RTJB 1WBCA 3BAHA 1HWOB 1JQZA 3WINA 4KEJA 4ZFUB 4I1BA 4ZA3B 2HW9A 1I1BA 3AKHA 4II0A 2MIBA 1V6UA 1BFGA 2NS2A 1HWMB 3CRHA 2F2FA 4D8HA 3ZXGA 3VEQA 1FN0A 4ZFYB 3NBCA 4I2SA 2DRZA 1ILR1 2MLLB 4GOYA 1S0LA 1NUNA 2ERMA 4QBCA 1G82A 2ET2A 4GOVA 1WD4A 2NM1A 4JPZA 1NZKA 4QKSA 2D20A 7I1BA 3FJKA 1R8NA 3OJMA 1DFCA 2NTDA 1QXMA 5FNXA 2MC2A 3UD7A 1FV3A 3HMYA 4XFTA 3V0BB 4DENA 3VSZA 3CRGA 3BRGC 4OW4A 4QD2B 4HA2A 2L5XA 1II4A 1YTOA 4OEEA 1EV2A 1TOOA 4KEKA 5GAQA 2Y9GA 4LO1C 3N7KA 1BASA 5JMCA 4X3AA 3ZXDA 3H6RB 1FQ9A 4DEPA 2HWAA 4XFSA 1W3AA 3AJ5A 3CQAA 1ISXA 4QD2C 5DVHA 1JT7A 3D7WB 4QALA 1RY7A 1HWPB 1W3FA 1ISZA 5BOWA 4D0ZA 2D1ZA 2BEAA 1RMLA 3F62B 3NBEA 3B9UA 3A07A 2F8XC 4ZOTA 2P39A 8I1BA 1CE7B 4J2XA 3PUBA 3TC2A 2NP0A 1QQKA 3A21A 4I4UA 3N0KA 4X37A 2LIEA 4Z9WB 3Q7YA 1ITBA 4ISRA 1HWNB 1SR4C 1TIEA 1YYNA 1TWMA 2AAIB 3BB2A 3NBDA 5B2HA 1FGAA 2VLCA 3WO2A 3Q7WA 3AKFA 3PG0A 1YBIA 4LO2C 3I29B 1DJSB 3WMVA 2VSEA 2QYIB 1IOBA 5EC5A 5BQUC 1TP0A 3CA6A 3IAGC 2KI6B 3CA4A 3FJHA 4TLPA 4LO1A 3AJ6A 2WBCA 3N7LA 4LO7B 1BARA 1HCEA 3BA4A 3AKIA 3IM5A 2M49A 4I4OA 3FJJA 3Q7XA 5FZYA 1T4QA 4JAWA 5EHAA 2HWMA 4LO0C 1N4KA 3S8KA 4IHZA 9ILBA 4LO7C 3H6RA 4OWKA 4P0JA 2KI4A 3WA1A 4I4XA 4H9WA 3FJIA 4I4RA 4L4IA 2RG9B 4X38A 2IHOA 4EB2B 4IY9A 4KC3A 1I1EA 1E0OA 1JLYA 3H6SE 2RQ9A 4D0TA 3BA5A 3PMEA 4X39A 4G1RA 2VU9A 4IZEA 3IIRA 5I1BA 4P0LA 5BXTA 5D61A 2KH2A 1PZZA 3HOMA 1Q03A 1VCLA 3IM7A 4LO3C 1JT4A 3IM6A 3H6QA 1G9BA 2E4MA 3UDAA 2DRYA 1V6VA 5EG6C 1SR4A 3O44A 4GP3A 1DZDA 4I4QA 3FUOA 4QO3A 4UY4A 4JRAA 3HSMA 1EYLA 2P23A 1WBAA 4ZBVB 3LTQA 5G00A 3V0AB 5BXSA 5JLVA 2I1BA 1P63A 1PUMB 1G9AA 4EFRA 1AVXB 3O4BA 3S8JA 4QBVA 1OQLB 3P6IA 2Y9WC 4I4YA 3QYDA 1S0EA 4G9MA 4IY8A 2WRYA 1QQLA 4OEFA 1V6XA 2DREA 1SZ6B 1Z0HA 4AN7B 3W9TA 3CU1B 1F31A 4OUJA 4KEIA 2ZQNA 5F8SA 4PC4A 1IILA 3ZX7A 3C9ZA 2GZBA 4I8MA 2R9KB 3UJ0A 4JP0A 1EPWA 4I37A 3VT0A 5D63A 4MZFB 3BAGA 2AXMA 1L2HA 1K5VA 4XKIA 2VXRA 3N7JA 3FFZA 3JRRA 2ZR1B 4I1EA 1PUUB 4I96A 1ONKB 1ABRB 2VUAA 3A22A 3BX1C 4JKXB 4R6UB 3BA7A 5F8WA 3P6JA 2HZ9A 4A7KA 1JY0A 3KMVA 4ZKTB 3VWCA 1HKNA 4I4VA 3K1XA 2FGFA 3OBRA 2D7RA 2J3PA 4P0KA 3AH2A 4KBBA 1S0CA 4GAIA 3WINC 4OEGA 5FZZA 1FWUA 1XG6A 1FMMS 2FDBM 1IJTA 4Z8SB 6I1BA 1PWAA 5DZUA 3NBNA 2BFHA 5BXRA 1D0HA 3BAVA 3OJVA 5F8YA 4GAFA 1HIBA 5D62A 4CJMA 2F2FC 3O3QA 4H04A 1AVUA 3HBWA 1TFMB 3V0BA 1RG8A 31BIA 2ZQOA 4I3NA 4I7IA 5BP5C 1JLXA 3CA3A 3LLPA 3FJ9A 2LIQA 2K43A 1Q04A 2NVHA 5E24E 1FMZA 2FFUA 3RTIB 1XZZA 4IZXA 3QR5A 1AF9A 1DLLA 4EFQA 1K5UA 2D23A 2Z48A 3CRIA 2YUGA 2AFGA 4IYBA 1HCDA 4J2KA 4Q9GA 3VUOA 2Y9XE 2QN4A 3PHZA 3CA0A 3JUTA 3O4DA 3FJAA 1A8DA 4HJJA 3AH4A 1DFQA 2DS0A 4XFUA 1FWVA 3CA5A 3O4OA 3HN1A 3T8SA 1IT0A 21BIA 1G9DA 4AN6A 4OWLA 4GP0A 41BIA 1IRPA 5DUYA 3WO3A 1DZCA 3FJFA 1Z4SA 4I0YA 4IONA 1KNMA 4IQPA 3BAOA 1AVWB 4Q9PA 2Q3NB 1CVSA 3E8LC 4OWJA 4LO2A 4QC4A 4MZHA 3OBTA 3AH1A 3F1RA 1M16A 2UUSA 5BXPA 2D44A 4ENDA 1TTUA 2VXTI 5BQUA 3UJ4A 3O49A 2FO1A 1BLAA 3ZC9A 3BADA 3FJEA 2NZ9A 1J0SA 1S0GA 5BP5A 2X2SA 3P53A 3CA1A 4JQ0A 4L4HA 5DSSB 2FFVA 1AFCA 4LO0A 2D22A 3OGFA 5F90A 1YF8B 4EFPA 3OGGA 4EEEB 3BRDA 2BEBA 4I6IA 3FJ8A 3SNVA 1UPSA 2VSAA 1GGPB 2XOAA 3O4AA 3OJ2A 3FJDA 1TWEA 3HALA 4WBCA 4I4PA 4QKRA 3UD8A 1WD3A 4ZLBB 1PC8B 1IRAX 1V6WA 3UD9A 4P6AA 4F34A 5HPZA 3FGMA 4A7YA 2K4AB 4LO3A 4EKXB 1G9CA 3R4UA 4YOLA 2D24A 3BAUA 2KKIA 1BFFA 1FV2A 3AZVA 3I2AA 1Z2VA 1Q1UA 4G6MA 3A23A 3NJ5A 4ZGRB 1DIWA 1JTCA 1XYFA 1ISVA 3AZWA 4ISQA 3I2XA 1MC9A 1EVTA 4DCKC 3O4CA 4G9NA 1JT5A 3AKGA 4LO8B 3FJCA 4G6JA 2Q9XA 2D43A 1T9FA 3RSJA 1DQGA 1MD6A 4FVVA 2Y9FA 5FZUA 3ILAA 3V0AA 4F83A 3MALA 1AVAC 3ZC8A 4J2SA 1BFCA 4JKQA 4FGFA 3N7MA 3RMYA 5FNWA 3WO4A 2D7IA 2NYYA 2E4MC 2X2TA 1BLDA 2ESUA 1S0DA 4USPA 1BFBA 3FJBA 2Z49A 4J23B 3BRFA 3R4SA 1S0BA 1R8OA 2GO2A 1S0FA 3V79C 3FUQA 3BTAA 4USOA 1YXWA 3BAQA 1RZOB 4J2YA 1BA7A 4HR6C 2IWTB 4H75A 3WMUA
chains in the Genus database with same CATH topology
3VT1A 3EF2A 1IHKA 4ZFWB 1DQOA 2RSTA 4Q91A 1AXMA 2AQZA 1ISYA 3RMXA 4A7ZA 4MZGB 1W3GA 1XHBA 3CAHA 3VT2A 5BVPI 2KLLA 1M2TB 3MPPG 2K8RA 1JT3A 3VSFA 3O5WB 1ISWA 3POKA 4I4SA 3RTJB 1WBCA 3BAHA 1HWOB 1JQZA 3WINA 4KEJA 4ZFUB 4I1BA 4ZA3B 2HW9A 1I1BA 3AKHA 4II0A 2MIBA 1V6UA 1BFGA 2NS2A 1HWMB 3CRHA 2F2FA 4D8HA 3ZXGA 3VEQA 1FN0A 4ZFYB 3NBCA 4I2SA 2DRZA 1ILR1 2MLLB 4GOYA 1S0LA 1NUNA 2ERMA 4QBCA 1G82A 2ET2A 4GOVA 1WD4A 2NM1A 4JPZA 1NZKA 4QKSA 2D20A 7I1BA 3FJKA 1R8NA 3OJMA 1DFCA 2NTDA 1QXMA 5FNXA 2MC2A 3UD7A 1FV3A 3HMYA 4XFTA 3V0BB 4DENA 3VSZA 3CRGA 3BRGC 4OW4A 4QD2B 4HA2A 2L5XA 1II4A 1YTOA 4OEEA 1EV2A 1TOOA 4KEKA 5GAQA 2Y9GA 4LO1C 3N7KA 1BASA 5JMCA 4X3AA 3ZXDA 3H6RB 1FQ9A 4DEPA 2HWAA 4XFSA 1W3AA 3AJ5A 3CQAA 1ISXA 4QD2C 5DVHA 1JT7A 3D7WB 4QALA 1RY7A 1HWPB 1W3FA 1ISZA 5BOWA 4D0ZA 2D1ZA 2BEAA 1RMLA 3F62B 3NBEA 3B9UA 3A07A 2F8XC 4ZOTA 2P39A 8I1BA 1CE7B 4J2XA 3PUBA 3TC2A 2NP0A 1QQKA 3A21A 4I4UA 3N0KA 4X37A 2LIEA 4Z9WB 3Q7YA 1ITBA 4ISRA 1HWNB 1SR4C 1TIEA 1YYNA 1TWMA 2AAIB 3BB2A 3NBDA 5B2HA 1FGAA 2VLCA 3WO2A 3Q7WA 3AKFA 3PG0A 1YBIA 4LO2C 3I29B 1DJSB 3WMVA 2VSEA 2QYIB 1IOBA 5EC5A 5BQUC 1TP0A 3CA6A 3IAGC 2KI6B 3CA4A 3FJHA 4TLPA 4LO1A 3AJ6A 2WBCA 3N7LA 4LO7B 1BARA 1HCEA 3BA4A 3AKIA 3IM5A 2M49A 4I4OA 3FJJA 3Q7XA 5FZYA 1T4QA 4JAWA 5EHAA 2HWMA 4LO0C 1N4KA 3S8KA 4IHZA 9ILBA 4LO7C 3H6RA 4OWKA 4P0JA 2KI4A 3WA1A 4I4XA 4H9WA 3FJIA 4I4RA 4L4IA 2RG9B 4X38A 2IHOA 4EB2B 4IY9A 4KC3A 1I1EA 1E0OA 1JLYA 3H6SE 2RQ9A 4D0TA 3BA5A 3PMEA 4X39A 4G1RA 2VU9A 4IZEA 3IIRA 5I1BA 4P0LA 5BXTA 5D61A 2KH2A 1PZZA 3HOMA 1Q03A 1VCLA 3IM7A 4LO3C 1JT4A 3IM6A 3H6QA 1G9BA 2E4MA 3UDAA 2DRYA 1V6VA 5EG6C 1SR4A 3O44A 4GP3A 1DZDA 4I4QA 3FUOA 4QO3A 4UY4A 4JRAA 3HSMA 1EYLA 2P23A 1WBAA 4ZBVB 3LTQA 5G00A 3V0AB 5BXSA 5JLVA 2I1BA 1P63A 1PUMB 1G9AA 4EFRA 1AVXB 3O4BA 3S8JA 4QBVA 1OQLB 3P6IA 2Y9WC 4I4YA 3QYDA 1S0EA 4G9MA 4IY8A 2WRYA 1QQLA 4OEFA 1V6XA 2DREA 1SZ6B 1Z0HA 4AN7B 3W9TA 3CU1B 1F31A 4OUJA 4KEIA 2ZQNA 5F8SA 4PC4A 1IILA 3ZX7A 3C9ZA 2GZBA 4I8MA 2R9KB 3UJ0A 4JP0A 1EPWA 4I37A 3VT0A 5D63A 4MZFB 3BAGA 2AXMA 1L2HA 1K5VA 4XKIA 2VXRA 3N7JA 3FFZA 3JRRA 2ZR1B 4I1EA 1PUUB 4I96A 1ONKB 1ABRB 2VUAA 3A22A 3BX1C 4JKXB 4R6UB 3BA7A 5F8WA 3P6JA 2HZ9A 4A7KA 1JY0A 3KMVA 4ZKTB 3VWCA 1HKNA 4I4VA 3K1XA 2FGFA 3OBRA 2D7RA 2J3PA 4P0KA 3AH2A 4KBBA 1S0CA 4GAIA 3WINC 4OEGA 5FZZA 1FWUA 1XG6A 1FMMS 2FDBM 1IJTA 4Z8SB 6I1BA 1PWAA 5DZUA 3NBNA 2BFHA 5BXRA 1D0HA 3BAVA 3OJVA 5F8YA 4GAFA 1HIBA 5D62A 4CJMA 2F2FC 3O3QA 4H04A 1AVUA 3HBWA 1TFMB 3V0BA 1RG8A 31BIA 2ZQOA 4I3NA 4I7IA 5BP5C 1JLXA 3CA3A 3LLPA 3FJ9A 2LIQA 2K43A 1Q04A 2NVHA 5E24E 1FMZA 2FFUA 3RTIB 1XZZA 4IZXA 3QR5A 1AF9A 1DLLA 4EFQA 1K5UA 2D23A 2Z48A 3CRIA 2YUGA 2AFGA 4IYBA 1HCDA 4J2KA 4Q9GA 3VUOA 2Y9XE 2QN4A 3PHZA 3CA0A 3JUTA 3O4DA 3FJAA 1A8DA 4HJJA 3AH4A 1DFQA 2DS0A 4XFUA 1FWVA 3CA5A 3O4OA 3HN1A 3T8SA 1IT0A 21BIA 1G9DA 4AN6A 4OWLA 4GP0A 41BIA 1IRPA 5DUYA 3WO3A 1DZCA 3FJFA 1Z4SA 4I0YA 4IONA 1KNMA 4IQPA 3BAOA 1AVWB 4Q9PA 2Q3NB 1CVSA 3E8LC 4OWJA 4LO2A 4QC4A 4MZHA 3OBTA 3AH1A 3F1RA 1M16A 2UUSA 5BXPA 2D44A 4ENDA 1TTUA 2VXTI 5BQUA 3UJ4A 3O49A 2FO1A 1BLAA 3ZC9A 3BADA 3FJEA 2NZ9A 1J0SA 1S0GA 5BP5A 2X2SA 3P53A 3CA1A 4JQ0A 4L4HA 5DSSB 2FFVA 1AFCA 4LO0A 2D22A 3OGFA 5F90A 1YF8B 4EFPA 3OGGA 4EEEB 3BRDA 2BEBA 4I6IA 3FJ8A 3SNVA 1UPSA 2VSAA 1GGPB 2XOAA 3O4AA 3OJ2A 3FJDA 1TWEA 3HALA 4WBCA 4I4PA 4QKRA 3UD8A 1WD3A 4ZLBB 1PC8B 1IRAX 1V6WA 3UD9A 4P6AA 4F34A 5HPZA 3FGMA 4A7YA 2K4AB 4LO3A 4EKXB 1G9CA 3R4UA 4YOLA 2D24A 3BAUA 2KKIA 1BFFA 1FV2A 3AZVA 3I2AA 1Z2VA 1Q1UA 4G6MA 3A23A 3NJ5A 4ZGRB 1DIWA 1JTCA 1XYFA 1ISVA 3AZWA 4ISQA 3I2XA 1MC9A 1EVTA 4DCKC 3O4CA 4G9NA 1JT5A 3AKGA 4LO8B 3FJCA 4G6JA 2Q9XA 2D43A 1T9FA 3RSJA 1DQGA 1MD6A 4FVVA 2Y9FA 5FZUA 3ILAA 3V0AA 4F83A 3MALA 1AVAC 3ZC8A 4J2SA 1BFCA 4JKQA 4FGFA 3N7MA 3RMYA 5FNWA 3WO4A 2D7IA 2NYYA 2E4MC 2X2TA 1BLDA 2ESUA 1S0DA 4USPA 1BFBA 3FJBA 2Z49A 4J23B 3BRFA 3R4SA 1S0BA 1R8OA 2GO2A 1S0FA 3V79C 3FUQA 3BTAA 4USOA 1YXWA 3BAQA 1RZOB 4J2YA 1BA7A 4HR6C 2IWTB 4H75A 3WMUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VT1 A;  3EF2 A;  1IHK A;  4ZFW B;  1DQO A;  2RST A;  4Q91 A;  1AXM A;  2AQZ A;  1ISY A;  3RMX A;  4A7Z A;  1W3G A;  1XHB A;  3CAH A;  3VT2 A;  5BVP I;  2KLL A;  1M2T B;  3MPP G;  2K8R A;  1JT3 A;  3VSF A;  3O5W B;  1ISW A;  3POK A;  4I4S A;  3RTJ B;  1WBC A;  3BAH A;  1HWO B;  1JQZ A;  3WIN A;  4KEJ A;  4ZFU B;  4I1B A;  4ZA3 B;  2HW9 A;  1I1B A;  3AKH A;  4II0 A;  2MIB A;  1V6U A;  1BFG A;  1HWM B;  3CRH A;  2F2F A;  4D8H A;  3ZXG A;  3VEQ A;  1FN0 A;  4ZFY B;  3NBC A;  4I2S A;  2DRZ A;  1ILR 1;  2MLL B;  4GOY A;  1S0L A;  1NUN A;  2ERM A;  4QBC A;  1G82 A;  2ET2 A;  4GOV A;  1WD4 A;  2NM1 A;  4JPZ A;  1NZK A;  4QKS A;  2D20 A;  7I1B A;  3FJK A;  1R8N A;  3OJM A;  1DFC A;  2NTD A;  1QXM A;  5FNX A;  2MC2 A;  3UD7 A;  1FV3 A;  3HMY A;  4XFT A;  3V0B B;  4DEN A;  3VSZ A;  3CRG A;  3BRG C;  4OW4 A;  4QD2 B;  4HA2 A;  2L5X A;  1II4 A;  1YTO A;  4OEE A;  1EV2 A;  1TOO A;  4KEK A;  5GAQ A;  2Y9G A;  4LO1 C;  3N7K A;  1BAS A;  5JMC A;  4X3A A;  3ZXD A;  3H6R B;  1FQ9 A;  4DEP A;  2HWA A;  4XFS A;  1W3A A;  3AJ5 A;  3CQA A;  1ISX A;  4QD2 C;  5DVH A;  1JT7 A;  3D7W B;  4QAL A;  1RY7 A;  1HWP B;  1W3F A;  1ISZ A;  5BOW A;  4D0Z A;  2D1Z A;  2BEA A;  1RML A;  3F62 B;  3NBE A;  3B9U A;  3A07 A;  2F8X C;  4ZOT A;  2P39 A;  8I1B A;  1CE7 B;  4J2X A;  3PUB A;  3TC2 A;  2NP0 A;  1QQK A;  3A21 A;  4I4U A;  3N0K A;  4X37 A;  2LIE A;  4Z9W B;  3Q7Y A;  1ITB A;  4ISR A;  1HWN B;  1SR4 C;  1TIE A;  1YYN A;  1TWM A;  2AAI B;  3BB2 A;  3NBD A;  5B2H A;  1FGA A;  2VLC A;  3WO2 A;  3Q7W A;  3AKF A;  3PG0 A;  1YBI A;  4LO2 C;  3I29 B;  1DJS B;  3WMV A;  2VSE A;  2QYI B;  1IOB A;  5EC5 A;  5BQU C;  1TP0 A;  3CA6 A;  3IAG C;  2KI6 B;  3CA4 A;  3FJH A;  4TLP A;  4LO1 A;  3AJ6 A;  2WBC A;  3N7L A;  4LO7 B;  1BAR A;  1HCE A;  3BA4 A;  3AKI A;  3IM5 A;  2M49 A;  4I4O A;  3FJJ A;  3Q7X A;  5FZY A;  1T4Q A;  4JAW A;  5EHA A;  2HWM A;  4LO0 C;  1N4K A;  3S8K A;  4IHZ A;  9ILB A;  4LO7 C;  3H6R A;  4OWK A;  4P0J A;  2KI4 A;  3WA1 A;  4I4X A;  4H9W A;  3FJI A;  4I4R A;  4L4I A;  2RG9 B;  4X38 A;  2IHO A;  4EB2 B;  4IY9 A;  4KC3 A;  1I1E A;  1E0O A;  1JLY A;  3H6S E;  2RQ9 A;  4D0T A;  3BA5 A;  3PME A;  4X39 A;  4G1R A;  2VU9 A;  4IZE A;  3IIR A;  5I1B A;  4P0L A;  5BXT A;  5D61 A;  2KH2 A;  1PZZ A;  3HOM A;  1Q03 A;  1VCL A;  3IM7 A;  4LO3 C;  1JT4 A;  3IM6 A;  3H6Q A;  1G9B A;  2E4M A;  3UDA A;  2DRY A;  1V6V A;  5EG6 C;  1SR4 A;  3O44 A;  4GP3 A;  1DZD A;  4I4Q A;  3FUO A;  4QO3 A;  4JRA A;  3HSM A;  1EYL A;  2P23 A;  1WBA A;  4ZBV B;  3LTQ A;  5G00 A;  3V0A B;  5BXS A;  5JLV A;  2I1B A;  1P63 A;  1PUM B;  1G9A A;  4EFR A;  1AVX B;  3O4B A;  3S8J A;  4QBV A;  1OQL B;  3P6I A;  2Y9W C;  4I4Y A;  3QYD A;  1S0E A;  4G9M A;  4IY8 A;  2WRY A;  1QQL A;  4OEF A;  1V6X A;  2DRE A;  1SZ6 B;  1Z0H A;  4AN7 B;  3W9T A;  3CU1 B;  1F31 A;  4OUJ A;  4KEI A;  2ZQN A;  5F8S A;  4PC4 A;  1IIL A;  3ZX7 A;  3C9Z A;  2GZB A;  4I8M A;  2R9K B;  3UJ0 A;  4JP0 A;  1EPW A;  4I37 A;  3VT0 A;  5D63 A;  3BAG A;  2AXM A;  1L2H A;  1K5V A;  4XKI A;  2VXR A;  3N7J A;  3FFZ A;  3JRR A;  2ZR1 B;  4I1E A;  1PUU B;  4I96 A;  1ONK B;  1ABR B;  2VUA A;  3A22 A;  3BX1 C;  4JKX B;  4R6U B;  3BA7 A;  5F8W A;  3P6J A;  2HZ9 A;  4A7K A;  1JY0 A;  3KMV A;  4ZKT B;  3VWC A;  1HKN A;  4I4V A;  3K1X A;  2FGF A;  3OBR A;  2D7R A;  2J3P A;  4P0K A;  3AH2 A;  4KBB A;  1S0C A;  4GAI A;  3WIN C;  4OEG A;  5FZZ A;  1FWU A;  1XG6 A;  1FMM S;  2FDB M;  1IJT A;  4Z8S B;  6I1B A;  1PWA A;  5DZU A;  3NBN A;  2BFH A;  5BXR A;  1D0H A;  3BAV A;  3OJV A;  5F8Y A;  4GAF A;  1HIB A;  5D62 A;  4CJM A;  2F2F C;  3O3Q A;  4H04 A;  1AVU A;  3HBW A;  1TFM B;  3V0B A;  1RG8 A;  31BI A;  2ZQO A;  4I3N A;  4I7I A;  5BP5 C;  1JLX A;  3CA3 A;  3LLP A;  3FJ9 A;  2LIQ A;  2K43 A;  1Q04 A;  2NVH A;  5E24 E;  1FMZ A;  2FFU A;  3RTI B;  1XZZ A;  4IZX A;  3QR5 A;  1AF9 A;  1DLL A;  4EFQ A;  1K5U A;  2D23 A;  2Z48 A;  3CRI A;  2YUG A;  2AFG A;  4IYB A;  1HCD A;  4J2K A;  4Q9G A;  3VUO A;  2Y9X E;  2QN4 A;  3PHZ A;  3CA0 A;  3JUT A;  3O4D A;  3FJA A;  1A8D A;  4HJJ A;  3AH4 A;  1DFQ A;  2DS0 A;  4XFU A;  1FWV A;  3CA5 A;  3O4O A;  3HN1 A;  3T8S A;  1IT0 A;  21BI A;  1G9D A;  4AN6 A;  4OWL A;  4GP0 A;  41BI A;  1IRP A;  5DUY A;  3WO3 A;  1DZC A;  3FJF A;  1Z4S A;  4I0Y A;  4ION A;  1KNM A;  4IQP A;  3BAO A;  1AVW B;  4Q9P A;  2Q3N B;  1CVS A;  3E8L C;  4OWJ A;  4LO2 A;  4QC4 A;  3OBT A;  3AH1 A;  3F1R A;  1M16 A;  2UUS A;  5BXP A;  2D44 A;  4END A;  1TTU A;  2VXT I;  5BQU A;  3UJ4 A;  3O49 A;  2FO1 A;  1BLA A;  3ZC9 A;  3BAD A;  3FJE A;  2NZ9 A;  1J0S A;  1S0G A;  5BP5 A;  2X2S A;  3P53 A;  3CA1 A;  4JQ0 A;  4L4H A;  5DSS B;  2FFV A;  1AFC A;  4LO0 A;  2D22 A;  3OGF A;  5F90 A;  1YF8 B;  4EFP A;  3OGG A;  4EEE B;  3BRD A;  2BEB A;  4I6I A;  3FJ8 A;  3SNV A;  1UPS A;  2VSA A;  1GGP B;  2XOA A;  3O4A A;  3OJ2 A;  3FJD A;  1TWE A;  3HAL A;  4WBC A;  4I4P A;  4QKR A;  3UD8 A;  1WD3 A;  4ZLB B;  1PC8 B;  1IRA X;  1V6W A;  3UD9 A;  4P6A A;  4F34 A;  5HPZ A;  3FGM A;  4A7Y A;  2K4A B;  4LO3 A;  4EKX B;  1G9C A;  3R4U A;  4YOL A;  2D24 A;  3BAU A;  2KKI A;  1BFF A;  1FV2 A;  3AZV A;  3I2A A;  1Z2V A;  1Q1U A;  4G6M A;  3A23 A;  3NJ5 A;  4ZGR B;  1DIW A;  1JTC A;  1XYF A;  1ISV A;  3AZW A;  4ISQ A;  3I2X A;  1MC9 A;  1EVT A;  4DCK C;  3O4C A;  4G9N A;  1JT5 A;  3AKG A;  4LO8 B;  3FJC A;  4G6J A;  2Q9X A;  2D43 A;  1T9F A;  3RSJ A;  1DQG A;  1MD6 A;  4FVV A;  2Y9F A;  5FZU A;  3ILA A;  3V0A A;  4F83 A;  3MAL A;  1AVA C;  3ZC8 A;  4J2S A;  1BFC A;  4JKQ A;  4FGF A;  3N7M A;  3RMY A;  5FNW A;  3WO4 A;  2D7I A;  2NYY A;  2E4M C;  2X2T A;  1BLD A;  2ESU A;  1S0D A;  4USP A;  1BFB A;  3FJB A;  2Z49 A;  4J23 B;  3BRF A;  3R4S A;  1S0B A;  1R8O A;  2GO2 A;  1S0F A;  3V79 C;  3FUQ A;  3BTA A;  4USO A;  1YXW A;  3BAQ A;  1RZO B;  4J2Y A;  1BA7 A;  4HR6 C;  2IWT B;  3WMU A; 
#chains in the Genus database with same CATH topology
 3VT1 A;  3EF2 A;  1IHK A;  4ZFW B;  1DQO A;  2RST A;  4Q91 A;  1AXM A;  2AQZ A;  1ISY A;  3RMX A;  4A7Z A;  4MZG B;  1W3G A;  1XHB A;  3CAH A;  3VT2 A;  5BVP I;  2KLL A;  1M2T B;  3MPP G;  2K8R A;  1JT3 A;  3VSF A;  3O5W B;  1ISW A;  3POK A;  4I4S A;  3RTJ B;  1WBC A;  3BAH A;  1HWO B;  1JQZ A;  3WIN A;  4KEJ A;  4ZFU B;  4I1B A;  4ZA3 B;  2HW9 A;  1I1B A;  3AKH A;  4II0 A;  2MIB A;  1V6U A;  1BFG A;  2NS2 A;  1HWM B;  3CRH A;  2F2F A;  4D8H A;  3ZXG A;  3VEQ A;  1FN0 A;  4ZFY B;  3NBC A;  4I2S A;  2DRZ A;  1ILR 1;  2MLL B;  4GOY A;  1S0L A;  1NUN A;  2ERM A;  4QBC A;  1G82 A;  2ET2 A;  4GOV A;  1WD4 A;  2NM1 A;  4JPZ A;  1NZK A;  4QKS A;  2D20 A;  7I1B A;  3FJK A;  1R8N A;  3OJM A;  1DFC A;  2NTD A;  1QXM A;  5FNX A;  2MC2 A;  3UD7 A;  1FV3 A;  3HMY A;  4XFT A;  3V0B B;  4DEN A;  3VSZ A;  3CRG A;  3BRG C;  4OW4 A;  4QD2 B;  4HA2 A;  2L5X A;  1II4 A;  1YTO A;  4OEE A;  1EV2 A;  1TOO A;  4KEK A;  5GAQ A;  2Y9G A;  4LO1 C;  3N7K A;  1BAS A;  5JMC A;  4X3A A;  3ZXD A;  3H6R B;  1FQ9 A;  4DEP A;  2HWA A;  4XFS A;  1W3A A;  3AJ5 A;  3CQA A;  1ISX A;  4QD2 C;  5DVH A;  1JT7 A;  3D7W B;  4QAL A;  1RY7 A;  1HWP B;  1W3F A;  1ISZ A;  5BOW A;  4D0Z A;  2D1Z A;  2BEA A;  1RML A;  3F62 B;  3NBE A;  3B9U A;  3A07 A;  2F8X C;  4ZOT A;  2P39 A;  8I1B A;  1CE7 B;  4J2X A;  3PUB A;  3TC2 A;  2NP0 A;  1QQK A;  3A21 A;  4I4U A;  3N0K A;  4X37 A;  2LIE A;  4Z9W B;  3Q7Y A;  1ITB A;  4ISR A;  1HWN B;  1SR4 C;  1TIE A;  1YYN A;  1TWM A;  2AAI B;  3BB2 A;  3NBD A;  5B2H A;  1FGA A;  2VLC A;  3WO2 A;  3Q7W A;  3AKF A;  3PG0 A;  1YBI A;  4LO2 C;  3I29 B;  1DJS B;  3WMV A;  2VSE A;  2QYI B;  1IOB A;  5EC5 A;  5BQU C;  1TP0 A;  3CA6 A;  3IAG C;  2KI6 B;  3CA4 A;  3FJH A;  4TLP A;  4LO1 A;  3AJ6 A;  2WBC A;  3N7L A;  4LO7 B;  1BAR A;  1HCE A;  3BA4 A;  3AKI A;  3IM5 A;  2M49 A;  4I4O A;  3FJJ A;  3Q7X A;  5FZY A;  1T4Q A;  4JAW A;  5EHA A;  2HWM A;  4LO0 C;  1N4K A;  3S8K A;  4IHZ A;  9ILB A;  4LO7 C;  3H6R A;  4OWK A;  4P0J A;  2KI4 A;  3WA1 A;  4I4X A;  4H9W A;  3FJI A;  4I4R A;  4L4I A;  2RG9 B;  4X38 A;  2IHO A;  4EB2 B;  4IY9 A;  4KC3 A;  1I1E A;  1E0O A;  1JLY A;  3H6S E;  2RQ9 A;  4D0T A;  3BA5 A;  3PME A;  4X39 A;  4G1R A;  2VU9 A;  4IZE A;  3IIR A;  5I1B A;  4P0L A;  5BXT A;  5D61 A;  2KH2 A;  1PZZ A;  3HOM A;  1Q03 A;  1VCL A;  3IM7 A;  4LO3 C;  1JT4 A;  3IM6 A;  3H6Q A;  1G9B A;  2E4M A;  3UDA A;  2DRY A;  1V6V A;  5EG6 C;  1SR4 A;  3O44 A;  4GP3 A;  1DZD A;  4I4Q A;  3FUO A;  4QO3 A;  4UY4 A;  4JRA A;  3HSM A;  1EYL A;  2P23 A;  1WBA A;  4ZBV B;  3LTQ A;  5G00 A;  3V0A B;  5BXS A;  5JLV A;  2I1B A;  1P63 A;  1PUM B;  1G9A A;  4EFR A;  1AVX B;  3O4B A;  3S8J A;  4QBV A;  1OQL B;  3P6I A;  2Y9W C;  4I4Y A;  3QYD A;  1S0E A;  4G9M A;  4IY8 A;  2WRY A;  1QQL A;  4OEF A;  1V6X A;  2DRE A;  1SZ6 B;  1Z0H A;  4AN7 B;  3W9T A;  3CU1 B;  1F31 A;  4OUJ A;  4KEI A;  2ZQN A;  5F8S A;  4PC4 A;  1IIL A;  3ZX7 A;  3C9Z A;  2GZB A;  4I8M A;  2R9K B;  3UJ0 A;  4JP0 A;  1EPW A;  4I37 A;  3VT0 A;  5D63 A;  4MZF B;  3BAG A;  2AXM A;  1L2H A;  1K5V A;  4XKI A;  2VXR A;  3N7J A;  3FFZ A;  3JRR A;  2ZR1 B;  4I1E A;  1PUU B;  4I96 A;  1ONK B;  1ABR B;  2VUA A;  3A22 A;  3BX1 C;  4JKX B;  4R6U B;  3BA7 A;  5F8W A;  3P6J A;  2HZ9 A;  4A7K A;  1JY0 A;  3KMV A;  4ZKT B;  3VWC A;  1HKN A;  4I4V A;  3K1X A;  2FGF A;  3OBR A;  2D7R A;  2J3P A;  4P0K A;  3AH2 A;  4KBB A;  1S0C A;  4GAI A;  3WIN C;  4OEG A;  5FZZ A;  1FWU A;  1XG6 A;  1FMM S;  2FDB M;  1IJT A;  4Z8S B;  6I1B A;  1PWA A;  5DZU A;  3NBN A;  2BFH A;  5BXR A;  1D0H A;  3BAV A;  3OJV A;  5F8Y A;  4GAF A;  1HIB A;  5D62 A;  4CJM A;  2F2F C;  3O3Q A;  4H04 A;  1AVU A;  3HBW A;  1TFM B;  3V0B A;  1RG8 A;  31BI A;  2ZQO A;  4I3N A;  4I7I A;  5BP5 C;  1JLX A;  3CA3 A;  3LLP A;  3FJ9 A;  2LIQ A;  2K43 A;  1Q04 A;  2NVH A;  5E24 E;  1FMZ A;  2FFU A;  3RTI B;  1XZZ A;  4IZX A;  3QR5 A;  1AF9 A;  1DLL A;  4EFQ A;  1K5U A;  2D23 A;  2Z48 A;  3CRI A;  2YUG A;  2AFG A;  4IYB A;  1HCD A;  4J2K A;  4Q9G A;  3VUO A;  2Y9X E;  2QN4 A;  3PHZ A;  3CA0 A;  3JUT A;  3O4D A;  3FJA A;  1A8D A;  4HJJ A;  3AH4 A;  1DFQ A;  2DS0 A;  4XFU A;  1FWV A;  3CA5 A;  3O4O A;  3HN1 A;  3T8S A;  1IT0 A;  21BI A;  1G9D A;  4AN6 A;  4OWL A;  4GP0 A;  41BI A;  1IRP A;  5DUY A;  3WO3 A;  1DZC A;  3FJF A;  1Z4S A;  4I0Y A;  4ION A;  1KNM A;  4IQP A;  3BAO A;  1AVW B;  4Q9P A;  2Q3N B;  1CVS A;  3E8L C;  4OWJ A;  4LO2 A;  4QC4 A;  4MZH A;  3OBT A;  3AH1 A;  3F1R A;  1M16 A;  2UUS A;  5BXP A;  2D44 A;  4END A;  1TTU A;  2VXT I;  5BQU A;  3UJ4 A;  3O49 A;  2FO1 A;  1BLA A;  3ZC9 A;  3BAD A;  3FJE A;  2NZ9 A;  1J0S A;  1S0G A;  5BP5 A;  2X2S A;  3P53 A;  3CA1 A;  4JQ0 A;  4L4H A;  5DSS B;  2FFV A;  1AFC A;  4LO0 A;  2D22 A;  3OGF A;  5F90 A;  1YF8 B;  4EFP A;  3OGG A;  4EEE B;  3BRD A;  2BEB A;  4I6I A;  3FJ8 A;  3SNV A;  1UPS A;  2VSA A;  1GGP B;  2XOA A;  3O4A A;  3OJ2 A;  3FJD A;  1TWE A;  3HAL A;  4WBC A;  4I4P A;  4QKR A;  3UD8 A;  1WD3 A;  4ZLB B;  1PC8 B;  1IRA X;  1V6W A;  3UD9 A;  4P6A A;  4F34 A;  5HPZ A;  3FGM A;  4A7Y A;  2K4A B;  4LO3 A;  4EKX B;  1G9C A;  3R4U A;  4YOL A;  2D24 A;  3BAU A;  2KKI A;  1BFF A;  1FV2 A;  3AZV A;  3I2A A;  1Z2V A;  1Q1U A;  4G6M A;  3A23 A;  3NJ5 A;  4ZGR B;  1DIW A;  1JTC A;  1XYF A;  1ISV A;  3AZW A;  4ISQ A;  3I2X A;  1MC9 A;  1EVT A;  4DCK C;  3O4C A;  4G9N A;  1JT5 A;  3AKG A;  4LO8 B;  3FJC A;  4G6J A;  2Q9X A;  2D43 A;  1T9F A;  3RSJ A;  1DQG A;  1MD6 A;  4FVV A;  2Y9F A;  5FZU A;  3ILA A;  3V0A A;  4F83 A;  3MAL A;  1AVA C;  3ZC8 A;  4J2S A;  1BFC A;  4JKQ A;  4FGF A;  3N7M A;  3RMY A;  5FNW A;  3WO4 A;  2D7I A;  2NYY A;  2E4M C;  2X2T A;  1BLD A;  2ESU A;  1S0D A;  4USP A;  1BFB A;  3FJB A;  2Z49 A;  4J23 B;  3BRF A;  3R4S A;  1S0B A;  1R8O A;  2GO2 A;  1S0F A;  3V79 C;  3FUQ A;  3BTA A;  4USO A;  1YXW A;  3BAQ A;  1RZO B;  4J2Y A;  1BA7 A;  4HR6 C;  2IWT B;  4H75 A;  3WMU A; 
#chains in the Genus database with same CATH homology
 3VT1 A;  3EF2 A;  1IHK A;  4ZFW B;  1DQO A;  2RST A;  4Q91 A;  1AXM A;  2AQZ A;  1ISY A;  3RMX A;  4A7Z A;  4MZG B;  1W3G A;  1XHB A;  3CAH A;  3VT2 A;  5BVP I;  2KLL A;  1M2T B;  3MPP G;  2K8R A;  1JT3 A;  3VSF A;  3O5W B;  1ISW A;  3POK A;  4I4S A;  3RTJ B;  1WBC A;  3BAH A;  1HWO B;  1JQZ A;  3WIN A;  4KEJ A;  4ZFU B;  4I1B A;  4ZA3 B;  2HW9 A;  1I1B A;  3AKH A;  4II0 A;  2MIB A;  1V6U A;  1BFG A;  2NS2 A;  1HWM B;  3CRH A;  2F2F A;  4D8H A;  3ZXG A;  3VEQ A;  1FN0 A;  4ZFY B;  3NBC A;  4I2S A;  2DRZ A;  1ILR 1;  2MLL B;  4GOY A;  1S0L A;  1NUN A;  2ERM A;  4QBC A;  1G82 A;  2ET2 A;  4GOV A;  1WD4 A;  2NM1 A;  4JPZ A;  1NZK A;  4QKS A;  2D20 A;  7I1B A;  3FJK A;  1R8N A;  3OJM A;  1DFC A;  2NTD A;  1QXM A;  5FNX A;  2MC2 A;  3UD7 A;  1FV3 A;  3HMY A;  4XFT A;  3V0B B;  4DEN A;  3VSZ A;  3CRG A;  3BRG C;  4OW4 A;  4QD2 B;  4HA2 A;  2L5X A;  1II4 A;  1YTO A;  4OEE A;  1EV2 A;  1TOO A;  4KEK A;  5GAQ A;  2Y9G A;  4LO1 C;  3N7K A;  1BAS A;  5JMC A;  4X3A A;  3ZXD A;  3H6R B;  1FQ9 A;  4DEP A;  2HWA A;  4XFS A;  1W3A A;  3AJ5 A;  3CQA A;  1ISX A;  4QD2 C;  5DVH A;  1JT7 A;  3D7W B;  4QAL A;  1RY7 A;  1HWP B;  1W3F A;  1ISZ A;  5BOW A;  4D0Z A;  2D1Z A;  2BEA A;  1RML A;  3F62 B;  3NBE A;  3B9U A;  3A07 A;  2F8X C;  4ZOT A;  2P39 A;  8I1B A;  1CE7 B;  4J2X A;  3PUB A;  3TC2 A;  2NP0 A;  1QQK A;  3A21 A;  4I4U A;  3N0K A;  4X37 A;  2LIE A;  4Z9W B;  3Q7Y A;  1ITB A;  4ISR A;  1HWN B;  1SR4 C;  1TIE A;  1YYN A;  1TWM A;  2AAI B;  3BB2 A;  3NBD A;  5B2H A;  1FGA A;  2VLC A;  3WO2 A;  3Q7W A;  3AKF A;  3PG0 A;  1YBI A;  4LO2 C;  3I29 B;  1DJS B;  3WMV A;  2VSE A;  2QYI B;  1IOB A;  5EC5 A;  5BQU C;  1TP0 A;  3CA6 A;  3IAG C;  2KI6 B;  3CA4 A;  3FJH A;  4TLP A;  4LO1 A;  3AJ6 A;  2WBC A;  3N7L A;  4LO7 B;  1BAR A;  1HCE A;  3BA4 A;  3AKI A;  3IM5 A;  2M49 A;  4I4O A;  3FJJ A;  3Q7X A;  5FZY A;  1T4Q A;  4JAW A;  5EHA A;  2HWM A;  4LO0 C;  1N4K A;  3S8K A;  4IHZ A;  9ILB A;  4LO7 C;  3H6R A;  4OWK A;  4P0J A;  2KI4 A;  3WA1 A;  4I4X A;  4H9W A;  3FJI A;  4I4R A;  4L4I A;  2RG9 B;  4X38 A;  2IHO A;  4EB2 B;  4IY9 A;  4KC3 A;  1I1E A;  1E0O A;  1JLY A;  3H6S E;  2RQ9 A;  4D0T A;  3BA5 A;  3PME A;  4X39 A;  4G1R A;  2VU9 A;  4IZE A;  3IIR A;  5I1B A;  4P0L A;  5BXT A;  5D61 A;  2KH2 A;  1PZZ A;  3HOM A;  1Q03 A;  1VCL A;  3IM7 A;  4LO3 C;  1JT4 A;  3IM6 A;  3H6Q A;  1G9B A;  2E4M A;  3UDA A;  2DRY A;  1V6V A;  5EG6 C;  1SR4 A;  3O44 A;  4GP3 A;  1DZD A;  4I4Q A;  3FUO A;  4QO3 A;  4UY4 A;  4JRA A;  3HSM A;  1EYL A;  2P23 A;  1WBA A;  4ZBV B;  3LTQ A;  5G00 A;  3V0A B;  5BXS A;  5JLV A;  2I1B A;  1P63 A;  1PUM B;  1G9A A;  4EFR A;  1AVX B;  3O4B A;  3S8J A;  4QBV A;  1OQL B;  3P6I A;  2Y9W C;  4I4Y A;  3QYD A;  1S0E A;  4G9M A;  4IY8 A;  2WRY A;  1QQL A;  4OEF A;  1V6X A;  2DRE A;  1SZ6 B;  1Z0H A;  4AN7 B;  3W9T A;  3CU1 B;  1F31 A;  4OUJ A;  4KEI A;  2ZQN A;  5F8S A;  4PC4 A;  1IIL A;  3ZX7 A;  3C9Z A;  2GZB A;  4I8M A;  2R9K B;  3UJ0 A;  4JP0 A;  1EPW A;  4I37 A;  3VT0 A;  5D63 A;  4MZF B;  3BAG A;  2AXM A;  1L2H A;  1K5V A;  4XKI A;  2VXR A;  3N7J A;  3FFZ A;  3JRR A;  2ZR1 B;  4I1E A;  1PUU B;  4I96 A;  1ONK B;  1ABR B;  2VUA A;  3A22 A;  3BX1 C;  4JKX B;  4R6U B;  3BA7 A;  5F8W A;  3P6J A;  2HZ9 A;  4A7K A;  1JY0 A;  3KMV A;  4ZKT B;  3VWC A;  1HKN A;  4I4V A;  3K1X A;  2FGF A;  3OBR A;  2D7R A;  2J3P A;  4P0K A;  3AH2 A;  4KBB A;  1S0C A;  4GAI A;  3WIN C;  4OEG A;  5FZZ A;  1FWU A;  1XG6 A;  1FMM S;  2FDB M;  1IJT A;  4Z8S B;  6I1B A;  1PWA A;  5DZU A;  3NBN A;  2BFH A;  5BXR A;  1D0H A;  3BAV A;  3OJV A;  5F8Y A;  4GAF A;  1HIB A;  5D62 A;  4CJM A;  2F2F C;  3O3Q A;  4H04 A;  1AVU A;  3HBW A;  1TFM B;  3V0B A;  1RG8 A;  31BI A;  2ZQO A;  4I3N A;  4I7I A;  5BP5 C;  1JLX A;  3CA3 A;  3LLP A;  3FJ9 A;  2LIQ A;  2K43 A;  1Q04 A;  2NVH A;  5E24 E;  1FMZ A;  2FFU A;  3RTI B;  1XZZ A;  4IZX A;  3QR5 A;  1AF9 A;  1DLL A;  4EFQ A;  1K5U A;  2D23 A;  2Z48 A;  3CRI A;  2YUG A;  2AFG A;  4IYB A;  1HCD A;  4J2K A;  4Q9G A;  3VUO A;  2Y9X E;  2QN4 A;  3PHZ A;  3CA0 A;  3JUT A;  3O4D A;  3FJA A;  1A8D A;  4HJJ A;  3AH4 A;  1DFQ A;  2DS0 A;  4XFU A;  1FWV A;  3CA5 A;  3O4O A;  3HN1 A;  3T8S A;  1IT0 A;  21BI A;  1G9D A;  4AN6 A;  4OWL A;  4GP0 A;  41BI A;  1IRP A;  5DUY A;  3WO3 A;  1DZC A;  3FJF A;  1Z4S A;  4I0Y A;  4ION A;  1KNM A;  4IQP A;  3BAO A;  1AVW B;  4Q9P A;  2Q3N B;  1CVS A;  3E8L C;  4OWJ A;  4LO2 A;  4QC4 A;  4MZH A;  3OBT A;  3AH1 A;  3F1R A;  1M16 A;  2UUS A;  5BXP A;  2D44 A;  4END A;  1TTU A;  2VXT I;  5BQU A;  3UJ4 A;  3O49 A;  2FO1 A;  1BLA A;  3ZC9 A;  3BAD A;  3FJE A;  2NZ9 A;  1J0S A;  1S0G A;  5BP5 A;  2X2S A;  3P53 A;  3CA1 A;  4JQ0 A;  4L4H A;  5DSS B;  2FFV A;  1AFC A;  4LO0 A;  2D22 A;  3OGF A;  5F90 A;  1YF8 B;  4EFP A;  3OGG A;  4EEE B;  3BRD A;  2BEB A;  4I6I A;  3FJ8 A;  3SNV A;  1UPS A;  2VSA A;  1GGP B;  2XOA A;  3O4A A;  3OJ2 A;  3FJD A;  1TWE A;  3HAL A;  4WBC A;  4I4P A;  4QKR A;  3UD8 A;  1WD3 A;  4ZLB B;  1PC8 B;  1IRA X;  1V6W A;  3UD9 A;  4P6A A;  4F34 A;  5HPZ A;  3FGM A;  4A7Y A;  2K4A B;  4LO3 A;  4EKX B;  1G9C A;  3R4U A;  4YOL A;  2D24 A;  3BAU A;  2KKI A;  1BFF A;  1FV2 A;  3AZV A;  3I2A A;  1Z2V A;  1Q1U A;  4G6M A;  3A23 A;  3NJ5 A;  4ZGR B;  1DIW A;  1JTC A;  1XYF A;  1ISV A;  3AZW A;  4ISQ A;  3I2X A;  1MC9 A;  1EVT A;  4DCK C;  3O4C A;  4G9N A;  1JT5 A;  3AKG A;  4LO8 B;  3FJC A;  4G6J A;  2Q9X A;  2D43 A;  1T9F A;  3RSJ A;  1DQG A;  1MD6 A;  4FVV A;  2Y9F A;  5FZU A;  3ILA A;  3V0A A;  4F83 A;  3MAL A;  1AVA C;  3ZC8 A;  4J2S A;  1BFC A;  4JKQ A;  4FGF A;  3N7M A;  3RMY A;  5FNW A;  3WO4 A;  2D7I A;  2NYY A;  2E4M C;  2X2T A;  1BLD A;  2ESU A;  1S0D A;  4USP A;  1BFB A;  3FJB A;  2Z49 A;  4J23 B;  3BRF A;  3R4S A;  1S0B A;  1R8O A;  2GO2 A;  1S0F A;  3V79 C;  3FUQ A;  3BTA A;  4USO A;  1YXW A;  3BAQ A;  1RZO B;  4J2Y A;  1BA7 A;  4HR6 C;  2IWT B;  4H75 A;  3WMU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...