4I4SA

Bel beta-trefoil complex with lactose
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
146
structure length
146
Chain Sequence
VNFPNIPAEGAQFRLRARDTGYVIYSRTENPPLVWQYNGPPYDDQLFTLIYGTGPHQNLYAIKSVPNGRVLFSRTSASPHVGNIAGDGTYNDNWFQFIQDDNDPNSFRIYSLASDTVLYSRTTPDPQFGNYTGAKYDDQLWHFELV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title BEL {beta}-trefoil: A novel lectin with antineoplastic properties in king bolete (Boletus edulis) mushrooms.
pubmed doi rcsb
molecule keywords BEL beta-trefoil
molecule tags Sugar binding protein
total genus 38
structure length 146
sequence length 146
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-11-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 4i4sA00
4ZOTA 1N4KA 1AVUA 3I29B 4HA2A 1PUUB 3NBEA 1HKNA 4D8HA 4LO2C 3ZX7A 2FGFA 4QO3A 4PC4A 3EF2A 2D22A 1FN0A 4QKRA 3R4UA 1ONKB 1JLYA 4OEEA 1HWPB 3O4BA 5DVHA 3ZC9A 5BXSA 1PWAA 1DQGA 2Y9XE 4KC3A 2KH2A 3FJDA 2QYIB 5BVPI 1MC9A 4OWJA 5EC5A 3RTIB 3H6RA 4I4PA 8I1BA 1F31A 1XYFA 2AAIB 3FJAA 2UUSA 3BRFA 4H9WA 5BQUA 1AVXB 31BIA 3NJ5A 2WRYA 4EFQA 3A21A 2AFGA 2VLCA 3FJKA 1BASA 3OGGA 3PHZA 4JQ0A 3O49A 5EHAA 1K5VA 4HJJA 5I1BA 4QBVA 2VSAA 4II0A 1TOOA 4ISQA 4I4QA 4DEPA 1AVWB 4TLPA 4OWKA 5BP5A 1V6WA 4J2KA 4D0ZA 3HSMA 4A7KA 3VSFA 4Q9PA 2MC2A 5F8SA 1V6UA 2FO1A 4LO1C 4LO7B 4G6JA 4WBCA 1TFMB 2ET2A 1WBAA 4EKXB 4ZGRB 2D20A 2L5XA 3VUOA 3OJVA 2ZQNA 4ENDA 1SZ6B 5F90A 1EV2A 1W3AA 1S0BA 2HWMA 3CRGA 2DS0A 3IAGC 1YBIA 3I2AA 3PG0A 1JY0A 2F2FA 2M49A 3ZC8A 4IHZA 2KKIA 3S8JA 3HOMA 3UJ4A 1HIBA 3BAGA 3QYDA 4G9MA 4D0TA 3AKGA 1J0SA 3OGFA 1EVTA 2DRZA 3AKIA 3H6SE 1ISWA 3POKA 4QBCA 5FZYA 3ILAA 1L2HA 3FJ8A 4I2SA 1S0CA 2D1ZA 3O4OA 1TP0A 4LO8B 4J23B 4JPZA 4IZXA 1DJSB 1Q1UA 3VSZA 2Q9XA 4EFRA 4IZEA 3CA3A 3RMXA 2NZ9A 4Q91A 2QN4A 2XOAA 4I4OA 3P53A 2K8RA 2Q3NB 1W3GA 1Z2VA 4ISRA 4USPA 3FGMA 1BFGA 2AXMA 1BA7A 2LIEA 4OEGA 3O44A 3NBDA 4I7IA 3O4AA 5B2HA 2X2TA 4QD2C 3BTAA 2E4MC 4IQPA 4L4HA 3BAQA 1SR4A 4XKIA 3CA6A 2NYYA 5D62A 3AZVA 4HR6C 2P23A 2D7RA 4LO3A 1JQZA 3UJ0A 3IM5A 4X38A 4I96A 5FZUA 4JKQA 3S8KA 2F8XC 4F34A 2NVHA 1BARA 2DREA 1YYNA 1BLDA 4JRAA 1HWNB 1NZKA 1M2TB 3N0KA 4I4SA 1JT4A 3WA1A 1FWVA 1ISZA 3VWCA 1WD4A 4GP3A 4LO0A 2I1BA 1TWMA 4FVVA 1VCLA 1I1BA 3T8SA 3V0AB 3BAUA 3OBTA 1DIWA 1PUMB 2IHOA 1CVSA 1M16A 41BIA 3P6IA 3HBWA 4LO2A 4OWLA 2DRYA 4P0KA 3KMVA 3C9ZA 4GAFA 3V0BB 1WBCA 4QKSA 4P0LA 5BXPA 2Y9WC 2ZR1B 1RMLA 1Z0HA 3BB2A 4F83A 4ZBVB 2BEBA 4I4XA 3CA5A 4I4YA 2VSEA 3FJIA 3NBCA 5BOWA 4X3AA 3N7LA 4G1RA 1G9DA 4ZFYB 1HWOB 3V79C 1AF9A 3MPPG 1IT0A 1IJTA 3UD9A 2ERMA 1IHKA 1S0GA 4Q9GA 3VT2A 1PZZA 3BX1C 2NM1A 1BFBA 3A07A 1XZZA 1DZCA 4DCKC 1T4QA 1JTCA 1OQLB 2RSTA 3HN1A 4Z9WB 3CU1B 4JP0A 5E24E 1BFCA 5D63A 3RTJB 2P39A 2FFUA 2R9KB 1P63A 3CRHA 4J2YA 1ISVA 4EB2B 4IONA 1AXMA 1JT3A 1II4A 1FV3A 1HWMB 4OW4A 1TTUA 2AQZA 3FJFA 3Q7YA 5FNWA 4H04A 3UD8A 2F2FC 3OJMA 3WO4A 2D44A 1K5UA 1TWEA 4KEIA 3Q7WA 4USOA 1MD6A 1RG8A 2Y9FA 4LO1A 4IYBA 4I1BA 4P0JA 1YXWA 3AKFA 4GP0A 4JAWA 1R8OA 1DZDA 1CE7B 4KBBA 3BADA 1DQOA 1S0EA 1UPSA 4X37A 4P6AA 3AJ6A 3WINC 4XFTA 2MIBA 3ZXGA 2BFHA 1BLAA 4A7ZA 4ZFUB 1Q03A 2IWTB 3CQAA 4CJMA 1AFCA 1ISYA 1V6VA 3V0AA 3SNVA 5HPZA 1JT5A 3O4CA 1NUNA 4I4VA 3IIRA 4QC4A 1FGAA 4ZFWB 4ZLBB 2X2SA 3V0BA 3AH2A 1QQKA 3BA7A 1W3FA 1XG6A 6I1BA 1WD3A 3R4SA 1ILR1 3A22A 2VXRA 3UDAA 1IILA 4Z8SB 1XHBA 3CRIA 4I4UA 5FZZA 2VU9A 3CAHA 3PUBA 2Z48A 3BAHA 3WMUA 4I0YA 4DENA 1FWUA 4I37A 3WMVA 3A23A 5JLVA 3LTQA 4I4RA 3LLPA 4J2XA 1YF8B 2E4MA 2D23A 1GGPB 1Q04A 2GZBA 4I3NA 4I8MA 1FMMS 3I2XA 4ZKTB 1T9FA 3AJ5A 2YUGA 5GAQA 3CA4A 4J2SA 5F8YA 1FV2A 3AH1A 2D7IA 4X39A 5BQUC 1BFFA 3BRGC 1EYLA 1D0HA 4FGFA 3O4DA 1ABRB 1IOBA 4EEEB 3HALA 5BXRA 1R8NA 3FJ9A 1HCDA 2HW9A 2RQ9A 4KEJA 4AN6A 3JUTA 3FJHA 1DFCA 2GO2A 3BAVA 3PMEA 2KLLA 1FMZA 4G9NA 4GOYA 5EG6C 3FFZA 1IRPA 5BP5C 3B9UA 1AVAC 4QD2B 5DZUA 1QXMA 9ILBA 3K1XA 4OUJA 3O3QA 1S0FA 4I1EA 1TIEA 4IY8A 2BEAA 4A7YA 1QQLA 3F62B 4G6MA 1YTOA 1G9CA 4YOLA 4EFPA 3VT1A 2LIQA 2FFVA 3E8LC 3JRRA 1V6XA 4XFUA 3FUQA 1RZOB 1HCEA 2K43A 3N7JA 2K4AB 3CA0A 2HZ9A 5DUYA 2HWAA 3AKHA 1G9BA 3W9TA 3IM6A 1DFQA 4GAIA 4I6IA 5DSSB 5G00A 1E0OA 2Y9GA 3H6RB 4QALA 3O5WB 5F8WA 5FNXA 3TC2A 3ZXDA 3RSJA 3VT0A 3WO2A 3H6QA 3MALA 2D43A 4L4IA 3AH4A 3BAOA 1ITBA 2J3PA 5JMCA 1S0DA 1EPWA 2NP0A 1G82A 3N7MA 3N7KA 1FQ9A 3IM7A 5D61A 3NBNA 2WBCA 4IY9A 1A8DA 3FJEA 3FJJA 1Z4SA 4ZA3B 21BIA 3F1RA 2VXTI 3CA1A 4JKXB 3OBRA 2RG9B 1SR4C 3BRDA 1JT7A 2Z49A 3RMYA 7I1BA 2D24A 4KEKA 4R6UB 3FJBA 1S0LA 2KI6B 1PC8B 4LO3C 3FJCA 1KNMA 3WINA 5BXTA 2NTDA 3HMYA 4GOVA 3OJ2A 4XFSA 3QR5A 1G9AA 2VUAA 2MLLB 3VEQA 3AZWA 2FDBM 3UD7A 1JLXA 3Q7XA 1DLLA 1IRAX 2KI4A 4OEFA 3D7WB 3P6JA 4LO0C 3BA4A 2ZQOA 3BA5A 3WO3A 1RY7A 1ISXA 4AN7B 2ESUA 3FUOA 4LO7C 1I1EA
chains in the Genus database with same CATH superfamily
4ZOTA 1N4KA 1AVUA 3I29B 4HA2A 1PUUB 3NBEA 1HKNA 4D8HA 4LO2C 3ZX7A 2FGFA 4QO3A 4PC4A 3EF2A 2D22A 1FN0A 4QKRA 3R4UA 1ONKB 1JLYA 4OEEA 1HWPB 3O4BA 5DVHA 3ZC9A 5BXSA 1PWAA 1DQGA 2Y9XE 4KC3A 2KH2A 3FJDA 2QYIB 5BVPI 1MC9A 4OWJA 5EC5A 3RTIB 3H6RA 4I4PA 8I1BA 1F31A 1XYFA 2AAIB 3FJAA 2UUSA 3BRFA 4H9WA 5BQUA 1AVXB 31BIA 3NJ5A 2WRYA 4EFQA 3A21A 2AFGA 2VLCA 3FJKA 1BASA 3OGGA 3PHZA 4JQ0A 3O49A 5EHAA 1K5VA 4HJJA 5I1BA 4QBVA 2VSAA 4II0A 1TOOA 4ISQA 4I4QA 4DEPA 1AVWB 4TLPA 4OWKA 5BP5A 1V6WA 4J2KA 4D0ZA 3HSMA 4A7KA 3VSFA 4Q9PA 2MC2A 5F8SA 1V6UA 2FO1A 4LO1C 4LO7B 4G6JA 4MZHA 4WBCA 1TFMB 2ET2A 1WBAA 4EKXB 4ZGRB 2D20A 2L5XA 3VUOA 3OJVA 2ZQNA 4ENDA 1SZ6B 5F90A 1EV2A 1W3AA 1S0BA 2HWMA 3CRGA 2DS0A 4MZGB 3IAGC 1YBIA 3I2AA 3PG0A 1JY0A 2F2FA 2M49A 3ZC8A 4IHZA 2KKIA 3S8JA 3HOMA 3UJ4A 1HIBA 3BAGA 3QYDA 4G9MA 4D0TA 3AKGA 1J0SA 3OGFA 1EVTA 2DRZA 3AKIA 3H6SE 1ISWA 3POKA 4QBCA 5FZYA 3ILAA 1L2HA 3FJ8A 4I2SA 1S0CA 2D1ZA 3O4OA 1TP0A 4LO8B 4J23B 4JPZA 4IZXA 1DJSB 1Q1UA 3VSZA 2Q9XA 4EFRA 4IZEA 3CA3A 3RMXA 2NZ9A 4Q91A 2QN4A 2XOAA 4I4OA 3P53A 2K8RA 2Q3NB 1W3GA 1Z2VA 4ISRA 4USPA 3FGMA 1BFGA 2AXMA 1BA7A 2LIEA 4OEGA 3O44A 3NBDA 4I7IA 3O4AA 5B2HA 2X2TA 4QD2C 3BTAA 2E4MC 4IQPA 4L4HA 3BAQA 1SR4A 4XKIA 3CA6A 2NYYA 5D62A 3AZVA 4HR6C 2P23A 2D7RA 4LO3A 1JQZA 3UJ0A 3IM5A 4X38A 4I96A 5FZUA 4JKQA 4H75A 3S8KA 2F8XC 4F34A 2NVHA 1BARA 2DREA 1YYNA 1BLDA 4JRAA 1HWNB 1NZKA 1M2TB 3N0KA 4I4SA 1JT4A 3WA1A 1FWVA 1ISZA 3VWCA 1WD4A 4GP3A 4LO0A 2I1BA 1TWMA 4FVVA 1VCLA 1I1BA 3T8SA 3V0AB 3BAUA 3OBTA 1DIWA 1PUMB 2IHOA 1CVSA 1M16A 41BIA 3P6IA 3HBWA 4LO2A 4OWLA 2DRYA 4P0KA 3KMVA 3C9ZA 4GAFA 3V0BB 1WBCA 4QKSA 4P0LA 5BXPA 2Y9WC 2ZR1B 1RMLA 2NS2A 1Z0HA 3BB2A 4F83A 4ZBVB 2BEBA 4I4XA 3CA5A 4I4YA 2VSEA 3FJIA 3NBCA 5BOWA 4X3AA 3N7LA 4G1RA 1G9DA 4ZFYB 1HWOB 3V79C 1AF9A 3MPPG 1IT0A 1IJTA 3UD9A 2ERMA 1IHKA 1S0GA 4Q9GA 3VT2A 1PZZA 3BX1C 2NM1A 1BFBA 3A07A 1XZZA 1DZCA 4DCKC 1T4QA 1JTCA 1OQLB 2RSTA 3HN1A 4Z9WB 3CU1B 4JP0A 5E24E 1BFCA 5D63A 3RTJB 2P39A 2FFUA 2R9KB 1P63A 3CRHA 4J2YA 1ISVA 4EB2B 4IONA 1AXMA 1JT3A 1II4A 1FV3A 1HWMB 4OW4A 1TTUA 2AQZA 3FJFA 3Q7YA 5FNWA 4H04A 3UD8A 2F2FC 3OJMA 3WO4A 2D44A 1K5UA 1TWEA 4KEIA 3Q7WA 4USOA 1MD6A 1RG8A 2Y9FA 4LO1A 4IYBA 4I1BA 4P0JA 1YXWA 3AKFA 4GP0A 4JAWA 1R8OA 1DZDA 1CE7B 4KBBA 3BADA 1DQOA 1S0EA 1UPSA 4X37A 4P6AA 3AJ6A 3WINC 4XFTA 2MIBA 3ZXGA 2BFHA 1BLAA 4A7ZA 4ZFUB 1Q03A 2IWTB 3CQAA 4CJMA 1AFCA 1ISYA 1V6VA 3V0AA 3SNVA 5HPZA 1JT5A 3O4CA 1NUNA 4I4VA 3IIRA 4QC4A 1FGAA 4ZFWB 4ZLBB 2X2SA 3V0BA 3AH2A 1QQKA 3BA7A 1W3FA 1XG6A 6I1BA 1WD3A 3R4SA 1ILR1 3A22A 2VXRA 3UDAA 1IILA 4Z8SB 1XHBA 3CRIA 4I4UA 5FZZA 2VU9A 3CAHA 4MZFB 4UY4A 3PUBA 2Z48A 3BAHA 3WMUA 4I0YA 4DENA 1FWUA 4I37A 3WMVA 3A23A 5JLVA 3LTQA 4I4RA 3LLPA 4J2XA 1YF8B 2E4MA 2D23A 1GGPB 1Q04A 2GZBA 4I3NA 4I8MA 1FMMS 3I2XA 4ZKTB 1T9FA 3AJ5A 2YUGA 5GAQA 3CA4A 4J2SA 5F8YA 1FV2A 3AH1A 2D7IA 4X39A 5BQUC 1BFFA 3BRGC 1EYLA 1D0HA 4FGFA 3O4DA 1ABRB 1IOBA 4EEEB 3HALA 5BXRA 1R8NA 3FJ9A 1HCDA 2HW9A 2RQ9A 4KEJA 4AN6A 3JUTA 3FJHA 1DFCA 2GO2A 3BAVA 3PMEA 2KLLA 1FMZA 4G9NA 4GOYA 5EG6C 3FFZA 1IRPA 5BP5C 3B9UA 1AVAC 4QD2B 5DZUA 1QXMA 9ILBA 3K1XA 4OUJA 3O3QA 1S0FA 4I1EA 1TIEA 4IY8A 2BEAA 4A7YA 1QQLA 3F62B 4G6MA 1YTOA 1G9CA 4YOLA 4EFPA 3VT1A 2LIQA 2FFVA 3E8LC 3JRRA 1V6XA 4XFUA 3FUQA 1RZOB 1HCEA 2K43A 3N7JA 2K4AB 3CA0A 2HZ9A 5DUYA 2HWAA 3AKHA 1G9BA 3W9TA 3IM6A 1DFQA 4GAIA 4I6IA 5DSSB 5G00A 1E0OA 2Y9GA 3H6RB 4QALA 3O5WB 5F8WA 5FNXA 3TC2A 3ZXDA 3RSJA 3VT0A 3WO2A 3H6QA 3MALA 2D43A 4L4IA 3AH4A 3BAOA 1ITBA 2J3PA 5JMCA 1S0DA 1EPWA 2NP0A 1G82A 3N7MA 3N7KA 1FQ9A 3IM7A 5D61A 3NBNA 2WBCA 4IY9A 1A8DA 3FJEA 3FJJA 1Z4SA 4ZA3B 21BIA 3F1RA 2VXTI 3CA1A 4JKXB 3OBRA 2RG9B 1SR4C 3BRDA 1JT7A 2Z49A 3RMYA 7I1BA 2D24A 4KEKA 4R6UB 3FJBA 1S0LA 2KI6B 1PC8B 4LO3C 3FJCA 1KNMA 3WINA 5BXTA 2NTDA 3HMYA 4GOVA 3OJ2A 4XFSA 3QR5A 1G9AA 2VUAA 2MLLB 3VEQA 3AZWA 2FDBM 3UD7A 1JLXA 3Q7XA 1DLLA 1IRAX 2KI4A 4OEFA 3D7WB 3P6JA 4LO0C 3BA4A 2ZQOA 3BA5A 3WO3A 1RY7A 1ISXA 4AN7B 2ESUA 3FUOA 4LO7C 1I1EA
chains in the Genus database with same CATH topology
4ZOTA 1N4KA 1AVUA 3I29B 4HA2A 1PUUB 3NBEA 1HKNA 4D8HA 4LO2C 3ZX7A 2FGFA 4QO3A 4PC4A 3EF2A 2D22A 1FN0A 4QKRA 3R4UA 1ONKB 1JLYA 4OEEA 1HWPB 3O4BA 5DVHA 3ZC9A 5BXSA 1PWAA 1DQGA 2Y9XE 4KC3A 2KH2A 3FJDA 2QYIB 5BVPI 1MC9A 4OWJA 5EC5A 3RTIB 3H6RA 4I4PA 8I1BA 1F31A 1XYFA 2AAIB 3FJAA 2UUSA 3BRFA 4H9WA 5BQUA 1AVXB 31BIA 3NJ5A 2WRYA 4EFQA 3A21A 2AFGA 2VLCA 3FJKA 1BASA 3OGGA 3PHZA 4JQ0A 3O49A 5EHAA 1K5VA 4HJJA 5I1BA 4QBVA 2VSAA 4II0A 1TOOA 4ISQA 4I4QA 4DEPA 1AVWB 4TLPA 4OWKA 5BP5A 1V6WA 4J2KA 4D0ZA 3HSMA 4A7KA 3VSFA 4Q9PA 2MC2A 5F8SA 1V6UA 2FO1A 4LO1C 4LO7B 4G6JA 4MZHA 4WBCA 1TFMB 2ET2A 1WBAA 4EKXB 4ZGRB 2D20A 2L5XA 3VUOA 3OJVA 2ZQNA 4ENDA 1SZ6B 5F90A 1EV2A 1W3AA 1S0BA 2HWMA 3CRGA 2DS0A 4MZGB 3IAGC 1YBIA 3I2AA 3PG0A 1JY0A 2F2FA 2M49A 3ZC8A 4IHZA 2KKIA 3S8JA 3HOMA 3UJ4A 1HIBA 3BAGA 3QYDA 4G9MA 4D0TA 3AKGA 1J0SA 3OGFA 1EVTA 2DRZA 3AKIA 3H6SE 1ISWA 3POKA 4QBCA 5FZYA 3ILAA 1L2HA 3FJ8A 4I2SA 1S0CA 2D1ZA 3O4OA 1TP0A 4LO8B 4J23B 4JPZA 4IZXA 1DJSB 1Q1UA 3VSZA 2Q9XA 4EFRA 4IZEA 3CA3A 3RMXA 2NZ9A 4Q91A 2QN4A 2XOAA 4I4OA 3P53A 2K8RA 2Q3NB 1W3GA 1Z2VA 4ISRA 4USPA 3FGMA 1BFGA 2AXMA 1BA7A 2LIEA 4OEGA 3O44A 3NBDA 4I7IA 3O4AA 5B2HA 2X2TA 4QD2C 3BTAA 2E4MC 4IQPA 4L4HA 3BAQA 1SR4A 4XKIA 3CA6A 2NYYA 5D62A 3AZVA 4HR6C 2P23A 2D7RA 4LO3A 1JQZA 3UJ0A 3IM5A 4X38A 4I96A 5FZUA 4JKQA 4H75A 3S8KA 2F8XC 4F34A 2NVHA 1BARA 2DREA 1YYNA 1BLDA 4JRAA 1HWNB 1NZKA 1M2TB 3N0KA 4I4SA 1JT4A 3WA1A 1FWVA 1ISZA 3VWCA 1WD4A 4GP3A 4LO0A 2I1BA 1TWMA 4FVVA 1VCLA 1I1BA 3T8SA 3V0AB 3BAUA 3OBTA 1DIWA 1PUMB 2IHOA 1CVSA 1M16A 41BIA 3P6IA 3HBWA 4LO2A 4OWLA 2DRYA 4P0KA 3KMVA 3C9ZA 4GAFA 3V0BB 1WBCA 4QKSA 4P0LA 5BXPA 2Y9WC 2ZR1B 1RMLA 2NS2A 1Z0HA 3BB2A 4F83A 4ZBVB 2BEBA 4I4XA 3CA5A 4I4YA 2VSEA 3FJIA 3NBCA 5BOWA 4X3AA 3N7LA 4G1RA 1G9DA 4ZFYB 1HWOB 3V79C 1AF9A 3MPPG 1IT0A 1IJTA 3UD9A 2ERMA 1IHKA 1S0GA 4Q9GA 3VT2A 1PZZA 3BX1C 2NM1A 1BFBA 3A07A 1XZZA 1DZCA 4DCKC 1T4QA 1JTCA 1OQLB 2RSTA 3HN1A 4Z9WB 3CU1B 4JP0A 5E24E 1BFCA 5D63A 3RTJB 2P39A 2FFUA 2R9KB 1P63A 3CRHA 4J2YA 1ISVA 4EB2B 4IONA 1AXMA 1JT3A 1II4A 1FV3A 1HWMB 4OW4A 1TTUA 2AQZA 3FJFA 3Q7YA 5FNWA 4H04A 3UD8A 2F2FC 3OJMA 3WO4A 2D44A 1K5UA 1TWEA 4KEIA 3Q7WA 4USOA 1MD6A 1RG8A 2Y9FA 4LO1A 4IYBA 4I1BA 4P0JA 1YXWA 3AKFA 4GP0A 4JAWA 1R8OA 1DZDA 1CE7B 4KBBA 3BADA 1DQOA 1S0EA 1UPSA 4X37A 4P6AA 3AJ6A 3WINC 4XFTA 2MIBA 3ZXGA 2BFHA 1BLAA 4A7ZA 4ZFUB 1Q03A 2IWTB 3CQAA 4CJMA 1AFCA 1ISYA 1V6VA 3V0AA 3SNVA 5HPZA 1JT5A 3O4CA 1NUNA 4I4VA 3IIRA 4QC4A 1FGAA 4ZFWB 4ZLBB 2X2SA 3V0BA 3AH2A 1QQKA 3BA7A 1W3FA 1XG6A 6I1BA 1WD3A 3R4SA 1ILR1 3A22A 2VXRA 3UDAA 1IILA 4Z8SB 1XHBA 3CRIA 4I4UA 5FZZA 2VU9A 3CAHA 4MZFB 4UY4A 3PUBA 2Z48A 3BAHA 3WMUA 4I0YA 4DENA 1FWUA 4I37A 3WMVA 3A23A 5JLVA 3LTQA 4I4RA 3LLPA 4J2XA 1YF8B 2E4MA 2D23A 1GGPB 1Q04A 2GZBA 4I3NA 4I8MA 1FMMS 3I2XA 4ZKTB 1T9FA 3AJ5A 2YUGA 5GAQA 3CA4A 4J2SA 5F8YA 1FV2A 3AH1A 2D7IA 4X39A 5BQUC 1BFFA 3BRGC 1EYLA 1D0HA 4FGFA 3O4DA 1ABRB 1IOBA 4EEEB 3HALA 5BXRA 1R8NA 3FJ9A 1HCDA 2HW9A 2RQ9A 4KEJA 4AN6A 3JUTA 3FJHA 1DFCA 2GO2A 3BAVA 3PMEA 2KLLA 1FMZA 4G9NA 4GOYA 5EG6C 3FFZA 1IRPA 5BP5C 3B9UA 1AVAC 4QD2B 5DZUA 1QXMA 9ILBA 3K1XA 4OUJA 3O3QA 1S0FA 4I1EA 1TIEA 4IY8A 2BEAA 4A7YA 1QQLA 3F62B 4G6MA 1YTOA 1G9CA 4YOLA 4EFPA 3VT1A 2LIQA 2FFVA 3E8LC 3JRRA 1V6XA 4XFUA 3FUQA 1RZOB 1HCEA 2K43A 3N7JA 2K4AB 3CA0A 2HZ9A 5DUYA 2HWAA 3AKHA 1G9BA 3W9TA 3IM6A 1DFQA 4GAIA 4I6IA 5DSSB 5G00A 1E0OA 2Y9GA 3H6RB 4QALA 3O5WB 5F8WA 5FNXA 3TC2A 3ZXDA 3RSJA 3VT0A 3WO2A 3H6QA 3MALA 2D43A 4L4IA 3AH4A 3BAOA 1ITBA 2J3PA 5JMCA 1S0DA 1EPWA 2NP0A 1G82A 3N7MA 3N7KA 1FQ9A 3IM7A 5D61A 3NBNA 2WBCA 4IY9A 1A8DA 3FJEA 3FJJA 1Z4SA 4ZA3B 21BIA 3F1RA 2VXTI 3CA1A 4JKXB 3OBRA 2RG9B 1SR4C 3BRDA 1JT7A 2Z49A 3RMYA 7I1BA 2D24A 4KEKA 4R6UB 3FJBA 1S0LA 2KI6B 1PC8B 4LO3C 3FJCA 1KNMA 3WINA 5BXTA 2NTDA 3HMYA 4GOVA 3OJ2A 4XFSA 3QR5A 1G9AA 2VUAA 2MLLB 3VEQA 3AZWA 2FDBM 3UD7A 1JLXA 3Q7XA 1DLLA 1IRAX 2KI4A 4OEFA 3D7WB 3P6JA 4LO0C 3BA4A 2ZQOA 3BA5A 3WO3A 1RY7A 1ISXA 4AN7B 2ESUA 3FUOA 4LO7C 1I1EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZOT A;  1N4K A;  1AVU A;  3I29 B;  4HA2 A;  1PUU B;  3NBE A;  1HKN A;  4D8H A;  4LO2 C;  3ZX7 A;  2FGF A;  4QO3 A;  4PC4 A;  3EF2 A;  2D22 A;  1FN0 A;  4QKR A;  3R4U A;  1ONK B;  1JLY A;  4OEE A;  1HWP B;  3O4B A;  5DVH A;  3ZC9 A;  5BXS A;  1PWA A;  1DQG A;  2Y9X E;  4KC3 A;  2KH2 A;  3FJD A;  2QYI B;  5BVP I;  1MC9 A;  4OWJ A;  5EC5 A;  3RTI B;  3H6R A;  4I4P A;  8I1B A;  1F31 A;  1XYF A;  2AAI B;  3FJA A;  2UUS A;  3BRF A;  4H9W A;  5BQU A;  1AVX B;  31BI A;  3NJ5 A;  2WRY A;  4EFQ A;  3A21 A;  2AFG A;  2VLC A;  3FJK A;  1BAS A;  3OGG A;  3PHZ A;  4JQ0 A;  3O49 A;  5EHA A;  1K5V A;  4HJJ A;  5I1B A;  4QBV A;  2VSA A;  4II0 A;  1TOO A;  4ISQ A;  4I4Q A;  4DEP A;  1AVW B;  4TLP A;  4OWK A;  5BP5 A;  1V6W A;  4J2K A;  4D0Z A;  3HSM A;  4A7K A;  3VSF A;  4Q9P A;  2MC2 A;  5F8S A;  1V6U A;  2FO1 A;  4LO1 C;  4LO7 B;  4G6J A;  4WBC A;  1TFM B;  2ET2 A;  1WBA A;  4EKX B;  4ZGR B;  2D20 A;  2L5X A;  3VUO A;  3OJV A;  2ZQN A;  4END A;  1SZ6 B;  5F90 A;  1EV2 A;  1W3A A;  1S0B A;  2HWM A;  3CRG A;  2DS0 A;  3IAG C;  1YBI A;  3I2A A;  3PG0 A;  1JY0 A;  2F2F A;  2M49 A;  3ZC8 A;  4IHZ A;  2KKI A;  3S8J A;  3HOM A;  3UJ4 A;  1HIB A;  3BAG A;  3QYD A;  4G9M A;  4D0T A;  3AKG A;  1J0S A;  3OGF A;  1EVT A;  2DRZ A;  3AKI A;  3H6S E;  1ISW A;  3POK A;  4QBC A;  5FZY A;  3ILA A;  1L2H A;  3FJ8 A;  4I2S A;  1S0C A;  2D1Z A;  3O4O A;  1TP0 A;  4LO8 B;  4J23 B;  4JPZ A;  4IZX A;  1DJS B;  1Q1U A;  3VSZ A;  2Q9X A;  4EFR A;  4IZE A;  3CA3 A;  3RMX A;  2NZ9 A;  4Q91 A;  2QN4 A;  2XOA A;  4I4O A;  3P53 A;  2K8R A;  2Q3N B;  1W3G A;  1Z2V A;  4ISR A;  4USP A;  3FGM A;  1BFG A;  2AXM A;  1BA7 A;  2LIE A;  4OEG A;  3O44 A;  3NBD A;  4I7I A;  3O4A A;  5B2H A;  2X2T A;  4QD2 C;  3BTA A;  2E4M C;  4IQP A;  4L4H A;  3BAQ A;  1SR4 A;  4XKI A;  3CA6 A;  2NYY A;  5D62 A;  3AZV A;  4HR6 C;  2P23 A;  2D7R A;  4LO3 A;  1JQZ A;  3UJ0 A;  3IM5 A;  4X38 A;  4I96 A;  5FZU A;  4JKQ A;  3S8K A;  2F8X C;  4F34 A;  2NVH A;  1BAR A;  2DRE A;  1YYN A;  1BLD A;  4JRA A;  1HWN B;  1NZK A;  1M2T B;  3N0K A;  4I4S A;  1JT4 A;  3WA1 A;  1FWV A;  1ISZ A;  3VWC A;  1WD4 A;  4GP3 A;  4LO0 A;  2I1B A;  1TWM A;  4FVV A;  1VCL A;  1I1B A;  3T8S A;  3V0A B;  3BAU A;  3OBT A;  1DIW A;  1PUM B;  2IHO A;  1CVS A;  1M16 A;  41BI A;  3P6I A;  3HBW A;  4LO2 A;  4OWL A;  2DRY A;  4P0K A;  3KMV A;  3C9Z A;  4GAF A;  3V0B B;  1WBC A;  4QKS A;  4P0L A;  5BXP A;  2Y9W C;  2ZR1 B;  1RML A;  1Z0H A;  3BB2 A;  4F83 A;  4ZBV B;  2BEB A;  4I4X A;  3CA5 A;  4I4Y A;  2VSE A;  3FJI A;  3NBC A;  5BOW A;  4X3A A;  3N7L A;  4G1R A;  1G9D A;  4ZFY B;  1HWO B;  3V79 C;  1AF9 A;  3MPP G;  1IT0 A;  1IJT A;  3UD9 A;  2ERM A;  1IHK A;  1S0G A;  4Q9G A;  3VT2 A;  1PZZ A;  3BX1 C;  2NM1 A;  1BFB A;  3A07 A;  1XZZ A;  1DZC A;  4DCK C;  1T4Q A;  1JTC A;  1OQL B;  2RST A;  3HN1 A;  4Z9W B;  3CU1 B;  4JP0 A;  5E24 E;  1BFC A;  5D63 A;  3RTJ B;  2P39 A;  2FFU A;  2R9K B;  1P63 A;  3CRH A;  4J2Y A;  1ISV A;  4EB2 B;  4ION A;  1AXM A;  1JT3 A;  1II4 A;  1FV3 A;  1HWM B;  4OW4 A;  1TTU A;  2AQZ A;  3FJF A;  3Q7Y A;  5FNW A;  4H04 A;  3UD8 A;  2F2F C;  3OJM A;  3WO4 A;  2D44 A;  1K5U A;  1TWE A;  4KEI A;  3Q7W A;  4USO A;  1MD6 A;  1RG8 A;  2Y9F A;  4LO1 A;  4IYB A;  4I1B A;  4P0J A;  1YXW A;  3AKF A;  4GP0 A;  4JAW A;  1R8O A;  1DZD A;  1CE7 B;  4KBB A;  3BAD A;  1DQO A;  1S0E A;  1UPS A;  4X37 A;  4P6A A;  3AJ6 A;  3WIN C;  4XFT A;  2MIB A;  3ZXG A;  2BFH A;  1BLA A;  4A7Z A;  4ZFU B;  1Q03 A;  2IWT B;  3CQA A;  4CJM A;  1AFC A;  1ISY A;  1V6V A;  3V0A A;  3SNV A;  5HPZ A;  1JT5 A;  3O4C A;  1NUN A;  4I4V A;  3IIR A;  4QC4 A;  1FGA A;  4ZFW B;  4ZLB B;  2X2S A;  3V0B A;  3AH2 A;  1QQK A;  3BA7 A;  1W3F A;  1XG6 A;  6I1B A;  1WD3 A;  3R4S A;  1ILR 1;  3A22 A;  2VXR A;  3UDA A;  1IIL A;  4Z8S B;  1XHB A;  3CRI A;  4I4U A;  5FZZ A;  2VU9 A;  3CAH A;  3PUB A;  2Z48 A;  3BAH A;  3WMU A;  4I0Y A;  4DEN A;  1FWU A;  4I37 A;  3WMV A;  3A23 A;  5JLV A;  3LTQ A;  4I4R A;  3LLP A;  4J2X A;  1YF8 B;  2E4M A;  2D23 A;  1GGP B;  1Q04 A;  2GZB A;  4I3N A;  4I8M A;  1FMM S;  3I2X A;  4ZKT B;  1T9F A;  3AJ5 A;  2YUG A;  5GAQ A;  3CA4 A;  4J2S A;  5F8Y A;  1FV2 A;  3AH1 A;  2D7I A;  4X39 A;  5BQU C;  1BFF A;  3BRG C;  1EYL A;  1D0H A;  4FGF A;  3O4D A;  1ABR B;  1IOB A;  4EEE B;  3HAL A;  5BXR A;  1R8N A;  3FJ9 A;  1HCD A;  2HW9 A;  2RQ9 A;  4KEJ A;  4AN6 A;  3JUT A;  3FJH A;  1DFC A;  2GO2 A;  3BAV A;  3PME A;  2KLL A;  1FMZ A;  4G9N A;  4GOY A;  5EG6 C;  3FFZ A;  1IRP A;  5BP5 C;  3B9U A;  1AVA C;  4QD2 B;  5DZU A;  1QXM A;  9ILB A;  3K1X A;  4OUJ A;  3O3Q A;  1S0F A;  4I1E A;  1TIE A;  4IY8 A;  2BEA A;  4A7Y A;  1QQL A;  3F62 B;  4G6M A;  1YTO A;  1G9C A;  4YOL A;  4EFP A;  3VT1 A;  2LIQ A;  2FFV A;  3E8L C;  3JRR A;  1V6X A;  4XFU A;  3FUQ A;  1RZO B;  1HCE A;  2K43 A;  3N7J A;  2K4A B;  3CA0 A;  2HZ9 A;  5DUY A;  2HWA A;  3AKH A;  1G9B A;  3W9T A;  3IM6 A;  1DFQ A;  4GAI A;  4I6I A;  5DSS B;  5G00 A;  1E0O A;  2Y9G A;  3H6R B;  4QAL A;  3O5W B;  5F8W A;  5FNX A;  3TC2 A;  3ZXD A;  3RSJ A;  3VT0 A;  3WO2 A;  3H6Q A;  3MAL A;  2D43 A;  4L4I A;  3AH4 A;  3BAO A;  1ITB A;  2J3P A;  5JMC A;  1S0D A;  1EPW A;  2NP0 A;  1G82 A;  3N7M A;  3N7K A;  1FQ9 A;  3IM7 A;  5D61 A;  3NBN A;  2WBC A;  4IY9 A;  1A8D A;  3FJE A;  3FJJ A;  1Z4S A;  4ZA3 B;  21BI A;  3F1R A;  2VXT I;  3CA1 A;  4JKX B;  3OBR A;  2RG9 B;  1SR4 C;  3BRD A;  1JT7 A;  2Z49 A;  3RMY A;  7I1B A;  2D24 A;  4KEK A;  4R6U B;  3FJB A;  1S0L A;  2KI6 B;  1PC8 B;  4LO3 C;  3FJC A;  1KNM A;  3WIN A;  5BXT A;  2NTD A;  3HMY A;  4GOV A;  3OJ2 A;  4XFS A;  3QR5 A;  1G9A A;  2VUA A;  2MLL B;  3VEQ A;  3AZW A;  2FDB M;  3UD7 A;  1JLX A;  3Q7X A;  1DLL A;  1IRA X;  2KI4 A;  4OEF A;  3D7W B;  3P6J A;  4LO0 C;  3BA4 A;  2ZQO A;  3BA5 A;  3WO3 A;  1RY7 A;  1ISX A;  4AN7 B;  2ESU A;  3FUO A;  4LO7 C;  1I1E A; 
#chains in the Genus database with same CATH topology
 4ZOT A;  1N4K A;  1AVU A;  3I29 B;  4HA2 A;  1PUU B;  3NBE A;  1HKN A;  4D8H A;  4LO2 C;  3ZX7 A;  2FGF A;  4QO3 A;  4PC4 A;  3EF2 A;  2D22 A;  1FN0 A;  4QKR A;  3R4U A;  1ONK B;  1JLY A;  4OEE A;  1HWP B;  3O4B A;  5DVH A;  3ZC9 A;  5BXS A;  1PWA A;  1DQG A;  2Y9X E;  4KC3 A;  2KH2 A;  3FJD A;  2QYI B;  5BVP I;  1MC9 A;  4OWJ A;  5EC5 A;  3RTI B;  3H6R A;  4I4P A;  8I1B A;  1F31 A;  1XYF A;  2AAI B;  3FJA A;  2UUS A;  3BRF A;  4H9W A;  5BQU A;  1AVX B;  31BI A;  3NJ5 A;  2WRY A;  4EFQ A;  3A21 A;  2AFG A;  2VLC A;  3FJK A;  1BAS A;  3OGG A;  3PHZ A;  4JQ0 A;  3O49 A;  5EHA A;  1K5V A;  4HJJ A;  5I1B A;  4QBV A;  2VSA A;  4II0 A;  1TOO A;  4ISQ A;  4I4Q A;  4DEP A;  1AVW B;  4TLP A;  4OWK A;  5BP5 A;  1V6W A;  4J2K A;  4D0Z A;  3HSM A;  4A7K A;  3VSF A;  4Q9P A;  2MC2 A;  5F8S A;  1V6U A;  2FO1 A;  4LO1 C;  4LO7 B;  4G6J A;  4MZH A;  4WBC A;  1TFM B;  2ET2 A;  1WBA A;  4EKX B;  4ZGR B;  2D20 A;  2L5X A;  3VUO A;  3OJV A;  2ZQN A;  4END A;  1SZ6 B;  5F90 A;  1EV2 A;  1W3A A;  1S0B A;  2HWM A;  3CRG A;  2DS0 A;  4MZG B;  3IAG C;  1YBI A;  3I2A A;  3PG0 A;  1JY0 A;  2F2F A;  2M49 A;  3ZC8 A;  4IHZ A;  2KKI A;  3S8J A;  3HOM A;  3UJ4 A;  1HIB A;  3BAG A;  3QYD A;  4G9M A;  4D0T A;  3AKG A;  1J0S A;  3OGF A;  1EVT A;  2DRZ A;  3AKI A;  3H6S E;  1ISW A;  3POK A;  4QBC A;  5FZY A;  3ILA A;  1L2H A;  3FJ8 A;  4I2S A;  1S0C A;  2D1Z A;  3O4O A;  1TP0 A;  4LO8 B;  4J23 B;  4JPZ A;  4IZX A;  1DJS B;  1Q1U A;  3VSZ A;  2Q9X A;  4EFR A;  4IZE A;  3CA3 A;  3RMX A;  2NZ9 A;  4Q91 A;  2QN4 A;  2XOA A;  4I4O A;  3P53 A;  2K8R A;  2Q3N B;  1W3G A;  1Z2V A;  4ISR A;  4USP A;  3FGM A;  1BFG A;  2AXM A;  1BA7 A;  2LIE A;  4OEG A;  3O44 A;  3NBD A;  4I7I A;  3O4A A;  5B2H A;  2X2T A;  4QD2 C;  3BTA A;  2E4M C;  4IQP A;  4L4H A;  3BAQ A;  1SR4 A;  4XKI A;  3CA6 A;  2NYY A;  5D62 A;  3AZV A;  4HR6 C;  2P23 A;  2D7R A;  4LO3 A;  1JQZ A;  3UJ0 A;  3IM5 A;  4X38 A;  4I96 A;  5FZU A;  4JKQ A;  4H75 A;  3S8K A;  2F8X C;  4F34 A;  2NVH A;  1BAR A;  2DRE A;  1YYN A;  1BLD A;  4JRA A;  1HWN B;  1NZK A;  1M2T B;  3N0K A;  4I4S A;  1JT4 A;  3WA1 A;  1FWV A;  1ISZ A;  3VWC A;  1WD4 A;  4GP3 A;  4LO0 A;  2I1B A;  1TWM A;  4FVV A;  1VCL A;  1I1B A;  3T8S A;  3V0A B;  3BAU A;  3OBT A;  1DIW A;  1PUM B;  2IHO A;  1CVS A;  1M16 A;  41BI A;  3P6I A;  3HBW A;  4LO2 A;  4OWL A;  2DRY A;  4P0K A;  3KMV A;  3C9Z A;  4GAF A;  3V0B B;  1WBC A;  4QKS A;  4P0L A;  5BXP A;  2Y9W C;  2ZR1 B;  1RML A;  2NS2 A;  1Z0H A;  3BB2 A;  4F83 A;  4ZBV B;  2BEB A;  4I4X A;  3CA5 A;  4I4Y A;  2VSE A;  3FJI A;  3NBC A;  5BOW A;  4X3A A;  3N7L A;  4G1R A;  1G9D A;  4ZFY B;  1HWO B;  3V79 C;  1AF9 A;  3MPP G;  1IT0 A;  1IJT A;  3UD9 A;  2ERM A;  1IHK A;  1S0G A;  4Q9G A;  3VT2 A;  1PZZ A;  3BX1 C;  2NM1 A;  1BFB A;  3A07 A;  1XZZ A;  1DZC A;  4DCK C;  1T4Q A;  1JTC A;  1OQL B;  2RST A;  3HN1 A;  4Z9W B;  3CU1 B;  4JP0 A;  5E24 E;  1BFC A;  5D63 A;  3RTJ B;  2P39 A;  2FFU A;  2R9K B;  1P63 A;  3CRH A;  4J2Y A;  1ISV A;  4EB2 B;  4ION A;  1AXM A;  1JT3 A;  1II4 A;  1FV3 A;  1HWM B;  4OW4 A;  1TTU A;  2AQZ A;  3FJF A;  3Q7Y A;  5FNW A;  4H04 A;  3UD8 A;  2F2F C;  3OJM A;  3WO4 A;  2D44 A;  1K5U A;  1TWE A;  4KEI A;  3Q7W A;  4USO A;  1MD6 A;  1RG8 A;  2Y9F A;  4LO1 A;  4IYB A;  4I1B A;  4P0J A;  1YXW A;  3AKF A;  4GP0 A;  4JAW A;  1R8O A;  1DZD A;  1CE7 B;  4KBB A;  3BAD A;  1DQO A;  1S0E A;  1UPS A;  4X37 A;  4P6A A;  3AJ6 A;  3WIN C;  4XFT A;  2MIB A;  3ZXG A;  2BFH A;  1BLA A;  4A7Z A;  4ZFU B;  1Q03 A;  2IWT B;  3CQA A;  4CJM A;  1AFC A;  1ISY A;  1V6V A;  3V0A A;  3SNV A;  5HPZ A;  1JT5 A;  3O4C A;  1NUN A;  4I4V A;  3IIR A;  4QC4 A;  1FGA A;  4ZFW B;  4ZLB B;  2X2S A;  3V0B A;  3AH2 A;  1QQK A;  3BA7 A;  1W3F A;  1XG6 A;  6I1B A;  1WD3 A;  3R4S A;  1ILR 1;  3A22 A;  2VXR A;  3UDA A;  1IIL A;  4Z8S B;  1XHB A;  3CRI A;  4I4U A;  5FZZ A;  2VU9 A;  3CAH A;  4MZF B;  4UY4 A;  3PUB A;  2Z48 A;  3BAH A;  3WMU A;  4I0Y A;  4DEN A;  1FWU A;  4I37 A;  3WMV A;  3A23 A;  5JLV A;  3LTQ A;  4I4R A;  3LLP A;  4J2X A;  1YF8 B;  2E4M A;  2D23 A;  1GGP B;  1Q04 A;  2GZB A;  4I3N A;  4I8M A;  1FMM S;  3I2X A;  4ZKT B;  1T9F A;  3AJ5 A;  2YUG A;  5GAQ A;  3CA4 A;  4J2S A;  5F8Y A;  1FV2 A;  3AH1 A;  2D7I A;  4X39 A;  5BQU C;  1BFF A;  3BRG C;  1EYL A;  1D0H A;  4FGF A;  3O4D A;  1ABR B;  1IOB A;  4EEE B;  3HAL A;  5BXR A;  1R8N A;  3FJ9 A;  1HCD A;  2HW9 A;  2RQ9 A;  4KEJ A;  4AN6 A;  3JUT A;  3FJH A;  1DFC A;  2GO2 A;  3BAV A;  3PME A;  2KLL A;  1FMZ A;  4G9N A;  4GOY A;  5EG6 C;  3FFZ A;  1IRP A;  5BP5 C;  3B9U A;  1AVA C;  4QD2 B;  5DZU A;  1QXM A;  9ILB A;  3K1X A;  4OUJ A;  3O3Q A;  1S0F A;  4I1E A;  1TIE A;  4IY8 A;  2BEA A;  4A7Y A;  1QQL A;  3F62 B;  4G6M A;  1YTO A;  1G9C A;  4YOL A;  4EFP A;  3VT1 A;  2LIQ A;  2FFV A;  3E8L C;  3JRR A;  1V6X A;  4XFU A;  3FUQ A;  1RZO B;  1HCE A;  2K43 A;  3N7J A;  2K4A B;  3CA0 A;  2HZ9 A;  5DUY A;  2HWA A;  3AKH A;  1G9B A;  3W9T A;  3IM6 A;  1DFQ A;  4GAI A;  4I6I A;  5DSS B;  5G00 A;  1E0O A;  2Y9G A;  3H6R B;  4QAL A;  3O5W B;  5F8W A;  5FNX A;  3TC2 A;  3ZXD A;  3RSJ A;  3VT0 A;  3WO2 A;  3H6Q A;  3MAL A;  2D43 A;  4L4I A;  3AH4 A;  3BAO A;  1ITB A;  2J3P A;  5JMC A;  1S0D A;  1EPW A;  2NP0 A;  1G82 A;  3N7M A;  3N7K A;  1FQ9 A;  3IM7 A;  5D61 A;  3NBN A;  2WBC A;  4IY9 A;  1A8D A;  3FJE A;  3FJJ A;  1Z4S A;  4ZA3 B;  21BI A;  3F1R A;  2VXT I;  3CA1 A;  4JKX B;  3OBR A;  2RG9 B;  1SR4 C;  3BRD A;  1JT7 A;  2Z49 A;  3RMY A;  7I1B A;  2D24 A;  4KEK A;  4R6U B;  3FJB A;  1S0L A;  2KI6 B;  1PC8 B;  4LO3 C;  3FJC A;  1KNM A;  3WIN A;  5BXT A;  2NTD A;  3HMY A;  4GOV A;  3OJ2 A;  4XFS A;  3QR5 A;  1G9A A;  2VUA A;  2MLL B;  3VEQ A;  3AZW A;  2FDB M;  3UD7 A;  1JLX A;  3Q7X A;  1DLL A;  1IRA X;  2KI4 A;  4OEF A;  3D7W B;  3P6J A;  4LO0 C;  3BA4 A;  2ZQO A;  3BA5 A;  3WO3 A;  1RY7 A;  1ISX A;  4AN7 B;  2ESU A;  3FUO A;  4LO7 C;  1I1E A; 
#chains in the Genus database with same CATH homology
 4ZOT A;  1N4K A;  1AVU A;  3I29 B;  4HA2 A;  1PUU B;  3NBE A;  1HKN A;  4D8H A;  4LO2 C;  3ZX7 A;  2FGF A;  4QO3 A;  4PC4 A;  3EF2 A;  2D22 A;  1FN0 A;  4QKR A;  3R4U A;  1ONK B;  1JLY A;  4OEE A;  1HWP B;  3O4B A;  5DVH A;  3ZC9 A;  5BXS A;  1PWA A;  1DQG A;  2Y9X E;  4KC3 A;  2KH2 A;  3FJD A;  2QYI B;  5BVP I;  1MC9 A;  4OWJ A;  5EC5 A;  3RTI B;  3H6R A;  4I4P A;  8I1B A;  1F31 A;  1XYF A;  2AAI B;  3FJA A;  2UUS A;  3BRF A;  4H9W A;  5BQU A;  1AVX B;  31BI A;  3NJ5 A;  2WRY A;  4EFQ A;  3A21 A;  2AFG A;  2VLC A;  3FJK A;  1BAS A;  3OGG A;  3PHZ A;  4JQ0 A;  3O49 A;  5EHA A;  1K5V A;  4HJJ A;  5I1B A;  4QBV A;  2VSA A;  4II0 A;  1TOO A;  4ISQ A;  4I4Q A;  4DEP A;  1AVW B;  4TLP A;  4OWK A;  5BP5 A;  1V6W A;  4J2K A;  4D0Z A;  3HSM A;  4A7K A;  3VSF A;  4Q9P A;  2MC2 A;  5F8S A;  1V6U A;  2FO1 A;  4LO1 C;  4LO7 B;  4G6J A;  4MZH A;  4WBC A;  1TFM B;  2ET2 A;  1WBA A;  4EKX B;  4ZGR B;  2D20 A;  2L5X A;  3VUO A;  3OJV A;  2ZQN A;  4END A;  1SZ6 B;  5F90 A;  1EV2 A;  1W3A A;  1S0B A;  2HWM A;  3CRG A;  2DS0 A;  4MZG B;  3IAG C;  1YBI A;  3I2A A;  3PG0 A;  1JY0 A;  2F2F A;  2M49 A;  3ZC8 A;  4IHZ A;  2KKI A;  3S8J A;  3HOM A;  3UJ4 A;  1HIB A;  3BAG A;  3QYD A;  4G9M A;  4D0T A;  3AKG A;  1J0S A;  3OGF A;  1EVT A;  2DRZ A;  3AKI A;  3H6S E;  1ISW A;  3POK A;  4QBC A;  5FZY A;  3ILA A;  1L2H A;  3FJ8 A;  4I2S A;  1S0C A;  2D1Z A;  3O4O A;  1TP0 A;  4LO8 B;  4J23 B;  4JPZ A;  4IZX A;  1DJS B;  1Q1U A;  3VSZ A;  2Q9X A;  4EFR A;  4IZE A;  3CA3 A;  3RMX A;  2NZ9 A;  4Q91 A;  2QN4 A;  2XOA A;  4I4O A;  3P53 A;  2K8R A;  2Q3N B;  1W3G A;  1Z2V A;  4ISR A;  4USP A;  3FGM A;  1BFG A;  2AXM A;  1BA7 A;  2LIE A;  4OEG A;  3O44 A;  3NBD A;  4I7I A;  3O4A A;  5B2H A;  2X2T A;  4QD2 C;  3BTA A;  2E4M C;  4IQP A;  4L4H A;  3BAQ A;  1SR4 A;  4XKI A;  3CA6 A;  2NYY A;  5D62 A;  3AZV A;  4HR6 C;  2P23 A;  2D7R A;  4LO3 A;  1JQZ A;  3UJ0 A;  3IM5 A;  4X38 A;  4I96 A;  5FZU A;  4JKQ A;  4H75 A;  3S8K A;  2F8X C;  4F34 A;  2NVH A;  1BAR A;  2DRE A;  1YYN A;  1BLD A;  4JRA A;  1HWN B;  1NZK A;  1M2T B;  3N0K A;  4I4S A;  1JT4 A;  3WA1 A;  1FWV A;  1ISZ A;  3VWC A;  1WD4 A;  4GP3 A;  4LO0 A;  2I1B A;  1TWM A;  4FVV A;  1VCL A;  1I1B A;  3T8S A;  3V0A B;  3BAU A;  3OBT A;  1DIW A;  1PUM B;  2IHO A;  1CVS A;  1M16 A;  41BI A;  3P6I A;  3HBW A;  4LO2 A;  4OWL A;  2DRY A;  4P0K A;  3KMV A;  3C9Z A;  4GAF A;  3V0B B;  1WBC A;  4QKS A;  4P0L A;  5BXP A;  2Y9W C;  2ZR1 B;  1RML A;  2NS2 A;  1Z0H A;  3BB2 A;  4F83 A;  4ZBV B;  2BEB A;  4I4X A;  3CA5 A;  4I4Y A;  2VSE A;  3FJI A;  3NBC A;  5BOW A;  4X3A A;  3N7L A;  4G1R A;  1G9D A;  4ZFY B;  1HWO B;  3V79 C;  1AF9 A;  3MPP G;  1IT0 A;  1IJT A;  3UD9 A;  2ERM A;  1IHK A;  1S0G A;  4Q9G A;  3VT2 A;  1PZZ A;  3BX1 C;  2NM1 A;  1BFB A;  3A07 A;  1XZZ A;  1DZC A;  4DCK C;  1T4Q A;  1JTC A;  1OQL B;  2RST A;  3HN1 A;  4Z9W B;  3CU1 B;  4JP0 A;  5E24 E;  1BFC A;  5D63 A;  3RTJ B;  2P39 A;  2FFU A;  2R9K B;  1P63 A;  3CRH A;  4J2Y A;  1ISV A;  4EB2 B;  4ION A;  1AXM A;  1JT3 A;  1II4 A;  1FV3 A;  1HWM B;  4OW4 A;  1TTU A;  2AQZ A;  3FJF A;  3Q7Y A;  5FNW A;  4H04 A;  3UD8 A;  2F2F C;  3OJM A;  3WO4 A;  2D44 A;  1K5U A;  1TWE A;  4KEI A;  3Q7W A;  4USO A;  1MD6 A;  1RG8 A;  2Y9F A;  4LO1 A;  4IYB A;  4I1B A;  4P0J A;  1YXW A;  3AKF A;  4GP0 A;  4JAW A;  1R8O A;  1DZD A;  1CE7 B;  4KBB A;  3BAD A;  1DQO A;  1S0E A;  1UPS A;  4X37 A;  4P6A A;  3AJ6 A;  3WIN C;  4XFT A;  2MIB A;  3ZXG A;  2BFH A;  1BLA A;  4A7Z A;  4ZFU B;  1Q03 A;  2IWT B;  3CQA A;  4CJM A;  1AFC A;  1ISY A;  1V6V A;  3V0A A;  3SNV A;  5HPZ A;  1JT5 A;  3O4C A;  1NUN A;  4I4V A;  3IIR A;  4QC4 A;  1FGA A;  4ZFW B;  4ZLB B;  2X2S A;  3V0B A;  3AH2 A;  1QQK A;  3BA7 A;  1W3F A;  1XG6 A;  6I1B A;  1WD3 A;  3R4S A;  1ILR 1;  3A22 A;  2VXR A;  3UDA A;  1IIL A;  4Z8S B;  1XHB A;  3CRI A;  4I4U A;  5FZZ A;  2VU9 A;  3CAH A;  4MZF B;  4UY4 A;  3PUB A;  2Z48 A;  3BAH A;  3WMU A;  4I0Y A;  4DEN A;  1FWU A;  4I37 A;  3WMV A;  3A23 A;  5JLV A;  3LTQ A;  4I4R A;  3LLP A;  4J2X A;  1YF8 B;  2E4M A;  2D23 A;  1GGP B;  1Q04 A;  2GZB A;  4I3N A;  4I8M A;  1FMM S;  3I2X A;  4ZKT B;  1T9F A;  3AJ5 A;  2YUG A;  5GAQ A;  3CA4 A;  4J2S A;  5F8Y A;  1FV2 A;  3AH1 A;  2D7I A;  4X39 A;  5BQU C;  1BFF A;  3BRG C;  1EYL A;  1D0H A;  4FGF A;  3O4D A;  1ABR B;  1IOB A;  4EEE B;  3HAL A;  5BXR A;  1R8N A;  3FJ9 A;  1HCD A;  2HW9 A;  2RQ9 A;  4KEJ A;  4AN6 A;  3JUT A;  3FJH A;  1DFC A;  2GO2 A;  3BAV A;  3PME A;  2KLL A;  1FMZ A;  4G9N A;  4GOY A;  5EG6 C;  3FFZ A;  1IRP A;  5BP5 C;  3B9U A;  1AVA C;  4QD2 B;  5DZU A;  1QXM A;  9ILB A;  3K1X A;  4OUJ A;  3O3Q A;  1S0F A;  4I1E A;  1TIE A;  4IY8 A;  2BEA A;  4A7Y A;  1QQL A;  3F62 B;  4G6M A;  1YTO A;  1G9C A;  4YOL A;  4EFP A;  3VT1 A;  2LIQ A;  2FFV A;  3E8L C;  3JRR A;  1V6X A;  4XFU A;  3FUQ A;  1RZO B;  1HCE A;  2K43 A;  3N7J A;  2K4A B;  3CA0 A;  2HZ9 A;  5DUY A;  2HWA A;  3AKH A;  1G9B A;  3W9T A;  3IM6 A;  1DFQ A;  4GAI A;  4I6I A;  5DSS B;  5G00 A;  1E0O A;  2Y9G A;  3H6R B;  4QAL A;  3O5W B;  5F8W A;  5FNX A;  3TC2 A;  3ZXD A;  3RSJ A;  3VT0 A;  3WO2 A;  3H6Q A;  3MAL A;  2D43 A;  4L4I A;  3AH4 A;  3BAO A;  1ITB A;  2J3P A;  5JMC A;  1S0D A;  1EPW A;  2NP0 A;  1G82 A;  3N7M A;  3N7K A;  1FQ9 A;  3IM7 A;  5D61 A;  3NBN A;  2WBC A;  4IY9 A;  1A8D A;  3FJE A;  3FJJ A;  1Z4S A;  4ZA3 B;  21BI A;  3F1R A;  2VXT I;  3CA1 A;  4JKX B;  3OBR A;  2RG9 B;  1SR4 C;  3BRD A;  1JT7 A;  2Z49 A;  3RMY A;  7I1B A;  2D24 A;  4KEK A;  4R6U B;  3FJB A;  1S0L A;  2KI6 B;  1PC8 B;  4LO3 C;  3FJC A;  1KNM A;  3WIN A;  5BXT A;  2NTD A;  3HMY A;  4GOV A;  3OJ2 A;  4XFS A;  3QR5 A;  1G9A A;  2VUA A;  2MLL B;  3VEQ A;  3AZW A;  2FDB M;  3UD7 A;  1JLX A;  3Q7X A;  1DLL A;  1IRA X;  2KI4 A;  4OEF A;  3D7W B;  3P6J A;  4LO0 C;  3BA4 A;  2ZQO A;  3BA5 A;  3WO3 A;  1RY7 A;  1ISX A;  4AN7 B;  2ESU A;  3FUO A;  4LO7 C;  1I1E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...