4I4ZA

Synechocystis sp. pcc 6803 1,4-dihydroxy-2-naphthoyl-coenzyme a synthase (menb) in complex with salicylyl-coa
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
275
structure length
275
Chain Sequence
b'MDWHIAKHYDDILYYKAGGIAKIVINRPHKRNAFRPQTVFELYDAFCNAREDNRIGVVLLTGAGPHSDGKYAFCSGGDQSVRGEGGYIDDQGTPRLNVLDLQRLIRSMPKVVIALVAGYAIGGGHVLHLVCDLTIAADNAIFGQTGPKVGSFDGGFGSSYLARIVGQKKAREIWYLCRQYSAQEAERMGMVNTVVPVDRLEEEGIQWAKEILSKSPLAIRCLKAAFNADCDGQAGLQELAGNATLLYYMTEEGSEGKQAFLEKRPPDFSQYPWLP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Naphthoate synthase
publication title Structural basis of the induced-fit mechanism of 1,4-dihydroxy-2-naphthoyl coenzyme a synthase from the crotonase fold superfamily
pubmed doi rcsb
source organism Synechocystis sp.
molecule tags Lyase
total genus 101
structure length 275
sequence length 275
chains with identical sequence B, C, D, E, F, G, H, I
ec nomenclature ec 4.1.3.36: 1,4-dihydroxy-2-naphthoyl-CoA synthase.
pdb deposition date 2012-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.10 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase, Chain A, domain 2 4i4zA02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 4i4zA01
2X24A 4ZDEA 4IZDA 4IZCA 3QXZA 3TVWA 3PE8A 2ZL4A 2ZL3A 3TRRA 5CTBA 4IZBA 1PJHA 5INIA 4OG1A 2ZL2A 2VSSF 1J7XA 3Q1TA 2J5GA 4QFEA 2HW5A 3KTIA 3U9TB 1EY3A 4Q1IA 3BF0A 1ON9A 5DL1A 3K50A 3STAA 1WDMA 4B3JA 3L3SA 3LAOA 5JBWA 5DTPA 3MYBA 4G2RA 5DU4A 4I4ZA 3H0QA 3NJDA 2J5II 3R9SA 3PGQA 2EJ5A 4MOUA 4ZU2A 3SWXA 4KD6A 1XO6A 5G1SA 3IB9A 1TYFA 3R9TA 3MT6A 1SZOA 3DORA 2J5IA 3KTKA 5E0SH 3SLLA 2ZQRA 3V5IA 3RSIA 3RSTA 3KTHA 3R0OA 1UYSA 1FC9A 5MGBA 4FZWC 4ZDCA 1WZ8A 1K32A 3OMEA 3V5EA 1FC7A 3PZKA 1VRGA 1HNUA 3LKEA 1EF8A 4WCZA 4B3IA 3NJBA 5FIFA 1ON3A 2NP9A 3P85A 5DKPA 3FDUA 3H0UA 5DZKA 2PG8A 1Y7OA 4QIJA 4JCTA 4OMRA 3H81A 2X58A 4FJWD 5DU6A 2FW2A 1OD2A 1JXZA 3QKAA 1Q52A 2VSSA 4L8KA 2UZFA 4B3HA 2C8TA 4FNDA 3HE2A 3H0JA 1UYTA 3TZ3A 5DTWA 3T8BA 3M6NA 4ASIA 4MI2A 3QREA 3BPPA 3QYRA 5INFA 3IAVA 3Q0GA 5KJPA 3T8AA 3TV5A 1XNYA 4FZWA 4ZDFA 4K29A 3KQFA 5INGA 1NZYA 1UYVA 1N6FA 3HRXA 5C90A 4QIIA 2J5SA 2Q34A 4GM2A 4NEKA 2VX2A 4JVTA 4RYFH 2J5IB 4ELSA 4JYLA 3TLFA 4JCSA 4I52A 2VSSE 3G64A 3R9QA 3ZWAA 1X0UA 5DUFA 1MJ3A 1W2XA 2QQ3A 3PEAA 1O8UA 4JYJA 2A7SA 1HNOA 3KTGA 4GHNA 4MXIA 3RRVA 3GMAA 2DEOA 4NNQA 4I42A 3QK8A 1WDLA 1DUBA 4FNBA 3VIVA 4DI1A 4L6WA 2VSUF 3TVUA 2F9IA 4FN7A 5E0SA 5CTCA 4U1AA 2A81A 3MOYA 3GLMA 2DUBA 4K2NA 3T3WA 2Q2XA 3ST9A 3ZWBA 3ZW9A 3IBBA 4EMLA 4HC8A 3Q0JA 3QWDA 3HLN1 2F6IA 4EMPA 3ZWCA 2VSUC 4ELXA 3QXIA 3FF6A 4RCNA 3GKBA 4HNKA 4U0GH 4JCQA 1SG4A 1UYRA 2FZSA 5G1RA 1FC6A 5IKLB 1OD4A 2J5GD 2GTRA 3HINA 3H0SA 4JJTA 1NZYB 1Q51A 5JBXA 3T89A 4LK5A 1UIYA 3OC7A 3TT6A 1FCFA 2FBMA 2F9YB 3U9RB 1YG6A 2PPYA 3Q7HA 1N6DA 3BEZA 4JFCA 2WTBA 3OT6A 1YG8A 3MFMA 2CBYA 4JWVA 3QMJA 1XNVA 4U19A 2CE3A 1RJNA 3JU1A 5KDRB 1EF9A 4EMMA 3KTJA 4U18A 2F9YA 1WDKA 4F47A 2VSUA 1K39A 4K3WA 1XNWA 2BZRA 2F9IB 4JSBA 3R6HA 4RYFA 1N6EA 1PIXA 2Q35A 3P5MA 3N6RB 5DUCA 3TDCA 4KPKA 2ZQQA 4OLQA 5KDRA 3M6MA 3TT7A 2D3TA 2ZL0A 3DJAA 2A7KA 5E0NX 4KWBA 4FB8A 4Z0MA 4FN8A 3P2LA 1HZDA 4JOTA 4YLHA 3HP0A 5FUSA 1TG6A 5DU8A 2VSUE 3U9SB 3K8XA 5DZKH 3GF3A 5C9GA 4WYOB 3ISAA 4Q0GA 2F6QA 4ELWA 1DCIA 4KNPA 4U0HA 1RJMA 4WZ8B 3I47A 2VREA 2PBPA 3T88A 3WG5A 3H02A 4U0GA 2IEXA 4ZDBA 4ZDDA 3ZW8A 3GF7A 2W3PA 5G1QA 4JCRA 1XX4A
chains in the Genus database with same CATH superfamily
2X24A 4ZDEA 4IZDA 4IZCA 3QXZA 3TVWA 3PE8A 2ZL4A 2ZL3A 3TRRA 5CTBA 4IZBA 1PJHA 5INIA 4OG1A 2ZL2A 2VSSF 1J7XA 3Q1TA 2J5GA 4QFEA 2HW5A 4NARA 3KTIA 3U9TB 1EY3A 4Q1IA 3BF0A 1ON9A 2YJGA 5DL1A 3K50A 3STAA 3ADDA 1WDMA 4B3JA 3L3SA 3LAOA 5JBWA 5DTPA 4HDTA 1Y64B 3MYBA 1UX4A 4G2RA 5DU4A 4I4ZA 3H0QA 3NJDA 2J5II 3R9SA 3PGQA 2EJ5A 4MOUA 4ZU2A 3A4MA 3SWXA 4KD6A 1XO6A 5G1SA 3IB9A 1TYFA 3R9TA 3MT6A 1SZOA 3DORA 2J5IA 3KTKA 5E0SH 3SLLA 2ZQRA 3V5IA 3RSIA 3RSTA 3KTHA 3R0OA 1UYSA 1FC9A 5MGBA 4FZWC 4ZDCA 1WZ8A 1K32A 3OMEA 3O4XE 3V5EA 1FC7A 3PZKA 1VRGA 1HNUA 3LKEA 1EF8A 4WCZA 4B3IA 3NJBA 5FIFA 1ON3A 2NP9A 3P85A 5DKPA 3FDUA 3H0UA 5DZKA 2PG8A 1Y7OA 4QIJA 4JCTA 4OMRA 3H81A 2X58A 4FJWD 5DU6A 2FW2A 1OD2A 1JXZA 3QKAA 1Q52A 2VSSA 4L8KA 2UZFA 4B3HA 2C8TA 2P63A 4FNDA 3HE2A 3H0JA 1UYTA 3TZ3A 3L8IA 5DTWA 3T8BA 3M6NA 4ASIA 4MI2A 3QREA 3W8HB 3BPPA 3QYRA 5INFA 5HUQA 3IAVA 3Q0GA 5KJPA 3T8AA 3TV5A 1XNYA 4FZWA 4ZDFA 4K29A 3KQFA 5INGA 1NZYA 1UYVA 1N6FA 3HRXA 5C90A 4QIIA 2J5SA 2Q34A 3ADBA 4GM2A 4NEKA 2VX2A 4JVTA 4RYFH 2J5IB 4ELSA 4JYLA 3TLFA 4JCSA 4I52A 2VSSE 3G64A 3R9QA 3ZWAA 4GEHB 1X0UA 3A4NA 3RQEA 5DUFA 1MJ3A 1W2XA 2QQ3A 3PEAA 1O8UA 4JYJA 2A7SA 1HNOA 1UX5A 3KTGA 4GHNA 4MXIA 3RRVA 3GMAA 2DEOA 4NNQA 4I42A 3L8JA 3QK8A 1WDLA 1DUBA 4FNBA 3VIVA 4DI1A 4L6WA 2VSUF 3TVUA 2F9IA 4FN7A 5E0SA 5CTCA 4U1AA 2A81A 3MOYA 3GLMA 2DUBA 4K2NA 3T3WA 2Q2XA 3ST9A 3ZWBA 3ZW9A 3IBBA 4EMLA 4HC8A 3Q0JA 3QWDA 3HLN1 2F6IA 4EMPA 3ZWCA 2VSUC 4ELXA 3QXIA 3FF6A 4RCNA 3GKBA 4HNKA 4U0GH 4J2UA 4JCQA 1SG4A 1UYRA 2FZSA 5G1RA 1FC6A 5IKLB 1OD4A 2J5GD 2GTRA 3HINA 3H0SA 3AJMA 4JJTA 1NZYB 1Q51A 5JBXA 3T89A 4LK5A 1UIYA 3OC7A 3TT6A 1FCFA 2FBMA 2F9YB 3U9RB 1YG6A 2PPYA 3Q7HA 1N6DA 3BEZA 4JFCA 2WTBA 3OT6A 1YG8A 3MFMA 2CBYA 4JWVA 3A4LA 3QMJA 1XNVA 4U19A 2CE3A 1RJNA 3JU1A 5KDRB 1EF9A 4EMMA 3KTJA 4U18A 3RQGA 2F9YA 1WDKA 4F47A 2VSUA 1K39A 4K3WA 1XNWA 2BZRA 2F9IB 4JSBA 3R6HA 4RYFA 1N6EA 1PIXA 2Q35A 3P5MA 3N6RB 5DUCA 3TDCA 4KPKA 2ZQQA 4OLQA 5KDRA 3M6MA 3TT7A 2D3TA 2ZL0A 3DJAA 2A7KA 5E0NX 3RQFA 4KWBA 4FB8A 4Z0MA 4FN8A 3W8IB 3P2LA 1HZDA 4JOTA 3ADCA 4YLHA 3IRBA 3HP0A 5FUSA 1TG6A 5DU8A 2VSUE 3U9SB 3BPTA 3K8XA 5DZKH 3GF3A 5C9GA 4WYOB 3ISAA 4Q0GA 2F6QA 4ELWA 1DCIA 4KNPA 3AM1A 4U0HA 1RJMA 4WZ8B 3I47A 2VREA 2PBPA 3T88A 3WG5A 3H02A 4U0GA 2IEXA 4ZDBA 4ZDDA 3ZW8A 3GF7A 2W3PA 5G1QA 4JCRA 1XX4A
chains in the Genus database with same CATH topology
2X24A 4ZDEA 4IZDA 4IZCA 3QXZA 3TVWA 3PE8A 2ZL4A 2ZL3A 3TRRA 5CTBA 4IZBA 1PJHA 5INIA 4OG1A 2ZL2A 2VSSF 1J7XA 3Q1TA 2J5GA 4QFEA 2HW5A 4NARA 3KTIA 3U9TB 1EY3A 4Q1IA 3BF0A 1ON9A 2YJGA 5DL1A 3K50A 3STAA 1WDMA 4B3JA 3L3SA 3LAOA 5JBWA 5DTPA 4HDTA 3MYBA 4G2RA 5DU4A 4I4ZA 3H0QA 3NJDA 2J5II 3R9SA 3PGQA 2EJ5A 4MOUA 4ZU2A 3SWXA 4KD6A 1XO6A 5G1SA 3IB9A 1TYFA 3R9TA 3MT6A 1SZOA 3DORA 2J5IA 3KTKA 5E0SH 3SLLA 2ZQRA 3V5IA 3RSIA 3RSTA 3KTHA 3R0OA 1UYSA 1FC9A 5MGBA 4FZWC 4ZDCA 1WZ8A 1K32A 3OMEA 3V5EA 1FC7A 3PZKA 1VRGA 1HNUA 3LKEA 1EF8A 4WCZA 4B3IA 3NJBA 5FIFA 1ON3A 2NP9A 3P85A 5DKPA 3FDUA 3H0UA 5DZKA 2PG8A 1Y7OA 4QIJA 4JCTA 4OMRA 3H81A 2X58A 4FJWD 5DU6A 2FW2A 1OD2A 1JXZA 3QKAA 1Q52A 2VSSA 4L8KA 2UZFA 4B3HA 2C8TA 4FNDA 3HE2A 3H0JA 1UYTA 3TZ3A 5DTWA 3T8BA 3M6NA 4ASIA 4MI2A 3QREA 3BPPA 3QYRA 5INFA 5HUQA 3IAVA 3Q0GA 5KJPA 3T8AA 3TV5A 1XNYA 4FZWA 4ZDFA 4K29A 3KQFA 5INGA 1NZYA 1UYVA 1N6FA 3HRXA 5C90A 4QIIA 2J5SA 2Q34A 4GM2A 4NEKA 2VX2A 4JVTA 4RYFH 2J5IB 4ELSA 4JYLA 3TLFA 4JCSA 4I52A 2VSSE 3G64A 3R9QA 3ZWAA 1X0UA 5DUFA 1MJ3A 1W2XA 2QQ3A 3PEAA 1O8UA 4JYJA 2A7SA 1HNOA 3KTGA 4GHNA 4MXIA 3RRVA 3GMAA 2DEOA 4NNQA 4I42A 3QK8A 1WDLA 1DUBA 4FNBA 3VIVA 4DI1A 4L6WA 2VSUF 3TVUA 2F9IA 4FN7A 5E0SA 5CTCA 4U1AA 2A81A 3MOYA 3GLMA 2DUBA 4K2NA 3T3WA 2Q2XA 3ST9A 3ZWBA 3ZW9A 3IBBA 4EMLA 4HC8A 3Q0JA 3QWDA 3HLN1 2F6IA 4EMPA 3ZWCA 2VSUC 4ELXA 3QXIA 3FF6A 4RCNA 3GKBA 4HNKA 4U0GH 4J2UA 4JCQA 1SG4A 1UYRA 2FZSA 5G1RA 1FC6A 5IKLB 1OD4A 2J5GD 2GTRA 3HINA 3H0SA 4JJTA 1NZYB 1Q51A 5JBXA 3T89A 4LK5A 1UIYA 3OC7A 3TT6A 1FCFA 2FBMA 2F9YB 3U9RB 1YG6A 2PPYA 3Q7HA 1N6DA 3BEZA 4JFCA 2WTBA 3OT6A 1YG8A 3MFMA 2CBYA 4JWVA 3QMJA 1XNVA 4U19A 2CE3A 1RJNA 3JU1A 5KDRB 1EF9A 4EMMA 3KTJA 4U18A 2F9YA 1WDKA 4F47A 2VSUA 1K39A 4K3WA 1XNWA 2BZRA 2F9IB 4JSBA 3R6HA 4RYFA 1N6EA 1PIXA 2Q35A 3P5MA 3N6RB 5DUCA 3TDCA 4KPKA 2ZQQA 4OLQA 5KDRA 3M6MA 3TT7A 2D3TA 2ZL0A 3DJAA 2A7KA 5E0NX 4KWBA 4FB8A 4Z0MA 4FN8A 3P2LA 1HZDA 4JOTA 4YLHA 3HP0A 5FUSA 1TG6A 5DU8A 2VSUE 3U9SB 3BPTA 3K8XA 5DZKH 3GF3A 5C9GA 4WYOB 3ISAA 4Q0GA 2F6QA 4ELWA 1DCIA 4KNPA 4U0HA 1RJMA 4WZ8B 3I47A 2VREA 2PBPA 3T88A 3WG5A 3H02A 4U0GA 2IEXA 4ZDBA 4ZDDA 3ZW8A 3GF7A 2W3PA 5G1QA 4JCRA 1XX4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X24 A;  4ZDE A;  4IZD A;  4IZC A;  3QXZ A;  3TVW A;  3PE8 A;  2ZL4 A;  2ZL3 A;  3TRR A;  5CTB A;  4IZB A;  1PJH A;  5INI A;  4OG1 A;  2ZL2 A;  2VSS F;  1J7X A;  3Q1T A;  2J5G A;  4QFE A;  2HW5 A;  3KTI A;  3U9T B;  1EY3 A;  4Q1I A;  3BF0 A;  1ON9 A;  5DL1 A;  3K50 A;  3STA A;  1WDM A;  4B3J A;  3L3S A;  3LAO A;  5JBW A;  5DTP A;  3MYB A;  4G2R A;  5DU4 A;  4I4Z A;  3H0Q A;  3NJD A;  2J5I I;  3R9S A;  3PGQ A;  2EJ5 A;  4MOU A;  4ZU2 A;  3SWX A;  4KD6 A;  1XO6 A;  5G1S A;  3IB9 A;  1TYF A;  3R9T A;  3MT6 A;  1SZO A;  3DOR A;  2J5I A;  3KTK A;  5E0S H;  3SLL A;  2ZQR A;  3V5I A;  3RSI A;  3RST A;  3KTH A;  3R0O A;  1UYS A;  1FC9 A;  5MGB A;  4FZW C;  4ZDC A;  1WZ8 A;  1K32 A;  3OME A;  3V5E A;  1FC7 A;  3PZK A;  1VRG A;  1HNU A;  3LKE A;  1EF8 A;  4WCZ A;  4B3I A;  3NJB A;  5FIF A;  1ON3 A;  2NP9 A;  3P85 A;  5DKP A;  3FDU A;  3H0U A;  5DZK A;  2PG8 A;  1Y7O A;  4QIJ A;  4JCT A;  4OMR A;  3H81 A;  2X58 A;  4FJW D;  5DU6 A;  2FW2 A;  1OD2 A;  1JXZ A;  3QKA A;  1Q52 A;  2VSS A;  4L8K A;  2UZF A;  4B3H A;  2C8T A;  4FND A;  3HE2 A;  3H0J A;  1UYT A;  3TZ3 A;  5DTW A;  3T8B A;  3M6N A;  4ASI A;  4MI2 A;  3QRE A;  3BPP A;  3QYR A;  5INF A;  3IAV A;  3Q0G A;  5KJP A;  3T8A A;  3TV5 A;  1XNY A;  4FZW A;  4ZDF A;  4K29 A;  3KQF A;  5ING A;  1NZY A;  1UYV A;  1N6F A;  3HRX A;  5C90 A;  4QII A;  2J5S A;  2Q34 A;  4GM2 A;  4NEK A;  2VX2 A;  4JVT A;  4RYF H;  2J5I B;  4ELS A;  4JYL A;  3TLF A;  4JCS A;  4I52 A;  2VSS E;  3G64 A;  3R9Q A;  3ZWA A;  1X0U A;  5DUF A;  1MJ3 A;  1W2X A;  2QQ3 A;  3PEA A;  1O8U A;  4JYJ A;  2A7S A;  1HNO A;  3KTG A;  4GHN A;  4MXI A;  3RRV A;  3GMA A;  2DEO A;  4NNQ A;  4I42 A;  3QK8 A;  1WDL A;  1DUB A;  4FNB A;  3VIV A;  4DI1 A;  4L6W A;  2VSU F;  3TVU A;  2F9I A;  4FN7 A;  5E0S A;  5CTC A;  4U1A A;  2A81 A;  3MOY A;  3GLM A;  2DUB A;  4K2N A;  3T3W A;  2Q2X A;  3ST9 A;  3ZWB A;  3ZW9 A;  3IBB A;  4EML A;  4HC8 A;  3Q0J A;  3QWD A;  3HLN 1;  2F6I A;  4EMP A;  3ZWC A;  2VSU C;  4ELX A;  3QXI A;  3FF6 A;  4RCN A;  3GKB A;  4HNK A;  4U0G H;  4JCQ A;  1SG4 A;  1UYR A;  2FZS A;  5G1R A;  1FC6 A;  5IKL B;  1OD4 A;  2J5G D;  2GTR A;  3HIN A;  3H0S A;  4JJT A;  1NZY B;  1Q51 A;  5JBX A;  3T89 A;  4LK5 A;  1UIY A;  3OC7 A;  3TT6 A;  1FCF A;  2FBM A;  2F9Y B;  3U9R B;  1YG6 A;  2PPY A;  3Q7H A;  1N6D A;  3BEZ A;  4JFC A;  2WTB A;  3OT6 A;  1YG8 A;  3MFM A;  2CBY A;  4JWV A;  3QMJ A;  1XNV A;  4U19 A;  2CE3 A;  1RJN A;  3JU1 A;  5KDR B;  1EF9 A;  4EMM A;  3KTJ A;  4U18 A;  2F9Y A;  1WDK A;  4F47 A;  2VSU A;  1K39 A;  4K3W A;  1XNW A;  2BZR A;  2F9I B;  4JSB A;  3R6H A;  4RYF A;  1N6E A;  1PIX A;  2Q35 A;  3P5M A;  3N6R B;  5DUC A;  3TDC A;  4KPK A;  2ZQQ A;  4OLQ A;  5KDR A;  3M6M A;  3TT7 A;  2D3T A;  2ZL0 A;  3DJA A;  2A7K A;  5E0N X;  4KWB A;  4FB8 A;  4Z0M A;  4FN8 A;  3P2L A;  1HZD A;  4JOT A;  4YLH A;  3HP0 A;  5FUS A;  1TG6 A;  5DU8 A;  2VSU E;  3U9S B;  3K8X A;  5DZK H;  3GF3 A;  5C9G A;  4WYO B;  3ISA A;  4Q0G A;  2F6Q A;  4ELW A;  1DCI A;  4KNP A;  4U0H A;  1RJM A;  4WZ8 B;  3I47 A;  2VRE A;  2PBP A;  3T88 A;  3WG5 A;  3H02 A;  4U0G A;  2IEX A;  4ZDB A;  4ZDD A;  3ZW8 A;  3GF7 A;  2W3P A;  5G1Q A;  4JCR A;  1XX4 A; 
#chains in the Genus database with same CATH topology
 2X24 A;  4ZDE A;  4IZD A;  4IZC A;  3QXZ A;  3TVW A;  3PE8 A;  2ZL4 A;  2ZL3 A;  3TRR A;  5CTB A;  4IZB A;  1PJH A;  5INI A;  4OG1 A;  2ZL2 A;  2VSS F;  1J7X A;  3Q1T A;  2J5G A;  4QFE A;  2HW5 A;  4NAR A;  3KTI A;  3U9T B;  1EY3 A;  4Q1I A;  3BF0 A;  1ON9 A;  2YJG A;  5DL1 A;  3K50 A;  3STA A;  3ADD A;  1WDM A;  4B3J A;  3L3S A;  3LAO A;  5JBW A;  5DTP A;  4HDT A;  1Y64 B;  3MYB A;  1UX4 A;  4G2R A;  5DU4 A;  4I4Z A;  3H0Q A;  3NJD A;  2J5I I;  3R9S A;  3PGQ A;  2EJ5 A;  4MOU A;  4ZU2 A;  3A4M A;  3SWX A;  4KD6 A;  1XO6 A;  5G1S A;  3IB9 A;  1TYF A;  3R9T A;  3MT6 A;  1SZO A;  3DOR A;  2J5I A;  3KTK A;  5E0S H;  3SLL A;  2ZQR A;  3V5I A;  3RSI A;  3RST A;  3KTH A;  3R0O A;  1UYS A;  1FC9 A;  5MGB A;  4FZW C;  4ZDC A;  1WZ8 A;  1K32 A;  3OME A;  3O4X E;  3V5E A;  1FC7 A;  3PZK A;  1VRG A;  1HNU A;  3LKE A;  1EF8 A;  4WCZ A;  4B3I A;  3NJB A;  5FIF A;  1ON3 A;  2NP9 A;  3P85 A;  5DKP A;  3FDU A;  3H0U A;  5DZK A;  2PG8 A;  1Y7O A;  4QIJ A;  4JCT A;  4OMR A;  3H81 A;  2X58 A;  4FJW D;  5DU6 A;  2FW2 A;  1OD2 A;  1JXZ A;  3QKA A;  1Q52 A;  2VSS A;  4L8K A;  2UZF A;  4B3H A;  2C8T A;  2P63 A;  4FND A;  3HE2 A;  3H0J A;  1UYT A;  3TZ3 A;  3L8I A;  5DTW A;  3T8B A;  3M6N A;  4ASI A;  4MI2 A;  3QRE A;  3W8H B;  3BPP A;  3QYR A;  5INF A;  5HUQ A;  3IAV A;  3Q0G A;  5KJP A;  3T8A A;  3TV5 A;  1XNY A;  4FZW A;  4ZDF A;  4K29 A;  3KQF A;  5ING A;  1NZY A;  1UYV A;  1N6F A;  3HRX A;  5C90 A;  4QII A;  2J5S A;  2Q34 A;  3ADB A;  4GM2 A;  4NEK A;  2VX2 A;  4JVT A;  4RYF H;  2J5I B;  4ELS A;  4JYL A;  3TLF A;  4JCS A;  4I52 A;  2VSS E;  3G64 A;  3R9Q A;  3ZWA A;  4GEH B;  1X0U A;  3A4N A;  3RQE A;  5DUF A;  1MJ3 A;  1W2X A;  2QQ3 A;  3PEA A;  1O8U A;  4JYJ A;  2A7S A;  1HNO A;  1UX5 A;  3KTG A;  4GHN A;  4MXI A;  3RRV A;  3GMA A;  2DEO A;  4NNQ A;  4I42 A;  3L8J A;  3QK8 A;  1WDL A;  1DUB A;  4FNB A;  3VIV A;  4DI1 A;  4L6W A;  2VSU F;  3TVU A;  2F9I A;  4FN7 A;  5E0S A;  5CTC A;  4U1A A;  2A81 A;  3MOY A;  3GLM A;  2DUB A;  4K2N A;  3T3W A;  2Q2X A;  3ST9 A;  3ZWB A;  3ZW9 A;  3IBB A;  4EML A;  4HC8 A;  3Q0J A;  3QWD A;  3HLN 1;  2F6I A;  4EMP A;  3ZWC A;  2VSU C;  4ELX A;  3QXI A;  3FF6 A;  4RCN A;  3GKB A;  4HNK A;  4U0G H;  4J2U A;  4JCQ A;  1SG4 A;  1UYR A;  2FZS A;  5G1R A;  1FC6 A;  5IKL B;  1OD4 A;  2J5G D;  2GTR A;  3HIN A;  3H0S A;  3AJM A;  4JJT A;  1NZY B;  1Q51 A;  5JBX A;  3T89 A;  4LK5 A;  1UIY A;  3OC7 A;  3TT6 A;  1FCF A;  2FBM A;  2F9Y B;  3U9R B;  1YG6 A;  2PPY A;  3Q7H A;  1N6D A;  3BEZ A;  4JFC A;  2WTB A;  3OT6 A;  1YG8 A;  3MFM A;  2CBY A;  4JWV A;  3A4L A;  3QMJ A;  1XNV A;  4U19 A;  2CE3 A;  1RJN A;  3JU1 A;  5KDR B;  1EF9 A;  4EMM A;  3KTJ A;  4U18 A;  3RQG A;  2F9Y A;  1WDK A;  4F47 A;  2VSU A;  1K39 A;  4K3W A;  1XNW A;  2BZR A;  2F9I B;  4JSB A;  3R6H A;  4RYF A;  1N6E A;  1PIX A;  2Q35 A;  3P5M A;  3N6R B;  5DUC A;  3TDC A;  4KPK A;  2ZQQ A;  4OLQ A;  5KDR A;  3M6M A;  3TT7 A;  2D3T A;  2ZL0 A;  3DJA A;  2A7K A;  5E0N X;  3RQF A;  4KWB A;  4FB8 A;  4Z0M A;  4FN8 A;  3W8I B;  3P2L A;  1HZD A;  4JOT A;  3ADC A;  4YLH A;  3IRB A;  3HP0 A;  5FUS A;  1TG6 A;  5DU8 A;  2VSU E;  3U9S B;  3BPT A;  3K8X A;  5DZK H;  3GF3 A;  5C9G A;  4WYO B;  3ISA A;  4Q0G A;  2F6Q A;  4ELW A;  1DCI A;  4KNP A;  3AM1 A;  4U0H A;  1RJM A;  4WZ8 B;  3I47 A;  2VRE A;  2PBP A;  3T88 A;  3WG5 A;  3H02 A;  4U0G A;  2IEX A;  4ZDB A;  4ZDD A;  3ZW8 A;  3GF7 A;  2W3P A;  5G1Q A;  4JCR A;  1XX4 A; 
#chains in the Genus database with same CATH homology
 2X24 A;  4ZDE A;  4IZD A;  4IZC A;  3QXZ A;  3TVW A;  3PE8 A;  2ZL4 A;  2ZL3 A;  3TRR A;  5CTB A;  4IZB A;  1PJH A;  5INI A;  4OG1 A;  2ZL2 A;  2VSS F;  1J7X A;  3Q1T A;  2J5G A;  4QFE A;  2HW5 A;  4NAR A;  3KTI A;  3U9T B;  1EY3 A;  4Q1I A;  3BF0 A;  1ON9 A;  2YJG A;  5DL1 A;  3K50 A;  3STA A;  1WDM A;  4B3J A;  3L3S A;  3LAO A;  5JBW A;  5DTP A;  4HDT A;  3MYB A;  4G2R A;  5DU4 A;  4I4Z A;  3H0Q A;  3NJD A;  2J5I I;  3R9S A;  3PGQ A;  2EJ5 A;  4MOU A;  4ZU2 A;  3SWX A;  4KD6 A;  1XO6 A;  5G1S A;  3IB9 A;  1TYF A;  3R9T A;  3MT6 A;  1SZO A;  3DOR A;  2J5I A;  3KTK A;  5E0S H;  3SLL A;  2ZQR A;  3V5I A;  3RSI A;  3RST A;  3KTH A;  3R0O A;  1UYS A;  1FC9 A;  5MGB A;  4FZW C;  4ZDC A;  1WZ8 A;  1K32 A;  3OME A;  3V5E A;  1FC7 A;  3PZK A;  1VRG A;  1HNU A;  3LKE A;  1EF8 A;  4WCZ A;  4B3I A;  3NJB A;  5FIF A;  1ON3 A;  2NP9 A;  3P85 A;  5DKP A;  3FDU A;  3H0U A;  5DZK A;  2PG8 A;  1Y7O A;  4QIJ A;  4JCT A;  4OMR A;  3H81 A;  2X58 A;  4FJW D;  5DU6 A;  2FW2 A;  1OD2 A;  1JXZ A;  3QKA A;  1Q52 A;  2VSS A;  4L8K A;  2UZF A;  4B3H A;  2C8T A;  4FND A;  3HE2 A;  3H0J A;  1UYT A;  3TZ3 A;  5DTW A;  3T8B A;  3M6N A;  4ASI A;  4MI2 A;  3QRE A;  3BPP A;  3QYR A;  5INF A;  5HUQ A;  3IAV A;  3Q0G A;  5KJP A;  3T8A A;  3TV5 A;  1XNY A;  4FZW A;  4ZDF A;  4K29 A;  3KQF A;  5ING A;  1NZY A;  1UYV A;  1N6F A;  3HRX A;  5C90 A;  4QII A;  2J5S A;  2Q34 A;  4GM2 A;  4NEK A;  2VX2 A;  4JVT A;  4RYF H;  2J5I B;  4ELS A;  4JYL A;  3TLF A;  4JCS A;  4I52 A;  2VSS E;  3G64 A;  3R9Q A;  3ZWA A;  1X0U A;  5DUF A;  1MJ3 A;  1W2X A;  2QQ3 A;  3PEA A;  1O8U A;  4JYJ A;  2A7S A;  1HNO A;  3KTG A;  4GHN A;  4MXI A;  3RRV A;  3GMA A;  2DEO A;  4NNQ A;  4I42 A;  3QK8 A;  1WDL A;  1DUB A;  4FNB A;  3VIV A;  4DI1 A;  4L6W A;  2VSU F;  3TVU A;  2F9I A;  4FN7 A;  5E0S A;  5CTC A;  4U1A A;  2A81 A;  3MOY A;  3GLM A;  2DUB A;  4K2N A;  3T3W A;  2Q2X A;  3ST9 A;  3ZWB A;  3ZW9 A;  3IBB A;  4EML A;  4HC8 A;  3Q0J A;  3QWD A;  3HLN 1;  2F6I A;  4EMP A;  3ZWC A;  2VSU C;  4ELX A;  3QXI A;  3FF6 A;  4RCN A;  3GKB A;  4HNK A;  4U0G H;  4J2U A;  4JCQ A;  1SG4 A;  1UYR A;  2FZS A;  5G1R A;  1FC6 A;  5IKL B;  1OD4 A;  2J5G D;  2GTR A;  3HIN A;  3H0S A;  4JJT A;  1NZY B;  1Q51 A;  5JBX A;  3T89 A;  4LK5 A;  1UIY A;  3OC7 A;  3TT6 A;  1FCF A;  2FBM A;  2F9Y B;  3U9R B;  1YG6 A;  2PPY A;  3Q7H A;  1N6D A;  3BEZ A;  4JFC A;  2WTB A;  3OT6 A;  1YG8 A;  3MFM A;  2CBY A;  4JWV A;  3QMJ A;  1XNV A;  4U19 A;  2CE3 A;  1RJN A;  3JU1 A;  5KDR B;  1EF9 A;  4EMM A;  3KTJ A;  4U18 A;  2F9Y A;  1WDK A;  4F47 A;  2VSU A;  1K39 A;  4K3W A;  1XNW A;  2BZR A;  2F9I B;  4JSB A;  3R6H A;  4RYF A;  1N6E A;  1PIX A;  2Q35 A;  3P5M A;  3N6R B;  5DUC A;  3TDC A;  4KPK A;  2ZQQ A;  4OLQ A;  5KDR A;  3M6M A;  3TT7 A;  2D3T A;  2ZL0 A;  3DJA A;  2A7K A;  5E0N X;  4KWB A;  4FB8 A;  4Z0M A;  4FN8 A;  3P2L A;  1HZD A;  4JOT A;  4YLH A;  3HP0 A;  5FUS A;  1TG6 A;  5DU8 A;  2VSU E;  3U9S B;  3BPT A;  3K8X A;  5DZK H;  3GF3 A;  5C9G A;  4WYO B;  3ISA A;  4Q0G A;  2F6Q A;  4ELW A;  1DCI A;  4KNP A;  4U0H A;  1RJM A;  4WZ8 B;  3I47 A;  2VRE A;  2PBP A;  3T88 A;  3WG5 A;  3H02 A;  4U0G A;  2IEX A;  4ZDB A;  4ZDD A;  3ZW8 A;  3GF7 A;  2W3P A;  5G1Q A;  4JCR A;  1XX4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...