4I52A

Scmenb im complex with 1-hydroxy-2-naphthoyl-coa
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
275
structure length
275
Chain Sequence
b'MDWHIAKHYDDILYYKAGGIAKIVINRPHKRNAFRPQTVFELYDAFCNAREDNRIGVVLLTGAGPHSDGKYAFCSGGDQSVRGEGGYIDDQGTPRLNVLDLQRLIRSMPKVVIALVAGYAIGGGHVLHLVCDLTIAADNAIFGQTGPKVGSFDGGFGSSYLARIVGQKKAREIWYLCRQYSAQEAERMGMVNTVVPVDRLEEEGIQWAKEILSKSPLAIRCLKAAFNADCDGQAGLQELAGNATLLYYMTEEGSEGKQAFLEKRPPDFSQYPWLP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Naphthoate synthase
molecule tags Lyase
publication title Structural basis of the induced-fit mechanism of 1,4-dihydroxy-2-naphthoyl coenzyme a synthase from the crotonase fold superfamily
pubmed doi rcsb
total genus 100
structure length 275
sequence length 275
chains with identical sequence B, C, D, E, F, G, H, I
ec nomenclature ec 4.1.3.36: 1,4-dihydroxy-2-naphthoyl-CoA synthase.
pdb deposition date 2012-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.10 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase, Chain A, domain 2 4i52A02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 4i52A01
3MFMA 2QQ3A 1UYVA 4KPKA 3STAA 2BZRA 2F6IA 3SWXA 2FBMA 3U9SB 3R9TA 1XNWA 4KWBA 3V5EA 2VSUE 4GM2A 3OT6A 3R9QA 4JCRA 4QIJA 2X24A 2FZSA 3GLMA 5CTCA 4JJTA 3WG5A 3H02A 5DZKH 2D3TA 4JOTA 5CTBA 1XO6A 3H0JA 1VRGA 3RSIA 1XNVA 1FC7A 3LAOA 3MOYA 1HZDA 2EJ5A 2J5IA 2CBYA 3M6MA 3H81A 2Q2XA 3K50A 3Q7HA 1N6EA 3NJDA 3FDUA 1N6FA 2W3PA 1FCFA 4KD6A 3KTKA 4JSBA 4RYFA 3HE2A 3MYBA 5FIFA 4L8KA 2ZL2A 3R0OA 3ZWBA 1N6DA 2A7SA 4IZBA 5DU6A 4I42A 2IEXA 3R9SA 3T89A 3GMAA 2NP9A 3IBBA 3PGQA 4B3HA 3IB9A 4U0GH 1UIYA 3SLLA 4I52A 5DTWA 4EMLA 1O8UA 2VSSA 4JWVA 4MOUA 5DU8A 3HP0A 3QXZA 3N6RB 1WDLA 2PBPA 3U9RB 4ZDDA 3KQFA 4B3IA 2DUBA 3QK8A 3RRVA 1WDKA 2VSUC 4OMRA 4EMMA 3HRXA 2ZQQA 4JVTA 3T8AA 1X0UA 4U0HA 3KTHA 4FZWA 3P85A 2PG8A 4ZDFA 3JU1A 2F9YB 3PE8A 4B3JA 3NJBA 1FC6A 4FNBA 3T3WA 2VSSE 3Q0JA 2F9YA 1HNOA 1EF8A 1NZYA 1SZOA 5G1RA 4ZDEA 1NZYB 1XNYA 3GF3A 4QFEA 2ZL3A 4FNDA 2VREA 1PJHA 4L6WA 4IZCA 1OD2A 3U9TB 5C9GA 5DUCA 3TVWA 1WDMA 4HC8A 4MXIA 1YG6A 1ON9A 4QIIA 2VSUA 1HNUA 4WCZA 4IZDA 1WZ8A 2VSUF 3PZKA 4NNQA 3OMEA 1DUBA 2FW2A 4EMPA 3TV5A 3QYRA 3TT6A 1Y7OA 2J5II 3QREA 3BEZA 2ZL4A 1PIXA 4Q0GA 2F6QA 2A7KA 4OG1A 1W2XA 4JCTA 3TVUA 1EY3A 1K39A 2ZQRA 2PPYA 4WZ8B 3L3SA 5DL1A 3OC7A 3H0SA 5KDRB 3H0QA 4MI2A 4KNPA 3QWDA 3DORA 1ON3A 5KDRA 5JBWA 1UYTA 3G64A 3BF0A 2VX2A 4K2NA 4FB8A 1RJMA 3I47A 5E0SA 4Q1IA 2A81A 4FN8A 4U0GA 4JYJA 4JCSA 4ZDCA 3Q1TA 1K32A 4WYOB 2Q35A 4NEKA 1XX4A 2J5SA 3TT7A 3GF7A 2J5IB 5C90A 1FC9A 3HLN1 4OLQA 3TRRA 2CE3A 5INFA 3HINA 4RYFH 5E0SH 1UYSA 4GHNA 2F9IB 1TYFA 5DKPA 3RSTA 3ZW8A 4HNKA 2DEOA 4JYLA 5E0NX 1TG6A 4JCQA 3PEAA 3R6HA 3ZWAA 3TDCA 4RCNA 2ZL0A 3FF6A 5MGBA 4FJWD 3ZWCA 4FZWC 4U19A 4K29A 5FUSA 2Q34A 3H0UA 3ISAA 3MT6A 4ZDBA 5DU4A 1UYRA 5G1SA 3ST9A 2C8TA 4G2RA 3IAVA 1OD4A 3KTJA 4F47A 3KTGA 3P2LA 4JFCA 4I4ZA 3TLFA 3VIVA 4U18A 3P5MA 4K3WA 3ZW9A 5DTPA 2UZFA 1EF9A 4ELXA 4Z0MA 2F9IA 3V5IA 4ZU2A 4LK5A 3DJAA 1Q52A 3TZ3A 4DI1A 1DCIA 1JXZA 5IKLB 4U1AA 1RJNA 2HW5A 5DZKA 1SG4A 2J5GA 4ELWA 5INIA 3QXIA 4YLHA 3Q0GA 2VSSF 2X58A 1MJ3A 4FN7A 4ELSA 2J5GD 2WTBA 1J7XA 3BPPA 3T88A 3GKBA 3QKAA 2GTRA 3QMJA 3M6NA 5G1QA 5KJPA 4ASIA 5INGA 1YG8A 3LKEA 3K8XA 3T8BA 5JBXA 3KTIA 5DUFA 1Q51A
chains in the Genus database with same CATH superfamily
3MFMA 2QQ3A 3IRBA 1UYVA 4KPKA 3STAA 2BZRA 2F6IA 3SWXA 2FBMA 3U9SB 3R9TA 1XNWA 4KWBA 3V5EA 2VSUE 4GM2A 3OT6A 3R9QA 4JCRA 4QIJA 3RQGA 2X24A 2FZSA 3GLMA 5CTCA 4JJTA 3WG5A 3H02A 5DZKH 2D3TA 4JOTA 1Y64B 5CTBA 1XO6A 3H0JA 1VRGA 3RSIA 1XNVA 1FC7A 3LAOA 3MOYA 1HZDA 2EJ5A 2J5IA 2CBYA 3M6MA 3H81A 2Q2XA 3K50A 3Q7HA 1N6EA 3NJDA 3FDUA 1N6FA 2W3PA 1FCFA 4KD6A 3KTKA 4JSBA 4RYFA 3HE2A 3MYBA 3ADBA 5FIFA 4L8KA 2ZL2A 3R0OA 3ZWBA 1N6DA 4GEHB 2A7SA 4IZBA 5DU6A 4I42A 2IEXA 3R9SA 3T89A 3GMAA 2NP9A 3IBBA 3PGQA 4B3HA 3IB9A 3A4LA 4U0GH 1UIYA 3SLLA 4I52A 5DTWA 4EMLA 1O8UA 2VSSA 3A4NA 4JWVA 4MOUA 5DU8A 3HP0A 3L8IA 3QXZA 3N6RB 1WDLA 2PBPA 3U9RB 4ZDDA 3KQFA 4J2UA 3O4XE 4B3IA 2DUBA 3AJMA 3QK8A 3RRVA 1WDKA 2VSUC 4OMRA 4EMMA 1UX5A 3HRXA 2ZQQA 4JVTA 3T8AA 1X0UA 4U0HA 3KTHA 4FZWA 3P85A 2PG8A 4ZDFA 3JU1A 2F9YB 3PE8A 4B3JA 3NJBA 1FC6A 3L8JA 4FNBA 3T3WA 2VSSE 3Q0JA 3W8HB 2F9YA 1HNOA 1EF8A 1NZYA 1SZOA 5G1RA 4ZDEA 1NZYB 1XNYA 3GF3A 4QFEA 2ZL3A 4FNDA 2VREA 1PJHA 4NARA 4L6WA 4IZCA 1OD2A 3U9TB 5C9GA 5DUCA 3TVWA 1WDMA 4HC8A 4MXIA 1YG6A 1ON9A 4QIIA 2VSUA 1HNUA 4WCZA 4IZDA 3AM1A 1WZ8A 2VSUF 3PZKA 4NNQA 3OMEA 1DUBA 2FW2A 4EMPA 5HUQA 3TV5A 3QYRA 3TT6A 1Y7OA 2J5II 3QREA 3BEZA 2ZL4A 1PIXA 4Q0GA 2F6QA 2A7KA 4OG1A 1W2XA 4JCTA 3TVUA 1EY3A 1K39A 2ZQRA 2PPYA 4WZ8B 3L3SA 5DL1A 3OC7A 3H0SA 5KDRB 3H0QA 4MI2A 4KNPA 3QWDA 3DORA 1ON3A 5KDRA 5JBWA 1UYTA 3G64A 3BF0A 2VX2A 4K2NA 4FB8A 1RJMA 3I47A 5E0SA 3A4MA 4Q1IA 2A81A 4FN8A 4U0GA 4JYJA 4JCSA 4ZDCA 3Q1TA 1K32A 4WYOB 2Q35A 4NEKA 1XX4A 2J5SA 3TT7A 3GF7A 2J5IB 3W8IB 5C90A 1FC9A 3HLN1 3ADCA 4OLQA 3TRRA 2CE3A 5INFA 3HINA 4RYFH 5E0SH 1UYSA 4GHNA 2F9IB 1TYFA 5DKPA 3RSTA 3ZW8A 4HNKA 2DEOA 4JYLA 5E0NX 1UX4A 1TG6A 4JCQA 3PEAA 3R6HA 3TDCA 3ZWAA 4RCNA 2ZL0A 3FF6A 5MGBA 3RQEA 4FJWD 3ZWCA 4FZWC 4U19A 4K29A 5FUSA 2Q34A 3H0UA 3ISAA 3MT6A 4ZDBA 5DU4A 1UYRA 5G1SA 3ST9A 2C8TA 4G2RA 3IAVA 1OD4A 3KTJA 4F47A 3KTGA 4HDTA 3P2LA 4JFCA 4I4ZA 3TLFA 3VIVA 3ADDA 4U18A 3P5MA 4K3WA 3ZW9A 5DTPA 2UZFA 1EF9A 4ELXA 4Z0MA 2F9IA 3V5IA 4ZU2A 4LK5A 3DJAA 1Q52A 3TZ3A 4DI1A 3RQFA 1DCIA 1JXZA 5IKLB 4U1AA 1RJNA 2HW5A 2P63A 5DZKA 1SG4A 2YJGA 2J5GA 4ELWA 5INIA 3BPTA 3QXIA 4YLHA 3Q0GA 2VSSF 2X58A 1MJ3A 4FN7A 4ELSA 2J5GD 2WTBA 1J7XA 3BPPA 3T88A 3GKBA 3QKAA 2GTRA 3QMJA 3M6NA 5G1QA 5KJPA 4ASIA 5INGA 1YG8A 3LKEA 3K8XA 3T8BA 5JBXA 3KTIA 5DUFA 1Q51A
chains in the Genus database with same CATH topology
3MFMA 2QQ3A 1UYVA 4KPKA 3STAA 2BZRA 2F6IA 3SWXA 2FBMA 3U9SB 3R9TA 1XNWA 4KWBA 3V5EA 2VSUE 4GM2A 3OT6A 3R9QA 4JCRA 4QIJA 2X24A 2FZSA 3GLMA 5CTCA 4JJTA 3WG5A 3H02A 5DZKH 2D3TA 4JOTA 5CTBA 1XO6A 3H0JA 1VRGA 3RSIA 1XNVA 1FC7A 3LAOA 3MOYA 1HZDA 2EJ5A 2J5IA 2CBYA 3M6MA 3H81A 2Q2XA 3K50A 3Q7HA 1N6EA 3NJDA 3FDUA 1N6FA 2W3PA 1FCFA 4KD6A 3KTKA 4JSBA 4RYFA 3HE2A 3MYBA 5FIFA 4L8KA 2ZL2A 3R0OA 3ZWBA 1N6DA 2A7SA 4IZBA 5DU6A 4I42A 2IEXA 3R9SA 3T89A 3GMAA 2NP9A 3IBBA 3PGQA 4B3HA 3IB9A 4U0GH 1UIYA 3SLLA 4I52A 5DTWA 4EMLA 1O8UA 2VSSA 4JWVA 4MOUA 5DU8A 3HP0A 3QXZA 3N6RB 1WDLA 2PBPA 3U9RB 4ZDDA 3KQFA 4J2UA 4B3IA 2DUBA 3QK8A 3RRVA 1WDKA 2VSUC 4OMRA 4EMMA 3HRXA 2ZQQA 4JVTA 3T8AA 1X0UA 4U0HA 3KTHA 4FZWA 3P85A 2PG8A 4ZDFA 3JU1A 2F9YB 3PE8A 4B3JA 3NJBA 1FC6A 4FNBA 3T3WA 2VSSE 3Q0JA 2F9YA 1HNOA 1EF8A 1NZYA 1SZOA 5G1RA 4ZDEA 1NZYB 1XNYA 3GF3A 4QFEA 2ZL3A 4FNDA 2VREA 1PJHA 4NARA 4L6WA 4IZCA 1OD2A 3U9TB 5C9GA 5DUCA 3TVWA 1WDMA 4HC8A 4MXIA 1YG6A 1ON9A 4QIIA 2VSUA 1HNUA 4WCZA 4IZDA 1WZ8A 2VSUF 3PZKA 4NNQA 3OMEA 1DUBA 2FW2A 4EMPA 5HUQA 3TV5A 3QYRA 3TT6A 1Y7OA 2J5II 3QREA 3BEZA 2ZL4A 1PIXA 4Q0GA 2F6QA 2A7KA 4OG1A 1W2XA 4JCTA 3TVUA 1EY3A 1K39A 2ZQRA 2PPYA 4WZ8B 3L3SA 5DL1A 3OC7A 3H0SA 5KDRB 3H0QA 4MI2A 4KNPA 3QWDA 3DORA 1ON3A 5KDRA 5JBWA 1UYTA 3G64A 3BF0A 2VX2A 4K2NA 4FB8A 1RJMA 3I47A 5E0SA 4Q1IA 2A81A 4FN8A 4U0GA 4JYJA 4JCSA 4ZDCA 3Q1TA 1K32A 4WYOB 2Q35A 4NEKA 1XX4A 2J5SA 3TT7A 3GF7A 2J5IB 5C90A 1FC9A 3HLN1 4OLQA 3TRRA 2CE3A 5INFA 3HINA 4RYFH 5E0SH 1UYSA 4GHNA 2F9IB 1TYFA 5DKPA 3RSTA 3ZW8A 4HNKA 2DEOA 4JYLA 5E0NX 1TG6A 4JCQA 3PEAA 3R6HA 3ZWAA 3TDCA 4RCNA 2ZL0A 3FF6A 5MGBA 4FJWD 3ZWCA 4FZWC 4U19A 4K29A 5FUSA 2Q34A 3H0UA 3ISAA 3MT6A 4ZDBA 5DU4A 1UYRA 5G1SA 3ST9A 2C8TA 4G2RA 3IAVA 1OD4A 3KTJA 4F47A 3KTGA 4HDTA 3P2LA 4JFCA 4I4ZA 3TLFA 3VIVA 4U18A 3P5MA 4K3WA 3ZW9A 5DTPA 2UZFA 1EF9A 4ELXA 4Z0MA 2F9IA 3V5IA 4ZU2A 4LK5A 3DJAA 1Q52A 3TZ3A 4DI1A 1DCIA 1JXZA 5IKLB 4U1AA 1RJNA 2HW5A 5DZKA 1SG4A 2YJGA 2J5GA 4ELWA 5INIA 3BPTA 3QXIA 4YLHA 3Q0GA 2VSSF 2X58A 1MJ3A 4FN7A 4ELSA 2J5GD 2WTBA 1J7XA 3BPPA 3T88A 3GKBA 3QKAA 2GTRA 3QMJA 3M6NA 5G1QA 5KJPA 4ASIA 5INGA 1YG8A 3LKEA 3K8XA 3T8BA 5JBXA 3KTIA 5DUFA 1Q51A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MFM A;  2QQ3 A;  1UYV A;  4KPK A;  3STA A;  2BZR A;  2F6I A;  3SWX A;  2FBM A;  3U9S B;  3R9T A;  1XNW A;  4KWB A;  3V5E A;  2VSU E;  4GM2 A;  3OT6 A;  3R9Q A;  4JCR A;  4QIJ A;  2X24 A;  2FZS A;  3GLM A;  5CTC A;  4JJT A;  3WG5 A;  3H02 A;  5DZK H;  2D3T A;  4JOT A;  5CTB A;  1XO6 A;  3H0J A;  1VRG A;  3RSI A;  1XNV A;  1FC7 A;  3LAO A;  3MOY A;  1HZD A;  2EJ5 A;  2J5I A;  2CBY A;  3M6M A;  3H81 A;  2Q2X A;  3K50 A;  3Q7H A;  1N6E A;  3NJD A;  3FDU A;  1N6F A;  2W3P A;  1FCF A;  4KD6 A;  3KTK A;  4JSB A;  4RYF A;  3HE2 A;  3MYB A;  5FIF A;  4L8K A;  2ZL2 A;  3R0O A;  3ZWB A;  1N6D A;  2A7S A;  4IZB A;  5DU6 A;  4I42 A;  2IEX A;  3R9S A;  3T89 A;  3GMA A;  2NP9 A;  3IBB A;  3PGQ A;  4B3H A;  3IB9 A;  4U0G H;  1UIY A;  3SLL A;  4I52 A;  5DTW A;  4EML A;  1O8U A;  2VSS A;  4JWV A;  4MOU A;  5DU8 A;  3HP0 A;  3QXZ A;  3N6R B;  1WDL A;  2PBP A;  3U9R B;  4ZDD A;  3KQF A;  4B3I A;  2DUB A;  3QK8 A;  3RRV A;  1WDK A;  2VSU C;  4OMR A;  4EMM A;  3HRX A;  2ZQQ A;  4JVT A;  3T8A A;  1X0U A;  4U0H A;  3KTH A;  4FZW A;  3P85 A;  2PG8 A;  4ZDF A;  3JU1 A;  2F9Y B;  3PE8 A;  4B3J A;  3NJB A;  1FC6 A;  4FNB A;  3T3W A;  2VSS E;  3Q0J A;  2F9Y A;  1HNO A;  1EF8 A;  1NZY A;  1SZO A;  5G1R A;  4ZDE A;  1NZY B;  1XNY A;  3GF3 A;  4QFE A;  2ZL3 A;  4FND A;  2VRE A;  1PJH A;  4L6W A;  4IZC A;  1OD2 A;  3U9T B;  5C9G A;  5DUC A;  3TVW A;  1WDM A;  4HC8 A;  4MXI A;  1YG6 A;  1ON9 A;  4QII A;  2VSU A;  1HNU A;  4WCZ A;  4IZD A;  1WZ8 A;  2VSU F;  3PZK A;  4NNQ A;  3OME A;  1DUB A;  2FW2 A;  4EMP A;  3TV5 A;  3QYR A;  3TT6 A;  1Y7O A;  2J5I I;  3QRE A;  3BEZ A;  2ZL4 A;  1PIX A;  4Q0G A;  2F6Q A;  2A7K A;  4OG1 A;  1W2X A;  4JCT A;  3TVU A;  1EY3 A;  1K39 A;  2ZQR A;  2PPY A;  4WZ8 B;  3L3S A;  5DL1 A;  3OC7 A;  3H0S A;  5KDR B;  3H0Q A;  4MI2 A;  4KNP A;  3QWD A;  3DOR A;  1ON3 A;  5KDR A;  5JBW A;  1UYT A;  3G64 A;  3BF0 A;  2VX2 A;  4K2N A;  4FB8 A;  1RJM A;  3I47 A;  5E0S A;  4Q1I A;  2A81 A;  4FN8 A;  4U0G A;  4JYJ A;  4JCS A;  4ZDC A;  3Q1T A;  1K32 A;  4WYO B;  2Q35 A;  4NEK A;  1XX4 A;  2J5S A;  3TT7 A;  3GF7 A;  2J5I B;  5C90 A;  1FC9 A;  3HLN 1;  4OLQ A;  3TRR A;  2CE3 A;  5INF A;  3HIN A;  4RYF H;  5E0S H;  1UYS A;  4GHN A;  2F9I B;  1TYF A;  5DKP A;  3RST A;  3ZW8 A;  4HNK A;  2DEO A;  4JYL A;  5E0N X;  1TG6 A;  4JCQ A;  3PEA A;  3R6H A;  3ZWA A;  3TDC A;  4RCN A;  2ZL0 A;  3FF6 A;  5MGB A;  4FJW D;  3ZWC A;  4FZW C;  4U19 A;  4K29 A;  5FUS A;  2Q34 A;  3H0U A;  3ISA A;  3MT6 A;  4ZDB A;  5DU4 A;  1UYR A;  5G1S A;  3ST9 A;  2C8T A;  4G2R A;  3IAV A;  1OD4 A;  3KTJ A;  4F47 A;  3KTG A;  3P2L A;  4JFC A;  4I4Z A;  3TLF A;  3VIV A;  4U18 A;  3P5M A;  4K3W A;  3ZW9 A;  5DTP A;  2UZF A;  1EF9 A;  4ELX A;  4Z0M A;  2F9I A;  3V5I A;  4ZU2 A;  4LK5 A;  3DJA A;  1Q52 A;  3TZ3 A;  4DI1 A;  1DCI A;  1JXZ A;  5IKL B;  4U1A A;  1RJN A;  2HW5 A;  5DZK A;  1SG4 A;  2J5G A;  4ELW A;  5INI A;  3QXI A;  4YLH A;  3Q0G A;  2VSS F;  2X58 A;  1MJ3 A;  4FN7 A;  4ELS A;  2J5G D;  2WTB A;  1J7X A;  3BPP A;  3T88 A;  3GKB A;  3QKA A;  2GTR A;  3QMJ A;  3M6N A;  5G1Q A;  5KJP A;  4ASI A;  5ING A;  1YG8 A;  3LKE A;  3K8X A;  3T8B A;  5JBX A;  3KTI A;  5DUF A;  1Q51 A; 
#chains in the Genus database with same CATH topology
 3MFM A;  2QQ3 A;  3IRB A;  1UYV A;  4KPK A;  3STA A;  2BZR A;  2F6I A;  3SWX A;  2FBM A;  3U9S B;  3R9T A;  1XNW A;  4KWB A;  3V5E A;  2VSU E;  4GM2 A;  3OT6 A;  3R9Q A;  4JCR A;  4QIJ A;  3RQG A;  2X24 A;  2FZS A;  3GLM A;  5CTC A;  4JJT A;  3WG5 A;  3H02 A;  5DZK H;  2D3T A;  4JOT A;  1Y64 B;  5CTB A;  1XO6 A;  3H0J A;  1VRG A;  3RSI A;  1XNV A;  1FC7 A;  3LAO A;  3MOY A;  1HZD A;  2EJ5 A;  2J5I A;  2CBY A;  3M6M A;  3H81 A;  2Q2X A;  3K50 A;  3Q7H A;  1N6E A;  3NJD A;  3FDU A;  1N6F A;  2W3P A;  1FCF A;  4KD6 A;  3KTK A;  4JSB A;  4RYF A;  3HE2 A;  3MYB A;  3ADB A;  5FIF A;  4L8K A;  2ZL2 A;  3R0O A;  3ZWB A;  1N6D A;  4GEH B;  2A7S A;  4IZB A;  5DU6 A;  4I42 A;  2IEX A;  3R9S A;  3T89 A;  3GMA A;  2NP9 A;  3IBB A;  3PGQ A;  4B3H A;  3IB9 A;  3A4L A;  4U0G H;  1UIY A;  3SLL A;  4I52 A;  5DTW A;  4EML A;  1O8U A;  2VSS A;  3A4N A;  4JWV A;  4MOU A;  5DU8 A;  3HP0 A;  3L8I A;  3QXZ A;  3N6R B;  1WDL A;  2PBP A;  3U9R B;  4ZDD A;  3KQF A;  4J2U A;  3O4X E;  4B3I A;  2DUB A;  3AJM A;  3QK8 A;  3RRV A;  1WDK A;  2VSU C;  4OMR A;  4EMM A;  1UX5 A;  3HRX A;  2ZQQ A;  4JVT A;  3T8A A;  1X0U A;  4U0H A;  3KTH A;  4FZW A;  3P85 A;  2PG8 A;  4ZDF A;  3JU1 A;  2F9Y B;  3PE8 A;  4B3J A;  3NJB A;  1FC6 A;  3L8J A;  4FNB A;  3T3W A;  2VSS E;  3Q0J A;  3W8H B;  2F9Y A;  1HNO A;  1EF8 A;  1NZY A;  1SZO A;  5G1R A;  4ZDE A;  1NZY B;  1XNY A;  3GF3 A;  4QFE A;  2ZL3 A;  4FND A;  2VRE A;  1PJH A;  4NAR A;  4L6W A;  4IZC A;  1OD2 A;  3U9T B;  5C9G A;  5DUC A;  3TVW A;  1WDM A;  4HC8 A;  4MXI A;  1YG6 A;  1ON9 A;  4QII A;  2VSU A;  1HNU A;  4WCZ A;  4IZD A;  3AM1 A;  1WZ8 A;  2VSU F;  3PZK A;  4NNQ A;  3OME A;  1DUB A;  2FW2 A;  4EMP A;  5HUQ A;  3TV5 A;  3QYR A;  3TT6 A;  1Y7O A;  2J5I I;  3QRE A;  3BEZ A;  2ZL4 A;  1PIX A;  4Q0G A;  2F6Q A;  2A7K A;  4OG1 A;  1W2X A;  4JCT A;  3TVU A;  1EY3 A;  1K39 A;  2ZQR A;  2PPY A;  4WZ8 B;  3L3S A;  5DL1 A;  3OC7 A;  3H0S A;  5KDR B;  3H0Q A;  4MI2 A;  4KNP A;  3QWD A;  3DOR A;  1ON3 A;  5KDR A;  5JBW A;  1UYT A;  3G64 A;  3BF0 A;  2VX2 A;  4K2N A;  4FB8 A;  1RJM A;  3I47 A;  5E0S A;  3A4M A;  4Q1I A;  2A81 A;  4FN8 A;  4U0G A;  4JYJ A;  4JCS A;  4ZDC A;  3Q1T A;  1K32 A;  4WYO B;  2Q35 A;  4NEK A;  1XX4 A;  2J5S A;  3TT7 A;  3GF7 A;  2J5I B;  3W8I B;  5C90 A;  1FC9 A;  3HLN 1;  3ADC A;  4OLQ A;  3TRR A;  2CE3 A;  5INF A;  3HIN A;  4RYF H;  5E0S H;  1UYS A;  4GHN A;  2F9I B;  1TYF A;  5DKP A;  3RST A;  3ZW8 A;  4HNK A;  2DEO A;  4JYL A;  5E0N X;  1UX4 A;  1TG6 A;  4JCQ A;  3PEA A;  3R6H A;  3TDC A;  3ZWA A;  4RCN A;  2ZL0 A;  3FF6 A;  5MGB A;  3RQE A;  4FJW D;  3ZWC A;  4FZW C;  4U19 A;  4K29 A;  5FUS A;  2Q34 A;  3H0U A;  3ISA A;  3MT6 A;  4ZDB A;  5DU4 A;  1UYR A;  5G1S A;  3ST9 A;  2C8T A;  4G2R A;  3IAV A;  1OD4 A;  3KTJ A;  4F47 A;  3KTG A;  4HDT A;  3P2L A;  4JFC A;  4I4Z A;  3TLF A;  3VIV A;  3ADD A;  4U18 A;  3P5M A;  4K3W A;  3ZW9 A;  5DTP A;  2UZF A;  1EF9 A;  4ELX A;  4Z0M A;  2F9I A;  3V5I A;  4ZU2 A;  4LK5 A;  3DJA A;  1Q52 A;  3TZ3 A;  4DI1 A;  3RQF A;  1DCI A;  1JXZ A;  5IKL B;  4U1A A;  1RJN A;  2HW5 A;  2P63 A;  5DZK A;  1SG4 A;  2YJG A;  2J5G A;  4ELW A;  5INI A;  3BPT A;  3QXI A;  4YLH A;  3Q0G A;  2VSS F;  2X58 A;  1MJ3 A;  4FN7 A;  4ELS A;  2J5G D;  2WTB A;  1J7X A;  3BPP A;  3T88 A;  3GKB A;  3QKA A;  2GTR A;  3QMJ A;  3M6N A;  5G1Q A;  5KJP A;  4ASI A;  5ING A;  1YG8 A;  3LKE A;  3K8X A;  3T8B A;  5JBX A;  3KTI A;  5DUF A;  1Q51 A; 
#chains in the Genus database with same CATH homology
 3MFM A;  2QQ3 A;  1UYV A;  4KPK A;  3STA A;  2BZR A;  2F6I A;  3SWX A;  2FBM A;  3U9S B;  3R9T A;  1XNW A;  4KWB A;  3V5E A;  2VSU E;  4GM2 A;  3OT6 A;  3R9Q A;  4JCR A;  4QIJ A;  2X24 A;  2FZS A;  3GLM A;  5CTC A;  4JJT A;  3WG5 A;  3H02 A;  5DZK H;  2D3T A;  4JOT A;  5CTB A;  1XO6 A;  3H0J A;  1VRG A;  3RSI A;  1XNV A;  1FC7 A;  3LAO A;  3MOY A;  1HZD A;  2EJ5 A;  2J5I A;  2CBY A;  3M6M A;  3H81 A;  2Q2X A;  3K50 A;  3Q7H A;  1N6E A;  3NJD A;  3FDU A;  1N6F A;  2W3P A;  1FCF A;  4KD6 A;  3KTK A;  4JSB A;  4RYF A;  3HE2 A;  3MYB A;  5FIF A;  4L8K A;  2ZL2 A;  3R0O A;  3ZWB A;  1N6D A;  2A7S A;  4IZB A;  5DU6 A;  4I42 A;  2IEX A;  3R9S A;  3T89 A;  3GMA A;  2NP9 A;  3IBB A;  3PGQ A;  4B3H A;  3IB9 A;  4U0G H;  1UIY A;  3SLL A;  4I52 A;  5DTW A;  4EML A;  1O8U A;  2VSS A;  4JWV A;  4MOU A;  5DU8 A;  3HP0 A;  3QXZ A;  3N6R B;  1WDL A;  2PBP A;  3U9R B;  4ZDD A;  3KQF A;  4J2U A;  4B3I A;  2DUB A;  3QK8 A;  3RRV A;  1WDK A;  2VSU C;  4OMR A;  4EMM A;  3HRX A;  2ZQQ A;  4JVT A;  3T8A A;  1X0U A;  4U0H A;  3KTH A;  4FZW A;  3P85 A;  2PG8 A;  4ZDF A;  3JU1 A;  2F9Y B;  3PE8 A;  4B3J A;  3NJB A;  1FC6 A;  4FNB A;  3T3W A;  2VSS E;  3Q0J A;  2F9Y A;  1HNO A;  1EF8 A;  1NZY A;  1SZO A;  5G1R A;  4ZDE A;  1NZY B;  1XNY A;  3GF3 A;  4QFE A;  2ZL3 A;  4FND A;  2VRE A;  1PJH A;  4NAR A;  4L6W A;  4IZC A;  1OD2 A;  3U9T B;  5C9G A;  5DUC A;  3TVW A;  1WDM A;  4HC8 A;  4MXI A;  1YG6 A;  1ON9 A;  4QII A;  2VSU A;  1HNU A;  4WCZ A;  4IZD A;  1WZ8 A;  2VSU F;  3PZK A;  4NNQ A;  3OME A;  1DUB A;  2FW2 A;  4EMP A;  5HUQ A;  3TV5 A;  3QYR A;  3TT6 A;  1Y7O A;  2J5I I;  3QRE A;  3BEZ A;  2ZL4 A;  1PIX A;  4Q0G A;  2F6Q A;  2A7K A;  4OG1 A;  1W2X A;  4JCT A;  3TVU A;  1EY3 A;  1K39 A;  2ZQR A;  2PPY A;  4WZ8 B;  3L3S A;  5DL1 A;  3OC7 A;  3H0S A;  5KDR B;  3H0Q A;  4MI2 A;  4KNP A;  3QWD A;  3DOR A;  1ON3 A;  5KDR A;  5JBW A;  1UYT A;  3G64 A;  3BF0 A;  2VX2 A;  4K2N A;  4FB8 A;  1RJM A;  3I47 A;  5E0S A;  4Q1I A;  2A81 A;  4FN8 A;  4U0G A;  4JYJ A;  4JCS A;  4ZDC A;  3Q1T A;  1K32 A;  4WYO B;  2Q35 A;  4NEK A;  1XX4 A;  2J5S A;  3TT7 A;  3GF7 A;  2J5I B;  5C90 A;  1FC9 A;  3HLN 1;  4OLQ A;  3TRR A;  2CE3 A;  5INF A;  3HIN A;  4RYF H;  5E0S H;  1UYS A;  4GHN A;  2F9I B;  1TYF A;  5DKP A;  3RST A;  3ZW8 A;  4HNK A;  2DEO A;  4JYL A;  5E0N X;  1TG6 A;  4JCQ A;  3PEA A;  3R6H A;  3ZWA A;  3TDC A;  4RCN A;  2ZL0 A;  3FF6 A;  5MGB A;  4FJW D;  3ZWC A;  4FZW C;  4U19 A;  4K29 A;  5FUS A;  2Q34 A;  3H0U A;  3ISA A;  3MT6 A;  4ZDB A;  5DU4 A;  1UYR A;  5G1S A;  3ST9 A;  2C8T A;  4G2R A;  3IAV A;  1OD4 A;  3KTJ A;  4F47 A;  3KTG A;  4HDT A;  3P2L A;  4JFC A;  4I4Z A;  3TLF A;  3VIV A;  4U18 A;  3P5M A;  4K3W A;  3ZW9 A;  5DTP A;  2UZF A;  1EF9 A;  4ELX A;  4Z0M A;  2F9I A;  3V5I A;  4ZU2 A;  4LK5 A;  3DJA A;  1Q52 A;  3TZ3 A;  4DI1 A;  1DCI A;  1JXZ A;  5IKL B;  4U1A A;  1RJN A;  2HW5 A;  5DZK A;  1SG4 A;  2YJG A;  2J5G A;  4ELW A;  5INI A;  3BPT A;  3QXI A;  4YLH A;  3Q0G A;  2VSS F;  2X58 A;  1MJ3 A;  4FN7 A;  4ELS A;  2J5G D;  2WTB A;  1J7X A;  3BPP A;  3T88 A;  3GKB A;  3QKA A;  2GTR A;  3QMJ A;  3M6N A;  5G1Q A;  5KJP A;  4ASI A;  5ING A;  1YG8 A;  3LKE A;  3K8X A;  3T8B A;  5JBX A;  3KTI A;  5DUF A;  1Q51 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...