4I52A

Scmenb im complex with 1-hydroxy-2-naphthoyl-coa
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
275
structure length
275
Chain Sequence
MDWHIAKHYDDILYYKAGGIAKIVINRPHKRNAFRPQTVFELYDAFCNAREDNRIGVVLLTGAGPHSDGKYAFCSGGDQSVRGEGGYIDDQGTPRLNVLDLQRLIRSMPKVVIALVAGYAIGGGHVLHLVCDLTIAADNAIFGQTGPKVGSFDGGFGSSYLARIVGQKKAREIWYLCRQYSAQEAERMGMVNTVVPVDRLEEEGIQWAKEILSKSPLAIRCLKAAFNADCDGQAGLQELAGNATLLYYMTEEGSEGKQAFLEKRPPDFSQYPWLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of the induced-fit mechanism of 1,4-dihydroxy-2-naphthoyl coenzyme a synthase from the crotonase fold superfamily
pubmed doi rcsb
molecule tags Lyase
molecule keywords Naphthoate synthase
total genus 100
structure length 275
sequence length 275
chains with identical sequence B, C, D, E, F, G, H, I
ec nomenclature ec 4.1.3.36: 1,4-dihydroxy-2-naphthoyl-CoA synthase.
pdb deposition date 2012-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.10 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase, Chain A, domain 2 4i52A02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 4i52A01
4L6WA 2A7SA 2J5IA 3T88A 4JJTA 3ST9A 3K50A 4QIIA 2Q35A 1WDMA 3RRVA 3R9QA 1TG6A 3H0UA 4FNDA 5JBXA 3PZKA 3H02A 4Q0GA 1NZYB 4ELXA 1WZ8A 1PJHA 4FZWC 3T8AA 1FC7A 3STAA 1SZOA 4ZDFA 1XNVA 1K32A 1FCFA 5E0SH 3H81A 5DL1A 3IBBA 5JBWA 4IZCA 4WZ8B 4FN7A 2C8TA 3ZWCA 3HRXA 4KPKA 4YLHA 1RJNA 1FC6A 3OT6A 3I47A 3BPPA 3R0OA 2J5IB 3MYBA 2HW5A 3ZW9A 4JCQA 1X0UA 5IKLB 4Q1IA 4WCZA 3Q7HA 5DZKA 1OD2A 4ZDCA 2J5GD 4MXIA 3MFMA 5G1SA 2F9IA 3HLN1 1WDLA 4EMPA 1K39A 3ZWAA 3H0SA 5CTCA 3QXIA 4QFEA 1NZYA 4U0GA 3GF3A 3ZW8A 3T8BA 3ZWBA 5FIFA 4ELSA 3TT7A 4U0HA 4FNBA 3TV5A 1TYFA 5DU4A 1EY3A 4JCRA 3MOYA 3HP0A 4IZDA 2ZQRA 3M6MA 4I52A 2FW2A 2VSSA 1EF9A 2J5GA 3G64A 3KTHA 4OG1A 3T89A 4ELWA 3QWDA 4FZWA 4I4ZA 3P85A 2VX2A 5E0SA 3V5EA 2D3TA 3QKAA 2DUBA 3NJDA 4HNKA 4RYFH 2F9IB 3TT6A 5DTPA 2BZRA 2UZFA 3RSTA 1Q51A 3Q1TA 2VREA 3LKEA 3U9SB 4U19A 4K29A 1Y7OA 4LK5A 3TVWA 4ZDDA 3R9TA 2FZSA 5KDRA 3OC7A 4FN8A 5G1RA 4B3JA 1UYTA 2F9YB 3NJBA 3V5IA 5INGA 3KTGA 3Q0JA 3HE2A 5INIA 1XO6A 5DUCA 2X24A 4B3IA 2F6QA 3QK8A 3SWXA 1OD4A 1N6FA 1YG8A 5C90A 1HNUA 5CTBA 2FBMA 3R9SA 1DCIA 2PBPA 1N6EA 3IAVA 3U9TB 1VRGA 4WYOB 4FJWD 2PG8A 3P2LA 4JCTA 2ZL3A 2F9YA 2ZL4A 1W2XA 3GMAA 4EMLA 1UYSA 1N6DA 1SG4A 5KJPA 1UIYA 3HINA 3Q0GA 3LAOA 5G1QA 3GKBA 2VSSF 1ON3A 1JXZA 4B3HA 3H0QA 3GF7A 4ZDEA 1ON9A 1Q52A 1HZDA 2ZL0A 2ZL2A 2PPYA 3JU1A 3KTIA 2Q34A 4JFCA 3QREA 4G2RA 4ZU2A 1WDKA 3KTJA 3GLMA 3WG5A 1UYVA 2GTRA 2Q2XA 2VSSE 2WTBA 3U9RB 4JCSA 2F6IA 2A81A 3H0JA 5E0NX 1XNWA 4MOUA 4RYFA 4GM2A 1XNYA 4DI1A 2CE3A 3P5MA 4IZBA 5DU6A 1RJMA 3OMEA 3FDUA 3QMJA 4U0GH 4ZDBA 4FB8A 2A7KA 2VSUF 3KTKA 5INFA 3TRRA 4GHNA 4QIJA 4JOTA 5DUFA 1EF8A 3M6NA 3IB9A 3RSIA 3R6HA 5DTWA 4JWVA 5C9GA 4K2NA 3L3SA 5DKPA 2W3PA 2IEXA 3N6RB 3VIVA 4K3WA 3DJAA 4MI2A 3BF0A 3BEZA 4RCNA 4JSBA 3PEAA 4NEKA 2J5SA 4KD6A 5KDRB 3TLFA 5FUSA 3KQFA 2VSUE 4NNQA 2EJ5A 3TZ3A 3PGQA 2ZQQA 4KNPA 2QQ3A 3SLLA 1HNOA 1PIXA 5DU8A 3DORA 5MGBA 4KWBA 3FF6A 1MJ3A 2VSUC 2VSUA 3PE8A 1UYRA 2CBYA 1YG6A 4JVTA 3TVUA 3K8XA 1DUBA 3TDCA 4U1AA 4U18A 4HC8A 3QXZA 1FC9A 4ASIA 3MT6A 1O8UA 4JYJA 1J7XA 4OMRA 4EMMA 2X58A 4I42A 3QYRA 4OLQA 2NP9A 4F47A 2J5II 4L8KA 2DEOA 3T3WA 1XX4A 5DZKH 4Z0MA 3ISAA 4JYLA
chains in the Genus database with same CATH superfamily
4L6WA 2A7SA 2J5IA 3T88A 4JJTA 3ST9A 3K50A 4QIIA 2Q35A 1WDMA 3RRVA 3R9QA 1TG6A 1Y64B 3H0UA 4FNDA 5JBXA 3PZKA 3H02A 4Q0GA 1NZYB 4ELXA 1WZ8A 1PJHA 4FZWC 3T8AA 1FC7A 3STAA 1SZOA 4ZDFA 1XNVA 1K32A 1FCFA 5E0SH 3H81A 5DL1A 3ADBA 1UX4A 5JBWA 4IZCA 3IBBA 4WZ8B 4FN7A 2C8TA 3ZWCA 3HRXA 4KPKA 4YLHA 1RJNA 1FC6A 3OT6A 3I47A 3BPPA 3R0OA 2J5IB 3MYBA 2HW5A 3ZW9A 4JCQA 1X0UA 5IKLB 4Q1IA 4WCZA 3Q7HA 5DZKA 1OD2A 4ZDCA 2J5GD 4MXIA 3MFMA 5G1SA 2F9IA 3HLN1 1WDLA 4EMPA 1K39A 3ZWAA 3RQGA 3H0SA 5CTCA 3QXIA 3W8IB 5HUQA 4QFEA 1NZYA 4U0GA 3GF3A 3ZW8A 3T8BA 3ZWBA 5FIFA 4ELSA 3TT7A 4U0HA 4FNBA 3TV5A 4J2UA 1TYFA 5DU4A 1EY3A 4JCRA 3MOYA 3HP0A 4IZDA 3RQEA 2ZQRA 3M6MA 4I52A 2FW2A 2VSSA 1EF9A 2J5GA 3G64A 3KTHA 4OG1A 3T89A 4ELWA 3QWDA 4FZWA 4I4ZA 3P85A 2VX2A 5E0SA 3V5EA 2D3TA 3QKAA 2DUBA 3NJDA 4HNKA 3IRBA 4RYFH 2F9IB 3TT6A 5DTPA 2BZRA 2UZFA 3RSTA 1Q51A 3Q1TA 2VREA 3LKEA 3U9SB 4U19A 3ADCA 4K29A 1Y7OA 4LK5A 3TVWA 4ZDDA 3R9TA 2FZSA 5KDRA 3OC7A 4FN8A 5G1RA 4B3JA 3AM1A 1UYTA 2F9YB 3NJBA 3V5IA 5INGA 3KTGA 3Q0JA 3HE2A 2YJGA 5INIA 1XO6A 5DUCA 2X24A 4B3IA 2F6QA 3QK8A 3SWXA 1OD4A 1N6FA 1YG8A 5C90A 1HNUA 5CTBA 3ADDA 2FBMA 3R9SA 1DCIA 2PBPA 1N6EA 3IAVA 4HDTA 3A4LA 3U9TB 1VRGA 4WYOB 4FJWD 2PG8A 3P2LA 4JCTA 2ZL3A 2F9YA 2ZL4A 1W2XA 3GMAA 3BPTA 4EMLA 1UYSA 1N6DA 1SG4A 5KJPA 1UIYA 3HINA 3Q0GA 3LAOA 5G1QA 3GKBA 2VSSF 1ON3A 1JXZA 4B3HA 4NARA 3H0QA 3GF7A 4ZDEA 1ON9A 1Q52A 1HZDA 2ZL0A 2ZL2A 2PPYA 3JU1A 3KTIA 2Q34A 4JFCA 3QREA 4G2RA 4ZU2A 1WDKA 3KTJA 3GLMA 3WG5A 1UYVA 2GTRA 2Q2XA 2VSSE 2WTBA 3U9RB 4JCSA 2F6IA 2A81A 3H0JA 5E0NX 1XNWA 3AJMA 4MOUA 4RYFA 4GM2A 1XNYA 4DI1A 3RQFA 3O4XE 2CE3A 3P5MA 4IZBA 5DU6A 1RJMA 3OMEA 3FDUA 3QMJA 3W8HB 4U0GH 4ZDBA 4FB8A 2A7KA 2VSUF 3KTKA 5INFA 3TRRA 4GHNA 4QIJA 4JOTA 5DUFA 1EF8A 3M6NA 3IB9A 3RSIA 3R6HA 5DTWA 4JWVA 5C9GA 4K2NA 3L3SA 5DKPA 2W3PA 2IEXA 3N6RB 3A4NA 3VIVA 4K3WA 3DJAA 3L8JA 4MI2A 3BF0A 3BEZA 4RCNA 4JSBA 3PEAA 4NEKA 2J5SA 4KD6A 5KDRB 3L8IA 3TLFA 5FUSA 3KQFA 2VSUE 4NNQA 2EJ5A 3TZ3A 3PGQA 2ZQQA 4KNPA 2QQ3A 3SLLA 1HNOA 1PIXA 5DU8A 3DORA 5MGBA 3A4MA 4KWBA 4GEHB 3FF6A 1MJ3A 2VSUC 2VSUA 3PE8A 1UYRA 2CBYA 1YG6A 4JVTA 3TVUA 3K8XA 1DUBA 3TDCA 4U1AA 4U18A 4HC8A 3QXZA 1FC9A 4ASIA 3MT6A 1O8UA 4JYJA 1J7XA 4OMRA 4EMMA 2X58A 4I42A 3QYRA 4OLQA 2NP9A 4F47A 2J5II 4L8KA 2DEOA 3T3WA 1XX4A 5DZKH 2P63A 4Z0MA 3ISAA 4JYLA 1UX5A
chains in the Genus database with same CATH topology
4L6WA 2A7SA 2J5IA 3T88A 4JJTA 3ST9A 3K50A 4QIIA 2Q35A 1WDMA 3RRVA 3R9QA 1TG6A 3H0UA 4FNDA 5JBXA 3PZKA 3H02A 4Q0GA 1NZYB 4ELXA 1WZ8A 1PJHA 4FZWC 3T8AA 1FC7A 3STAA 1SZOA 4ZDFA 1XNVA 1K32A 1FCFA 5E0SH 3H81A 5DL1A 3IBBA 5JBWA 4IZCA 4WZ8B 4FN7A 2C8TA 3ZWCA 3HRXA 4KPKA 4YLHA 1RJNA 1FC6A 3OT6A 3I47A 3BPPA 3R0OA 2J5IB 3MYBA 2HW5A 3ZW9A 4JCQA 1X0UA 5IKLB 4Q1IA 4WCZA 3Q7HA 5DZKA 1OD2A 4ZDCA 2J5GD 4MXIA 3MFMA 5G1SA 2F9IA 3HLN1 1WDLA 4EMPA 1K39A 3ZWAA 3H0SA 5CTCA 3QXIA 5HUQA 4QFEA 1NZYA 4U0GA 3GF3A 3ZW8A 3T8BA 3ZWBA 5FIFA 4ELSA 3TT7A 4U0HA 4FNBA 3TV5A 4J2UA 1TYFA 5DU4A 1EY3A 4JCRA 3MOYA 3HP0A 4IZDA 2ZQRA 3M6MA 4I52A 2FW2A 2VSSA 1EF9A 2J5GA 3G64A 3KTHA 4OG1A 3T89A 4ELWA 3QWDA 4FZWA 4I4ZA 3P85A 2VX2A 5E0SA 3V5EA 2D3TA 3QKAA 2DUBA 3NJDA 4HNKA 4RYFH 2F9IB 3TT6A 5DTPA 2BZRA 2UZFA 3RSTA 1Q51A 3Q1TA 2VREA 3LKEA 3U9SB 4U19A 4K29A 1Y7OA 4LK5A 3TVWA 4ZDDA 3R9TA 2FZSA 5KDRA 3OC7A 4FN8A 5G1RA 4B3JA 1UYTA 2F9YB 3NJBA 3V5IA 5INGA 3KTGA 3Q0JA 3HE2A 2YJGA 5INIA 1XO6A 5DUCA 2X24A 4B3IA 2F6QA 3QK8A 3SWXA 1OD4A 1N6FA 1YG8A 5C90A 1HNUA 5CTBA 2FBMA 3R9SA 1DCIA 2PBPA 1N6EA 3IAVA 4HDTA 3U9TB 1VRGA 4WYOB 4FJWD 2PG8A 3P2LA 4JCTA 2ZL3A 2F9YA 2ZL4A 1W2XA 3GMAA 3BPTA 4EMLA 1UYSA 1N6DA 1SG4A 5KJPA 1UIYA 3HINA 3Q0GA 3LAOA 5G1QA 3GKBA 2VSSF 1ON3A 1JXZA 4B3HA 4NARA 3H0QA 3GF7A 4ZDEA 1ON9A 1Q52A 1HZDA 2ZL0A 2ZL2A 2PPYA 3JU1A 3KTIA 2Q34A 4JFCA 3QREA 4G2RA 4ZU2A 1WDKA 3KTJA 3GLMA 3WG5A 1UYVA 2GTRA 2Q2XA 2VSSE 2WTBA 3U9RB 4JCSA 2F6IA 2A81A 3H0JA 5E0NX 1XNWA 4MOUA 4RYFA 4GM2A 1XNYA 4DI1A 2CE3A 3P5MA 4IZBA 5DU6A 1RJMA 3OMEA 3FDUA 3QMJA 4U0GH 4ZDBA 4FB8A 2A7KA 2VSUF 3KTKA 5INFA 3TRRA 4GHNA 4QIJA 4JOTA 5DUFA 1EF8A 3M6NA 3IB9A 3RSIA 3R6HA 5DTWA 4JWVA 5C9GA 4K2NA 3L3SA 5DKPA 2W3PA 2IEXA 3N6RB 3VIVA 4K3WA 3DJAA 4MI2A 3BF0A 3BEZA 4RCNA 4JSBA 3PEAA 4NEKA 2J5SA 4KD6A 5KDRB 3TLFA 5FUSA 3KQFA 2VSUE 4NNQA 2EJ5A 3TZ3A 3PGQA 2ZQQA 4KNPA 2QQ3A 3SLLA 1HNOA 1PIXA 5DU8A 3DORA 5MGBA 4KWBA 3FF6A 1MJ3A 2VSUC 2VSUA 3PE8A 1UYRA 2CBYA 1YG6A 4JVTA 3TVUA 3K8XA 1DUBA 3TDCA 4U1AA 4U18A 4HC8A 3QXZA 1FC9A 4ASIA 3MT6A 1O8UA 4JYJA 1J7XA 4OMRA 4EMMA 2X58A 4I42A 3QYRA 4OLQA 2NP9A 4F47A 2J5II 4L8KA 2DEOA 3T3WA 1XX4A 5DZKH 4Z0MA 3ISAA 4JYLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L6W A;  2A7S A;  2J5I A;  3T88 A;  4JJT A;  3ST9 A;  3K50 A;  4QII A;  2Q35 A;  1WDM A;  3RRV A;  3R9Q A;  1TG6 A;  3H0U A;  4FND A;  5JBX A;  3PZK A;  3H02 A;  4Q0G A;  1NZY B;  4ELX A;  1WZ8 A;  1PJH A;  4FZW C;  3T8A A;  1FC7 A;  3STA A;  1SZO A;  4ZDF A;  1XNV A;  1K32 A;  1FCF A;  5E0S H;  3H81 A;  5DL1 A;  3IBB A;  5JBW A;  4IZC A;  4WZ8 B;  4FN7 A;  2C8T A;  3ZWC A;  3HRX A;  4KPK A;  4YLH A;  1RJN A;  1FC6 A;  3OT6 A;  3I47 A;  3BPP A;  3R0O A;  2J5I B;  3MYB A;  2HW5 A;  3ZW9 A;  4JCQ A;  1X0U A;  5IKL B;  4Q1I A;  4WCZ A;  3Q7H A;  5DZK A;  1OD2 A;  4ZDC A;  2J5G D;  4MXI A;  3MFM A;  5G1S A;  2F9I A;  3HLN 1;  1WDL A;  4EMP A;  1K39 A;  3ZWA A;  3H0S A;  5CTC A;  3QXI A;  4QFE A;  1NZY A;  4U0G A;  3GF3 A;  3ZW8 A;  3T8B A;  3ZWB A;  5FIF A;  4ELS A;  3TT7 A;  4U0H A;  4FNB A;  3TV5 A;  1TYF A;  5DU4 A;  1EY3 A;  4JCR A;  3MOY A;  3HP0 A;  4IZD A;  2ZQR A;  3M6M A;  4I52 A;  2FW2 A;  2VSS A;  1EF9 A;  2J5G A;  3G64 A;  3KTH A;  4OG1 A;  3T89 A;  4ELW A;  3QWD A;  4FZW A;  4I4Z A;  3P85 A;  2VX2 A;  5E0S A;  3V5E A;  2D3T A;  3QKA A;  2DUB A;  3NJD A;  4HNK A;  4RYF H;  2F9I B;  3TT6 A;  5DTP A;  2BZR A;  2UZF A;  3RST A;  1Q51 A;  3Q1T A;  2VRE A;  3LKE A;  3U9S B;  4U19 A;  4K29 A;  1Y7O A;  4LK5 A;  3TVW A;  4ZDD A;  3R9T A;  2FZS A;  5KDR A;  3OC7 A;  4FN8 A;  5G1R A;  4B3J A;  1UYT A;  2F9Y B;  3NJB A;  3V5I A;  5ING A;  3KTG A;  3Q0J A;  3HE2 A;  5INI A;  1XO6 A;  5DUC A;  2X24 A;  4B3I A;  2F6Q A;  3QK8 A;  3SWX A;  1OD4 A;  1N6F A;  1YG8 A;  5C90 A;  1HNU A;  5CTB A;  2FBM A;  3R9S A;  1DCI A;  2PBP A;  1N6E A;  3IAV A;  3U9T B;  1VRG A;  4WYO B;  4FJW D;  2PG8 A;  3P2L A;  4JCT A;  2ZL3 A;  2F9Y A;  2ZL4 A;  1W2X A;  3GMA A;  4EML A;  1UYS A;  1N6D A;  1SG4 A;  5KJP A;  1UIY A;  3HIN A;  3Q0G A;  3LAO A;  5G1Q A;  3GKB A;  2VSS F;  1ON3 A;  1JXZ A;  4B3H A;  3H0Q A;  3GF7 A;  4ZDE A;  1ON9 A;  1Q52 A;  1HZD A;  2ZL0 A;  2ZL2 A;  2PPY A;  3JU1 A;  3KTI A;  2Q34 A;  4JFC A;  3QRE A;  4G2R A;  4ZU2 A;  1WDK A;  3KTJ A;  3GLM A;  3WG5 A;  1UYV A;  2GTR A;  2Q2X A;  2VSS E;  2WTB A;  3U9R B;  4JCS A;  2F6I A;  2A81 A;  3H0J A;  5E0N X;  1XNW A;  4MOU A;  4RYF A;  4GM2 A;  1XNY A;  4DI1 A;  2CE3 A;  3P5M A;  4IZB A;  5DU6 A;  1RJM A;  3OME A;  3FDU A;  3QMJ A;  4U0G H;  4ZDB A;  4FB8 A;  2A7K A;  2VSU F;  3KTK A;  5INF A;  3TRR A;  4GHN A;  4QIJ A;  4JOT A;  5DUF A;  1EF8 A;  3M6N A;  3IB9 A;  3RSI A;  3R6H A;  5DTW A;  4JWV A;  5C9G A;  4K2N A;  3L3S A;  5DKP A;  2W3P A;  2IEX A;  3N6R B;  3VIV A;  4K3W A;  3DJA A;  4MI2 A;  3BF0 A;  3BEZ A;  4RCN A;  4JSB A;  3PEA A;  4NEK A;  2J5S A;  4KD6 A;  5KDR B;  3TLF A;  5FUS A;  3KQF A;  2VSU E;  4NNQ A;  2EJ5 A;  3TZ3 A;  3PGQ A;  2ZQQ A;  4KNP A;  2QQ3 A;  3SLL A;  1HNO A;  1PIX A;  5DU8 A;  3DOR A;  5MGB A;  4KWB A;  3FF6 A;  1MJ3 A;  2VSU C;  2VSU A;  3PE8 A;  1UYR A;  2CBY A;  1YG6 A;  4JVT A;  3TVU A;  3K8X A;  1DUB A;  3TDC A;  4U1A A;  4U18 A;  4HC8 A;  3QXZ A;  1FC9 A;  4ASI A;  3MT6 A;  1O8U A;  4JYJ A;  1J7X A;  4OMR A;  4EMM A;  2X58 A;  4I42 A;  3QYR A;  4OLQ A;  2NP9 A;  4F47 A;  2J5I I;  4L8K A;  2DEO A;  3T3W A;  1XX4 A;  5DZK H;  4Z0M A;  3ISA A;  4JYL A; 
#chains in the Genus database with same CATH topology
 4L6W A;  2A7S A;  2J5I A;  3T88 A;  4JJT A;  3ST9 A;  3K50 A;  4QII A;  2Q35 A;  1WDM A;  3RRV A;  3R9Q A;  1TG6 A;  1Y64 B;  3H0U A;  4FND A;  5JBX A;  3PZK A;  3H02 A;  4Q0G A;  1NZY B;  4ELX A;  1WZ8 A;  1PJH A;  4FZW C;  3T8A A;  1FC7 A;  3STA A;  1SZO A;  4ZDF A;  1XNV A;  1K32 A;  1FCF A;  5E0S H;  3H81 A;  5DL1 A;  3ADB A;  1UX4 A;  5JBW A;  4IZC A;  3IBB A;  4WZ8 B;  4FN7 A;  2C8T A;  3ZWC A;  3HRX A;  4KPK A;  4YLH A;  1RJN A;  1FC6 A;  3OT6 A;  3I47 A;  3BPP A;  3R0O A;  2J5I B;  3MYB A;  2HW5 A;  3ZW9 A;  4JCQ A;  1X0U A;  5IKL B;  4Q1I A;  4WCZ A;  3Q7H A;  5DZK A;  1OD2 A;  4ZDC A;  2J5G D;  4MXI A;  3MFM A;  5G1S A;  2F9I A;  3HLN 1;  1WDL A;  4EMP A;  1K39 A;  3ZWA A;  3RQG A;  3H0S A;  5CTC A;  3QXI A;  3W8I B;  5HUQ A;  4QFE A;  1NZY A;  4U0G A;  3GF3 A;  3ZW8 A;  3T8B A;  3ZWB A;  5FIF A;  4ELS A;  3TT7 A;  4U0H A;  4FNB A;  3TV5 A;  4J2U A;  1TYF A;  5DU4 A;  1EY3 A;  4JCR A;  3MOY A;  3HP0 A;  4IZD A;  3RQE A;  2ZQR A;  3M6M A;  4I52 A;  2FW2 A;  2VSS A;  1EF9 A;  2J5G A;  3G64 A;  3KTH A;  4OG1 A;  3T89 A;  4ELW A;  3QWD A;  4FZW A;  4I4Z A;  3P85 A;  2VX2 A;  5E0S A;  3V5E A;  2D3T A;  3QKA A;  2DUB A;  3NJD A;  4HNK A;  3IRB A;  4RYF H;  2F9I B;  3TT6 A;  5DTP A;  2BZR A;  2UZF A;  3RST A;  1Q51 A;  3Q1T A;  2VRE A;  3LKE A;  3U9S B;  4U19 A;  3ADC A;  4K29 A;  1Y7O A;  4LK5 A;  3TVW A;  4ZDD A;  3R9T A;  2FZS A;  5KDR A;  3OC7 A;  4FN8 A;  5G1R A;  4B3J A;  3AM1 A;  1UYT A;  2F9Y B;  3NJB A;  3V5I A;  5ING A;  3KTG A;  3Q0J A;  3HE2 A;  2YJG A;  5INI A;  1XO6 A;  5DUC A;  2X24 A;  4B3I A;  2F6Q A;  3QK8 A;  3SWX A;  1OD4 A;  1N6F A;  1YG8 A;  5C90 A;  1HNU A;  5CTB A;  3ADD A;  2FBM A;  3R9S A;  1DCI A;  2PBP A;  1N6E A;  3IAV A;  4HDT A;  3A4L A;  3U9T B;  1VRG A;  4WYO B;  4FJW D;  2PG8 A;  3P2L A;  4JCT A;  2ZL3 A;  2F9Y A;  2ZL4 A;  1W2X A;  3GMA A;  3BPT A;  4EML A;  1UYS A;  1N6D A;  1SG4 A;  5KJP A;  1UIY A;  3HIN A;  3Q0G A;  3LAO A;  5G1Q A;  3GKB A;  2VSS F;  1ON3 A;  1JXZ A;  4B3H A;  4NAR A;  3H0Q A;  3GF7 A;  4ZDE A;  1ON9 A;  1Q52 A;  1HZD A;  2ZL0 A;  2ZL2 A;  2PPY A;  3JU1 A;  3KTI A;  2Q34 A;  4JFC A;  3QRE A;  4G2R A;  4ZU2 A;  1WDK A;  3KTJ A;  3GLM A;  3WG5 A;  1UYV A;  2GTR A;  2Q2X A;  2VSS E;  2WTB A;  3U9R B;  4JCS A;  2F6I A;  2A81 A;  3H0J A;  5E0N X;  1XNW A;  3AJM A;  4MOU A;  4RYF A;  4GM2 A;  1XNY A;  4DI1 A;  3RQF A;  3O4X E;  2CE3 A;  3P5M A;  4IZB A;  5DU6 A;  1RJM A;  3OME A;  3FDU A;  3QMJ A;  3W8H B;  4U0G H;  4ZDB A;  4FB8 A;  2A7K A;  2VSU F;  3KTK A;  5INF A;  3TRR A;  4GHN A;  4QIJ A;  4JOT A;  5DUF A;  1EF8 A;  3M6N A;  3IB9 A;  3RSI A;  3R6H A;  5DTW A;  4JWV A;  5C9G A;  4K2N A;  3L3S A;  5DKP A;  2W3P A;  2IEX A;  3N6R B;  3A4N A;  3VIV A;  4K3W A;  3DJA A;  3L8J A;  4MI2 A;  3BF0 A;  3BEZ A;  4RCN A;  4JSB A;  3PEA A;  4NEK A;  2J5S A;  4KD6 A;  5KDR B;  3L8I A;  3TLF A;  5FUS A;  3KQF A;  2VSU E;  4NNQ A;  2EJ5 A;  3TZ3 A;  3PGQ A;  2ZQQ A;  4KNP A;  2QQ3 A;  3SLL A;  1HNO A;  1PIX A;  5DU8 A;  3DOR A;  5MGB A;  3A4M A;  4KWB A;  4GEH B;  3FF6 A;  1MJ3 A;  2VSU C;  2VSU A;  3PE8 A;  1UYR A;  2CBY A;  1YG6 A;  4JVT A;  3TVU A;  3K8X A;  1DUB A;  3TDC A;  4U1A A;  4U18 A;  4HC8 A;  3QXZ A;  1FC9 A;  4ASI A;  3MT6 A;  1O8U A;  4JYJ A;  1J7X A;  4OMR A;  4EMM A;  2X58 A;  4I42 A;  3QYR A;  4OLQ A;  2NP9 A;  4F47 A;  2J5I I;  4L8K A;  2DEO A;  3T3W A;  1XX4 A;  5DZK H;  2P63 A;  4Z0M A;  3ISA A;  4JYL A;  1UX5 A; 
#chains in the Genus database with same CATH homology
 4L6W A;  2A7S A;  2J5I A;  3T88 A;  4JJT A;  3ST9 A;  3K50 A;  4QII A;  2Q35 A;  1WDM A;  3RRV A;  3R9Q A;  1TG6 A;  3H0U A;  4FND A;  5JBX A;  3PZK A;  3H02 A;  4Q0G A;  1NZY B;  4ELX A;  1WZ8 A;  1PJH A;  4FZW C;  3T8A A;  1FC7 A;  3STA A;  1SZO A;  4ZDF A;  1XNV A;  1K32 A;  1FCF A;  5E0S H;  3H81 A;  5DL1 A;  3IBB A;  5JBW A;  4IZC A;  4WZ8 B;  4FN7 A;  2C8T A;  3ZWC A;  3HRX A;  4KPK A;  4YLH A;  1RJN A;  1FC6 A;  3OT6 A;  3I47 A;  3BPP A;  3R0O A;  2J5I B;  3MYB A;  2HW5 A;  3ZW9 A;  4JCQ A;  1X0U A;  5IKL B;  4Q1I A;  4WCZ A;  3Q7H A;  5DZK A;  1OD2 A;  4ZDC A;  2J5G D;  4MXI A;  3MFM A;  5G1S A;  2F9I A;  3HLN 1;  1WDL A;  4EMP A;  1K39 A;  3ZWA A;  3H0S A;  5CTC A;  3QXI A;  5HUQ A;  4QFE A;  1NZY A;  4U0G A;  3GF3 A;  3ZW8 A;  3T8B A;  3ZWB A;  5FIF A;  4ELS A;  3TT7 A;  4U0H A;  4FNB A;  3TV5 A;  4J2U A;  1TYF A;  5DU4 A;  1EY3 A;  4JCR A;  3MOY A;  3HP0 A;  4IZD A;  2ZQR A;  3M6M A;  4I52 A;  2FW2 A;  2VSS A;  1EF9 A;  2J5G A;  3G64 A;  3KTH A;  4OG1 A;  3T89 A;  4ELW A;  3QWD A;  4FZW A;  4I4Z A;  3P85 A;  2VX2 A;  5E0S A;  3V5E A;  2D3T A;  3QKA A;  2DUB A;  3NJD A;  4HNK A;  4RYF H;  2F9I B;  3TT6 A;  5DTP A;  2BZR A;  2UZF A;  3RST A;  1Q51 A;  3Q1T A;  2VRE A;  3LKE A;  3U9S B;  4U19 A;  4K29 A;  1Y7O A;  4LK5 A;  3TVW A;  4ZDD A;  3R9T A;  2FZS A;  5KDR A;  3OC7 A;  4FN8 A;  5G1R A;  4B3J A;  1UYT A;  2F9Y B;  3NJB A;  3V5I A;  5ING A;  3KTG A;  3Q0J A;  3HE2 A;  2YJG A;  5INI A;  1XO6 A;  5DUC A;  2X24 A;  4B3I A;  2F6Q A;  3QK8 A;  3SWX A;  1OD4 A;  1N6F A;  1YG8 A;  5C90 A;  1HNU A;  5CTB A;  2FBM A;  3R9S A;  1DCI A;  2PBP A;  1N6E A;  3IAV A;  4HDT A;  3U9T B;  1VRG A;  4WYO B;  4FJW D;  2PG8 A;  3P2L A;  4JCT A;  2ZL3 A;  2F9Y A;  2ZL4 A;  1W2X A;  3GMA A;  3BPT A;  4EML A;  1UYS A;  1N6D A;  1SG4 A;  5KJP A;  1UIY A;  3HIN A;  3Q0G A;  3LAO A;  5G1Q A;  3GKB A;  2VSS F;  1ON3 A;  1JXZ A;  4B3H A;  4NAR A;  3H0Q A;  3GF7 A;  4ZDE A;  1ON9 A;  1Q52 A;  1HZD A;  2ZL0 A;  2ZL2 A;  2PPY A;  3JU1 A;  3KTI A;  2Q34 A;  4JFC A;  3QRE A;  4G2R A;  4ZU2 A;  1WDK A;  3KTJ A;  3GLM A;  3WG5 A;  1UYV A;  2GTR A;  2Q2X A;  2VSS E;  2WTB A;  3U9R B;  4JCS A;  2F6I A;  2A81 A;  3H0J A;  5E0N X;  1XNW A;  4MOU A;  4RYF A;  4GM2 A;  1XNY A;  4DI1 A;  2CE3 A;  3P5M A;  4IZB A;  5DU6 A;  1RJM A;  3OME A;  3FDU A;  3QMJ A;  4U0G H;  4ZDB A;  4FB8 A;  2A7K A;  2VSU F;  3KTK A;  5INF A;  3TRR A;  4GHN A;  4QIJ A;  4JOT A;  5DUF A;  1EF8 A;  3M6N A;  3IB9 A;  3RSI A;  3R6H A;  5DTW A;  4JWV A;  5C9G A;  4K2N A;  3L3S A;  5DKP A;  2W3P A;  2IEX A;  3N6R B;  3VIV A;  4K3W A;  3DJA A;  4MI2 A;  3BF0 A;  3BEZ A;  4RCN A;  4JSB A;  3PEA A;  4NEK A;  2J5S A;  4KD6 A;  5KDR B;  3TLF A;  5FUS A;  3KQF A;  2VSU E;  4NNQ A;  2EJ5 A;  3TZ3 A;  3PGQ A;  2ZQQ A;  4KNP A;  2QQ3 A;  3SLL A;  1HNO A;  1PIX A;  5DU8 A;  3DOR A;  5MGB A;  4KWB A;  3FF6 A;  1MJ3 A;  2VSU C;  2VSU A;  3PE8 A;  1UYR A;  2CBY A;  1YG6 A;  4JVT A;  3TVU A;  3K8X A;  1DUB A;  3TDC A;  4U1A A;  4U18 A;  4HC8 A;  3QXZ A;  1FC9 A;  4ASI A;  3MT6 A;  1O8U A;  4JYJ A;  1J7X A;  4OMR A;  4EMM A;  2X58 A;  4I42 A;  3QYR A;  4OLQ A;  2NP9 A;  4F47 A;  2J5I I;  4L8K A;  2DEO A;  3T3W A;  1XX4 A;  5DZK H;  4Z0M A;  3ISA A;  4JYL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...