4I52A

Scmenb im complex with 1-hydroxy-2-naphthoyl-coa
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
275
structure length
275
Chain Sequence
MDWHIAKHYDDILYYKAGGIAKIVINRPHKRNAFRPQTVFELYDAFCNAREDNRIGVVLLTGAGPHSDGKYAFCSGGDQSVRGEGGYIDDQGTPRLNVLDLQRLIRSMPKVVIALVAGYAIGGGHVLHLVCDLTIAADNAIFGQTGPKVGSFDGGFGSSYLARIVGQKKAREIWYLCRQYSAQEAERMGMVNTVVPVDRLEEEGIQWAKEILSKSPLAIRCLKAAFNADCDGQAGLQELAGNATLLYYMTEEGSEGKQAFLEKRPPDFSQYPWLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of the induced-fit mechanism of 1,4-dihydroxy-2-naphthoyl coenzyme a synthase from the crotonase fold superfamily
pubmed doi rcsb
molecule tags Lyase
molecule keywords Naphthoate synthase
total genus 100
structure length 275
sequence length 275
chains with identical sequence B, C, D, E, F, G, H, I
ec nomenclature ec 4.1.3.36: 1,4-dihydroxy-2-naphthoyl-CoA synthase.
pdb deposition date 2012-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.10 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase, Chain A, domain 2 4i52A02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 4i52A01
4FJWD 1FC9A 1XNVA 3H0QA 1UIYA 2A7SA 2VSUF 1WDKA 3G64A 4LK5A 2Q34A 4KWBA 4ZDCA 4JFCA 2VSUE 3U9SB 5DUCA 1PJHA 2VSSF 1RJMA 4IZCA 4HC8A 3RRVA 1FC6A 4F47A 1WDMA 4JVTA 1WZ8A 4JOTA 4JWVA 4MOUA 5JBWA 2D3TA 2J5GD 3TLFA 2F6QA 4U1AA 2J5IA 3ZW8A 3RSTA 4Q0GA 4EMLA 3QXIA 4QFEA 3IBBA 2CBYA 3P2LA 3U9TB 3M6MA 3DORA 3TZ3A 3V5IA 3P85A 3V5EA 4DI1A 3PZKA 2A81A 3IB9A 3T3WA 4FNDA 2F9YA 2ZL3A 4I52A 4KD6A 4B3IA 2Q2XA 5DUFA 1W2XA 3JU1A 1N6EA 4K2NA 5DTWA 1SG4A 5KDRB 1K32A 2X24A 4OLQA 2VSSA 3TVUA 5KDRA 3VIVA 2HW5A 3H02A 1YG8A 1SZOA 2CE3A 2F9IB 3H0UA 4OG1A 3N6RB 2C8TA 1HNUA 4RCNA 5DU4A 3WG5A 4FN8A 2ZL2A 3P5MA 1N6FA 3GLMA 4ZDBA 4FNBA 1O8UA 3DJAA 1FCFA 3K8XA 4I42A 3ISAA 1FC7A 2J5SA 3TT6A 4RYFH 3OC7A 3R9QA 4KNPA 4B3HA 4JJTA 4JCRA 1EY3A 5DZKA 2GTRA 3FDUA 5FUSA 2J5IB 1HNOA 1TG6A 4ZDDA 3BPPA 5MGBA 2ZQRA 3SWXA 4U18A 2J5II 5E0NX 1XNYA 4L6WA 3STAA 1EF9A 4GHNA 2WTBA 4JSBA 5KJPA 5C90A 3OMEA 5JBXA 1RJNA 3QXZA 2A7KA 3BF0A 3Q0GA 4KPKA 4K29A 2F6IA 4FB8A 4JCQA 1MJ3A 4IZBA 1UYVA 1ON9A 3Q0JA 2VSSE 1N6DA 4Q1IA 1DUBA 5C9GA 4HNKA 3PEAA 4Z0MA 4WZ8B 4G2RA 3H81A 3GF7A 2ZL0A 2BZRA 4ASIA 3T8BA 3LAOA 3QMJA 2IEXA 2VSUC 3I47A 2PBPA 4EMPA 2FBMA 3SLLA 2X58A 4ZDFA 4K3WA 2PG8A 1XNWA 4YLHA 3T88A 3NJBA 4NNQA 4ZU2A 3KTHA 3PE8A 3ZW9A 2DUBA 5INGA 5G1QA 5E0SH 5CTCA 1WDLA 2ZL4A 3TT7A 3QK8A 4ELXA 2UZFA 3RSIA 3MYBA 4JYJA 5DU8A 2F9IA 4ELWA 3KQFA 3R6HA 4JCSA 3KTJA 1ON3A 3HP0A 3U9RB 1Q52A 4FN7A 4ZDEA 2ZQQA 1HZDA 2PPYA 3GMAA 1VRGA 3KTIA 4FZWA 4WCZA 1K39A 1UYSA 1OD2A 4U0GH 4QIJA 3KTGA 5DZKH 2EJ5A 2F9YB 5DTPA 3Q1TA 3HLN1 4OMRA 4I4ZA 2J5GA 3GKBA 1Y7OA 1Q51A 3R0OA 3OT6A 1UYTA 5IKLB 4L8KA 2DEOA 4FZWC 3QREA 1EF8A 3T8AA 5E0SA 2QQ3A 3KTKA 3LKEA 4U19A 5DU6A 2FW2A 3MFMA 5INFA 3ZWCA 3Q7HA 3HRXA 5G1RA 3PGQA 3L3SA 4MI2A 3TVWA 1DCIA 3M6NA 1NZYA 3IAVA 4IZDA 3TRRA 3NJDA 2VSUA 1YG6A 1JXZA 4JYLA 4JCTA 5INIA 5DKPA 3QKAA 4U0HA 4RYFA 3BEZA 3R9TA 3QYRA 1J7XA 4NEKA 4QIIA 5FIFA 3GF3A 3QWDA 3MOYA 2W3PA 3ST9A 4EMMA 2NP9A 1XO6A 2VREA 4U0GA 1X0UA 2Q35A 1TYFA 4WYOB 3R9SA 4GM2A 3H0SA 1NZYB 3FF6A 5G1SA 5CTBA 3H0JA 3TDCA 4ELSA 3T89A 3HE2A 4MXIA 1XX4A 3ZWAA 1PIXA 1UYRA 3MT6A 3HINA 2FZSA 3ZWBA 3TV5A 1OD4A 4B3JA 5DL1A 2VX2A 3K50A
chains in the Genus database with same CATH superfamily
4FJWD 1FC9A 1XNVA 3H0QA 1UIYA 2A7SA 2VSUF 1WDKA 3G64A 4LK5A 2Q34A 4KWBA 4ZDCA 4JFCA 2VSUE 3U9SB 5DUCA 1PJHA 2VSSF 1RJMA 4IZCA 4HC8A 3RRVA 1FC6A 4F47A 1WDMA 4JVTA 1WZ8A 4JOTA 4JWVA 4MOUA 5JBWA 3IRBA 2D3TA 2J5GD 3TLFA 2F6QA 4U1AA 2J5IA 3ZW8A 3RSTA 4Q0GA 4EMLA 3QXIA 4QFEA 3IBBA 2CBYA 3P2LA 3U9TB 3M6MA 3DORA 3TZ3A 3V5IA 3P85A 3V5EA 4DI1A 3W8HB 3PZKA 2A81A 3IB9A 3T3WA 4FNDA 2F9YA 2ZL3A 4I52A 4KD6A 4B3IA 2Q2XA 5DUFA 1W2XA 3JU1A 1N6EA 4K2NA 5DTWA 1SG4A 5KDRB 1K32A 2X24A 4OLQA 2VSSA 3TVUA 5KDRA 3VIVA 2HW5A 3H02A 4GEHB 1YG8A 1SZOA 2CE3A 2F9IB 3H0UA 4OG1A 3N6RB 2C8TA 1HNUA 4RCNA 5DU4A 3RQGA 3WG5A 4FN8A 2ZL2A 3P5MA 1N6FA 3GLMA 4ZDBA 4FNBA 1O8UA 3DJAA 1FCFA 4NARA 3K8XA 4I42A 3ISAA 1FC7A 2J5SA 3TT6A 3RQEA 4RYFH 3OC7A 3R9QA 4KNPA 4B3HA 3L8JA 4JJTA 4JCRA 3A4NA 1EY3A 5DZKA 2GTRA 3FDUA 5FUSA 3W8IB 2J5IB 1HNOA 1TG6A 4ZDDA 3BPPA 5MGBA 2ZQRA 3SWXA 4U18A 2J5II 5E0NX 1XNYA 4L6WA 3STAA 1EF9A 4GHNA 2WTBA 3A4MA 4JSBA 5KJPA 3ADBA 5C90A 3OMEA 5JBXA 1RJNA 3QXZA 3ADDA 2A7KA 3BF0A 3Q0GA 4KPKA 3O4XE 4K29A 2F6IA 4FB8A 4JCQA 1MJ3A 4IZBA 1UYVA 1ON9A 3Q0JA 2VSSE 1N6DA 4Q1IA 1DUBA 5C9GA 4HNKA 3PEAA 5HUQA 4Z0MA 4WZ8B 4G2RA 3H81A 3GF7A 2ZL0A 2BZRA 4ASIA 3T8BA 3LAOA 3QMJA 2IEXA 2VSUC 3I47A 2PBPA 4EMPA 2FBMA 3SLLA 2X58A 4ZDFA 4K3WA 2PG8A 1XNWA 4YLHA 3AJMA 3T88A 4NNQA 3NJBA 4ZU2A 3KTHA 3PE8A 3ZW9A 2DUBA 5INGA 5G1QA 5E0SH 5CTCA 1WDLA 2ZL4A 3TT7A 3QK8A 4ELXA 1Y64B 2UZFA 3RSIA 3MYBA 4JYJA 5DU8A 2F9IA 4ELWA 3KQFA 3R6HA 4JCSA 3KTJA 1ON3A 3HP0A 3U9RB 1Q52A 4FN7A 4ZDEA 2ZQQA 1HZDA 2PPYA 3GMAA 1VRGA 3KTIA 4FZWA 4WCZA 3BPTA 1K39A 1UX4A 1UX5A 1UYSA 1OD2A 4U0GH 4QIJA 3KTGA 5DZKH 2EJ5A 2F9YB 5DTPA 3Q1TA 3RQFA 3HLN1 3AM1A 4OMRA 4I4ZA 2J5GA 3GKBA 1Y7OA 1Q51A 3R0OA 3OT6A 1UYTA 4HDTA 5IKLB 4L8KA 2DEOA 4FZWC 3QREA 1EF8A 3T8AA 5E0SA 2QQ3A 3KTKA 3LKEA 4U19A 5DU6A 2FW2A 3MFMA 5INFA 3ZWCA 3Q7HA 3HRXA 5G1RA 3PGQA 3L3SA 4MI2A 3TVWA 1DCIA 3M6NA 1NZYA 3IAVA 4IZDA 3TRRA 3NJDA 2VSUA 2P63A 1YG6A 1JXZA 4JYLA 4JCTA 5INIA 5DKPA 3QKAA 4U0HA 4RYFA 3BEZA 3R9TA 3QYRA 1J7XA 4NEKA 4QIIA 5FIFA 3A4LA 3GF3A 3L8IA 3QWDA 2YJGA 3MOYA 2W3PA 3ST9A 4EMMA 2NP9A 1XO6A 2VREA 4U0GA 1X0UA 2Q35A 1TYFA 4WYOB 3R9SA 4GM2A 3H0SA 1NZYB 3FF6A 5G1SA 5CTBA 3H0JA 3TDCA 4J2UA 4ELSA 3ADCA 3T89A 3HE2A 4MXIA 1XX4A 3ZWAA 1PIXA 1UYRA 3MT6A 3HINA 2FZSA 3ZWBA 3TV5A 1OD4A 4B3JA 5DL1A 2VX2A 3K50A
chains in the Genus database with same CATH topology
4FJWD 1FC9A 1XNVA 3H0QA 1UIYA 2A7SA 2VSUF 1WDKA 3G64A 4LK5A 2Q34A 4KWBA 4ZDCA 4JFCA 2VSUE 3U9SB 5DUCA 1PJHA 2VSSF 1RJMA 4IZCA 4HC8A 3RRVA 1FC6A 4F47A 1WDMA 4JVTA 1WZ8A 4JOTA 4JWVA 4MOUA 5JBWA 2D3TA 2J5GD 3TLFA 2F6QA 4U1AA 2J5IA 3ZW8A 3RSTA 4Q0GA 4EMLA 3QXIA 4QFEA 3IBBA 2CBYA 3P2LA 3U9TB 3M6MA 3DORA 3TZ3A 3V5IA 3P85A 3V5EA 4DI1A 3PZKA 2A81A 3IB9A 3T3WA 4FNDA 2F9YA 2ZL3A 4I52A 4KD6A 4B3IA 2Q2XA 5DUFA 1W2XA 3JU1A 1N6EA 4K2NA 5DTWA 1SG4A 5KDRB 1K32A 2X24A 4OLQA 2VSSA 3TVUA 5KDRA 3VIVA 2HW5A 3H02A 1YG8A 1SZOA 2CE3A 2F9IB 3H0UA 4OG1A 3N6RB 2C8TA 1HNUA 4RCNA 5DU4A 3WG5A 4FN8A 2ZL2A 3P5MA 1N6FA 3GLMA 4ZDBA 4FNBA 1O8UA 3DJAA 1FCFA 4NARA 3K8XA 4I42A 3ISAA 1FC7A 2J5SA 3TT6A 4RYFH 3OC7A 3R9QA 4KNPA 4B3HA 4JJTA 4JCRA 1EY3A 5DZKA 2GTRA 3FDUA 5FUSA 2J5IB 1HNOA 1TG6A 4ZDDA 3BPPA 5MGBA 2ZQRA 3SWXA 4U18A 2J5II 5E0NX 1XNYA 4L6WA 3STAA 1EF9A 4GHNA 2WTBA 4JSBA 5KJPA 5C90A 3OMEA 5JBXA 1RJNA 3QXZA 2A7KA 3BF0A 3Q0GA 4KPKA 4K29A 2F6IA 4FB8A 4JCQA 1MJ3A 4IZBA 1UYVA 1ON9A 3Q0JA 2VSSE 1N6DA 4Q1IA 1DUBA 5C9GA 4HNKA 3PEAA 5HUQA 4Z0MA 4WZ8B 4G2RA 3H81A 3GF7A 2ZL0A 2BZRA 4ASIA 3T8BA 3LAOA 3QMJA 2IEXA 2VSUC 3I47A 2PBPA 4EMPA 2FBMA 3SLLA 2X58A 4ZDFA 4K3WA 2PG8A 1XNWA 4YLHA 3T88A 3NJBA 4NNQA 4ZU2A 3KTHA 3PE8A 3ZW9A 2DUBA 5INGA 5G1QA 5E0SH 5CTCA 1WDLA 2ZL4A 3TT7A 3QK8A 4ELXA 2UZFA 3RSIA 3MYBA 4JYJA 5DU8A 2F9IA 4ELWA 3KQFA 3R6HA 4JCSA 3KTJA 1ON3A 3HP0A 3U9RB 1Q52A 4FN7A 4ZDEA 2ZQQA 1HZDA 2PPYA 3GMAA 1VRGA 3KTIA 4FZWA 4WCZA 3BPTA 1K39A 1UYSA 1OD2A 4U0GH 4QIJA 3KTGA 5DZKH 2EJ5A 2F9YB 5DTPA 3Q1TA 3HLN1 4OMRA 4I4ZA 2J5GA 3GKBA 1Y7OA 1Q51A 3R0OA 3OT6A 1UYTA 4HDTA 5IKLB 4L8KA 2DEOA 4FZWC 3QREA 1EF8A 3T8AA 5E0SA 2QQ3A 3KTKA 3LKEA 4U19A 5DU6A 2FW2A 3MFMA 5INFA 3ZWCA 3Q7HA 3HRXA 5G1RA 3PGQA 3L3SA 4MI2A 3TVWA 1DCIA 3M6NA 1NZYA 3IAVA 4IZDA 3TRRA 3NJDA 2VSUA 1YG6A 1JXZA 4JYLA 4JCTA 5INIA 5DKPA 3QKAA 4U0HA 4RYFA 3BEZA 3R9TA 3QYRA 1J7XA 4NEKA 4QIIA 5FIFA 3GF3A 3QWDA 2YJGA 3MOYA 2W3PA 3ST9A 4EMMA 2NP9A 1XO6A 2VREA 4U0GA 1X0UA 2Q35A 1TYFA 4WYOB 3R9SA 4GM2A 3H0SA 1NZYB 3FF6A 5G1SA 5CTBA 3H0JA 3TDCA 4J2UA 4ELSA 3T89A 3HE2A 4MXIA 1XX4A 3ZWAA 1PIXA 1UYRA 3MT6A 3HINA 2FZSA 3ZWBA 3TV5A 1OD4A 4B3JA 5DL1A 2VX2A 3K50A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FJW D;  1FC9 A;  1XNV A;  3H0Q A;  1UIY A;  2A7S A;  2VSU F;  1WDK A;  3G64 A;  4LK5 A;  2Q34 A;  4KWB A;  4ZDC A;  4JFC A;  2VSU E;  3U9S B;  5DUC A;  1PJH A;  2VSS F;  1RJM A;  4IZC A;  4HC8 A;  3RRV A;  1FC6 A;  4F47 A;  1WDM A;  4JVT A;  1WZ8 A;  4JOT A;  4JWV A;  4MOU A;  5JBW A;  2D3T A;  2J5G D;  3TLF A;  2F6Q A;  4U1A A;  2J5I A;  3ZW8 A;  3RST A;  4Q0G A;  4EML A;  3QXI A;  4QFE A;  3IBB A;  2CBY A;  3P2L A;  3U9T B;  3M6M A;  3DOR A;  3TZ3 A;  3V5I A;  3P85 A;  3V5E A;  4DI1 A;  3PZK A;  2A81 A;  3IB9 A;  3T3W A;  4FND A;  2F9Y A;  2ZL3 A;  4I52 A;  4KD6 A;  4B3I A;  2Q2X A;  5DUF A;  1W2X A;  3JU1 A;  1N6E A;  4K2N A;  5DTW A;  1SG4 A;  5KDR B;  1K32 A;  2X24 A;  4OLQ A;  2VSS A;  3TVU A;  5KDR A;  3VIV A;  2HW5 A;  3H02 A;  1YG8 A;  1SZO A;  2CE3 A;  2F9I B;  3H0U A;  4OG1 A;  3N6R B;  2C8T A;  1HNU A;  4RCN A;  5DU4 A;  3WG5 A;  4FN8 A;  2ZL2 A;  3P5M A;  1N6F A;  3GLM A;  4ZDB A;  4FNB A;  1O8U A;  3DJA A;  1FCF A;  3K8X A;  4I42 A;  3ISA A;  1FC7 A;  2J5S A;  3TT6 A;  4RYF H;  3OC7 A;  3R9Q A;  4KNP A;  4B3H A;  4JJT A;  4JCR A;  1EY3 A;  5DZK A;  2GTR A;  3FDU A;  5FUS A;  2J5I B;  1HNO A;  1TG6 A;  4ZDD A;  3BPP A;  5MGB A;  2ZQR A;  3SWX A;  4U18 A;  2J5I I;  5E0N X;  1XNY A;  4L6W A;  3STA A;  1EF9 A;  4GHN A;  2WTB A;  4JSB A;  5KJP A;  5C90 A;  3OME A;  5JBX A;  1RJN A;  3QXZ A;  2A7K A;  3BF0 A;  3Q0G A;  4KPK A;  4K29 A;  2F6I A;  4FB8 A;  4JCQ A;  1MJ3 A;  4IZB A;  1UYV A;  1ON9 A;  3Q0J A;  2VSS E;  1N6D A;  4Q1I A;  1DUB A;  5C9G A;  4HNK A;  3PEA A;  4Z0M A;  4WZ8 B;  4G2R A;  3H81 A;  3GF7 A;  2ZL0 A;  2BZR A;  4ASI A;  3T8B A;  3LAO A;  3QMJ A;  2IEX A;  2VSU C;  3I47 A;  2PBP A;  4EMP A;  2FBM A;  3SLL A;  2X58 A;  4ZDF A;  4K3W A;  2PG8 A;  1XNW A;  4YLH A;  3T88 A;  3NJB A;  4NNQ A;  4ZU2 A;  3KTH A;  3PE8 A;  3ZW9 A;  2DUB A;  5ING A;  5G1Q A;  5E0S H;  5CTC A;  1WDL A;  2ZL4 A;  3TT7 A;  3QK8 A;  4ELX A;  2UZF A;  3RSI A;  3MYB A;  4JYJ A;  5DU8 A;  2F9I A;  4ELW A;  3KQF A;  3R6H A;  4JCS A;  3KTJ A;  1ON3 A;  3HP0 A;  3U9R B;  1Q52 A;  4FN7 A;  4ZDE A;  2ZQQ A;  1HZD A;  2PPY A;  3GMA A;  1VRG A;  3KTI A;  4FZW A;  4WCZ A;  1K39 A;  1UYS A;  1OD2 A;  4U0G H;  4QIJ A;  3KTG A;  5DZK H;  2EJ5 A;  2F9Y B;  5DTP A;  3Q1T A;  3HLN 1;  4OMR A;  4I4Z A;  2J5G A;  3GKB A;  1Y7O A;  1Q51 A;  3R0O A;  3OT6 A;  1UYT A;  5IKL B;  4L8K A;  2DEO A;  4FZW C;  3QRE A;  1EF8 A;  3T8A A;  5E0S A;  2QQ3 A;  3KTK A;  3LKE A;  4U19 A;  5DU6 A;  2FW2 A;  3MFM A;  5INF A;  3ZWC A;  3Q7H A;  3HRX A;  5G1R A;  3PGQ A;  3L3S A;  4MI2 A;  3TVW A;  1DCI A;  3M6N A;  1NZY A;  3IAV A;  4IZD A;  3TRR A;  3NJD A;  2VSU A;  1YG6 A;  1JXZ A;  4JYL A;  4JCT A;  5INI A;  5DKP A;  3QKA A;  4U0H A;  4RYF A;  3BEZ A;  3R9T A;  3QYR A;  1J7X A;  4NEK A;  4QII A;  5FIF A;  3GF3 A;  3QWD A;  3MOY A;  2W3P A;  3ST9 A;  4EMM A;  2NP9 A;  1XO6 A;  2VRE A;  4U0G A;  1X0U A;  2Q35 A;  1TYF A;  4WYO B;  3R9S A;  4GM2 A;  3H0S A;  1NZY B;  3FF6 A;  5G1S A;  5CTB A;  3H0J A;  3TDC A;  4ELS A;  3T89 A;  3HE2 A;  4MXI A;  1XX4 A;  3ZWA A;  1PIX A;  1UYR A;  3MT6 A;  3HIN A;  2FZS A;  3ZWB A;  3TV5 A;  1OD4 A;  4B3J A;  5DL1 A;  2VX2 A;  3K50 A; 
#chains in the Genus database with same CATH topology
 4FJW D;  1FC9 A;  1XNV A;  3H0Q A;  1UIY A;  2A7S A;  2VSU F;  1WDK A;  3G64 A;  4LK5 A;  2Q34 A;  4KWB A;  4ZDC A;  4JFC A;  2VSU E;  3U9S B;  5DUC A;  1PJH A;  2VSS F;  1RJM A;  4IZC A;  4HC8 A;  3RRV A;  1FC6 A;  4F47 A;  1WDM A;  4JVT A;  1WZ8 A;  4JOT A;  4JWV A;  4MOU A;  5JBW A;  3IRB A;  2D3T A;  2J5G D;  3TLF A;  2F6Q A;  4U1A A;  2J5I A;  3ZW8 A;  3RST A;  4Q0G A;  4EML A;  3QXI A;  4QFE A;  3IBB A;  2CBY A;  3P2L A;  3U9T B;  3M6M A;  3DOR A;  3TZ3 A;  3V5I A;  3P85 A;  3V5E A;  4DI1 A;  3W8H B;  3PZK A;  2A81 A;  3IB9 A;  3T3W A;  4FND A;  2F9Y A;  2ZL3 A;  4I52 A;  4KD6 A;  4B3I A;  2Q2X A;  5DUF A;  1W2X A;  3JU1 A;  1N6E A;  4K2N A;  5DTW A;  1SG4 A;  5KDR B;  1K32 A;  2X24 A;  4OLQ A;  2VSS A;  3TVU A;  5KDR A;  3VIV A;  2HW5 A;  3H02 A;  4GEH B;  1YG8 A;  1SZO A;  2CE3 A;  2F9I B;  3H0U A;  4OG1 A;  3N6R B;  2C8T A;  1HNU A;  4RCN A;  5DU4 A;  3RQG A;  3WG5 A;  4FN8 A;  2ZL2 A;  3P5M A;  1N6F A;  3GLM A;  4ZDB A;  4FNB A;  1O8U A;  3DJA A;  1FCF A;  4NAR A;  3K8X A;  4I42 A;  3ISA A;  1FC7 A;  2J5S A;  3TT6 A;  3RQE A;  4RYF H;  3OC7 A;  3R9Q A;  4KNP A;  4B3H A;  3L8J A;  4JJT A;  4JCR A;  3A4N A;  1EY3 A;  5DZK A;  2GTR A;  3FDU A;  5FUS A;  3W8I B;  2J5I B;  1HNO A;  1TG6 A;  4ZDD A;  3BPP A;  5MGB A;  2ZQR A;  3SWX A;  4U18 A;  2J5I I;  5E0N X;  1XNY A;  4L6W A;  3STA A;  1EF9 A;  4GHN A;  2WTB A;  3A4M A;  4JSB A;  5KJP A;  3ADB A;  5C90 A;  3OME A;  5JBX A;  1RJN A;  3QXZ A;  3ADD A;  2A7K A;  3BF0 A;  3Q0G A;  4KPK A;  3O4X E;  4K29 A;  2F6I A;  4FB8 A;  4JCQ A;  1MJ3 A;  4IZB A;  1UYV A;  1ON9 A;  3Q0J A;  2VSS E;  1N6D A;  4Q1I A;  1DUB A;  5C9G A;  4HNK A;  3PEA A;  5HUQ A;  4Z0M A;  4WZ8 B;  4G2R A;  3H81 A;  3GF7 A;  2ZL0 A;  2BZR A;  4ASI A;  3T8B A;  3LAO A;  3QMJ A;  2IEX A;  2VSU C;  3I47 A;  2PBP A;  4EMP A;  2FBM A;  3SLL A;  2X58 A;  4ZDF A;  4K3W A;  2PG8 A;  1XNW A;  4YLH A;  3AJM A;  3T88 A;  4NNQ A;  3NJB A;  4ZU2 A;  3KTH A;  3PE8 A;  3ZW9 A;  2DUB A;  5ING A;  5G1Q A;  5E0S H;  5CTC A;  1WDL A;  2ZL4 A;  3TT7 A;  3QK8 A;  4ELX A;  1Y64 B;  2UZF A;  3RSI A;  3MYB A;  4JYJ A;  5DU8 A;  2F9I A;  4ELW A;  3KQF A;  3R6H A;  4JCS A;  3KTJ A;  1ON3 A;  3HP0 A;  3U9R B;  1Q52 A;  4FN7 A;  4ZDE A;  2ZQQ A;  1HZD A;  2PPY A;  3GMA A;  1VRG A;  3KTI A;  4FZW A;  4WCZ A;  3BPT A;  1K39 A;  1UX4 A;  1UX5 A;  1UYS A;  1OD2 A;  4U0G H;  4QIJ A;  3KTG A;  5DZK H;  2EJ5 A;  2F9Y B;  5DTP A;  3Q1T A;  3RQF A;  3HLN 1;  3AM1 A;  4OMR A;  4I4Z A;  2J5G A;  3GKB A;  1Y7O A;  1Q51 A;  3R0O A;  3OT6 A;  1UYT A;  4HDT A;  5IKL B;  4L8K A;  2DEO A;  4FZW C;  3QRE A;  1EF8 A;  3T8A A;  5E0S A;  2QQ3 A;  3KTK A;  3LKE A;  4U19 A;  5DU6 A;  2FW2 A;  3MFM A;  5INF A;  3ZWC A;  3Q7H A;  3HRX A;  5G1R A;  3PGQ A;  3L3S A;  4MI2 A;  3TVW A;  1DCI A;  3M6N A;  1NZY A;  3IAV A;  4IZD A;  3TRR A;  3NJD A;  2VSU A;  2P63 A;  1YG6 A;  1JXZ A;  4JYL A;  4JCT A;  5INI A;  5DKP A;  3QKA A;  4U0H A;  4RYF A;  3BEZ A;  3R9T A;  3QYR A;  1J7X A;  4NEK A;  4QII A;  5FIF A;  3A4L A;  3GF3 A;  3L8I A;  3QWD A;  2YJG A;  3MOY A;  2W3P A;  3ST9 A;  4EMM A;  2NP9 A;  1XO6 A;  2VRE A;  4U0G A;  1X0U A;  2Q35 A;  1TYF A;  4WYO B;  3R9S A;  4GM2 A;  3H0S A;  1NZY B;  3FF6 A;  5G1S A;  5CTB A;  3H0J A;  3TDC A;  4J2U A;  4ELS A;  3ADC A;  3T89 A;  3HE2 A;  4MXI A;  1XX4 A;  3ZWA A;  1PIX A;  1UYR A;  3MT6 A;  3HIN A;  2FZS A;  3ZWB A;  3TV5 A;  1OD4 A;  4B3J A;  5DL1 A;  2VX2 A;  3K50 A; 
#chains in the Genus database with same CATH homology
 4FJW D;  1FC9 A;  1XNV A;  3H0Q A;  1UIY A;  2A7S A;  2VSU F;  1WDK A;  3G64 A;  4LK5 A;  2Q34 A;  4KWB A;  4ZDC A;  4JFC A;  2VSU E;  3U9S B;  5DUC A;  1PJH A;  2VSS F;  1RJM A;  4IZC A;  4HC8 A;  3RRV A;  1FC6 A;  4F47 A;  1WDM A;  4JVT A;  1WZ8 A;  4JOT A;  4JWV A;  4MOU A;  5JBW A;  2D3T A;  2J5G D;  3TLF A;  2F6Q A;  4U1A A;  2J5I A;  3ZW8 A;  3RST A;  4Q0G A;  4EML A;  3QXI A;  4QFE A;  3IBB A;  2CBY A;  3P2L A;  3U9T B;  3M6M A;  3DOR A;  3TZ3 A;  3V5I A;  3P85 A;  3V5E A;  4DI1 A;  3PZK A;  2A81 A;  3IB9 A;  3T3W A;  4FND A;  2F9Y A;  2ZL3 A;  4I52 A;  4KD6 A;  4B3I A;  2Q2X A;  5DUF A;  1W2X A;  3JU1 A;  1N6E A;  4K2N A;  5DTW A;  1SG4 A;  5KDR B;  1K32 A;  2X24 A;  4OLQ A;  2VSS A;  3TVU A;  5KDR A;  3VIV A;  2HW5 A;  3H02 A;  1YG8 A;  1SZO A;  2CE3 A;  2F9I B;  3H0U A;  4OG1 A;  3N6R B;  2C8T A;  1HNU A;  4RCN A;  5DU4 A;  3WG5 A;  4FN8 A;  2ZL2 A;  3P5M A;  1N6F A;  3GLM A;  4ZDB A;  4FNB A;  1O8U A;  3DJA A;  1FCF A;  4NAR A;  3K8X A;  4I42 A;  3ISA A;  1FC7 A;  2J5S A;  3TT6 A;  4RYF H;  3OC7 A;  3R9Q A;  4KNP A;  4B3H A;  4JJT A;  4JCR A;  1EY3 A;  5DZK A;  2GTR A;  3FDU A;  5FUS A;  2J5I B;  1HNO A;  1TG6 A;  4ZDD A;  3BPP A;  5MGB A;  2ZQR A;  3SWX A;  4U18 A;  2J5I I;  5E0N X;  1XNY A;  4L6W A;  3STA A;  1EF9 A;  4GHN A;  2WTB A;  4JSB A;  5KJP A;  5C90 A;  3OME A;  5JBX A;  1RJN A;  3QXZ A;  2A7K A;  3BF0 A;  3Q0G A;  4KPK A;  4K29 A;  2F6I A;  4FB8 A;  4JCQ A;  1MJ3 A;  4IZB A;  1UYV A;  1ON9 A;  3Q0J A;  2VSS E;  1N6D A;  4Q1I A;  1DUB A;  5C9G A;  4HNK A;  3PEA A;  5HUQ A;  4Z0M A;  4WZ8 B;  4G2R A;  3H81 A;  3GF7 A;  2ZL0 A;  2BZR A;  4ASI A;  3T8B A;  3LAO A;  3QMJ A;  2IEX A;  2VSU C;  3I47 A;  2PBP A;  4EMP A;  2FBM A;  3SLL A;  2X58 A;  4ZDF A;  4K3W A;  2PG8 A;  1XNW A;  4YLH A;  3T88 A;  3NJB A;  4NNQ A;  4ZU2 A;  3KTH A;  3PE8 A;  3ZW9 A;  2DUB A;  5ING A;  5G1Q A;  5E0S H;  5CTC A;  1WDL A;  2ZL4 A;  3TT7 A;  3QK8 A;  4ELX A;  2UZF A;  3RSI A;  3MYB A;  4JYJ A;  5DU8 A;  2F9I A;  4ELW A;  3KQF A;  3R6H A;  4JCS A;  3KTJ A;  1ON3 A;  3HP0 A;  3U9R B;  1Q52 A;  4FN7 A;  4ZDE A;  2ZQQ A;  1HZD A;  2PPY A;  3GMA A;  1VRG A;  3KTI A;  4FZW A;  4WCZ A;  3BPT A;  1K39 A;  1UYS A;  1OD2 A;  4U0G H;  4QIJ A;  3KTG A;  5DZK H;  2EJ5 A;  2F9Y B;  5DTP A;  3Q1T A;  3HLN 1;  4OMR A;  4I4Z A;  2J5G A;  3GKB A;  1Y7O A;  1Q51 A;  3R0O A;  3OT6 A;  1UYT A;  4HDT A;  5IKL B;  4L8K A;  2DEO A;  4FZW C;  3QRE A;  1EF8 A;  3T8A A;  5E0S A;  2QQ3 A;  3KTK A;  3LKE A;  4U19 A;  5DU6 A;  2FW2 A;  3MFM A;  5INF A;  3ZWC A;  3Q7H A;  3HRX A;  5G1R A;  3PGQ A;  3L3S A;  4MI2 A;  3TVW A;  1DCI A;  3M6N A;  1NZY A;  3IAV A;  4IZD A;  3TRR A;  3NJD A;  2VSU A;  1YG6 A;  1JXZ A;  4JYL A;  4JCT A;  5INI A;  5DKP A;  3QKA A;  4U0H A;  4RYF A;  3BEZ A;  3R9T A;  3QYR A;  1J7X A;  4NEK A;  4QII A;  5FIF A;  3GF3 A;  3QWD A;  2YJG A;  3MOY A;  2W3P A;  3ST9 A;  4EMM A;  2NP9 A;  1XO6 A;  2VRE A;  4U0G A;  1X0U A;  2Q35 A;  1TYF A;  4WYO B;  3R9S A;  4GM2 A;  3H0S A;  1NZY B;  3FF6 A;  5G1S A;  5CTB A;  3H0J A;  3TDC A;  4J2U A;  4ELS A;  3T89 A;  3HE2 A;  4MXI A;  1XX4 A;  3ZWA A;  1PIX A;  1UYR A;  3MT6 A;  3HIN A;  2FZS A;  3ZWB A;  3TV5 A;  1OD4 A;  4B3J A;  5DL1 A;  2VX2 A;  3K50 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...