4I55B

Crystal structure of tubulin-stathmin-ttl complex
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
428
structure length
425
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha-1B chain
publication title Molecular Mechanism of Action of Microtubule-Stabilizing Anticancer Agents.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell cycle
total genus 162
structure length 425
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4i55B03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4i55B02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4i55B01
2GVIA 4ZHQA 4IHJA 3UT5A 4IIJB 3HKBA 5MN4A 3RYHB 3R4VA 5LA6A 5BMVB 1W5FA 4I4TA 2XKAA 4HNAA 3E22A 4X20B 4IHJB 3RB8A 4I55A 5EYPA 3C8LA 4KWEA 4ZI7B 4B46A 4TV9B 3JAKA 4O2AA 5LA6B 2BTQB 4EB6A 5J2UA 4B45A 5LP6B 3VOAA 5GONB 5CA0B 4XCQA 5C8YB 4O4IB 4DRXA 3M8KA 5LYJA 3JASA 2RHJA 4LNUA 3JATB 1JFFA 4TV8A 2VAMA 4U39A 1TVKA 1TUBA 3HKEB 4O4HB 4YJ3A 5KMGA 3N2KB 4X1KB 3WGMA 3WGLA 1FFXB 5CB4A 4X1IB 3RYIB 4EI7A 1RLUA 2R6R1 4FFBA 3HKCA 4WBNA 5LOVA 1TUBB 3RYCA 5JH7B 1FSZA 3ZBPA 5CA1A 5EIBD 4YJ2B 4ZOLB 3JAWB 4ZHQB 3VPAA 4F6RA 3UT5B 5IJ9A 1W581 3HKBB 5FNVA 1W5BA 1SA0A 3VO9A 4I4TB 4HNAB 3E22B 5JVDA 4I55B 5EYPB 2VAWA 1RQ7A 3JAKB 4O2AB 4O4LA 5EZYA 2BTOA 1SA0B 5J2UB 4EB6B 3ZBQA 5M7EA 2RHHA 2RHLA 4DRXB 3VOBA 5LYJB 3JALA 2VXYA 3HKDA 3JASB 4TUYA 4X1YA 4EI9A 4LNUB 1JFFB 4O4LB 4TV8B 5EZYB 1TVKB 2RHOA 3WGKA 3WGJA 5JQGA 4YJ3B 5KMGB 5MN5A 4M8IA 5CB4B 2VAPA 1W59A 3M89A 5IJ0A 4FFBB 3HKCB 4WBNB 5LOVB 3RYCB 4E6EA 5JQGB 5ITZA 3RYFA 5CA1B 5IYZA 5LXTA 5J2TA 3JARA 5LP6C 5IJ0B 3WGNA 4F6RB 1RQ2A 5IJ9B 4IIJA 5KX5A 5FNVB 3RYHA 5JCOC 1OFUA 5J2TB 5MN6A 2R751 4X20A 3CB2A 1Z5WA 2Q1YA 5JVDB 2XKBA 1W5AA 1Z5VA 4ZI7A 5KX5B 5EIBC 4TV9A 2Q1XA 2BTQA 5LP6A 3VO8A 5GONA 5CA0A 5C8YA 4O4IA 3ZIDA 3JALB 3HKDB 4TUYB 4X1YB 4I50A 3JATA 4EI8A 5JCOA 3HKEA 3N2GA 4O4HA 4O4JA 3N2KA 4X1KA 1FFXA 4U3JA 4X1IA 3RYIA 4O2BA 4I50B 3N2GB 1W5EA 4O4JB 5JH7A 5ITZB 3V3TA 3RYFB 5IYZB 4U3JB 5BMVA 5LXTB 4DXDA 4O2BB 3JARB 4YJ2A 4ZOLA 3JAWA
chains in the Genus database with same CATH superfamily
4YJFB 1MB3A 4U7DA 5GM2A 4FFMA 2HV8A 4CQNA 3CUKA 1N32O 2VRZA 4D5GA 1P39A 4RQEA 3X44A 4F8EA 1O89A 2JLZA 4KR6A 3FPFA 4HS9A 4JBYA 3SF8B 3T7KA 5IBRA 2N42A 4LOKA 2JCYA 3KR2A 3HM9A 1XELA 4X61A 4GQAA 1NYQA 1ZN8A 1HNNA 1NUAA 5DYGA 3WHIA 3CXCU 4CUKA 4BVJA 3LY9A 4M83A 2KTUA 1TMOA 3F6BX 4G85A 3VAZA 2I6UA 3EAQA 3OLZA 4BKUA 1OKKD 1L4UA 3R5KA 3ODPA 4JT2A 5JXJA 2HIGA 1P5FA 2L19A 1XHLA 1NRJB 3UMCA 4H0NA 1RM3A 2CZCA 1MDFA 1LK5A 3RA6A 1FQKA 2V7XA 2XE7A 1K33A 4Y3UA 3KYDA 1P1HA 4KIFA 2R84A 5CYGA 1DARA 3OLXA 3TAXA 3QPCA 3FOEC 1HH4A 2X7JA 3GZ4A 3O3NB 4QPDA 3IBFA 2YV2A 3E6AA 5E6RA 4N5MA 2GN9A 1YK1A 3DOJA 4YJDA 3LX4A 5M7EA 3LOUA 2DJVA 1IK4A 4Z3OA 3AHJA 1Y34E 4H7KA 1MBZA 1FXHA 5KDOA 2FJ0A 1RRPA 4X0EA 4Q48A 2ZULA 1J99A 2EF1A 1P9WA 4NCJA 4U5XA 3U44A 3TKAA 1ZONA 1VIBA 1S72V 1XCLA 3VU3A 2GAJA 1VBNA 2YKGA 3HKEA 3TPCA 2BFDA 3AR2A 4DHWA 2PQMA 5FJ4C 2P5UA 5BP7A 2QT0A 3N8KA 3WDSA 1GGVA 2OOSA 4HMPA 3O7WA 3EVBA 2YMPA 2GCIA 5CDTA 4A5SA 3T38A 1ZHOA 4IFTA 1U7TA 1OXBB 3OT5A 4PHZA 4D6TH 4G97A 3BFJA 1NH2B 1WXFA 2JJ8A 1PFYA 3GMSA 3RNLA 4Y2UA 4JVNA 2F4NA 1KI4A 4GX1A 3L8MA 1P9RA 4TMFA 1LRLA 2A1TS 2HDOA 3O82A 2ZGVA 3APQA 4NMHA 2IPMA 4WFIA 1NTMH 1SM4A 3P9XA 2VXCA 2X2FA 1UR5A 5U4QA 2A84A 3CF4G 2Z3VA 1NUUA 2IP4A 2ADQB 1KOFA 3I6BA 3I3FA 3LUHA 3CLRD 1X8XA 2EWWA 5G1PA 4G5FA 3L7NA 4MGKR 3DFZA 1BIFA 4LAFA 3ZHQA 4JPRA 5COQA 2QMUA 1XMJA 4G8BA 1Z83A 3RUAA 1WD7A 4RQFA 1YR9A 2XTNA 2XGOA 1BDIA 3GJRA 3R5TA 2R25B 4UREA 4EYQA 3OE5A 2BGTA 3GRCA 3OF5A 2BGNA 4XUDA 5CVUA 1TAUA 3FAKA 2UUOA 2I22A 2IEBA 4JLSA 1JA0A 3VQYA 4MGEA 2YV1A 2BCJQ 4IOLA 1IN6A 4JBLA 3VC2A 4AI8A 3ZCXA 2IU3A 3VR3A 1Z2OX 3GELA 2P91A 3OT1B 4ZQGA 3H4VA 5E9JA 1WW8A 1I36A 1CVIA 5DM0A 3DV9A 1SVWA 2YWGA 3IQGX 2EFCB 2PLRA 3JY6A 3W2GA 3W6UA 3LYLA 1CJBA 5H0IA 2Z01A 3WJ7A 3DKIA 3NIFB 2W2TA 4L5AA 5J2TA 1J4AA 1CZUA 1V6SA 3WRVA 2XPCA 4Z54A 3KFLA 1FSFA 2NZYA 3DDCA 4YDSA 2VUUA 4ZD6A 3D43A 2VYND 2JFFA 3WQHA 3WWOA 4MQFA 3K0KA 1KQFA 5H2FZ 4PG8A 5K3FB 5LJLA 3TZKA 3ZV6A 3THYA 2ZBEA 3O65A 5JWPA 4O02B 1U2GA 1Z2AA 1P1IA 4ZZ1A 1XZAA 4QDXA 3K92A 3D02A 3ZU6A 2WB4A 2ZWOA 4C4XA 1LX7A 1H69A 1W87A 4JBNA 3QELB 1AUXA 3JW8A 2BHTA 4X8OA 4GP7A 2C8LA 2C2HA 3FYIB 4C07A 5KSZA 2A4MA 3A3YA 4UBLA 1OU0A 2CE4A 4LVCA 3VOUA 4UCXA 1UXHA 3NOOA 5AVRA 3UJ3X 4N8EA 3BXEA 4QBHA 2RC5A 1GR1A 2C5AA 3AM1A 2JLRA 5JTTA 2ZBQA 5IN5A 5HDQA 3A26A 1IX9A 2ERXA 2O8DA 5M3BA 4MB6A 1R0BA 2Q46A 2XIQA 2WLJA 4CI0B 3RM3A 4XH9B 3STZC 2Q07A 1CUCA 4Y9TA 4NEGA 1YVDA 1BDMA 3H6HA 2PNFA 4X8MA 3OPMA 3FPLA 1WKVA 2XH8A 3W90A 1RWOA 1JF8A 4HNGA 4KRFA 4FFRA 4D9NA 1JAYA 2QI9F 3ROMA 4MVJP 4X7MA 1LW6E 2WF8A 4WUVA 2FAXA 3BXXA 4M76B 2JIZA 5AM3A 1ZHHA 2F43B 2ONYA 4RY2A 5DNVA 3T0IA 4ND4A 5JPIA 3U10A 3RU3A 3P0FA 5P8WA 2OL4A 2RGCA 4FCTA 3DBOB 3ADCA 1WTCA 4QVGA 4JAAA 3MDSA 2B7BA 1Q83A 4JI0O 4DV2B 5IJ0A 2JKVA 4HDMA 4JB2A 1YJWV 3ZPXA 1OLSB 5CN0A 2P8SA 3S1LA 4MDFA 3Q7EA 2HDNB 1O0CA 2AEJA 1DAPA 4IF4A 1PKEA 5CB6A 4RGYA 2PGNA 1NF8A 1C9NA 2Y0DA 4CIVA 3OWOA 1XTUA 1AURA 4O4IF 5EI5A 2NO4A 3VR5D 4H6XA 5MN4A 1FTYA 2BOVA 3GDFA 3ROQA 4MQBA 4MRVA 2VBIA 4OPHA 5LZ5A 1ZOIA 2VTDA 3C6YA 1I4EB 1EQAA 4GI3A 3VYSB 1KB9F 3T5PA 4JJZA 5HUQA 2X2OA 2QVBA 4KQMA 4QNNA 2C31A 3NBUA 4I55B 1NW6A 3AUXA 3IRUA 4UATA 1RXVA 3AJRA 4QYXA 4JHXA 2XMZA 4OBWA 2NVUB 1CF2O 1O6ZA 4C78A 4TLBA 3PGVA 4YLEA 3G4SF 3L0OA 2C3YA 2Q6AA 4E03A 3F7VC 3E5NA 2C9ZA 3RS3A 1MU0A 2G72A 2I1WA 2ZI7A 3G79A 2DFPA 3ZZTA 1L9KA 1NULA 4F97A 2VF5X 4ZTUB 2BMWA 2CNNA 3SR2C 4ZVTA 3DXZA 3FHJA 4FYVA 1UMKA 2HF2A 3RVLA 4AW9A 4BMCA 3E3OA 2X5XA 1VMAA 3FMFA 3MCTA 2HTFA 4Q19A 2DU8A 2WJVA 1PV2A 4U7FA 1B2RA 1Z25A 5LGNA 2WSSG 1M0WA 4GYWA 5JANA 1IK6A 3G5AA 4A0HA 3CPWF 4YDHB 1BXKA 1TMKA 5JJIA 4E5PA 5F7ZA 3RFCA 5HILA 2O7NA 3BTOA 4HDOB 4Z3KA 1NU6A 3FGZA 2PLAA 2CDBA 1A71A 1MB9A 5IH3A 2IYAA 2P68A 1V26A 4FM1A 5IARA 3K0AA 3VSBA 1ADYA 3A32A 4G0NA 1YA6A 2ZE5A 3GIWA 1RPTA 1JE0A 2GNOA 1U1CA 4JI7B 1DQRA 4R2WA 5A04A 3OZXA 2J0QA 3RVZA 4HDRA 3MWEB 4KN9S 3SYLA 5EWMB 3B8EA 3HDYA 3VR6H 4RIIA 4HBZA 4RHYA 1DQZA 5K20A 3PJEA 3CC8A 4R81A 4IPTA 1WB4A 4PTZA 3ZS9A 3QQ5A 3S3XA 3BPZA 1XD2A 3VUEA 1SUFA 2SHKA 4LYGA 4D7SA 5HJ7A 2IZ7A 4ASUA 5A5GA 1Y7TA 3K3PA 3TNYA 2B25A 3DP9A 3QEJA 1GRNA 3TM5A 2Z1TA 3TSZA 5IDWA 4BT7A 4J7ZA 1JA8A 4BZXA 4DC0A 2XMBA 2B8NA 2PL3A 3B7WA 3L6DA 2I1LA 4CTKA 4DUZB 1J21A 1SDSA 5AJVB 4LYJA 2OSVA 5EIAA 3DC5A 1BGVA 3TLAA 1Q1GA 4H77A 2F23A 2XE8A 4EG4A 2QSAA 4FD2A 2AT1A 1E4EB 1NBEA 1V1MB 2OV2A 4BW5A 3U62A 2EIMB 2V59A 1NM5A 4R2KA 1O2DA 1HMPA 3MTGA 4IHKA 2B5WA 3H9BA 2POQX 3E89A 4U7OA 1R00A 2V6JA 2AEEA 5CLHA 3S2YA 3QOXA 4X7PA 4D79A 3R75A 4MYSA 3G82C 2VJQA 1QOPB 3ZVMA 4F2PA 3CX4A 3GRZA 3JSAA 1JZTA 2DBYA 1G7RA 3A2FA 1K3FA 2JCSA 5HG0A 5EL0A 1OI3A 3H16A 1MVNA 4LQ4A 2JW5A 2ZI4A 2YRXA 3FB6C 1N2CB 1YJAA 3DL7A 1KIFA 1VIAA 3P2JA 1VK3A 3KQTA 3D3WA 2FMXA 4BT3A 4OU5A 2J0EA 3ZU4A 3PLAE 4G0UA 3HACA 1G5PA 3FYDA 1Z56C 4DV6O 3QBVA 4X20B 3E22A 4MW1A 1RAIA 4LXTA 4QDUA 3FWKA 3OD1A 2R7AA 1NASA 1SVUA 1RSZA 2IDJA 1KUQA 4N5NA 2QTBA 4FCWA 3UO8B 1LFAA 5BN3A 2ZYAA 2ZRLA 3OPVA 3URMA 4X7RA 1NVVQ 2JI8A 1DLIA 5JEDA 4I08A 5CCXA 3JAWB 1YZYA 1OX6A 5E2BA 4RVDA 2FFBA 4O6VA 1GADO 4HVCA 3LK7A 2N1BA 3HSKA 1JYFA 3X1DA 4K8XA 1R5BA 4BBZA 3UOWA 4XYMA 4N6GA 4B6JA 1VE9A 2HAEA 3CMEF 4G88A 2C4TA 3KR1A 1NW8A 1O3YA 5L51A 3ZWDA 3FSRA 4FPPA 3LQ4A 2XJ9A 2WU4A 4L02A 1V11B 1U3TA 1US8A 5CVVA 4AKIA 4HWPA 4S1TA 3U9LA 1NTRA 3ABKC 2WYVA 3S2EA 1X7WA 1B76A 3BMXA 5DP1A 2GVNA 2ZQZA 1M73E 4BLPA 1PR2A 2BI4A 5BNIA 4MS4A 2IE0A 2OYQA 3P9YA 4G4IA 4IOKA 5FWXB 4GD3Q 3QVJA 4D6XA 1DF5A 1IBRA 4ZQIA 1L9XA 2O14A 1VP7A 5C8YB 1Y3CE 1IOZA 2R9AA 2Q62A 1U81A 4DV1O 4JYAB 4MARA 3D36A 3DF9A 3EXG2 3HABA 1X87A 1Z4PX 3E7PA 1N2XA 1Z73A 2GZSA 3UY4A 4ZO8A 3FYUA 1PW7A 4OPMA 4J16A 2OIEA 5FOTA 4E3ZA 4EI9A 4D45A 2VAPA 4RD1A 3DDNA 4Q9LA 3I76A 1P6UA 3EZYA 4D82A 2OFXA 5JQWA 2WV9A 3AR4A 1GPJA 1JFLA 3ESZA 2NNWB 1AT1A 2W6IA 1KMCA 1SC5B 4BYGA 3MW8A 5C1OA 2ATIA 3IX7A 3GBVA 1NI5A 3HJGA 5JECA 1E0JA 4PNHA 1YJCA 3AU9A 4CQMD 3EEOA 2AN9A 1U3PA 1I0LA 1VCIA 5H1YA 3B1WA 5JRJA 2LDXA 3ESBA 1Q50A 2FB5A 4BO2A 3ZLTA 5HGJA 4I8DA 4PHCA 2PE5A 3UICA 2FE4A 4AILC 3AI7A 4B3TB 3QU9A 3T94A 1NDHA 3JWEA 4EPWA 2O2SA 5ESWA 1J2EA 1H2EA 1MTOA 4YRGA 4KAXA 3KNZA 1XNQB 1TZ2A 1LLCA 4CG0A 2JAQA 4A2PA 2WKRA 2QTTA 5AVTA 2KI5A 3ROXA 4N3AA 2VUTA 2XYGA 1CU1A 2G25A 1Q82W 2E76B 5B7QA 1CZLA 3DLTA 3HO8A 2EWVA 1Z75A 2V54A 4R84A 1CVLA 3OEEA 3IVMA 4YVFA 4JLAA 5AW5A 4RNDB 4GYJA 4TQGA 4N03A 1QP0A 2IDZA 4OXRA 3MRXA 1ZI9A 3CZRA 3UW1A 4LRXA 1ODIA 2DUUA 1W46A 3OFKA 4QGGA 3AR9A 4B6QA 2Y9PB 4M8KA 1E9SA 4HB0A 4UCSA 4FZ3A 2I54A 4FMBB 3NEJA 4X64O 3MINB 1KORA 5AVSA 2BKEA 1MUUA 2W83A 3QTYA 2PFGA 4TXMA 3TFQA 3W8RA 3B3GA 1JALA 4FONA 4M9ZA 4IRMA 3P0ZA 2ZBDA 4BVFA 3EXEB 1CRWG 4HDNA 1Y67A 4PAGA 2PTHA 1EVJA 3NP7A 2PY6A 4JTCB 5F1PA 4CMBA 9LDTA 1OREA 1T4CB 2RK4A 4I4IA 5LQJA 1U3UA 1CX9B 2NSLA 3GFVA 4BATA 1FPOA 5BN4A 2FHSA 4PZLA 3WLJA 2ZS7A 5HKKD 2H1WA 4TQFA 1YQEA 4Z1OA 1OLXB 2JEZA 4TTPA 4XASA 4RY9A 2D5LA 4C6TA 4OUKX 1SIOA 5IULC 3CJQA 1BFDA 3HMKA 2YN2A 3IPRA 4N4AA 2C7VA 1FKAO 4ZI5A 3Q8KA 1Z5UA 3VKHA 5CFZA 4RHAA 3HCFA 3DLHA 1TC2A 3E8GA 5EJ6A 1YDEA 2VEDA 4GU5A 1V35A 4Q4CA 2JGMA 1KMNA 4M54A 1V95A 5KHKA 3UAWA 1IZZA 5FR1A 2PGJA 1WCYA 4AY3A 1P0PA 2WG2A 5CXXA 3AUKA 3GFBA 1II0A 2AG1A 1EDBA 2EINC 2VATA 3EVEA 1FP7A 3NHRA 3Q3CA 3DQZA 2UYHA 5BVGA 2E4XA 2OAEA 3ZVLA 3PC8A 1XMQB 3ZBTA 3ASZA 1ONSA 5DBOA 2YC0A 4Q4HB 1Q20A 3MAAC 2YCBA 1GCAA 1IJBA 1TK3A 5K0NA 2KG4A 3N2KA 2Z1NA 4XDYA 1EXWA 3IAUA 2O1WA 1DKPA 3AW9A 4DSTA 5K3BA 2CY0A 1Z39A 1JWAB 5JNUA 1C9YA 4BBPA 1QQ7A 3SPIA 5FEMA 4S04A 3RK1A 4JDUA 3DD1A 4IQ4A 2EDCA 3ZS8C 1XD8A 1IG3A 1N3LA 1ZUNB 1XU9A 4H27A 5AM4A 1RZRA 2W11A 1U5BA 3BJZA 4DSOA 3EULA 3IVRA 1WVGA 3Q7IA 4LBWA 4P35A 3G6EF 4ISBA 3NBYC 1VPLA 2YICA 2VPPA 2GSDA 2PRZA 2DY0A 1BH6A 4EHBA 3GFFA 3UMBA 3LA8A 2ZRHA 2NX2A 4BT2A 2PXHA 4GS5A 4EUFA 2CLSA 2VPZA 2ODPA 3AEZA 3EDRA 4CH5A 3SYTA 3K0FA 1E3JA 2QSJA 5F73A 1AA9A 3G89A 4KQ2A 3KT6A 1M1ZA 1RWKA 2RHRA 1V39A 2W6JA 3KQYA 2Z8YM 1F6WA 4DDVA 1XZCA 4EYEA 1VHLA 5CVEA 2OB2A 2ERYA 2UKDA 5DGXA 4O2AA 1H05A 4ZHSA 4CV3A 3OKPA 3A1VA 5ALFA 4MVZA 1ZLYA 3B1VA 2RHJA 2NUTA 1VE6A 1CYDA 5B3SB 1E8NA 4M1QA 1E3DA 1P1KA 3FLBA 2G09A 1ORQC 2IP1A 4UXHA 4Q7LA 2XXBA 5AJXA 4PV1B 4P33A 3NHJA 4NAHA 1KC1A 2H08A 4F1WA 2IOQA 1V1RA 2YZNA 3CKMA 3OCVA 1Q7EA 1CQJB 1U5AA 2DZDA 5DM6V 2GX6A 2A14A 1NVFA 2PPVA 4M8LA 1AKTA 3GUCA 3G9ZA 3ER6A 1IV4A 4XYGA 3O85A 2OLKA 2CK3A 2O5CA 2X76A 1XC7A 1HRKA 1DOZA 4TV9A 2PMEA 1KETA 4MP6A 1GKUB 4Q1DA 3FGPA 2QN7A 5AUPB 3K03A 1Q1EA 2EX4A 2J7PA 5D5QA 5KTNA 2GPTA 2QUIA 4CLDA 2MSWA 2OYSA 1WV0A 1ULUA 4NV3A 4NNOA 1ID1A 3AF4A 5H5JA 1JH8A 2R8EA 1UJ2A 2ID7A 3PSHA 4UUPA 2PTGA 1JT2A 2NADA 4ZO6A 2ZTVA 2ZPTX 1PN3A 2D2FA 2ZCUA 3ETQA 3QO8A 5EIEA 1A4XA 3MCVA 4NLLA 2OBXA 4M0PA 3USES 1VKZA 4D3FA 3ND8A 4LMBA 3GLHB 2RJZA 2EBUA 1JEQB 1ZAYA 1N8SA 2NTYC 4ALKA 3RSGA 4I5FA 1PKXA 2XHBA 3A8TA 4DXAA 3RFRA 4G1VA 4DO2A 4HDKA 4RTKA 4KMMA 5C46F 3X1XA 2QI9C 4C7OB 3NKVA 5DM4A 1V9CA 4YHBA 4XVQA 3DGEA 1WZEA 1DCTA 3O8RA 5JMPA 2XGJA 1LPPA 1GTL1 3U4HA 2EJBA 1R0RE 3M7IA 1Q1QA 3MMPA 1CF4A 1GZ4A 1JIXA 1FX1A 2FY8A 1L7AA 2WUWE 1W44A 4DR6B 1C4XA 4EKDA 2GHYA 4QM7A 3IUBA 1IM2A 4FI3F 5LHHA 3SS8A 2PIAA 3GJ0A 1E6EA 1U11A 2Q0XA 1WVIA 5C80A 3SBXA 4I6GA 3BSSA 2HQBA 1HM5A 1I5EA 4PA3A 2QTMA 2XNCA 4WZBE 5AUNB 2IXGA 5CPFA 5C5EA 4J11A 3UZUA 4CPDA 3QVUA 2O7SA 4JBGA 1VSBA 2Q4OA 3DC6A 1U6IA 5L3DA 5BV0A 2BF4A 2F90A 4U9UA 4B73A 4J7CA 1WUTA 3T8YA 4XGIA 1EB9A 1SVIA 2Q5FA 3QFHA 2HYIC 5G3ZA 2QBYA 1I08A 2EX3A 5E9QA 4TM7A 4ZI7A 4BU0A 1HLPA 5KTOA 2BZ0A 3PUXA 5T4HA 1T26A 1XEQA 2H6EA 2QNIA 3LMKA 4B3FX 3U3DA 1RYFA 1JVMA 1SCUB 1TUEB 2DXIA 4D7TA 2FJUA 1BWPA 4AUEA 4C2TA 1P4GA 5J4HA 1NNI1 4B2LA 5DTJA 1TUBA 2C61A 3KT8A 2SCUA 2Y1EA 4NYJQ 1NUQA 2F3TA 2PR2A 3WYCA 5IWAB 5D01A 1HWYA 2RGWA 3U80A 4WUTA 4FYYA 3I2YX 4MQ5A 4D3XA 3CF6R 4X3LA 4YRBA 1KZ4A 3WNDA 2MK3A 4L9SA 3KV1A 1PJAA 4P5DA 3L73H 4DMHA 2G5CA 2Q6LA 5EKTA 1P6XA 1YVUA 2R1UA 1AQIA 2R11A 3LPLA 4W9MC 4J90A 4FBMA 1J1ZA 1HYHA 3CLHA 4P83A 1RHUA 2EARA 3ZCVA 1VJ1A 2FUG6 1U0HC 1QWOA 1DGSA 1NFFA 4YRAA 3WGZA 4FK8A 4EG1A 3OZBA 1M56C 1RHRA 4C3VA 2CEKA 3C3MA 2IW3A 3IRVA 4E5KA 3I01M 2ZYWX 3L7QA 2O0JA 2QM8A 1IH8A 1VIYA 4QPJC 1K75A 4E2FA 2BJHA 3K8QA 4I1RA 3CWZA 5CAEA 2NUPB 3R3YA 4W6QA 1EWTA 4H59A 2QD3A 5ETJA 1ORDA 2JI4A 1A77A 3SSAA 4P30A 2EBWA 1G6KA 5KYXB 2JZCA 2ZJ1A 4U63A 2OP1A 2NU8B 1DJOA 1M0TA 2G1KA 4F96A 1U31A 3RAEC 2NU6A 1CLUA 2OAP1 4CG1A 4C7VA 2QTFA 4JUFA 4HNVA 2AC4A 1GVNB 3I6QA 1L5WA 1F14A 3VQXA 2Z4TA 1KIAA 4LV6A 2ZIWB 3RO7A 1R16A 1FP4A 1NJ6A 4WLVA 4P4GA 5LXTB 2ZDHA 1PJTA 2Z43A 4NXNB 2XUKA 1JG7A 4CG3A 3UVEA 4JITA 4E12A 3GL9A 4LMPA 1O96B 1VIDA 3MJCA 2WPDA 5FWAA 1VGQA 1U99A 3SVTA 2G6TA 1A2BA 5EGSA 4D7AA 4ACAA 1ZC4A 1I30A 3H4MA 3B3FA 3TXXA 1PL0A 4Q3DA 2LPMA 4DKXA 2RHBA 5KJ1A 3ORFA 1XAHA 2QP9X 1HT1E 5JFOA 1EJ2A 2HJVA 3DQQA 4I46A 2G8NA 1I5OA 4R6WA 3OIUA 4NH4A 1C7RA 1H2YA 4PZDA 5DJ5A 3WSVA 1F60A 4RANA 1G7SA 3SC4A 3FFMA 3H8WA 4F46A 4I6EA 5KI6A 1W0JG 1MAVA 4WXPA 4DVGA 5AVMA 4MZXA 1JKMA 4KZKA 2IYLD 3MM4A 2YEVA 4BFCA 4WFAV 1NVPB 1RP1A 1INLA 2H6LA 4CN8A 4DR7O 4KRGA 4QHTA 2MOKA 4EB6A 2VCEA 2OC9A 2X8BA 4PRKA 5B3AA 4L74A 3NM4A 3TN7A 1Q86H 3N2IA 3FXAA 3PUIA 4B85A 1LDEA 3IODA 2R96A 2XA1A 3M7MX 4A10A 1JDBC 2PS3A 3O03A 4RK4A 5FPQA 2QM4A 5ALJA 3EEIA 3S2SA 3QE9Y 1QYRA 2VYFA 3DYBA 1VE5A 2AN4A 4YT2A 1QHSA 3WLPA 5H6QA 2BMVA 2PT7A 4AWXA 2FSVA 1USWA 5DNDA 2AJ8A 2VKTA 3KDAA 3MK31 3I7TA 1LDNA 1P49A 4YP0A 4G07A 1CJTC 1V3UA 3FVTA 5D5PA 3EAFA 1Z13A 5TEVA 5HGXA 4MMYB 2VQSA 4L8WB 4V0SA 5ADVA 4F21A 4V0KA 4ZAXA 4ER5A 5C3UA 1TJYA 3I2KA 4J2HA 1AKEA 5KBYA 3DCYA 4PG5A 5B30A 2HF8A 2QRQA 1VMIA 1PBNA 4AZ0B 2HV9A 4NCBA 3EZFA 2ACEA 1F2UB 1SBIA 1QB8A 3HN7A 1Z17A 4F93B 3TCUA 1L5VA 4OXXA 4RUKA 1KVUA 4GOLD 3AR8A 1XAIA 3QUTA 5D3MB 3NG1A 5HUJA 2B33A 3L0IB 2HXGA 3W7UA 3V00A 2BWJA 5CFLA 2EWMA 3MJEA 5K6TA 1PZEA 3KCQA 1XXHB 1XL6A 5GVRA 3FR7A 1H94A 3F1LA 4KYVA 4YV2A 4RHEA 4B4WA 3H5RA 3HJAA 1U97A 1Z5NA 3DMTA 2BIFA 5IRCD 1Z07A 2AD1A 4MQLA 1LNQA 2DWOA 3D8RA 5KSPA 1UOOA 2N9UA 5U1PA 2WF6A 1EFKA 2EV9A 4IUBS 2UAGA 4URVR 4MCJA 1O97D 1XL1A 4XJSA 1L7MA 1WSBA 2QUZA 7REQA 2LO1A 1GUYA 3G02A 3ISVA 1QJCA 1WHTA 4WASA 3M5DA 3P96A 2P6JA 2PUHA 2F64A 4B81A 1W88B 4G4ZA 1P0IA 2I3AA 1Y5RA 2YH2A 5IK2D 3FZEA 3DZCA 4FWIB 1PP4A 3RF6A 4EHFA 3ZKWA 3L3BA 4TGLA 3CVXA 4WFBV 4OLJA 3IT3A 3R6DA 3MA0A 1KDRA 1V5WA 1C81A 2ZRJA 4B76A 1S4MA 5DP2A 2VT2A 1FVXA 5DW0A 5F64A 5JR3A 4W99A 1E9AA 1UM8A 1EKXA 1X74A 1USGA 3FNHA 3M9LA 4NJEA 5JNSA 2WALA 1GITA 2Y1KA 3B2EE 2E21A 3NALA 5AMXA 1X7XB 5BWCA 1BCSA 1KDZA 3E9NA 3HVRA 4MA5A 1NHWA 2QVLA 2NVOA 3T7RA 3MJSA 2F8LA 2JK5C 4GBED 1DBPA 1K68A 3A4MA 3BTUA 2D1QA 5EMMA 4W7IA 3M5WA 2H85A 2CLLB 4L4RA 2WJWA 2GUWA 3JU3A 3LZCA 2LGWA 1TM4E 5IYZA 4HC4A 5EY5B 3ZGXA 4X62B 4XYLA 3QP9A 4ALIA 5GP1A 3T06B 4ETWA 4DY4A 3LDFA 4ZEVA 5JASA 3M5PA 1PFGA 2XQFA 4HLDA 3CJHB 1G8GA 1J95A 2WJ4A 4LDQA 2FWJA 2BSAA 4MS1B 3FG9A 3RGBA 4C3OB 3OIGA 2ITDC 2J6BA 1L4MA 5CG2A 2YS8A 1O58A 5I01A 3H18A 1IY2A 1QK3A 3LT1A 2I0FA 2IPOA 2C2KA 4F4DA 5AJTA 1F20A 1OT5A 1VQNF 2DTDA 2OQ2A 2QW0X 4RFVA 3RHFA 5JYCA 3S8YA 2QE6A 5HIAA 5K99A 2G28A 2CXTA 1MT0A 1FTGA 1K8AW 1ZQ1A 3A70A 3V4SA 1BOOA 5EJAA 2AZMA 1S0UA 3R44A 1GAJA 4W5HA 4MKFA 3P32A 5C1PA 4P31A 1TCVA 4MUKA 1X7ZA 3QJ5A 5KPJA 3GPLA 1LJ8A 3CZCA 2OORA 3CHXA 5TGTA 4B82A 5J3JA 4FHDA 4RH0A 2BEVA 1XQ9A 3W06A 4WW0A 2VI5A 4O4JB 4OLFA 2BFPA 2HB6A 3SYMA 3SICE 2ZINA 2OHOA 4EKGA 4OGQB 1L1QA 4WADA 4YUWA 4UXIA 3S5UA 5BSWA 3PNVA 1LWOA 1Z36A 3IELA 4MW6A 5HQJA 2NV2B 1EFTA 3OKFA 3CUEF 1DX4A 2L17A 1URPA 4CFZA 4XRRA 1OFVA 3GV0A 1HNWO 5H8WA 2B98A 4RJIA 2YOGA 3QYAA 3QHDA 2R0QC 3CC2V 1SQ0A 2SKDA 1K66A 4GGOA 2IY8A 4FBGA 3G0IA 4D26A 3E2IA 3D1JA 1QRAA 2LV8A 1V0JA 2GWRA 3F7OA 4KGDA 4W1PA 4CNBA 1U0RA 4XXHA 3QU4A 2H54A 3ZP4A 1DPFA 2I7TA 4KPUA 3NTVA 5DM70 1T3LA 3FOCA 3KJHA 1IONA 3G6KA 2IHVA 2V7EA 3SOZA 2GZMA 2A9HA 2WTEA 4P9OA 3RV3A 3IMPA 1MSDA 4K81B 1QVGF 3AERA 5H9VA 3D0QA 1SNYA 4X85A 2VPTA 3F6MA 2PIDA 3DVSX 2HSDA 4WA7A 2VCYA 4HQOA 1OYVA 2OG1A 3RHSA 2MIIA 4NWOB 4BP8A 1VYUA 4HZ3A 2Q41A 4FS8A 2IHNA 3INTA 1QHXA 2ZU0C 5LKRA 3NO4A 3K9QO 3T3EA 1FCJA 2DKNA 2NZ8A 3CF2A 2Q4EA 3DDHA 1WHSB 1GDHA 2E9SA 4RTPA 3CY6A 4DLZA 2JANA 2WJ3A 3X1WA 4CDRA 1NN3A 2VH1A 1NE2A 4YROA 1XCBA 4NAUA 4KR0A 1PGPA 1K5SA 2AJLI 4ZVVA 4GX0A 3WFIA 1RLGA 3FPAA 4BWVA 2Q7OE 2FEOA 1MH1A 5J4YA 3HPLC 1G4UR 1YRHA 3ZWCA 4ZEXA 1W55A 4CM3A 4H1UA 3TW8B 3HBJA 1NSYA 3C2QA 4RM2A 2A9RA 5G1OA 1VQVA 4N5LA 1R3KC 1XRJA 4L57A 4YJHB 3BICA 5D3KA 2E4AA 4YJGB 4IIHA 4DUYO 1H8HA 3OA0A 3P10A 3S7ZA 4PQGA 2RC6A 4WE3A 4JUIA 2DWUA 2X8WA 4Q66C 2XB8A 1R3IC 3WL7A 3R41A 4BVHA 1SCDA 1PQUA 1QF6A 4LSGA 5K3DA 4Y6OA 1E79G 2Q0HA 2ISQA 3V7NA 2XT9A 1JILA 2VA9A 4LHYA 1EEHA 2FW8A 1IATA 5AW6A 5KC8A 3OPYB 1FXWA 1EP9A 3R77A 3U3ZA 4MDEA 1WBBA 1ECGA 3F5DA 1CUHA 1ZKMA 4Q9JA 2HWXA 3DOCA 1NWCA 3TECE 1RXWA 3CUSA 4KO1S 1OCZC 2XAGA 4OJMX 4P7FA 4WNAA 3V42A 5DN6D 4R2IA 1O1YA 3V48A 4C0SA 2Q3BA 4KXFB 3IR6A 2N74A 2GCOB 1NC1A 4BJHB 5DT9A 4D2IA 1U7DA 1T2AA 3ETHA 4UCUA 3Q7TA 3DFUA 2ZCJA 2DQZA 4CCSA 1KAMA 4LZOA 4DCSA 3RH0A 4FFKA 2UZ0A 4RVHA 5I9MA 3HDVA 2RH5A 1VHQA 4TQAA 3HADA 3VOBA 3ROPA 1KA9H 4HB3A 1MC5A 4BMSA 2LNDA 2P9ZA 3OH8A 4HTAA 1EUDB 1MRZA 1OV4A 4DLVA 3X43A 1Y82A 1XRLA 3PX7A 5ESRA 4M87A 3DZBA 2AL7A 1U3FA 4G09A 2ODWA 5IBQA 2VHUA 1HGXA 3LUJA 3F49S 2FRDA 1O5IA 5JU6A 3SHWA 4PZEA 2DFDA 1TU3A 1A9YA 1BMFA 3UKJA 2IC5A 4QG3A 1TM1E 3AEIA 2ZROA 4LCJA 2J9FB 1ZA2A 4HX2A 3ADOA 4LRQA 2AHOA 2CXQA 2E6KA 3U4DA 3KWLA 4BJ6A 2PMBA 3KAQA 3KZNA 3OE7A 1EE2A 1TZCA 2A0FA 3CYPB 1WNSA 5CBGA 1HDZA 2A2ZA 4EEZA 4LR3A 3ODGA 2PHZA 2ZR2A 3SKYA 2BDUA 3LCMA 5FTWA 2G4LA 1GPUA 1XL4A 5H3HA 2XDYA 2ZRAA 3V2IA 1OLUB 1G9SA 1CXZB 4LWQA 2OSBA 3RRJA 2ZUFA 1XV5A 1WG8A 4QM6A 4LDPA 1GR0A 3PKIA 1BXGA 1PFUA 3HB9A 4YCDA 2ZJ7A 4KLNA 3D6FA 4FFLA 3CRW1 1A2KC 4WFQA 1G2IA 1U4SA 4FI3C 2XV1A 3AF5A 2ACKA 4NBLA 2F1MA 3B2EA 4R1TA 2TS1A 4G86A 5I4KA 4B8WA 3FBAA 2EU8A 3FNIA 4W5JA 2IK8A 3QE0A 4EY7A 3K1AB 5K8CA 2D7DA 1GO1A 3H11A 3FLMA 2I7CA 1XQ8A 3C3PA 1V71A 3F4KA 4V1CB 4M99A 2BMFA 2I8AA 4B6SA 5IFKA 1EM8A 4XB1A 2HS0A 4WERA 1WRBA 3THXB 3T5TA 2OBBA 4B4VA 2CNOA 5F7XA 3KL4A 2RONA 3FBTA 1JR2A 3RRBA 3ON1A 1UZLA 4C05A 1FNCA 3E9DA 4DLRA 2GR9A 1J9EA 4OAPA 1NLUA 1IZ3A 3OQVA 1ZJ4A 3T7TA 4M1SA 1UJCA 2PM8A 2EW2A 1R4AA 3E8HA 2XQIA 3PEUA 2CNKA 3S6JA 1Y76A 4UBOA 2OHWA 3IA7A 2I2BA 4ZV7A 1BAPA 1W2WB 3D4IA 1I7LA 1ZI6A 3P27A 1GQOA 1XVUA 1OXMA 2XGGA 1G4HA 3B36A 4Y2SA 3N6VA 3PXAA 3ZTYA 1NHGA 2VNKA 3IIJA 2EINB 3CG0A 4G67A 3FFTA 4TT3A 1SOVA 2A0LA 1EPUA 3ASYA 3QKSB 1D2RA 2CGNA 2NPFA 4LYYA 4IIVA 4LFBB 1EGQA 3N59A 2RJNA 2X23A 2JA1A 4EDFA 2IZZA 2HT6A 3E03A 5GIPE 5CLLA 3BAAA 1TVMA 3ANNA 4QNHB 3HXKA 3UMRA 1VBKA 3S44A 3DDWA 1M8GA 4AS2A 4AZWA 1W0KG 4AYWA 4C43A 4MQUA 2DEUA 4JUDX 1HLFA 2BMJA 3Q9NA 5LR6A 1MG0A 3D8HA 3SDBA 2FZWA 3OC0A 3MFQA 2EBOA 1PFWA 1PEAA 5KVCA 1GYPA 3O8LA 3LT5A 1OIWA 4E5MA 5AIBA 3ZVRA 3TR0A 3O4VA 2JFPA 2AQKA 5HPYB 2Z6UA 4CKWA 1E3WB 4MVJM 4DXWA 3HYNA 1W73A 2QROA 5A0FA 1PR5A 2C4KA 3MCAB 3STXA 3MWJA 4A6DA 4M49A 5FV7A 3L2OB 5BQ3A 2FSSA 3EGDA 2GFHA 4HRXA 2ECFA 1YZBA 1E69A 5FQOA 3LYUA 2Q0QA 2EVWX 5BSMA 2HJGA 5E79Z 3Q3JB 3W2EA 2VVTA 3R20A 3OF2A 2JEUA 5GTHZ 2VDNB 3ZWKA 4NBKA 3TJRA 3ORYA 1Q84A 2FUG1 2XE4A 5TS2A 3F6EX 2QP3A 1WY7A 2WWFA 3IULA 2FUEA 5CA1A 3ETCA 4FUTA 2BUAA 4I7EA 2Q68A 2EBHX 4RVSA 5CD9A 2Q6IA 1XPUA 3NX4A 5KUMA 1NSFA 5LWQA 4R1UA 2XDWA 1FUIA 1ADFA 7MDHA 1SXGA 1QQCA 4IG4A 2JK1A 3I32A 5KIAA 3GY0A 1T36B 4EJ6A 1N25A 4CMCA 2XUMA 3NC4A 3HZZA 2WLLA 1GTOA 3DW3X 3VKUA 3IVCA 1UWCA 4F4CA 2G9VA 2W2KB 4K46A 1MB0A 4D56A 4P80A 3IQHX 2MWMA 2GZHA 3QFSA 1NT2B 4RDXA 5CA0F 1B8VA 2W6CX 1E2GA 1OBOA 4JHLA 1S9HA 4GKKO 4KBFA 4E2YA 2FR8C 4M8NE 3P1JA 1O95D 3S2FA 2HY7A 5DHFA 4ZVQA 4OEHA 4XEUA 3VI6A 2NQ8A 4MO9A 4I4TF 3B78A 3RABA 1ILEA 3NATA 4AMBA 3THSA 1E61A 5EXSA 3N2NA 2O48X 1SOUA 3I72A 1GAEO 4HUQB 4TZTA 221PA 4HZUB 3WO0A 2ZB4A 4IIUA 4Z4IA 4RPLA 2RB9A 3OZDA 3T3GA 4CXMA 4WBSA 3HCRA 3F8SA 5AVUA 3OE1A 1K73H 1AHHA 3CCLV 1P61B 4ZCMA 2HA7A 1X80A 5A1JA 3SJBA 4NDNE 1R5OA 2C4UA 1LBHA 1T2UA 4QSMA 1VI2A 1UK9A 2WSIA 4L87A 1VPTA 4G5GA 4EENA 1TAQA 1PBTA 4RZUA 3FVVA 2PH1A 1UMCB 2LE0A 3ZCUA 3O8OB 3LHIA 2Q8NA 1KD1H 2XOXA 1GH6A 3NV9A 3GRRA 3GWZA 3T4DA 1UFRA 4N0QA 1IXBA 3WR5A 2CFSA 5KCMA 1LRJA 3ZW9A 1B4DA 2IS1A 3D2CA 3A2NA 4MLCA 1U3VA 2OHXA 3JCUZ 3DKKA 5FOSA 1NQXA 5LQNA 4JOCA 1Z0JA 1WQ1R 4HWOA 3TRIA 2HO5A 1W36B 2C7BA 2JBAA 4Q7JB 2HIMA 1Y4UA 1UBEA 3A1CA 2P9JA 4F9GA 4J7KA 4QPPA 1KWGA 3KOZA 3ED5A 2CXXA 1VSUA 3S02A 5HOQA 3OGCC 4G25A 2P41A 3EEYA 2WAYA 1GA4A 1NSTA 2AMYA 3PGMA 3A4NA 2CKMA 2D59A 1SS3A 3RFVA 5BSGA 4YP5A 1Z22A 4KU4A 4BT4A 1OB2A 1FY2A 1KY4A 3MT9A 1C7JA 3EC7A 4ARIA 2D1YA 3BA9A 4O4IB 1M2KA 3K8OE 1ZMRA 1UEIA 3EF3A 2V0GA 5AHKA 5CB4A 4K0KO 3DEIA 2R7MA 2C2GA 1UMBB 4WFKA 1J0CA 1FUYB 2FSFA 4TRNA 1WD5A 2HHCA 1DRVA 1D0IA 1MAUA 3IV7A 2AFHB 4MTGA 1OV6A 1TLTA 1JYEA 1QH8A 1A50B 2EJTA 1PJZA 1MJFA 3GHHA 3QVWA 2HK7A 3STWA 2HUNA 1UKYA 4ARZB 1HI9A 2I6FA 3T7EA 1RHKA 4UFZA 1WLEA 1W5SA 3KCNA 5L3VA 4GPTA 4P3NA 2X2PA 3KZVA 2G0NA 3AVQA 1DUVG 3S2GA 2FUKA 5K3EA 4H18A 1Z63A 3DBLB 3ZGZA 4C0JA 1IZ8A 1FDUA 3M1XA 2HA0A 4BDSA 2NUAB 2H0AA 2HK8A 3G80A 4M6WB 2WSLA 2UYCA 1ECPA 2HMWA 1SMKA 1HORA 1M66A 3ML0A 1COMA 1F2DA 1V3TA 4TMKA 3NPMA 1WPBA 3A2LA 3NTRA 5EPOA 3DZ8A 2D74A 4DDMA 2ZIXA 5B2ZA 2GCGA 5EXEA 1CIJA 5ICFA 4ICGA 3CH5A 4XE5A 1MGOA 4G23A 4YT4A 5KHHA 2C82A 1EFRA 1ODSA 1S72F 4KITB 1FYXA 4LF8O 1M56B 4UASA 4GUDA 4YYEA 2AWOA 2JHFA 2A4KA 5F2VO 3TIGA 4UTZA 4LK3A 3BE6A 5A71A 5U9CA 4Y6RA 3GTZA 3EVGA 1SN7A 3K9FC 3MVEA 1JQ3A 2RQ6A 2BV3A 4M0UA 4Z1VA 4M0FA 1TYAE 3PXGA 3RFTA 1WMAA 4GXNA 3EOBI 4D5EA 1GAWA 1OBCA 2QGZA 1QCYA 2D3WA 5GONF 5HWSA 2R1TA 4RH1A 4F9EA 2R48A 5KWIA 4WLUA 1OBVA 1GSIA 3ZQ6A 4JBIA 2Y48A 2HF7A 1SIUA 3NAQA 2V1UA 1HDCA 4IVNA 1XRGA 4P8RA 2G80A 3LX8A 4EG6A 3RVMA 3NR7A 3F3MA 4FOTA 3QNWA 3KQHA 5L3GA 3JWJA 5CYFA 2ZBUA 3WKBA 1XD9A 4LNUB 2DQ0A 2VNAA 2PRSA 4BNIA 6REQB 1GDDA 4GKJO 3SZ3A 1NW3A 2HRDA 1CIVA 2P9EA 3H83A 3ZU2A 3A31A 2Y0PA 1EWRA 3QKRA 3OQHA 1AV6A 5AM2A 3WVNA 2WK1A 3OZEA 4RFSA 1WSAA 4FTWA 1B1AA 2ADMA 4DWWA 1GN6A 1NMYA 5HF5A 1XQ1A 4RL6A 2P1ZA 4LJ7A 3AX6A 2FQXA 4IIDA 3FUXA 5BWMA 1XT6A 1SUBA 2GFIA 3PXXA 5FPSA 2IYWA 3AVPA 5TPWA 2W0MA 4ABYA 3LY8A 3OAAD 4UHDA 2CMFA 4JJKA 3IIKA 1WB6A 1YKSA 4KEAA 3ST7A 1P7PA 5REQB 1MW8X 4R7TA 2O7QA 3A2MA 1F17A 2ZIAA 2QAGC 3S0HA 3R0XA 4NOKA 2Q7XA 3DTNA 4DMFA 4MLDA 3L18A 1VL6A 1N92A 2BGGA 4PC6A 1PNRA 3I2FA 1KAGA 4FFOA 2W2LD 4DXHA 4RQAA 2XNDA 5JSYA 2OXCA 5IASA 5IHPA 2CF5A 4QXQA 1JDBB 2H4WA 3EIFA 1XJWA 4FSHA 1L4EA 4DMKA 2CVQA 2ZRGA 3IBTA 1L4FA 3IR7A 5KYYA 3TW6A 4Z49A 3B6ZA 3PIRA 1M2OA 1OZ0A 2BBSA 2WOOA 3CRNA 4JJ7A 4XFDA 3K1YA 4Y7CA 4NCHA 3L82B 1ESDA 4EA8A 1OV9A 3DLIA 4J94A 1H6DA 3WIUA 4E6PA 4TZZA 1V5EA 3BQMB 5EQTA 1TO2E 3O9MA 3ABUA 3KHNA 1P91A 2FE1A 4U6NA 2H1HA 4FLMA 5G4LA 5K8JB 5DBEX 1XQ6A 2VHWA 4B47A 4EZBA 5HXAA 3W2HA 5FNVF 2X0JA 1U2DC 3VYVA 4U2BA 4FGSA 3OZ7A 2UYOA 2ZOSA 4JEHA 4OQZA 4IGEA 4YMIA 3A0HZ 1Q5PA 4KFCA 4WOKA 4DMCA 3TX2A 2A9FA 5I4IA 2X58A 1FUEA 2GHIA 2FTKE 1QX3A 4C8EA 1KQPA 3PRKE 2R9IA 1NVMB 1CNMA 3BHNA 3L7MA 4DGSA 3K4QA 3GZNB 2K2WA 2EFEB 3LAWA 5CPBA 1XCOA 2BE7A 3BIWA 2AKYA 3JQQA 4TMYA 2VT6A 3MWDA 2WSBA 1P17A 1XRRA 4PYLA 2C0PA 4EJSC 1V3QE 3RG8A 4EMTA 3IO5A 1CNEA 4Z8YA 2Z8ZA 4PYRA 5IXYA 3CE9A 1M2NA 4D0GA 5C0OE 3CW2A 5EWLB 1NP3A 3FKSG 2QT9A 1YJWF 4UAUA 3IAXA 2CLKB 2GOYA 4QKQA 2IKQA 3HP1A 3L5OA 1W19A 2OHFA 4P3PA 3V9AA 1A7KA 4IQ8A 5CIYA 1TB4A 1DOHA 2Q4BA 2XYPA 3ZWYA 3N0WA 1A7UA 3CD6V 4R68A 3I9LA 3TEJA 1OTHA 4MDYA 2XOKD 1GCOA 1VSVA 1W59A 2PK3A 1MCZA 4A8TA 4PLYA 1JEAA 3BOSA 4C14A 5AW7A 1JFSA 4FOOA 1NQAO 2FLVA 1Q90D 1EFLA 4G8CA 3UV3A 4Q6GA 1ZD3A 2JS7A 4IQGA 3BRWD 1U0GA 3KS9A 5B2FA 2VTEA 2HLDA 3DM9B 2E82A 3B53X 4O5AA 1QH1A 2K2QB 2X9LA 2HREA 4JBHA 3DPSA 2ZIUB 5DGCA 1PEKE 3NORA 2CLOB 3OCWA 4MWCA 4X3OA 4BAGA 4PAWA 5EQJB 4NX2A 1LPOA 1C1XB 1RQLA 3X2FA 2DF8A 3ZCSA 3H1GA 1J7JA 1OI4A 2WWRA 3WAJA 3G8YA 4LXGA 4AP6A 5KKCA 4ZTBA 3HCPA 4TN5A 2F8TA 1NMXA 4JOQA 3UAGA 1B8PA 5JW6A 1P72A 2CHEA 1N8RH 2VBFA 4W82A 3SQNA 4R0VA 3CINA 3P2YA 4MW9A 4WKCA 3PA6A 1Y4ZA 1Y3AA 3MELA 5DTRA 4TSFG 5CBPB 2VZ0A 5EJ7A 1YB1A 1K86A 1J0AA 1GRJA 4DHEA 1ZWZA 4BWYA 1YF3A 3W5BA 3AHGA 2BUCA 2R79A 1X38A 3F5MA 2D5IA 3KL2A 1JHYA 4QXRA 3IOEA 1S2DA 4OHCA 2C95A 5AI6A 4EVSA 1I51A 2ENWA 4LF9B 5E7QA 3WDKA 2XXAA 4NONA 5LA6F 3M6IA 2VWGA 3TUIC 1SK9A 3FOWA 4JI6O 3WJPA 1P1JA 3I9KA 4UDYX 4JR1A 1RJDA 1D0VA 4MVJD 1WZCA 2H8CA 1QKJA 4LDAA 1YR2A 2ODAA 3M6XA 2IH4A 1MVOA 1U4NA 4FW9A 2JASA 2G1AA 3WBFA 1WKCA 3ANLA 5DXFA 3A28A 4G4VA 5I3CA 3UCXA 3HGTA 2BC9A 3T12A 1ZD1A 2R8BA 3IPCA 3VR2A 5DTIA 3UJNA 1N9GA 1I5RA 3GXOA 3WHLA 2RFLA 4RW0A 3DE4X 1DUIA 3WK5A 4LDRA 2XQVA 3ZMUA 3UJDA 3PNKA 4EVQA 1JFRA 2A9PA 5EYPA 4NBTA 1ZGGA 4J9ZB 3FPKA 4EUSA 3IMCA 4FM9A 1KOLA 3IKEA 3B13B 3AR3A 1UFIA 1Z0AA 1NZDA 2JEOA 1CIPA 4ANFA 4P38A 1YV9A 4FT2A 1HSOA 3I6MA 3LP8A 1ACMA 5A2QN 1SC6A 4GMDA 4G0WA 3TGLA 5EA2A 1VZ3A 4LECA 3R5FA 1B23P 1ZN2A 4K35A 5F7JA 4J6FA 2AMTA 2WU8A 1QYXA 4GRDA 4DT1A 2Z1MA 5A1TA 1Z4NA 5F52A 1GGJA 4Z99A 3TOCA 4R8RA 1VF5B 1E3QA 2JGRA 4WZZA 4BTLA 1ZK2A 3IMEA 1U2PA 5CLFA 2HBQA 1XRQA 2DLNA 4D44A 2QOEA 1OHHG 4DLAA 4WV3A 4LWSA 1O6FA 1P4AA 1YZQA 4WDRA 4OAOA 5F78A 1CERA 1PUJA 3OTHA 1UFQA 2QSUA 4BAUA 4BMZA 1QIFA 3ZZNA 2UZ4A 3ZHSA 3MDOA 2GXQA 3DKPA 5B3JC 3TL6A 2JFXA 1W1IA 3K9NA 4NJMA 2GUZA 4BEWA 1VIMA 5FADA 4JQCA 5I7EA 5FI0B 1EGMB 4CKCA 2GPJA 1PGJA 4MINA 1XUQA 3HKCA 4CM8B 1BVHA 3H3XA 2PQ2A 2AVDA 3O0DA 4BQFA 4YAKA 1MNGA 4EM6A 3OPXA 2XT0A 2I7DA 4RKQA 2R85A 1GX1A 1T5EA 4JI1O 4WBNF 1K5GA 1ZM4A 2CYAA 3B85A 3I30X 3CVUA 4IGFA 3O95A 2YZMA 4FWBA 1H4QA 4CIXA 1A72A 1C30B 3PQFA 2E4WA 3RYHA 5JD5A 1GPAA 3BH6A 1SC3A 4LXXA 3N0RA 3OA2A 1UQTA 3MJVA 1TX4B 5EE1A 2ZJYA 4L4ZA 1YJXA 5JI3E 4GR5A 2WFLA 1E94E 3BIFA 3TUJC 3AL3A 4IJ6A 3AFNA 2DWQA 5B4UA 2WWXA 1DLBA 1E5DA 3AH8A 3GEHA 1H6CA 3KQUA 1P74A 3LTEA 3QVGA 1VL2A 1XA3A 1EMDA 4FGUA 2BDTA 5J2UF 1ELOA 3AFIA 4NCIA 1SUSA 4JMPA 1OCZB 3IEXA 4QXOA 2OXIA 3VKFA 1QLNA 1QPZA 4HGPA 4UHFA 3SGLA 3KEGA 3EWAA 2LDBA 3NB0A 4PPYA 3I9V6 4BEBA 5AUQA 1ZDMA 3P0JA 3AF6A 1Q21A 4LJ4A 1PDOA 3R0QA 2FGKA 2RGBA 1FFDA 2AX3A 4EYKA 4QJBA 3A06A 4H7HA 1W93A 4PZUA 4PI0A 4E5VA 1MRSA 5CFPA 3VU9B 3MGAA 1G8YA 4Y18A 2QN1A 4DM3A 4QPCA 2BKAA 3BGSA 4QUGA 2WU3A 3AP1A 5I7UA 3MGCA 2W8BA 5ITZB 3RJ9A 4PI2A 2P9QA 2R7KA 4FMTA 1SRYA 4DR4B 4DUZO 4QE3A 1D2GA 4JP1A 2DECA 3JTEA 1Y8CA 1DJMA 1HT0A 1U0LA 3A27A 4B7CA 2X6BA 4BW0B 1MC4A 4DK0A 5BV1A 3F73A 4PRYA 2FTKA 1LS6A 2C4MA 3RG2A 3NDPA 2CVOA 1Z18A 3QE2A 4WZAB 1K6IA 2C9CA 2RSLA 3T4PA 2IYQA 1NNLA 4M1TA 2QAJA 5ES3A 2ATKC 3GNSA 3D5QA 1PNTA 1X7HA 3C3AA 3DZJA 3GLFB 1PNKA 1GKYA 3FF1A 1R4ZA 1FFHA 3RKSA 4JAUA 3LDTA 1SH7A 4IT5A 3C3BA 1S02A 2UXBB 4OJNA 3IUSA 3KZKA 4INOA 4ZQFA 5JXIA 1I7QB 5HCNA 3PD0A 1A9QA 2G9QA 4CIYA 4ZHQA 3PX2A 1ZJ5A 1XHFA 4WY2A 4BPBA 1K92A 2XZDA 5EERA 2C42A 1AHIA 1TE2A 1XLWA 5J5CA 1IFXA 4RHFA 2XYVA 4W7SA 2OKGA 3LY5A 1E6KA 3OP4A 1FXKC 5ERYA 3FMIA 1QFXA 4UJ5A 2WILA 3OBIA 1TCBA 3AL2A 5K8UA 5JSQA 2D6FA 2H5EA 3B51X 3GLRA 2CHFA 4PU0A 5BSTA 2CGEA 3OG9A 3QLJA 1Y33E 3QX8A 3JQBA 3OFNA 3NBAA 4DUGD 3NMUF 1N7IA 4DZZA 4JBWA 4EI8A 1VSTA 5CDGA 2FZLA 2GTIA 2MU1A 4TLMB 4JQSA 5KPDA 1D5AA 2HWKA 2FZEA 1P7WA 3PTAA 1I2CA 4RZXA 4N7MA 1KFBB 4MV7A 5AP9A 3FJ1A 4R9RA 3FVWA 3ABLC 3IPAA 3A9RA 3KZCA 4OP1A 2BW0A 4B4KA 1I24A 2V96A 2M6YA 3BDVA 5JSZB 5EXPA 4UOQA 4FFBA 4ETMA 3D3QA 2ZUWA 1T9CA 3KTOA 5KOYA 1SBCA 3FH0A 4DM4A 5MFPA 4DF3A 4IOMA 1MNQA 3M34A 5HIJA 3F7YC 3DS8A 4FLVA 3H1TA 3K5LA 5JQGF 3IALA 4H6VA 2FCRA 1IY1A 3GB7C 1SC9A 2X0NA 3QPVA 5I9IA 1CHNA 2O8EA 5FD8A 4LTDA 3PL1A 1MIHA 1PG2A 2NTVA 2X15A 3DE0X 2C4HA 4ZGGA 3ZGVA 1PEDA 1YQWA 3ZE7A 3LX6A 1WE2A 5C18A 1P5ZB 4JC5A 3LUDA 4NTXA 2ZBRA 3T9EA 4ENSA 3A2KA 4IGIA 5EFZA 3WP1B 2BKXA 1NXTA 4R3NA 4UBIA 4KYIB 3IP1A 4EBBA 3LFOA 2JDID 3IB3A 4YO7A 4JELA 2ATCA 5DEDA 5C4MA 4GF5A 4QYIB 3ESAA 4F9FA 4CUJA 1YS2X 1XTQA 1KH1A 4LYHA 2JIDA 1Z12A 4E94A 2YBDA 1QQ5A 3TGWA 2XUJA 3QBDA 3MNFA 3M33A 3H7AA 3CD6F 1E1CB 1N5RA 2XNKA 2F1KA 4QBTA 5H6RA 5E6UB 4ER6A 1QYVA 2IPXA 5DB4A 3E8XA 1RS0A 4MI9A 4II2A 3ABOB 3C5VA 2C9MA 4GP9A 5K0BA 4CBVA 2PZBA 3X1JA 2E4ZA 4CL3A 4MKIA 1QVAA 2NQ2C 3ZWAA 2I3ZA 4FX2A 4IRXA 1CJSA 2F59A 3MB8A 1KGDA 2WI8A 2CVFA 1V3VA 2DULA 2WJAA 2KPOA 5IUNC 1YCGA 4S24A 1XNQO 2PYJA 2ZKOA 1Y6RA 4KPYA 4L2IA 2IEDA 3BEOA 2VSXA 1VL1A 4NP6A 4MZDA 3CU5A 1UEXC 4Q05A 3LUTB 3QU7A 5KUKA 1E89A 1J8VA 2QTRA 1RJWA 2VF2A 1OTXA 5E2IA 4TMTA 1SEVA 3D1VA 2HLPA 2IEYA 2ZVQX 3RUEA 1DPGA 4Q6BA 5HMMA 3LWBA 2DTEA 1Z62A 2AV6A 2FEMA 3REGA 4BFVA 3C97A 1M1YB 2QA4V 2SICE 4XLLA 3IC5A 1W581 2QE7D 4D46A 1N2ZA 3AUSA 1EUQA 4IFIA 4EQ6A 3GHZA 5A3VA 1EIWA 3D2BA 2GD6A 3ORSA 2XVXA 2GEJA 4O29A 3NEAA 1GKLA 3HN2A 1M76A 5DLEA 4YX9A 3KOXA 4PLHA 1H6BA 4XOIA 4JENA 4G1UC 1YL5A 4AZVA 3HDQA 4WZBA 4LX8A 5LQSA 3GT3A 1FX0A 5IKEA 1TRKA 4QREA 1G4YB 1WUHS 4BNWA 1QIGA 5SZKB 2X22A 2NN3C 3ZHYA 3FPIA 1MPTA 3R8CA 1SIBE 3W8EA 1YNSA 3DMGA 5KNBD 2YHAA 3S3TA 1R0KA 3BHJA 3VU8A 5TPZA 2VLBA 3JAKA 2A57A 4QUEA 1DJPA 2D8AA 4BZWA 1HO3A 4QOJA 4GPAA 2JS3A 1T9BA 3A0BZ 5J4LA 5HY2A 4BZPA 3SX2A 3IP6A 3QUSA 3JD3A 1GN8A 5MFZA 3PXDA 3O4RA 3EDOA 1QLWA 3AI3A 3EG5A 2RJOA 3OTOB 4MV9A 3IMKA 4B84A 3WPXA 3A9UA 4FJ2A 4ZYTA 2A30A 4HZGA 5IZCC 2GWHA 2AW9A 4QYWA 2HG5C 1Z35A 1ZWIC 3L9XA 4MEBA 4MR8A 5EFOA 4CL0A 4PR3A 3E61A 3PI7A 4YC7A 1KAOA 2ZUEA 1J7HA 4YACA 3HB1A 3TTSA 4AICA 4NV1A 3ZNOA 4KE9A 1Y1RA 2QTVA 2DPMA 2HSWA 3L6UA 5IAJA 4KMRA 1CULC 3C4VA 3I55V 3H9CA 4CLRB 4GX2A 1AS3A 2VQFB 2CKDA 4FLTA 1ZLXA 1DIAA 2IYZA 3GNQA 4PICA 1OXVA 4M53A 4RCYA 2C29D 2NXJA 5JFGA 3P2IA 2PT5A 3GHYA 3L02A 1HQDA 4TL8A 4WOBA 2J30A 5ES4B 3DOEA 2Y8EA 1IXMA 4NBSA 3KZMA 1A8UA 3KU4A 2QX8A 3N8HA 5WRFA 1FB5A 3BEDA 5AVQA 4ENUA 1AH2A 1IRIA 4C29A 2VDOB 1C3OA 4R6ZA 1LPBB 4YMTA 3LWVC 3COJA 1E99A 4GKBA 1SB8A 3H2IA 2XB6A 5LM3A 4PW0A 4QDZA 1E32A 2R8YA 5CGZA 2QXUA 4MW7A 3S1AB 4LVNA 1A7JA 5IVPA 2RGRA 3DYVA 2P3OA 3N2EA 3HE3A 3DE1X 2M7WA 2NN4A 5CFNA 4P93A 2XBLA 4S35A 2PDAA 4M1KA 3NBQA 3W5HA 4Z4HA 1U90A 1RZ3A 4ZOLA 2JD2A 4RF4A 3QPAA 4Y2XA 3TZLA 2FQQA 5FR2A 3VUFA 1NMUB 4UEKA 1E1MA 4KV7A 4EFBA 3RU7A 1A98A 2V7QD 3KX2A 1JHPA 1VI5A 5G4VC 1BTOA 1Y4SA 4JJFA 4TV8F 5E0KB 4TLAA 3QU5A 5CNMA 1SA0A 1VHTA 4CGZA 3WZLA 1ISIA 1V16A 3EISA 1O4WA 3MLAA 3KBOA 5TMEA 3S0JA 3L40A 1C8LA 4DV3O 2Q6KA 1SXPA 2VGNA 5ISMA 1GUFA 2ZIZA 4YNBA 1HEUA 5KVVA 4TTTS 4ARUA 2G04A 1PLLA 3BIOA 5DGIA 2LZ0A 1S2MA 5L3SB 4HNQA 3LZ6A 3Q7PA 4UKDA 3PNBA 3TDNA 1K3TA 3GGJA 5E7JA 4DJEC 4G8JA 3ABKB 4YP1A 1AKVA 5HQ3A 3A1NA 2X1HA 2DUJA 1XU4A 3ANMA 3PF8A 5DHAA 5EJ2A 4K9PA 1B41A 2AGVA 3U4IA 1Y6QA 3LQKA 4RVGA 5BWOA 1CKEA 1UP4A 2I62A 3AP3A 4ID9A 3ACCA 4JT8A 4OJQA 3N53A 5K1ZA 4ZMBA 1ZVVA 5AK5A 3PDWA 2PSJA 3WXMA 1P4JA 4KAAA 2BSXA 1UKAA 4OBXA 4Z1MD 3SPJA 2PX0A 1GM9A 1P7ZA 3JASB 3EF0A 1USUA 1E6MA 2IBSA 5CVJA 2YI8A 3B9QA 3A11A 4MICA 1Z37A 4PYIA 3BGIA 4B0OA 1TA4A 1DZ3A 3OM8A 4H7IA 4XFKA 5FI1B 5G4KB 5E9WA 3Q7SA 3KLMX 3MGBA 1KZ1A 3NBMA 2B20A 1IPAA 1PNOA 2P2LA 4E32A 1B26A 2ICAA 4CQMA 1C3JA 5M34A 2G36A 4FR5A 1MO4A 2OT5A 3UV6A 4KXXA 4Q47A 5JJJB 1RYEA 1XN1A 5C7YA 4J0JA 2A5YB 1JMYA 1W8DA 4RPKA 3UTDA 5B12A 4DR5B 1HTBA 5H5NA 1KXJA 9ABPA 2O3JA 3C5CA 1GGMA 2PUEA 1JJBA 5FA8A 1T5BA 4H1HA 3ZHBA 4RYLA 2HS3A 1GN3A 1R4MA 2W2NA 2AFIE 4DR6O 3OQPA 2ZSUA 1Q1AA 5EB1B 5AK4A 3FPGA 3KJFA 1X92A 3UJHA 1CZRA 4Q6WA 4UUQA 2CJWB 3K5WA 4NOLA 9ATCA 1FEZA 4PIMA 4UVDA 3AEUB 5G2OA 1IUOA 2GHQA 4AKHA 3IP3A 4LWZA 3WHPA 4O3FA 5JDCC 3OF3A 1IEVA 3QW4B 5K5EA 2X6RA 4ZBMA 1TZMA 1EVLA 1DQPA 2BE3A 5BY2A 2Y4NA 2YNMC 1WUKS 3L75H 1XLTC 1Z6TA 3EQ8A 2QAGB 1I0IA 1NKSA 5KNCA 3JAMN 2XECA 3K09A 3PL5A 4CS3A 3WQQA 3HVIA 4ISCA 1SQXH 2IX9A 1K3UB 3ZQUA 1Q0TA 1QRDA 4X3CA 3W4JA 1AI5A 1RHJA 1WMBA 3PPWA 3NKFA 4H3SA 4PX2A 1YZGA 3EGCA 2B2NA 4KSCA 3E05A 2WT9A 1JOYA 1DFHA 3GDHA 5A3SA 2NU7B 3OMIB 4C6SA 2CAZC 1EU1A 1QYDA 3U7IA 4KXWA 1DBWA 2HMUA 3H13A 3TINA 5IWAO 2RGUA 1O6BA 2O50A 4DIFA 1YVEI 1OX4A 4US1R 2VHQA 3TQCA 5DHRA 2B4TO 3F98A 3CSDA 1Z6AA 1R3UA 3K5PA 2FP4B 4XRGA 1EWQA 4PSAA 3WNZA 4X66B 4Z7NB 1D0SA 3ZDDA 1GM8A 3BHPA 1NT4A 3OTWA 4Q93A 1U5CA 1MB4A 4Y6PA 1BXZA 4RZQA 2AUNA 4XIFA 4GOND 4D9FA 5BMVF 3QVSA 2QZSA 2XF8A 1J70A 2Y4OA 1SKYE 2I4RA 5I7AA 1UL1X 3R8XA 1L4BA 2ESRA 4K86A 1T9GS 4JUBA 3TL3A 3AFOA 3ZEAA 1NLYA 4RSHA 4XQGA 2HN9A 4RWZA 1YI8A 3OMXA 3DTVD 4NR1A 4ZZIA 4UD2A 2XGSA 1FDVA 3QO7A 1SCQA 2COUA 1ZH0A 3KQVA 1PR4A 4PSVA 3P5BA 4C0KA 1OA0A 1DEKA 4EJSB 5IT0A 2J9ZB 4TYMA 4B6OA 4H0LB 5JVDF 3GDWA 2EKQA 4BQSA 4B32A 4K28A 1BXRB 3IP7A 4OK6A 3OU2A 5CXSA 4WN9B 3CLKA 3DHYA 3H9VA 2RHWA 1SQQH 2H5JA 1IMJA 3JAMA 3PFGA 3CRQA 2H07A 5CNJA 1DAMA 1XGKA 3OEHG 3DFKA 4YPFA 4UXNA 3V2HA 2K9PA 4RM3A 4UMFA 4UNQA 1UKBA 2XCOA 1JXMA 4FEGA 4R8KA 5I9TA 5G0SA 1O94C 3UMSA 1Y48E 2C2XA 4PGFA 3QUCA 2WIFA 4QDTA 4MIYA 3V6MA 1TQ8A 1ZL8A 3H5VA 1AJNA 3WK7A 4I9HA 2GBGA 1KYQA 1Y6JA 2PBLA 4KOAA 5T6BA 1L7DA 4WCFC 3ONDA 1S5JA 4WKOA 1NRIA 4W8HA 4NXNO 3GK3A 5F33A 1G3QA 3ERNA 3G2NA 3TPFA 4Z0TA 4HRYA 1E7RA 1OILA 5T4FA 1UFKA 3PCTA 3KB6A 1TQ4A 2FDRA 4X45A 3DF7A 4H0CA 1NL3A 1LSSA 1CQIB 1IZ0A 3A0RB 4F06A 3QLUA 1AUQA 2QD1A 1HY3A 3IJRA 2LGQA 4PZYA 4GT1A 1X7OA 1YR7A 4HO1X 2YJ5A 1Z5OA 3KPJA 1ONOA 1P0QA 1REQA 5IDXA 1OFUA 1ORVA 1KBQA 3N0TA 1BCRB 1F2TA 2KGWA 2AG0A 4A6EA 2NO9A 5BQPA 2C92A 3I9V1 1JKJB 1X7YB 1KJWA 1QR2A 1ESNA 1UC4B 4E7OA 2YXYA 3HCDA 1W25A 3F5SA 1NQOA 2Y1GA 3J7AU 2XUGA 4OFZA 5AQEA 1UZUA 1WETA 3CNEA 5H83A 2A67A 1U8XX 5LMUO 1I80A 2UYGA 1E5QA 3MUNA 2OG2A 2NQTA 1XBTA 3FFBA 4NULA 4H7FA 4FOLA 5AOAA 2YN4A 1TAHA 2Q5HA 1K9MW 4D02A 1HKHA 2FPIA 4RKYA 1WS6A 3A6LA 3IQEA 3LP5A 5B3LA 3FCEA 1I1QB 4UOZA 4J2OA 1C1YA 4OGKA 2GVDC 3QWAA 3FROA 1EESA 4X84A 4IFEA 1S8OA 5I7FA 3CRAA 1ODTC 5F9FA 1SKMA 3O8DA 3ZHXA 4FKBA 4CEIA 3PXCX 4B35A 1KOGA 1DXYA 1PQ4A 3S0WA 2FWAA 3P4UA 2ZD9A 5F76A 1YQDA 4NFHA 4Q7KA 3IGAC 4G0XA 3ZOPA 4F4HA 1I33A 3OQ1A 3PUYA 1TTPB 1M2VB 5JS8A 5EAZA 1DKNA 1YZUA 4QG7A 2R70A 2OHIA 1QNMA 3N2LA 3W9YA 1FOEB 5HZGA 3MIZA 1KJYA 1E1DA 3SQMA 4W9NA 3W78A 1RC0A 3NHAA 4E22A 1Q0QA 3T5GA 1Z0ZA 1Y5MA 4LZPA 4EB3A 4LJSA 4RABA 4EPXA 3EDCA 3NMUC 4AUNA 3E5HA 3RVDA 1FTNA 1VLHA 2PD3A 1BEUB 3SMVA 2ALEA 1J06A 1CCWA 3LWQC 3RARA 1TUGA 4XUCA 7AT1A 4H15A 1D2NA 1RXUA 3RBZA 2IOHA 2AGAA 1H93A 5KHIA 3FCSB 1Z5VA 1OGYA 3L7BA 4RVNA 3U60B 5L45A 1R37A 4COKA 1FLAA 1PLJA 5F5NA 4A03A 3CC2F 2Q5JA 4KVZA 4R2JA 4BLVA 1KI9A 4X54A 1N9KA 3M1LA 1Q81W 1ZVKA 3A1UA 1M34E 4OXQA 2XVMA 4NE2A 5FP0A 2EL9A 4L0DA 3WGMA 1K0UA 3E3NA 1W9MA 4ZCLA 4NJOA 3PWSA 3RSCA 2YC2C 2ISCA 1E3MA 5HMLA 3ZWVA 4EJ2A 1FRNA 2AVNA 5JFTA 2FYTA 1KR2A 2ZVJA 5A9RA 2DBQA 4HUJA 5I4BA 4RAQA 3ENKA 4FNGA 3IBYA 2P2ZA 1C8VB 2FL4A 2VT7A 3RYFA 5ENDA 1OFGA 3EWSA 3KQMA 4GR4A 2HNBA 2MR5A 1WP4A 1Z8FA 2HKIA 5TGZA 5AI4A 1RCUA 3KJEA 4RA6B 5JMOA 2H65A 4N5IX 5EWRA 1COWD 3PCRB 2AFIA 2PG3A 2Z9DA 1U6JA 2R68A 1ND6A 1KJIA 3K2IA 3F97A 1B6TA 4RHXA 5KQRA 9MHTA 4LFCB 2EFJA 3NM6B 3ONWA 3V8QA 3EPJA 4OUDA 1I2ZA 2IH1C 4IS3A 3QFRA 3K15A 3HDJA 2HJSA 3TL2A 4YEDA 4ML3A 1L4YA 4MR9B 1TKAA 2UXNA 4MRMB 2ONCA 3JYCA 5CM8B 1RI5A 1KMIY 4C21A 4UULA 1P6QA 5ILGA 2H2WA 4LGCA 4J2TA 4LY3A 3K9SA 3OZGA 3QNMA 1QO9A 4MV6A 3CVVA 5KYVA 4I4CA 3IXMA 4RIFA 3CX8A 3KM0A 4XX0A 2IWHA 2MMCA 4RORA 2IYTA 3OZAA 2G38A 3CLUD 4OATA 2O5EA 2ZYRA 3JQ8B 4NYIR 4B3BA 2JATA 1X19A 2EP8A 4X1KA 1CTQA 4EATA 1QLHA 1HE1C 1XZLA 5KDDA 5FFFA 2NM0A 2Y1WA 2X6QA 1VDMA 3FDIA 3D6UA 2OWOA 3ZI4A 4JNKA 3IP5A 2IY7A 5CA0B 2QUBA 1K7SN 1VQ5V 1ESCA 3M3PA 1HEYA 5AK6A 2WFMA 4BS9A 2XMGA 1Q44A 3RT9A 4JLUA 3KTFA 1YZVA 4HEHA 1WMEA 3NC0C 1N2SA 3W9BA 3EXHA 4I4TB 2BGKA 2A3NA 4GM0A 5DRYA 4MYUA 5B1DA 3BULA 1BWSA 2VHJA 3QHAA 3GP5A 5BY1A 3GVCA 4DV7B 3V7UA 3M89A 1QHTA 4G56A 5DH9A 5FBZA 2PLNA 5BVHB 2NO0A 1ZOPA 2AA3A 2XA9A 3ZHUA 2R4QA 4E4TA 3TQTA 3K20A 3NW9A 5C4IA 4D42A 1MZVA 4JI8B 5J9PC 3ZYZA 2DCUA 1ZM9A 1W35A 4J0GA 2RNBA 3B4SA 1SU7A 2VOJA 1PJQA 4LCBA 4HRVA 3L1KA 2P4EA 4IXNA 3P2MA 4O1MA 2PXAA 4JKYA 2P30A 1YI1A 3K9BA 1QLJA 3D8UA 2ONJA 4J7UA 2HPZA 4P58A 2QPTA 1NQWA 2YX1A 3PKJA 3HJWC 3WLHA 1WABA 1Z38A 4OHBA 1A2OA 4I5GA 4QX6A 1MQ8B 3RWOA 2Z58A 2CDCA 1YQNA 1JDUA 2V8BA 1QKKA 3N28A 4ND5A 3G17A 5EJEA 4Q3OA 5HJ5A 3CWQA 1UOPA 1Z68A 3CWBH 1KP2A 4JJGA 1TXGA 2VNHA 3U0ZA 4NIMA 4X6XA 3TNJA 2VWQA 1GG5A 5SY6A 1S9DA 3SQWA 3A3NA 2Q8VA 4KQIA 1U1EA 5MGNA 5T41A 5I3ZA 2H2DA 4KPGA 3T7JA 2ZQMA 2JJ2D 1IN1A 2JF0A 1T0AA 4BRSA 4GZ5A 2HWYA 2CHSA 3X0DA 3G9QA 3LWOC 4QUHA 4PYOA 3BQ9A 1XRSB 1JXOA 5KYUA 1NR7A 2Z08A 3FTEA 3M5CA 1I3OA 4H0FA 2NWQA 8ADHA 2J3EA 5EIBD 5D5HA 5BRNA 2PUGA 4UBNA 4NH0A 1O8CA 4DMMA 5FL7A 4YQFA 4NL4H 3QVTA 1GSOA 1YRAA 1MO2A 3TTWA 2ZKIA 5ALSA 5GINE 2HRRA 2IU6A 2H29A 4RA9A 3VZDA 1PL6A 4IAOA 3PUHA 4BR6A 3T35A 3SIRA 4G5HA 3TOSA 1SQ5A 4GYKA 4S2EA 4YLGA 1GUZA 3G1WA 4CCAA 4OQNA 4Q3KA 1Y9EA 4H3HB 4GXQA 3RODA 4XD7D 3T3DA 2Z8XA 2AMFA 5ALUA 2M6SA 1YS9A 2RE8A 2H4FA 1ZGAA 1H9CA 5AFSA 5ALIA 3GPCA 1XKTA 1D2CA 3OQNA 5JBIA 4KH1A 3EZNA 3UPUA 4KQHA 4HLUA 3LHFA 3DR3A 4YRTA 5LZ2A 4ARSA 2QY9A 3PLRA 1JJVA 1H2XA 4XM1A 4D9GA 3I0MA 3L43A 1EB8A 3TR5A 1SQBH 1H2MA 2EJUA 1JL3A 1E2IA 4TS1A 3ZJ4A 4GP6A 1Y80A 2OMKA 1Y8AA 2AC2A 1I6MA 1JG2A 3HBLA 4KBGA 3ZLUA 4F1KA 3NVIB 4OMDA 5IK2A 3EXFA 4LI0A 3HUFA 4A92A 3JR3A 1UADA 1RKBA 4X1YB 4BO3A 5C52B 4LGYA 1H2LA 1TT5B 2KB0A 2C03A 4R1LA 2Q9LA 4HY3A 4RD6A 3AUYA 1R9JA 1X1DA 2GTPA 5LB2A 2OHVA 5IJZA 1GEEA 2WHRA 1NI4A 1EK5A 2REXB 3UPTA 2XZTA 2ZCEA 3WAGA 2QM7A 1L7BA 5JAUA 3Q8XB 5GONB 5LD2C 1GARA 3G0OA 3EIOA 3UAXA 1HZJA 5GGYA 3LBFA 2ZPUA 4RTQA 5C1DA 4EH1A 3MSCA 1JJOA 2BM9A 1ECLA 2C5GA 3JQ9C 2OAQ1 1U1DA 2FZVA 1J24A 4RVUA 2PX8A 3K31A 4HADA 1ZYUA 3WLSA 2D5BA 1BS9A 1I7SB 3NFRA 4L6IA 3NDIA 4C03A 4CMAA 2DPGA 3FB4A 4HR7A 5KKAA 3NGMA 5DBGA 1IHPA 2R97A 3RUIA 3C0KA 5ALKA 4S1OA 4OQXA 1M34A 5G0TA 1RXYA 4AO7A 1TGOA 4IIFA 3CSUA 4TLDA 2CTPA 3S29A 4IEIA 3AOEC 4Q02A 4NKGB 1E5TA 1Y66A 5HWEA 1CLEA 2F55A 3K5OA 3WWPA 5EUBA 3K0CA 1USKA 4JKIA 1P2VA 3IDQA 1I2BA 4TS3A 2GBLC 1QYWA 1RYYA 2VUHB 5LHIA 3UNXA 5JO0A 3F7NA 4ZCTA 1GUBA 2CNBA 5ULLA 3WTCA 4FNMA 1HXHA 2O23A 1GNRA 5FUXA 3IE1A 3MWGA 1OH5A 3SQDA 1Q16A 2Z2KA 4HYTA 5BV8A 2GHRA 4PZ9A 3E4CA 2HA4A 2QTLA 4WMLA 3RA5A 2GN2A 4PY2A 2PUTA 5AIAA 4YGXB 2FCAA 4ZVNA 1J5EB 1M2JA 1VFNA 4L73A 1SELA 1V4BA 4ZO4A 3AKDA 5LP1A 5ERXA 4NC9A 4HX9A 1I3NA 1SVOA 3ZD7A 4XAQA 3M4SA 3TZHA 4JTDB 4UPVA 1BDBA 3UO2A 1TFUA 4YMSA 1WA8B 1RI2A 2NU9A 2JJ1D 1SR8A 5JCOA 1C8KA 3ASVA 2RGXA 4F56A 3D0KA 5I9SA 1OF1A 1J1UA 2GSWA 2AKAB 4M21A 3LT4A 2YJZA 2B82A 4DIDA 2O19A 2A92A 1JECA 3RWRD 4NAVA 4RKWA 3JVHA 1E1RA 5KNDA 4CV2A 4DCVA 1YTFB 1GNPA 1B43A 1EX9A 2OAGA 2DSNA 4IHJF 2VT3A 2RGGA 4PC3A 1PO7A 1NJ2A 2VHEA 1QE5A 1D8TA 4XDKA 1GY8A 3CCLF 1BNCA 3AM3A 1M1UA 4LFBO 4P22A 1FC0A 2ZAGA 3I8OA 1IEXA 3KPVA 5TMDA 4D4IA 1X25A 4DLYA 2IHJA 4AJKA 4DV2O 4NPCA 4KL1A 4O08A 1QHHB 3E53A 5JBQA 4QAQA 4Q3EA 4PHGA 4IICA 4WTOA 1S3FA 5HCUA 4MV5A 5FNVB 4UMDA 2R6FA 2I6RA 4R7CA 4E21A 1QYCA 3LCJA 3KSDO 4XDJA 3L1JA 3NTXA 2PUAA 2BM8A 2C77A 1JTVA 1R1DA 1N2OA 3I1JA 2E55A 4ZC1A 2Q3MA 1QKIA 3AETA 1P4HA 3OSZA 1ZINA 4GWLA 3VKVA 1F6DA 2P1RA 4AI6A 5T4BA 1TRHA 5K6AC 5KOIA 1GQYA 4CGYA 3KZXA 1OKKA 3H2JA 4P9PA 3RYIB 3TQSA 2ZYGA 2N04A 3NDBB 4Q39A 3WLRA 5CFMA 1G5QA 3VOSA 5KC9A 2I4IA 1Z0DA 5I9NA 1DF4A 3JQFA 2RKWA 4ZALA 1TZJA 3ENVA 4PBRA 4YRFA 2IYUA 4L8LA 3SU8A 3ONNA 3BJEA 3WIOA 2OCBA 3TLBA 2WD7A 2B3DA 3ICWA 2OBLA 2GRAA 4ZPJA 5TJ9A 5KA5A 1JJ2F 2CLIB 5EWJA 3UMVA 4ARAA 3QNUA 2AOWA 4Z7JA 5FYDA 1YIJV 5LBQA 4HN9A 3QF4B 3Q9UA 2ZWPA 1GXSB 2M6LA 3MTDA 1RZVA 1QG0A 2AG5A 3GWOA 1CWUA 1SZPA 1TCUA 2F93B 4XDHA 1QRTA 3L4JA 3CPQA 1NVXQ 1DTOA 5HW0A 3CMCO 2JARA 2W71A 4INAA 1IHDA 1OVMA 3WLKX 4CM7A 2YRWA 1AJPA 3W7TA 2CE2X 3KALA 3NVAA 1J0DA 1N2GA 5LYJA 2HQOA 1DC4A 1ETHA 3KC2A 3QVMA 4B31A 3UN1A 5E1MA 2OOKA 2NVBA 4ZGWA 4G2KA 4QXPA 4HYEA 2KG7A 2AMLA 3NR2A 3A6KA 1E92A 4X00A 1VQKV 1CY0A 1YL7A 3OMAB 4HN2A 1KK1A 4I9FA 5FUWA 1H8ED 4M98A 3F3YA 3L0BA 3KXDA 4E33A 1R6NA 1HDGO 1FF9A 1HSZA 3JD4A 4Y2GA 4E5DA 1DIRA 1RWNA 4JEMA 4XSHA 2CYBA 4LY0A 4QJ5A 5DN6A 3LGAA 5A2QA 4JI7O 1DOAA 3T1YB 3VOTA 3O9ZA 2B99A 1XOIA 3WGHA 4N49A 1ODCA 3W9UA 2K7ZA 1UM9B 4PLPA 1VQ5F 3FGNA 2QQGA 4MH0R 1GO0A 1YBFA 1UDWA 2PUVA 2P2SA 1GZ6A 2CDRA 1EN6A 1N34B 2NZ2A 4OXKA 3BC1A 5CT4A 2DR0A 1DT3A 3LK6A 4GKAA 4YP7A 1F0PA 2A35A 2J87A 3GROA 4F8YA 3KD3A 5IU6A 1VYHA 3QWHA 2DJ5A 3VC7A 1MO5A 3PNMA 3U4CA 4TYWA 1U2ZA 3WB0A 4JAVA 4NVPA 4G37A 2DBZA 5TMBA 4MV4A 4D99A 3GCXA 5CHYA 1SXJC 1KPGA 1KEPA 3SDZA 5LN1A 1G20E 3QYJA 4EEKA 4QU5A 1MJGM 4F2HA 3OJWA 3GQBA 1WEHA 4U3JB 2P6YA 2W9XA 3D2AA 3EA5A 3QGMA 1U8YA 3VJLA 3RI3A 4F3YA 2FPSA 3LUGA 1CB7A 3T54A 3HHEA 5EC8A 1CDEA 2G8LA 1UKEA 4RIHA 2QTOA 2C88A 1UP6A 3HZRA 1Y3DE 4M22A 3GGPA 3SIWA 1QTNA 4ERNA 4PG6A 4DABA 5A4IS 2PX2A 2F4VB 4C5AA 2ZJ5A 3KXKA 3VTAA 2C4VA 2VYNA 1KFEB 3UAZA 4N39A 3BZUA 2Y0EA 1RLOA 4HH0A 4JL8A 3RDPA 4PBSA