4I55B

Crystal structure of tubulin-stathmin-ttl complex
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
428
structure length
425
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular Mechanism of Action of Microtubule-Stabilizing Anticancer Agents.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell cycle
molecule keywords Tubulin alpha-1B chain
total genus 162
structure length 425
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4i55B03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4i55B02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4i55B01
4IHJA 3HKCA 3JALA 3WGNA 1TUBA 3JAWA 1RQ2A 5GONA 2GVIA 5KMGA 5BMVA 2XKBA 4FFBB 4X1IA 4YJ2B 5M7EA 3UT5A 1W59A 4XCQA 3VOBA 1W5FA 5JCOA 4ZHQB 1SA0B 5ITZA 1FSZA 5LP6A 3JATB 3N2KB 3RYIA 4B46A 4I4TB 5LA6B 5J2UB 4F6RA 4EI8A 3RYFB 4TUYB 5C8YA 5IJ0A 5FNVA 2VXYA 3M89A 2RHJA 5JQGB 1W5AA 5J2UA 5CA0B 4X1KB 1JFFA 4O4IB 3ZBQA 1W581 4O4JA 4O2AB 4WBNA 5LXTA 3WGLA 5LOVB 4ZI7A 4EI9A 1Z5VA 3M8KA 3WGKA 4O4LB 4DRXA 1JFFB 4O4IA 5IYZB 4TV9A 4I50A 4U39A 4I55B 3JALB 4WBNB 5LXTB 4X20A 2RHHA 1TUBB 1TVKB 2VAWA 3HKBB 3JARA 3VOAA 5MN6A 5BMVB 4KWEA 1FFXB 5GONB 3RYCB 5MN5A 5KMGB 3HKEA 4O4HA 4IIJB 3R4VA 4ZHQA 3RB8A 4U3JA 3UT5B 1SA0A 5JVDB 4TV8A 5J2TA 4I4TA 3JATA 3N2KA 3RYCA 2BTQA 3HKEB 2RHLA 3HKDB 4YJ3A 3E22A 3RYHB 5JVDA 5FNVB 4DXDA 4EB6B 5EZYA 4X1KA 4HNAB 5CA1B 3VO8A 3WGMA 5CB4B 2Q1YA 4O2AA 5LYJB 3E22B 5EIBD 4IHJB 1Z5WA 5EZYB 4X1YA 5KX5B 5LOVA 1RLUA 3JAWB 4F6RB 1RQ7A 3JAKA 3N2GA 3ZBPA 5IYZA 5IJ9A 3HKBA 3JARB 4ZOLA 4X1YB 4X20B 2RHOA 5EYPB 5LP6B 1FFXA 4E6EA 4O4JB 4IIJA 1W5BA 3C8LA 5JH7A 4TUYA 4EI7A 4LNUA 4TV8B 5J2TB 1OFUA 4ZOLB 5EYPA 5IJ0B 2Q1XA 4YJ2A 4I50B 5JH7B 4FFBA 4X1IB 5LP6C 2BTQB 4LNUB 5ITZB 1TVKA 3ZIDA 3RYIB 4O2BA 4YJ3B 3RYHA 5JCOC 4ZI7B 2VAPA 3RYFA 4EB6A 3JASA 5LA6A 2R6R1 5CB4A 4DRXB 3VPAA 5LYJA 4HNAA 5CA1A 2XKAA 5C8YB 4O2BB 2R751 5JQGA 2BTOA 2VAMA 5KX5A 4B45A 3V3TA 3CB2A 1W5EA 3JASB 5CA0A 5MN4A 3JAKB 3HKDA 3N2GB 4M8IA 5IJ9B 4O4HB 3VO9A 3HKCB 4U3JB 4O4LA 3WGJA 4TV9B 5EIBC 4I55A
chains in the Genus database with same CATH superfamily
3AQ4A 4L6IA 5BUZA 4PVCA 3OCVA 4DTCA 3ANXA 1DTSA 3KKPA 4HX5A 3IVRA 5DEIA 3WR5A 3JQ9A 3V1KA 2LFSA 2G1UA 2GPNA 3THYB 1G21E 1E3QA 1JALA 4EY4A 4YASA 5CRIA 4Y9UA 3P2EA 4NCNA 3U4GA 2HSJA 3TWOA 3FNRA 3F9CA 1N34B 1CR6A 2OPBA 4LHWA 1AK9A 1PR6A 1KJZA 4GX0A 3RRFA 2F1MA 3NT2A 4X65B 1GCIA 3B1YA 3R77A 3TSOA 4HZUA 1Y1QA 3PF8A 3WKDA 4UQLA 5K6RA 1QIDA 9MHTA 5AW5A 2NYAA 1JL3A 2H6LA 3CLRD 3L0DA 3O95A 2HW8A 3ME5A 4G27B 3GDGA 1LK5A 4HH3C 3LP5A 3LUPA 4MQ4A 4KR0A 1X3LA 3EW9A 3M0EA 4WN9A 4KXNA 4Y0AA 4UAUA 5DV9A 4CUZA 5GZ3A 2O2IA 2ZT5A 2QUZA 4BX3A 1XZAA 1ABBA 1OOEA 1BH2A 1Q0PA 1V39A 3ZJVA 1PR0A 3RASA 2ONYA 1QTNA 2W0XA 2XAFA 5TSDA 2RH8A 2ZJZA 3TLMA 1OUMA 2CHTA 1XMIA 3L8ZA 1VJDA 4OK5A 3EGDA 5ENDA 5B4TA 1EDBA 1CY1A 1JGTA 1CD5A 2OHHA 2OZVA 3A9VA 3NHWA 4HQNA 3C7TA 4B43A 2WTUA 2XRZA 3G1UA 3K9LA 3NO4A 3RRYA 3L6BA 1F2UB 3EVBA 1HRKA 2RGNC 4CWAA 1XQ1A 3NP7A 4TLLB 5AJWA 4YCAA 4RPJA 1EX9A 2APJA 1GAWA 2I3DA 2Q6VA 2O3RA 4DIUA 2UZHA 1HNZB 1T36B 3D7NA 3UOAB 1WMBA 3G6KA 3PIRA 1GPBA 4Q6GA 3LGXA 3OOJA 4IZOA 4R2WA 1VF6A 4M9RA 4V39A 2YW2A 2NZWA 4KEAA 4RMNA 2V7BA 5KQSA 3E8SA 3DFMA 1A7KA 1TD9A 4S3MA 2C29D 1E99A 3IDFA 4LYGA 3H3FA 1KKLA 3DVQX 4TWZA 2FZWA 3ASVA 2PTHA 4LDZA 3T99A 2QBYA 4ZO9A 3LWQC 1OJHA 4E5UA 1TM1E 1IONA 2CLLB 3I1IA 4IDGA 2GDJA 2YJ6A 1N8RW 3SI7A 5JR3A 5ELXA 1H4SA 2PUBA 4FMBB 3EASA 3H1AA 1M0EA 4I1PA 3P8ZA 3HV2A 1EBOA 4BVEA 4HBNA 4UDYX 3PNOA 1D6NA 2JI9A 4BLVA 4DKJA 4DV0B 3AWDA 3E61A 5C1PA 2DY1A 13PKA 1YTFD 3MAGA 3MUFA 3ABOB 4O4JF 4P92A 1R6NA 4MRMB 4XWYA 4QEKA 3JQBA 1SUPA 4FFLA 4IHKA 2FR0A 2O0KA 3QFHA 3NDRA 4KN6A 3B77A 1A32A 2D1SA 3K9BA 4LDNA 5T7BA 4UTXA 4U7WA 3T5TA 1SXJA 5CX1B 3O4RA 3ENKA 5CTAA 1MQ9A 3S8EA 1S8AA 2ZAYA 3TOCA 3Q3VA 4CTOA 4F5WA 1ZSYA 2WPNA 2ZI5A 3OEWA 2HJVA 3N87A 2EDCA 3I4LA 2H2HA 1O95D 5FJIA 5F9HA 3DUFA 1LUVA 1E2LA 1N6NA 1Q1AA 2XECA 2G4CA 3CE9A 3FWHA 3GDWA 4BFYA 1NMUB 4O2BB 1U7OA 2VRCD 2VPWA 1DT3A 3GD7A 3OCZA 4NZMA 3VX4A 4EVQA 4QTYA 5A5DA 4BY9E 1GZHB 2R62A 1TDJA 3COSA 2D6FA 4UVCA 2MDTA 4DPLA 4QTUB 4QQ8A 1XN4A 3OOWA 1U43A 1PR1A 4GNKA 4Q4AB 2JLYA 1W1UA 2HPAA 3FIJA 4NMLA 3BEHA 3ISJA 4JP8A 2P0YA 4RS4A 3FYEB 1X13A 3BXGA 3CCSV 4S0ZA 1ODSA 3KLOA 4C8GA 2CXHA 3NC4A 5D5HA 1BW9A 3T06B 5I4IA 5B53A 1QR8A 2MWMA 2YXBA 5FPTA 2P4KA 1ECCA 1NM5C 3CURA 3VYUC 3TTTA 4DNPA 2R47A 5H3CA 4PJ0Z 4DV5B 1IV4A 2QYOA 3ZHCA 1NF3A 2ZULA 1VP7A 3D43A 4IIXA 1JJIA 1JEYA 3PJRA 1R88A 5LP6A 1LLQA 2D1RA 3HJBA 2H1OA 1ZMXA 3D4IA 4I4TB 1NVAA 3KR9A 3H9VA 1YTFB 2BH9A 1IPAA 1VQVA 2AEJA 2D5IA 3QV1A 1EGVB 2GO1A 2ZROA 5DYYA 1CYEA 1N6IA 5FTLA 5KC9A 3VHXB 4TKMA 5J63A 2CH7A 1EE9A 4NYKA 1M90W 5CDFA 3SKVA 5IYBO 1U2EA 3EVTA 3EHBB 1HEYA 2WFAA 2KLHA 1DKUA 1UXJA 4JOCA 3BPZA 4Q7LA 5DCLA 3VI4B 1VG1A 1GHTA 3RFTA 1MJ5A 1ZGJA 1X15A 3M6UA 4IH4A 3C3PA 5CX4A 1X92A 5B58T 5KREA 2DQYA 2PRZA 4EW2A 4FYMA 1XTJA 2P9ZA 4FYKA 4G0XA 1DFHA 3KT0A 2PNFA 3RLFA 2HVJC 2VA9A 1XF1A 4FYYA 4EHKA 1NYRA 4CL0A 2ZE5A 4NPAA 2SCUA 3HI6A 4HC4A 3UW3A 4CN9A 2IAFA 2Z3YA 2P91A 3D2LA 1EJBA 2Q28A 4DBLE 1X52A 5JZMA 3AG4B 1SQ5A 1POXA 3H1TA 3AFHA 3NT4A 2BEWB 2EQBA 4XRRA 5JD3A 3VNVA 2J4CA 3JX9A 1KJIA 2HUNA 5ETJA 4MXDA 1W5SA 2PX2A 3WAKA 1SZJG 3WZMA 4CR8A 5JNRA 4PGFA 2QNRA 1VB5A 4YH1A 4LIPD 1JE1A 2GTIA 2XAAA 3S68A 1DU4A 5IT9A 1NDUA 1SVWA 3ZWNA 5DECA 3F6EX 1LGYA 4RORA 2WNHA 4FNGA 2HDHA 2QA4V 2V5VA 4L8LA 4PZPA 3TLCA 5SYAA 4AAYA 2PXAA 3ZHRA 3B3JA 1GM7A 1KVRA 3D2BA 3FRIA 5H9VA 4J03A 3J7AR 2XSZD 3LCJA 2BM0A 2W6ZA 1HF3A 4G97A 1T8YA 5JC8A 1Y67A 1XVUA 1FTQA 4FNOA 3RQSA 1DIAA 1UR5A 2XOXA 4ZCLA 2AZXA 1Z2CA 3W78A 1ORVA 2BFPA 3NVIB 2OCXA 3JW8A 4WCFC 3HAXD 1SXJD 1TU3A 1XRSB 3RFUA 5KYWA 3OH8A 4G4JA 3RADC 2SKDA 1B8NA 3U4IA 2ODWA 4PHGA 2G0AA 1JXMA 5TQ0B 1ISHA 3OMXA 4F4UA 3K04A 2H52A 1YRBA 1IC6A 2FL4A 3E3OA 1PDWA 5LA6F 3E3AA 1N25A 1W87A 2IHKA 2YV4A 4BAGA 4B7AA 1U0EA 3JWJA 1WP7A 1MSWD 5KVAA 1XOIA 4MQBA 4WZBB 4TXNA 4MARA 3BZWA 4FGUA 4UDXX 2Q6TA 4PFKA 4EKWA 1T6NA 2BP7B 2OT5A 3ZDAA 1KFBB 4PNHA 3RTGA 3MYRA 2HA3A 2JS7A 2VP5A 3CB2A 1U0JA 1C9EA 4M4SA 4P4NA 3IEMA 1LSUA 1E7MA 2OZLB 4DR4O 3QOYA 4CS3A 4OHBA 4QL3A 4TSFD 5LJLA 1Y9ZA 4A10A 3P3NA 1IB0A 3SBDA 3VMMA 3CH6A 1YS4A 3ZZNA 5FV4A 3K2IA 5CA1F 2G5GX 3VSBA 1A2QA 1J49A 3K32A 5KC8A 4O08A 2ECPA 1KMHB 4U2BA 1OCOC 1I9GA 2AJBA 3P9NA 2H8CA 1G4HA 1NSYA 3SPHA 1P6QA 1QR2A 1VA5A 5IHPA 2WB4A 1SMKA 1ZLXA 1YCGA 1T9HA 1BWPA 3SC3A 4LDRA 3UT5A 1XL0A 1AQNA 3WA7A 1J06A 5MGNA 2ZINA 1BT8A 4B6RA 2WZCA 3CRVA 2BDTA 3U4MA 1KHTA 1TW3A 4L2IA 4B2YA 5EJEA 3IL2A 4FU0A 3WFIA 5JS1A 2VPTA 4KDEA 1NHWA 1UQRA 4DSNA 1DC5A 2VSOA 2XMGA 4IV5A 4X62B 1MT3A 2YQ5A 4O8CA 3VZRA 1QVWA 4JLNA 5G4LA 1H2NA 3LBIA 3LUKA 3IT3A 5D6OA 3EQ7A 3V8PA 1JFFA 4D4KA 4ZCRA 5L95A 3K70D 3N4YA 3EXHB 3O2SB 5GTHZ 1ZYUA 5LOVB 4JUCA 4GO1A 1UFOA 3IQEA 1V26A 1W8DA 4QDKA 1ZHFA 2I80A 4RU1A 2TMYA 5K3FB 5ALTA 3FKQA 3DDWA 3U4QA 2Z6UA 1FQOA 5FUXA 3RFFA 1WXDA 5D1HA 1KAOA 1RM4A 3IIMA 4KDRA 4A9AA 1NNI1 1Q1QA 4RTPA 1CUXA 3ZMZA 4L28A 1GQ2A 4QDUA 1Y33E 4JJIA 3T2MA 4BFXA 2AZ2A 3M7IA 3MWDA 5FPQA 4LYAA 5GV7A 1IZ7A 4F4IA 1PEAA 4QGBA 4BNUA 1Z6ZA 4TX1A 3B3GA 2HF2A 1KEVA 3CCVF 4B40A 3U7HB 1Y8RA 3LVFO 2BFBB 1P7BA 2FSPA 3H01A 3DVAB 3F9RA 3C24A 3GNQA 5IKMA 4B3DA 1FEZA 2GEJA 2YJ3A 1KI3A 2H06A 4I1RA 1GLVA 1DXOA 2VP6A 1N2BA 2RC5A 3W9YA 3QVKA 3WFZA 4BKQA 2YSUB 5A2QA 3BIFA 3I5YA 2I3GA 3V1YA 4YJFB 1N92A 2R96A 5HIMA 3SPXA 4FFVA 1IH8A 1YULA 1IJFA 1JVBA 2NUPB 1U1CA 4YJGA 4MR9A 2HY7A 4H13B 1VE7A 2GEVA 2IT1A 2XAQA 4Q9HA 3ER6A 3UWDA 4DADA 1AI4A 3CNHA 5MFZA 1R66A 1T1JA 2PRKA 1R6KA 2CUGA 2AJDA 4AJ2A 1G16A 2PUAA 1U40A 4U7OA 4UB6Z 2WHQA 2O3JA 4OVKA 3WOHA 2BZ0A 1UFRA 5IVDA 4Y2VA 3DDCA 1DAFA 2X40A 3LCRA 1EZ1A 1MH1A 4O1IA 4O4JB 2R1VB 5AKZA 5IARA 4HD8A 1FK8A 4IGKA 4DRZA 1KO1A 4LVUA 1EWTA 2XZTA 1E6WA 4NRDA 3W3ZB 3WA6A 4R41A 2HU8A 5EIFA 4YPOA 1R0ZA 1K88A 2H92A 1MDBA 4OX9O 1RSOA 1O4WA 1RWVA 2H3EA 2J0UA 3ICXA 1LB1B 3HFGA 4I1UA 1GUBA 1I7LA 1KMCA 2WHPB 1YRAA 2YRFA 4Y8VA 5JD5A 4DLXA 1OFUX 2TECE 4TWBA 3TM4A 1QIEA 4G1CA 4WFEA 4BYGA 4UCSA 5DK6A 4EFEA 3Q5DA 3SSNA 4HLQB 2MR5A 4QJBA 1KEEB 3JCZA 2GX6A 2XCIA 4ZREA 2HSGA 1BVHA 2G17A 2GB4A 2QDXA 1DEOA 2BFDA 2QRQA 5K8IA 3WNZA 1IXBA 2W8BA 4R2XA 4XIJA 5ALQA 2DR0A 2QMEA 5F52A 5G1OA 4EMUA 2N0SA 3I6ZA 3PZBA 4Y6LA 3W2FA 3CJRA 4C0SA 5CXQA 5JY6A 4NFHA 3E9EA 4ZI5A 3MHSC 1KAMA 3I56V 1B0PA 2B9VA 3LHSA 4C06A 1KJWA 3GCGA 3M1XA 2JVKA 3HCEA 3QUQA 4NK5A 5FULA 2H1SA 3RVRA 4K1LA 2C7VA 3QKRA 2AS0A 1L8DA 2H4WA 1TQDA 3ILXA 4LXYA 4S1TA 3MD0A 2HH9A 3ELWA 3AGQA 4E4EA 4C8IA 1FUKA 3IEXA 2PPVA 1FUUA 1TK2A 5IVPA 2PT6A 4MB6A 2ZBDA 5HG0A 3R7WA 1NJ6A 3K6SB 1IPFA 1E3SA 1P5RA 3CGWA 4L4SA 5TMBA 1XNQO 4O4HF 2F3PA 5HMMA 1R6TA 5K6AC 2NLOA 2ZJ6A 2LXNA 2OILA 3L6OO 4WBSA 3U7QA 5HQ3A 3F98A 1E2HA 4ZHQB 1AKNA 1A5BB 2C5GA 4D92A 2OV2A 2ODQA 1TUEA 5LD2C 3BJRA 3JD0A 1WXWA 3C9SA 1ADBA 4GZLA 5L4LA 2G4LA 1HTBA 1RMTA 3JQRA 1CUCA 1E60A 1NP3A 2P9HA 3AL3A 4M1ZA 4J0QA 4RIEA 1UJ5A 3K8QA 4Y6PA 3C98A 2EX3A 1MGPA 5F12A 5ADUS 3KLPX 1H2SB 2OESA 4TTJA 2NU6A 5I9TA 2JA2A 4CIYA 1N2HA 1IATA 1Z6PA 2DFLA 2H1FA 1GRVA 3L7LA 4M83A 3RVMA 4YXFA 3KIZA 1S5PA 5AVVA 1DAGA 4DMFA 5A5FA 3CCCA 3RGWS 1UC8A 1DBPA 4YGYA 1FMFA 1X80A 5IT9M 4L3WA 1A9ZA 2E4WA 4LHSA 1FE8A 2HV9A 3PUZA 1T4CA 2J0UB 4LGVA 4LNAA 1AF7A 2P6PA 3JZIA 1WBJB 2VFAA 4G4YA 1NHGA 1Y48E 2BR4A 3LUBA 1QRDA 1OLXB 4QU5A 4RVUA 4DN6A 4ACBA 2IM9A 2QUAA 2V8BA 3NDIA 4D79A 1ZVVA 4ZPJA 3LG2A 2P4QA 3DVLA 4LN1A 5DNYB 1TLTA 3ZIAG 4ZANA 3DCIA 4MMXB 5SV2A 2GH1A 1GGNA 5IDJA 2PLAA 2ZRJA 3B3QA 2WBLC 2F3QA 4WHMA 5B4UA 3LWDA 1T0BA 4BTVA 1KPHA 2AIZP 1MAUA 2HCRA 1ZK3A 4KZKA 4MW1A 4QOJA 4RLSA 4WY2A 4X63A 4CZ2A 1QH8B 3PNQA 3RSLA 3P2JA 2ZSDA 5KNCH 3VR1A 3EEYA 4DMLA 4DJAA 3ADCA 2R87A 1OWLA 3DQQA 1SU6A 1VYUA 5AYVA 1SOMA 5FNVF 3QKRB 1N32B 4NI5A 3ZU2A 1X94A 1X1BA 1R3JC 1ONOA 2G7MC 1KUQA 2I6RA 1A5AB 3G2PA 1XTIA 4OJTA 3FNBA 3LDEA 6LDHA 4JC4A 4S04A 4KPYA 1THMA 1X42A 3BG5A 3ZWQA 4GT1A 1P8JA 2WPDD 4N6GA 1UL1X 1BE0A 4WY8A 3FOAA 2FZKA 3S1LA 3H5IA 3WHPA 3GUUA 4F93B 2F55A 2VHWA 1GP2A 2FDRA 3BQNB 4WAUA 2BAGA 1U3WA 1P0IA 2DWQA 2VUUA 4YY3O 2RHOA 1BHQ1 3OEHD 4PGGA 2Z43A 1GDTA 4K8XA 3CCEV 4X5OA 1X1SA 2QR2A 1ZJYA 1Y4SA 4CLRB 1RW4A 2QX6A 3QFCA 2Y6VA 5BXZA 2MTBA 1XBLA 4B3TO 1BWSA 3I01M 4GC9A 2EILC 1AUVA 1ZXLA 2NXWA 5IKPA 1VDMA 3IRVA 5AVTA 4YJ2A 2DHQA 3F1LA 3PSAA 2NU6B 1LRKA 1RACA 2MYUA 1W4AA 2OCAA 3I1FA 3KJQA 4JBNA 3WLSA 2QKYA 5EZQA 4NEQA 4DTIA 1TVKA 2FOIA 3KHSA 4TYQA 4Y2YA 5BQ3A 2ZQYA 1FFTB 1CY7A 1IEQA 3O1JC 3UJCA 1VE9A 1GAXA 4FYPA 4XM1A 1O54A 2E37A 3ZGVA 4UM9B 1Z4JA 2W71A 4RK0A 1PQ4A 3DE0X 4BNLA 4K8OA 3B20A 4OYRA 1TAGA 4B5LA 4DREA 3Q3CA 1TTTA 4OL9A 4E09A 1GPKA 2QTNA 5ITSA 2VGNA 1IBKB 1C1HA 4NK4A 4L3OA 3RJ9A 1GY8A 1QVZA 2QWOB 4MW2A 3SM9A 4QOGA 3QVUA 2BTUA 3CU5A 4FFOA 1E1DA 1JPXA 4PGMA 1EFTA 5K0EA 3AV3A 3E8BA 4P84A 4WXHA 4D9HA 1N2CB 3ZDRA 4C3UA 1NPDA 3E7PA 3R9WA 3S99A 1KBOA 4CKCB 2H8PC 2KB1A 5CB0A 3R66A 2DBZA 5DBIA 3G9XA 2WSIA 3LQ2A 4PAWA 1V4NA 3JQ8A 5FI3A 521PA 1PNLA 1EWVA 4KX5A 1JSZA 3EGDB 2AXPA 2IIPA 4G6ZA 2Q8VA 2JEYA 4Q16A 1WZNA 3CKLA 4RO2A 4X1OA 4UUPA 4E94A 2EJTA 3UWMA 4D4HA 2QBYB 2I0FA 1CP9A 5HJ2A 4DQUA 3DE7X 5HW0A 4ENUA 2E82A 2GD1O 4HSEA 4B6EA 5IF9A 3N2IA 5K7SA 4FNAA 4WEQA 4TZZA 1GZ0A 4MRRA 2EWWA 3PEUA 3KCNA 4RD3A 3VPGA 4LJ5A 1OI2A 1N5JA 3MVEA 2WV7A 16PKA 3BFJA 2BMEA 1QYRA 3OQ1A 4WNYA 5JAZA 3M4SA 5LQCA 1G4UR 2BBOA 2D1FA 2CD9A 3D0KA 3GXOA 1CUVA 2KKWA 2ZUVA 2DPXA 5FPOA 3HM2A 3W7TA 2HGZA 3MMZA 4Y1EA 3VQVA 1WPXA 3LDDA 2UZ1A 3L84A 4LJ7A 3K31A 2MSEB 4G9EA 2PRSA 4YUXA 5IG2A 2IBZH 5H02A 2XW6A 3T1TA 1KNXA 1O57A 4QUDA 4A0SA 4OHMA 4C0JA 4RA6B 4YRRA 2E49A 1QB7A 1ID1A 1SXJB 5CX1A 2XASA 1E3WA 2EAUA 2QMHA 2FMIA 3ZMVA 5B6IA 4MW6A 4QXRA 5J5AA 3CCRV 1IQPA 1CFJA 1BIFA 2GNPA 4NCAA 1ORHA 2BKLA 3GJ0A 3FVVA 1NXSA 4OI1A 4OJYA 3WLFA 1CDOA 8LDHA 2A0FA 1RC0A 1KKUA 1GM9A 1KRWA 3HKEB 4BQSA 4FTWA 1VCNA 3ZQ4A 1LVGA 1OLSB 2P1ZA 4MCAA 2FUNB 4Q19A 4QQFA 1UFKA 2P6YA 3WWPA 1URFA 4YROA 5CA1B 2JI4A 5FD8A 1S3JA 1A76A 2UVPA 4TLAA 3D00A 5FBVB 1UAYA 2OQ2A 3U9TA 1A71A 1LBHA 4BRZA 5C53B 1PLJA 1UEJA 1OV9A 2JK0A 3D8SA 3GZNA 1GU0A 3OFNA 1HTTA 4YPFA 1Z63A 1NG9A 4PQRA 1DKMA 4Q9AA 4Z54A 4B3GA 3DYIA 2GESA 2NAPA 4E31A 4ZDIA 5HK9A 2HMWA 5C8YF 1XRRA 3MS2A 2DUMA 2ATKC 5JJ5A 1Q84A 2VDOB 3AXSA 3MELA 4EPVA 1D7OA 1UK9A 5JBIA 5JSZA 1OHHD 4OHWA 4MVJA 1H66A 3D4NA 3I45A 4XVRA 2D3TA 2OZPA 2XITA 3GL9A 2PBLA 4BIIA 2F9LA 1EGQA 3ZDQA 4AF8A 4B4OA 1XZPA 1AKUA 2OLEA 5IZCC 2QRVA 1XZHA 4CM4B 4P9OA 1USGA 3OCJA 3V42A 2J31A 1Z2GA 1Q0RA 3KWJA 2QD4A 3ZY6A 1BKSB 3O8OB 4FDVA 4UKDA 2C2BA 2RAUA 5JWOA 1COMA 3DCJA 4WACA 3AVXA 1S89A 2BGLA 3QTBA 1GDDA 1KEUA 2LUOA 3VPSA 1NBIA 4TOIA 4CZZA 2BCEA 2ETNA 2GYUA 3P9CA 1C7FA 4H18A 4JA2A 2XT6A 1N5RA 4HNRA 1HP8A 3B38A 4CM7A 3AP1A 1S1MA 2A94A 4U3JB 1LF5A 2C5HA 4HWRA 1K4DC 1CP3A 1NKVA 3C3DA 2I8AA 3EFOA 2R4TA 3CPJB 3QUTA 2CHQA 4OKSA 4LRWA 4ZPXA 1P6XA 3VU8A 3T1NA 3QVTA 3VC1A 1B1CA 2C2GA 3DO6A 1A9YA 3CLSD 3QHQA 4KQ2A 4Z9FA 1ULBA 5DN9A 3JAWA 4I6GA 5G0SA 1RQ2A 1L0LH 1ZOPA 1RWKA 2GVIA 2B2CA 2IYZA 3NIGB 3GELA 4JR1A 1FVFA 4MB2A 2CJPA 5ECDA 3Q8LA 4JLVA 3FB7C 3I6IA 2KBEA 4LK2A 3QK7A 3T3PB 2X1VA 1FOEB 2YYAA 2A4MA 2BEWA 1W4LA 3KE8A 3PJEA 3AINA 5L3ZA 2ZVDA 5A9RA 2Q50A 4NYIQ 1JPUA 2ZREA 2P69A 2YWCA 5TDHA 1FXSA 1YACA 1NP7A 3PQ8A 4Q12A 4ZDWA 2ZPUA 1NTKH 2R6GA 4CT0A 2QKCA 1DRKA 1MVLA 1ZD3A 4WW0A 5JSZB 4JJFA 1C9MA 1VA4A 1JQKA 3C14C 4JWKA 3A0UA 1K8YB 2ALEA 3T4EA 2IVFA 1ZM7A 2QWQB 4K3UA 2E4UA 4RHYA 2JI8A 2HIGA 4F6EA 4IH9A 3BCRA 4QU9A 3W90A 5L40A 2ECFA 3K1AB 3EUAA 4MYRA 4OL0A 3WJ1A 2ZE7A 3CLUC 3WLHA 3N8IA 2EFHB 2O3TA 1CDEA 1R6UA 3FYUC 4AZ0A 2R2GA 4J9VA 1T5EA 4BQQA 2GAIA 3LP8A 2V4UA 4KITB 3EPLA 2BOCC 3WHKA 4DC0A 3D6JA 3HDQA 3ITNA 4NCXA 3ETCA 5FFNA 5B1DA 4UCTA 3Q11A 5FLXM 3S81A 4AHCA 3NAGA 1JPNA 4LVOA 4XVHA 3DKPA 1M1YB 2QD3A 3GFOA 2N46A 4YIHA 3TCUA 2GT1A 3ROZA 3H2HA 2YASA 4PG8A 1QC5B 3WJQA 2NADA 1KMHA 1JHUA 4DEXA 3QPUA 4RDCA 5MDHA 2ADPA 4P83A 3WRYC 2Q9CA 2QN6A 2FQXA 3QPAA 3GFGA 1JLRA 1G0OA 1UBJS 3LPDA 4EY5A 4UV8A 3MJVA 1YRQA 2HO5A 2JGFA 3JY6A 2GPSA 3O3NB 3IAEA 4IRUB 4ZVOA 4XVUA 1BEUB 1YBAA 1LW6E 2O8CB 1V25A 2JCGA 1GD1O 1ZQ9A 4HVAA 5KYXB 1PE0A 2DQSA 3O8BA 4ARUA 4CQJA 5JDCA 2WA4A 4U7JA 4JLSA 1K8QA 2VH5R 1G7RA 4N7BA 4AFNA 3APQA 4A23A 1X14A 3ZE2B 2O3SA 3PPWA 3PPIA 1JIKA 1Q7BA 1SCAA 3ETHA 4TQGA 3SR3A 5JAIA 3K9NA 1Q6YA 3LWZA 3CVXA 2FP3A 2KG7B 2WJJA 1I6WA 1ML4A 3HWRA 3ICCA 1JDTA 1U8FO 3KFLA 4PZEA 4RH0A 5TQVA 5CA0F 3D9QX 1CZKA 4V0KA 3O38A 5E0KB 2ZJYA 3ZDFA 7GPBA 2MINA 4XR4A 5JZOA 3ZH2A 1U9IC 1LXCA 2R85A 3L4BC 2X42A 1V9LA 3OOHA 4MCHA 1NVBA 4MVJE 1G291 2CMFA 4FLUA 1YS7A 2CNKA 2DPYA 5K3AA 2ZYAA 5FHQA 2DYSC 3MS7A 1Z0KA 3FBGA 3LQRA 4RYDA 5REQA 1EFRA 4F4HA 4PC6A 1GN6A 2OGWA 2Q1SA 1EFRG 1ZK2A 2RK3A 2Z30A 4JZYA 1WMSA 2PGOA 3D01A 4L22A 5DHTA 4J3NA 3ZXYA 3PRHA 4EJSC 3VTAA 5BVHA 2Y05A 4IYHA 1UJMA 2RD2A 2P1DA 1P9RA 1JR3E 1WMDA 2FRDA 2QT0A 4FHZA 3QUAA 3IMKA 2QTVA 4KE7A 3H84A 2NZJA 3Q5EA 5I9SA 1EWQA 1SC4A 2ZR0A 3EHDA 2FF7A 1S2MA 3B9RA 2XE4A 3LWBA 3RT7A 3GLIB 5MHTA 3I3OA 2G07A 5A02A 1GTSA 1B41A 1JEQA 3EFHA 3H86A 1VQ7F 1XWIA 4IDEA 4BO5A 1P60A 2GS9A 1XROA 1CP2A 3G5TA 3H1FA 1M7BA 1V16A 1MG1A 4L5JA 4DUZO 1X1RA 4BVFA 1C1DB 1NKSA 3FMGA 1H1LB 2BSXA 3II6X 4FIPC 1Z2EA 4IXNA 4OXYA 1LSSA 3H8SA 4MW7A 4RCZA 1LWNA 1YL6A 2AJCA 2O07A 2SICE 5F5NA 4AY4A 2GZDA 5HRAA 4CCSA 3LK6A 4L15A 3VQWA 3LSTA 1O5IA 1LC0A 3FAKA 3GAMA 3GLTA 2P8JA 3A9CA 4ZI7A 3GT3A 4EYKA 5E1OA 3RAEC 4IHQA 1T9GS 3HR0A 2LCIA 2IE0A 3BL5A 3JSNA 3OJFA 3RUPA 3E8HA 1FPQA 4S1WA 4GMKA 5K99A 5BO5A 3K0CC 4MMZB 2DYSB 2X0LA 1N7IA 3B89A 2BGUA 5EL0A 4BQRA 3G2OA 2XUZA 3P9RA 3OQ6A 1XTQA 2OXFA 4IG9A 4W1PA 4WZAE 4CLHA 4DMKA 3K0SA 4LOHA 3QPCA 5KQLA 2Q7DA 2MMGA 2VDJA 4LXHA 1UMDB 3UJ3X 1ILWA 2NSJA 4RDHA 1XHOA 1PZNA 3MGAA 3P2KA 4KP7A 4OQYA 4QXMA 5FF9A 3ZBTA 4M0CA 1TAEA 1ENPA 3O65A 3ZCCA 1G64A 3BKXA 4DQKA 3FGOA 1VPEA 4E88A 5BY2A 4IEFB 3UK0A 4N3GA 1XJ5A 3R0VA 1Z5NA 5H2FZ 2IYSA 2ZG6A 2ZIOA 2I6XA 3T5AA 2PFGA 2B33A 2PD4A 4I66A 1KJJA 4B47A 4YRDA 4ZQEA 3QZUA 3O3CA 1XUQA 2BFDB 2ISCA 3E84A 5J47A 1CUDA 1QQAA 3PRKE 1X1TA 2IHNA 1XMQB 3TB4A 4BQEA 2Z8ZA 2GVNA 1IOLA 3VQXA 3OZGA 4HEQA 1PZXA 2HA2A 3FX2A 3A37A 3GJTA 3RVNA 1AA6A 1IVNA 3E53A 5KDDA 1OI3A 1A2OA 1G63A 2JIMA 2PH1A 1V71A 1NAIA 3AESA 1UPBA 3HA3A 3I2KA 1DF4A 1Z0ZA 1AS2A 1ULZA 2GCNA 4KQEA 4GL2A 1I0LA 4E22A 1P84F 1W5BA 1ZSPA 2I3BA 2WEKA 3F3KA 3IAM1 3ZXXA 1N6HA 3TRIA 2WU0A 2YXDA 1EM6A 2GZMA 4GOND 5EJGA 5C5DA 3U13A 1JEOA 4XXHA 1X25A 2D7JA 3I53A 1F9EA 1V54C 4YA6A 2GAJA 1NX6A 2I6QA 3U7QB 1EK0A 1WD7A 3C3WA 2VF4X 3GLRA 4UEOA 1YCIA 1H65A 1PR2A 3DEYX 2JEZA 1DRVA 5T67A 4ZI7B 2NPIA 2NZYA 4B3RO 1F17A 4RQEA 2BGMA 3DKIA 3W34A 3BJEA 4TKUA 3KE1A 1Q8IA 1WBBA 4J9YB 3DONA 3HRHA 3EARA 4ZAXA 3OR6C 3T12A 1FX0B 1KIAA 1CRQA 1SJ9A 3PQFA 4NMWA 4FE7A 3VYUB 3D6AA 4FC7A 3DDOA 4N21A 1B0ZA 1CERA 4I5IA 4XI9A 1MQ8B 1RC8A 1YS2X 4CXMA 3CYPB 1M0SA 1RBQA 2W6MA 1OLUA 2R8EA 3OD1A 3OTWA 3QELA 4TSKA 5BR4A 3TF5A 1E7YA 2Q7GA 1L4EA 5BXYA 2A9KA 1QH8A 1PG2A 1NURA 2X4DA 3VPCA 2H7VA 2RJ3A 3HR7A 2V3CC 4UZEA 2VRNA 5ALVA 3IOMA 2QWNB 3CCRF 1U9IA 2RK6A 2IC5A 3P0JA 1P5HA 4BB0A 1E94E 1SIOA 3EDRA 1Q22A 1KJNA 4H7EA 5KQMA 5CK4A 1F2TA 4A0HA 1QIHA 2CVQA 2HB6A 5DW3A 5EXTA 4KMSA 2W2LD 3L6RA 3FPKA 4LZAA 5HCIA 3TD5A 2LCFA 5AI0A 3BGOS 5BVGB 3O8QB 1BH6A 1C7IA 5H1YA 3W06A 1VRCA 1N9KA 2QW0X 1SHUX 1TYDE 2PKEA 2CMDA 2WT8A 3ND7A 4R6WA 3IUJA 3VI3B 2V6MA 4MWTA 1Y6ZA 4RVCA 5JXIA 3LP6A 3A32A 5C46F 4Q4JA 3DEIA 5I7HA 1HNZO 5EC2C 1RZRD 2QJ1A 1I8TA 1JG3A 4I7EA 4WUTA 5ALNA 2VEDA 4GUNA 3LT1A 1CWUA 4DR5O 1ZKMA 3HA5A 2W6JG 1YCDA 2JHPA 1YVPA 1TVKB 3W7WA 3SGIA 1EDEA 1M6NA 4MR8B 4MWGA 1EFHA 5IEBA 2DLDA 3IAHA 3E3MA 2KJQA 1WPRA 3RWOA 5BRAA 1HETA 2L18A 2ODBA 3AG6A 3B70A 4MW5A 1C0EA 4X24A 2XMCA 4OHKA 1HTWA 1PT8A 1FKAO 1Q3HA 5JVDB 4U6QA 1YRHA 3TLBA 3MF4A 1BZYA 1T2CA 1FTYA 5IP5A 1D5AA 1HG1A 2P2ZA 4HWSA 1N9ZA 4G5XA 4XCXA 4UMFA 2B4KA 4KB5A 3G5LA 3A8TA 1CU1A 4PV7A 4CKXA 3QG1A 1Z0SA 5EFOA 4PQGA 1YHQF 4ILEA 1AHHA 3M4ZA 4JLOA 3PDWA 3KSBC 1B0UA 1J7JA 3ABKB 4GI7A 3VOTA 3JS5A 4XX0A 2XY4A 3UXYA 1WCV1 1LI7A 2BF4A 3IBYA 1TLFA 4K0KO 3DM9B 3IELA 3GEBA 1QVGF 4G1FA 3HFJA 4RUFA 1L5QA 2XCTB 1SVKA 4RZIA 2HJFC 4OGKA 1M93A 4MK4A 1BMDA 3NTUA 5E95A 3TN7A 1JQDA 1S9HA 1VHTA 1TZ2A 4L5AA 5EC8A 2YMQA 4BWFB 3I58A 3IURA 5DHAA 3CXCF 1YQGA 3HY6A 2Y71A 1H2WA 1P0QA 1QORA 3FN4A 4YUWA 3UF0A 2IZZA 5IDXA 1B04A 3KXIA 1G6OA 2EJRA 1QCEA 5DYTA 5B8FA 3FCYA 3D7KA 5FJ4C 4LYJA 4X41A 5LBTA 4B76A 3UPTA 5JXWA 4Q5IA 3SQLA 2ENUA 2ZSIA 1KHHA 2WR8A 4EOGA 5JJJB 2VJYA 4GR4A 4OGLA 1EEHA 3JQBC 2OHWA 3JR7A 4QG3A 3E9CA 1T24A 2CSUA 2VHZA 2C9DA 4BGDA 4YC7A 3FPCA 3UATA 1J33A 1Q6IA 2PTGA 1ZAKA 2NPOA 4G36A 5LMNB 1VL0A 4PIPA 4RSRA 4UCWA 2D59A 3VPAA 5TISZ 4F5YA 3QTTA 2ZEJA 1H0KA 3KR2A 5H83A 1JTEA 1XEFA 2VDWB 3LLVA 1MAHA 1WHSA 2AKAB 3FPHA 3ML1A 4D9JA 2QD2A 3L41A 3JASB 2HIHA 1YQWA 2PQ6A 4YHHB 2XOEA 2QZPA 4FLMA 1H6BA 1VE1A 4UBJA 4Y6OA 5B2ZA 4AF7A 5F98A 3KNZA 3LHFA 4GRIA 3E5RA 3W5CA 1M57C 2WSSG 4DK0A 1CE8B 2CFOA 4MIOA 4H7HA 2DC1A 3PJGA 4US1R 1Y3DE 4ENPA 2TMDA 1SHTX 1Z0IA 2CVHA 3C7KA 3CWZA 1K5DA 2OC9A 3L04A 4FMCB 4BB6A 4GYWA 4EGQA 4NE7A 2PGXA 3HUFA 4N0MA 1XDUA 3AKDA 2O8BA 1OLSA 1TUBA 1UIMA 3LDTA 2QN2A 2FW8A 2SCUB 3H1JH 1R6VA 3DMDA 4LA4A 4NU5A 3O4JA 5ERGB 3UZUA 3VBCA 1E3WB 3V7FA 4G0MA 2RGNA 4PFJA 5ESXA 3UV3A 2J5BA 4G4SP 3DZ8A 4XJSA 1GPWB 1ZSVA 4D41A 3QI2A 4DM4A 5KKNB 5AW9A 1EESA 1EJ0A 1I4LD 4C0LA 3U10A 2FWIA 4E15A 1N77A 1Q90D 5EQDA 4EBFA 3U2QA 4QPZA 4J2OA 2IS4A 2ZNIA 3NTVA 5B3JA 5TPZA 1KRXA 4R6XA 4UFZA 3FLEA 3KWMA 4D3DA 4MLZA 1FTGA 3KHUA 1RSZA 2HLDD 2I91A 1DJPA 5LGTA 2AEMA 2CFSA 3KUKA 2C7GA 4RPCA 4HDRB 2ZTVA 3G13A 3NQ41 2J0EA 3RIEA 3ETLA 4B31A 4E2ZA 5HKKA 1ZINA 5KYUA 1ZXXA 5BYAA 3E7XA 1P4GA 2DJIA 5C93A 3DF7A 1VKNA 5E1BA 3ZGXA 1MGOA 3OFNG 2GRJA 3DV2A 4CV0A 3TSYA 4NLLA 4DHEA 2QQ5A 4OQQA 4QTTB 3EXIB 2I2FA 3K0KA 4P5DA 1T4GA 4BEVA 3JTEA 4P0QB 4KKVA 3RQIA 2LV8A 3AUKA 4IQ4A 1ABEA 4P3OA 2E89A 2EIXA 3P94A 1VCHA 3IUMA 4TV9F 4ZAFA 5KDLA 3WGQA 1F23A 2RH9B 1P1FA 3CVUA 4R5HA 3TLXA 1Q43A 2P4EA 1V55C 4L6CA 2WSLA 3SBOA 3HDVA 2C2KA 4MS1A 3WGZA 5U4XA 3MYYA 1ZBDA 2EBOA 4Z0NA 1FS5A 1OJ7A 1VL8A 1XRQA 4FCWA 5FWAA 2M6LA 2C2ZA 1FRFS 4PR3A 4PQEA 1C2YA 3Q4HA 4RVOA 3RK1A 3Q9UA 1UINA 2HVYD 1R1DA 2BP7A 3Q7IA 4ZVLA 3DNFA 4R54A 4DIDA 4AG3A 3HO1A 2BV3A 3N4ZA 4RFVA 5C5IA 2PGLA 1CQZA 2JCVA 2VL7A 1X7XB 2PZJA 3OG9A 1OAOC 3LYAA 5DI3B 4WDRA 5E1DA 3Q8XB 1BWRA 4P9NA 4PTZA 4KQFA 3GEEA 3KJGA 4GI5A 2GM4A 1DK1A 2OGZA 2C5FA 3HLKA 1KD1W 3RT3C 4EATA 5JMTA 3RIGA 2LGQA 1V55B 5KWSA 4TLCA 3I83A 3KQWA 1G2OA 4WKGA 2O0HA 1DC7A 5JBQA 1R73A 1JXQA 1YGPA 4MUNA 2I62A 1KKDA 4BO7A 4E3WA 4E4RA 4EQ6A 1NN5A 2FN7A 4TM7A 1SC6A 3GVXA 4EB0A 2B5OA 1DQYA 4N18A 5KNLA 4P38A 4G0UA 3RYIB 2W48A 5DGDA 4JLAA 5F9FA 5EEGA 5EWLA 5I9LA 1P81A 1DWPA 2LBWA 1VIMA 5EXXA 2KE5A 5DTRA 2ONCA 3D3JA 4IIBA 2OWOA 4DAOA 1W4CA 2IK8A 1WW2A 3T5GA 1ZD1A 3ZGYA 1CIPA 3UHPA 1EXMA 2JPDA 5C1IA 1XXHE 3HGTA 2J5QA 1VL6A 4OXXA 5F7ZA 1QVAA 2YNMC 1XDGA 2G71A 2B4TO 2P7HA 2JRIA 2OWDA 1U2TA 2HYDA 3Q87B 5KNCD 4CEIB 1ID8A 4GSKA 4K05A 4C1BA 3UOWA 3DMPA 2O5RA 1RZVA 2Y1OA 2PXHA 1T6ZA 4MQFA 4ICIA 3EWSA 3QX7A 5AH0A 5FR2A 3AONB 4F5DA 4BVKA 2XCSB 1Z45A 1XNHA 2J8ZA 1KZ7B 1B8OA 1EFUA 3CINA 3PSHA 4FKBA 2CLKB 4PI0A 2D0PB 5KS2A 5CBGA 3X43A 4M7WA 4RZ2A 2GBLA 4XWGA 1P80A 4O2BF 3REQA 5I9NA 2BFBA 3DEJA 3NDJA 1PL0A 1SU4A 1VBNA 3GZTB 4JD5A 2F1IA 4YRAA 2GJAA 1YIOA 4EL0A 2ZYHA 2P6MA 1XA4A 3VKGA 1PF5A 1LJLA 2HJWA 3LHKA 3QE9Y 3L9DA 3OX2A 2R00A 4BKUA 4EWLA 5CA0B 2AOVA 1HEUA 4YUYA 1MTOA 3F0DA 2BOBC 5ALDA 5KNDA 3CNLA 4ZZ3A 1O95A 3DHWC 1S8NA 2XQGA 2OD7A 1HNXB 4GXRA 3KVOA 4L4UA 4X6LA 4EAQA 4ZT2A 4G2KA 3TCKA 1XKLA 2QVXX 3UO3A 4XLTA 3E23A 3RNOA 4MUEA 5DJ5A 3VJMA 3GVHA 3WLOA 1YZKA 2HPZA 1VECA 3NHRA 3KOYA 3JALB 4XPIA 3CXUA 3E0XA 4AP5A 3TAHA 1ND6A 1NQXA 4A2QA 3OR7C 9LDTA 3IJ4A 1WHTA 5CH5A 2K2WA 4HUTA 2W2TA 2OBBA 3L1KA 3VOUA 3SIPA 3E1KA 4G37A 4M9CA 2PQ2A 3LX6A 4HRYA 5LZ8A 3PXGA 4WH0A 4AO7A 1U97A 3L75H 1K66A 4PIMA 1J4AA 1P4RA 3WGIA 4GRAA 3OM1A 2EEPA 3DZCA 3KOMA 1FXKA 1N0UA 2IJJA 2BE9A 4CFZA 4QGAA 3TW6A 3OWOA 1KFCB 3GI1A 1EHCA 4HWPA 2ZWOA 4BV9A 4I2NA 2W70A 2O50A 1UJ4A 1PW5A 2PT5A 4DMCA 4ZYXA 5HOEA 2HXYA 2KQXA 3NKVA 3DZFA 4MA5A 3RT9A 2MK3A 2AJ8A 4X1YA 1XNRO 2ATIA 4UBLA 4XIGS 2JGNA 3DLBA 2AOWA 3EDYA 5IMSA 3R6LA 4MJ3A 2A9OA 2I71A 4N39A 3V8MA 2ZT8A 4RUEA 2QP9X 2E6KA 1H6DA 1XCMA 2C9ZA 3TL3A 3OTFA 2PKWA 2A67A 2XTMA 4XQGA 3VQTA 2YIMA 5JWPA 4WN3A 2LPMA 1H47A 1H1LA 4X71A 1NXVA 1W88A 2PKCA 1X74A 2RBEA 3KQPA 4ZQHA 3ZBUA 2WC1A 3S55A 4TQAA 1KYVA 4AYTA 5F7XA 3V8RA 4FHFA 4UUAA 4QYSA 1XL4A 3H1IH 1JIVA 2WYWA 4LJSA 1LU9A 4YQEA 4J7CA 3BRSA 5CT9A 4FZVA 4E1BA 2REOA 1H2EA 1OBOA 4WOPA 1KI4A 1V7CA 5AHWA 1MABG 4LF7B 1CFZA 1CR0A 3KJIA 3O75A 3P9XA 3PFGA 4ZZ2A 5A0FA 5LNK6 1JJOA 1UPUA 1WS6A 1Z6YA 3BRWD 5A3VA 5EHXA 1GGMA 2FX5A 4IGFA 2EKQA 5FOXA 3QXCA 5IAKA 4IDOA 3RSCA 4B6SA 5L4NA 1BFDA 1WXHA 4D9NA 3AG2B 1O97D 4Z2YA 3DT9A 2WJAA 4A8JB 3TFOA 5F2OA 1GMGA 4V2UA 1NTZH 2J30A 2W5UA 5EMJA 4OHZA 4B6OA 5AUNB 5FWYB 3U6KA 3PUVA 2JDIG 4IV0A 1SERA 3DWIA 5DKFA 3ZIAA 2CJFA 1M10A 5EE3A 1MABA 4I5FA 4CM6A 1QYIA 3K92A 4YDSA 3C43A 3TIVA 1B00A 1U0SY 1T3SA 2Z1NA 4JEIA 1XOUA 3TIFA 5C32A 1NP6A 1MO2A 2P2GA 2REQB 1P1BA 4KACA 5AW2A 3DC6A 3C4JA 1GQSA 6ADHA 2DFKB 4X1IA 4JL5A 1CEQA 1H93A 1J20A 5I3CA 2XVYA 4IBOA 1SZTA 5KCMA 3LX4A 2QTGA 2R7LA 2IPLA 3KPJA 5IC4A 3DTTA 5LA6B 1HXHA 3FAVB 1CDDA 2IXTA 3R5HA 3I6BA 3RBVA 4LJRA 1QU9A 4GPIB 2HCJB 2Z4RA 2ZU0C 3EIQA 1CRZA 3F8WA 3H4IA 3IAFA 3W7UA 1VMAA 1YAHA 5EBLC 1DWQA 3H04A 2EHJA 3G9ZA 3LFTA 5LBQA 1COWA 1Y7HA 2E87A 2OORC 2ZJ4A 1ESMA 1W3EX 1BS9A 1IQRA 4YDRA 2Z1EA 4BTEA 3CW2A 2WY2D 4PGAA 3GVCA 5DBHX 5AOAA 2VOEA 2BLNA 3H9JA 4P8RA 2DYYA 2H51A 2PWAA 3ZQKA 3CLUD 4AN0A 2NTVA 1QYWA 2GPYA 2HMSA 3OECA 3TVYA 1DUIA 1M1NA 4C0HA 7ADHA 1ZESA 1ZUWA 4ZDJA 4EY8A 3G4SV 3GY0A 1RBMA 3A4IA 3DMRA 2E5LB 1M8JA 1OY1A 1X7WB 4KV7A 5K03A 4Z2WA 1RXSA 3GYBA 1ZUD1 4G0QA 3WYCA 2F95B 3IBCA 2HPVA 1F8YA 2XUOA 4NH0A 5DEOA 1QLHA 1D09A 3WISA 1E2IA 3B1VA 4KO2S 4GDMA 3HXLA 4J07A 5F33A 3TW0A 5CNJA 1BHO1 2LTAA 2P9YA 1QHHA 3FVQA 3ND5A 4RGYA 1FW6A 4Y6SA 1U2RA 5EP1A 4BWVA 1OCRB 3DXRA 3EZFA 3MWJA 4PCUA 3IMFA 1TAUA 2BM9A 3WRWA 2HA7A 5T8KA 3QHDA 2JCBA 1M8PA 3OA0A 4RLFA 1KSFX 2QA4F 2J7PD 3ZIUA 1P9LA 1P7CA 2W8ZA 5DM60 4JU9A 2XNSA 3EDQA 2DQ3A 2ZVZA 5JEDA 3MCVA 5DX8A 3KB2A 1S96A 3JCMM 1XMJA 2P3SA 4HBGA 3SYLA 3KZNA 3LUJA 1TA0A 4NIMA 4EZEA 2JK1A 1JEEA 2PG3A 2OSBA 1BOFA 3EY9A 1Y76B 2G40A 1XMOB 1GZ5A 4D43A 3ZV6A 3DOHA 2QEXF 4G86A 3OM0A 3WJAA 1FDWA 1XQWA 4ALMA 1OV4A 3CRW1 4BWYA 3NWOA 4FYHA 4M0UA 1XIVA 3BXOA 5ICGA 2GBGA 3QY9A 3NBMA 3ZNPA 4FGKA 9LDBA 1YC5A 4QJIA 1OWOA 1ONPA 1A04A 4RLQA 4Y9DA 5EPEA 5TT0A 4I50B 2QL6A 5BW8A 5JDIC 4MQ5A 3LBFA 3VR2D 1N2GA 4JS0A 1K7FB 3UJHA 4JP5A 3D3QA 3EORA 3TX2A 1KAQA 5J4KA 4IP0A 1PWEA 4HRXA 3G8AA 4QO8A 1ZGZA 4BBZA 1CUAA 4O3MA 3PX2A 4BC0A 1VQNF 3JRWA 5CVCA 3S0JA 1IEVA 1VG8A 2OG1A 3NT5A 3GUYA 1RRCA 1WEHA 2WUDA 3O8QA 4CVNA 3IJRA 4K46A 3V4LA 1OFIA 3KC2A 2CL6X 4GR5A 4BP8A 2HRRA 4D3FA 1OV6A 1XDWA 2ACWA 2Q6AA 1P17A 1ZNZA 2X4IA 2Z2KA 3TZLA 3MJHA 4WV3A 1W47A 4R68A 1T2AA 5K3FA 4LRQA 2AA3A 1R0XA 4HP8A 2C7BA 2JGLA 3VFDA 1T0AA 4BECA 3HACA 4FYXA 3NYWA 4IIDA 4RMIA 1BA3A 1CVIA 4BN4A 5IZ4A 1GA4A 1T2EA 1A8UA 1NZDA 2XAUA 3KFVA 3LY7A 4GLFA 5HS4A 3TUZC 5BNIA 2IW1A 3HNRA 4PR0A 4ENRA 4TZ0A 3R8CA 3PJFA 2C31A 2G25A 4M53A 3SMVA 4CE6A 5JJBA 4IX1A 4LJAA 4QRHA 2WLMA 5AVWA 2V54A 3H5OA 4Z5XA 5LZ4A 3UA4A 5PGMA 4MQLA 1G20E 1WZIA 3G7SA 4MPPA 4UVIA 5BN4B 2H59A 3IP1A 4TVOA 1NBMD 3WMRA 1IHUA 3EBLA 1L5ZA 1A2BA 1VE6A 4P4UA 4FCTA 4P33A 1RM0A 4K9DA 5J4LA 5KAIZ 1H1DA 4Q34A 4YY3B 1P7YA 4OGQB 4Z8XA 5DLQC 5T41A 3SR0A 8GPBA 2HCTA 4EGAA 2Q1UA 4PPYA 5LQKA 3JD1A 2ZYIA 2J09A 1J0AA 1OCEA 3KBOA 3LPLA 1QKKA 1B6QA 2Q6KA 2JJ1D 3CUVA 2LP4Y 3K9GA 3S8YA 1W36C 4YMIA 1FPOA 4LBWA 3CIFA 3LDCA 1UBGA 4JTDB 1QAOA 2VPYA 1QE3A 4I50A 3OMAB 3WFVA 3DBIA 1I33A 3VZDA 4AMVA 3THWB 2YVQA 4M99A 2WOJA 4GHWA 2WD7A 3U3XA 4BMCA 2H1WA 2WQ7A 1V7QA 3ND8A 3AJEA 1MOZA 2IIVA 3RA5A 3BL6A 3O4IA 4FMDF 3AFMA 3M5DA 2WK1A 5K0NA 3VU3A 5KHIA 3V8VA 4IFEA 3MJTA 2Z2JA 5E9JA 4UOEA 1E0JA 1KK2A 5DP2A 3VKWA 4NB5A 3L0CA 1DLBA 1AC5A 1VOTA 2FZLA 3OZXA 4GYJA 2WVGA 3EF1A 1JJVA 4PDMA 2Y0IA 3PB3A 4M86A 1Q3KA 4GW3A 1PSZA 3GAZA 4G0OA 4B74A 1YCFA 5A6VA 3R3JA 4OI4A 3L7CA 2AG1A 2YVKA 4OJMX 1S2LA 2HSEA 4XYBA 1FMTA 4MV7A 2I2AA 2R79A 3ZHBA 5L3SA 1WABA 1P3JA 1HK7A 4R2MA 4WOCA 4KLAA 2HKIA 3EF3A 3GA0A 3GJYA 2EC5A 2AUMA 2XNJA 4W5RA 1EQ2A 5EB0A 2JFNA 3Q8HA 3I04M 3LT0A 3R9IA 3UJ8A 3WL8A 4AJHA 5JNUA 3CLRC 3L5OA 2VJLA 3JSXA 3WLLA 3KPYA 2F43A 5K1ZA 1M73E 2RGAA 2EINC 4LOKA 4P22A 1RKUA 1P74A 3FDZA 1R5BA 4KGXA 1YR6A 3QTLA 3TNJA 3W5JA 2PH7A 2XMPA 3T3HA 5E3IA 5F5LA 2QDKA 3R24A 2TMGA 3LYUA 2R00C 3ABMC 5KUMA 2PLNA 4IIJA 3ENQA 3P45A 3BXHA 2WTAA 3G2MA 2YN2A 4GLJA 1KDZA 4AM8A 3IYLW 3K5MA 2HBZA 1G1AA 1WV0A 4PLFA 5D8DA 4QRIA 4X93A 3U5ZB 4WA7A 1DAHA 1VPTA 1UPXA 4CDRA 1VIYA 4L4RA 4F8YA 1KMQA 3K70C 1I7FA 4CIAA 1V8ZA 2IJHA 1WKVA 3FYUB 5EZYF 1KY2A 2CNDA 3WIDA 5KVQA 1N4AA 1LDBA 2DB3A 3LI2A 1LPPA 4BL5A 4LHYA 2FWAA 5TGDA 5CCEA 1COWD 2HX1A 3AH8A 4CIDA 2Q69A 3DSRA 3D5EA 2CYCA 3EQ2A 1QQCA 2WWTA 2PGIA 1SUWA 3ZP4A 1R9NA 3HCNA 3NORA 1L8QA 4GOKA 4Q9KA 5K8CA 1CQXA 4NFYA 4IVPA 2BGGA 4FCVA 4EIWA 1IU9A 4UTRA 5M2QA 5BV8A 5JRDS 1L8AA 1FNKA 2FPWA 4GVLA 4QBKA 4XSHA 2IE8A 2YWXA 3KU4A 4GEGA 1T8TA 1U8YA 4MUKA 3JZDA 4JT4A 3HI4A 1O89A 1W48A 1UQUA 1VYVA 1KR2A 3S0YA 2AG0A 1ISJA 3LBYA 3ASNB 3GRPA 5NULA 2AF3C 5BMVA 3A1SA 4S0XA 1N2CE 3TSAA 2O2JA 2F23A 1ZI8A 5LM3A 2MSCB 4KHPO 3JQFC 4A0FA 1R3DA 1J1IA 2OIEA 4LOJA 1CJTC 1E6MA 5K4GA 2D8MA 1KZ6A 3EZ7A 1T8UA 2MJLA 3F49S 3OE7A 1NRIA 1ROPA 3OHSX 3R6TA 1L1RA 4G1EB 5EB1B 2C9BA 1TZCA 5HJEA 1FP7A 4UHCA 3HYRA 3ZZ0A 3GHZA 4CJXA 3KKQA 2OTLV 4H16A 4OG2A 5F9MA 1BD3A 4DR5B 2XMSA 1Y4AE 2AN1A 1CZRA 4P0PB 5JSUA 1R8XA 3O9VA 4FUQA 3OQIB 4YIKA 5HXZA 1V1MB 1YR9A 2FY8A 1RC1A 2ZYGA 4ZIRB 5HHTA 4DDUA 1W96A 3A4LA 1QRAA 3B2EE 1PJ8A 3R20A 4KIUA 4PC7A 4WLEA 4FUTA 4DZTA 1VSVA 3WO0A 1YL7A 3ZDEA 3R0XA 1GN9A 1X7XA 3OZDA 4PRYA 1LSJA 3TDKA 3I30X 2ZWMA 1MX3A 2CHUA 3F6RA 4E2WA 4UARA 3IQDB 2A7WA 3CN7A 3UGJA 1UBRS 2IP4A 1WDWB 4OXIA 1KQOA 3BHNA 3TK1A 3P0FA 2HS0A 3VYSC 1VPWA 3G8CA 2W0FC 2XH8A 2O8EA 4X6YA 4B7KA 2LBPA 5GP1A 1XZBA 4PW0A 5ICFA 1K3UB 2IYTA 1BGXT 3QHAA 1GV0A 5AW1A 4BNFA 2VKQA 2XDQA 4FOPA 3RRZA 4E08A 1G41A 4U8GA 3BJIC 3AHEA 3U3RA 2NP6A 3BYZA 2VT7A 1U7PA 4JQSA 1QYCA 2G1AA 1VXRA 4RIHA 4NATA 4URFA 5JI3E 3ENWA 5CB6A 4P7KA 5L3VA 5CGZA 1ZR4A 1JQ5A 2AOUB 4A0RA 2ZR2A 1NZFA 4GQBA 3FUWA 2V5AA 2J48A 2I1LA 5JJEB 1K4MA 3R09A 4L9SA 2GXSA 3CCMV 1JWAB 4MEAA 4BLUA 3O8CA 3OBWA 1RPZA 5H8WA 1KJYA 4UOQA 4JASA 3UCEA 4D2IA 3FDXA 4H60A 4ZOLA 4V0LA 3ABLC 4ZIBA 1OXTA 4R1UA 1QRTA 4HNQA 3M7MX 1LUWA 3FCCA 3MTJA 2O6HA 4Q37A 5J1TB 3CKKA 3U11A 3B9QA 4F5ZA 4LK3A 2QSJA 1RTKA 4HQ0A 3ZJUA 1HFJA 1C4WA 1NUHA 2GCEA 3HBMA 2PUHA 1BX1A 4RA9A 1PWZA 1WVMA 4RLHA 2FFRA 1CJBA 1W85A 3PNSA 1XC7A 1G98A 3G9UA 3ZNQA 4UCOA 3VNSA 3JQ9C 1Z4PX 2IL1A 1C9JA 3HQ4O 5EVCA 4GLXA 3EE6A 5HF5A 3IOEA 3QF4B 3S2IA 3CC8A 2GARA 4YPVA 1TVMA 3RDPA 1N2JA 4UHBA 4EUEA 3FLAA 3NWJA 5KSYA 1QVGU 2CSLA 2B99A 1TZMA 3HPQA 3MAJA 3O93A 4EY6A 1FRNA 5H4HA 5EE0A 3OUSA 1L5MA 4G4VA 3NETA 4IOJA 5EJ2A 1HE5A 1MU0A 2AT1A 5C34B 3A70A 1QFZA 3ILSA 3ZQUA 1BC5A 4JI2O 1E2EA 4ZQIA 5BSKA 1GGKA 3HNOA 3HWSA 3U44A 3DJFA 1N3IA 2O2ZA 2Q3CA 1YVEI 4TTVA 1CJKC 4PSAA 3GIWA 3OTOB 3MQWA 5AW8A 2JGUA 1NLYA 4M60A 2VHYA 3DF9A 1TYAE 1VCMA 3L07A 2VZLA 4YN3A 5WRFA 4DQLA 4F9EA 5L4SA 4GLOA 1MIOB 1TF7A 1Y4MA 1N5DA 3ZZ1A 1IMJA 3H9GA 1C8KA 2R9VA 1K27A 3DOUA 1HT3A 3PXCX 4RTSA 4MUXA 3OURA 2XMBA 2RHJA 1UBEA 3UAGA 3UJBA 2FGYA 4B79A 4D82A 1OD6A 2P4HX 1Z9BA 2IGTA 4PPNA 3RFRA 2GHTA 1L5LA 3ZWKA 1YOVA 4BUJA 5C4GB 1KPIA 1G2PA 2HQRA 1C4KA 4BU0A 2P4UA 3B2EA 2JJ1G 4HGRA 3ZJTA 2QTBA 3NOOA 1AA9A 3Q6MA 4XFJA 1A98A 4PS0A 3H2JA 2CSXA 1ZH2A 2WABA 1PK8A 5JPCA 1PV4A 1T8RA 3C8MA 2GRUA 1L5HB 1SUEA 5CR9A 3VDMA 3TG2A 3HG7A 4N9QA 4H4CA 5B7GA 1YA6A 4H3VA 1MUUA 2PRYA 2Y1KA 2UXDO 2JIOA 3QOXA 5B37A 2D13A 1A5TA 1WXXA 4GI2A 1GTL1 3IEUA 3GJQA 1SAYA 1IHXA 4NU6A 2Q41A 3UB2A 1S2IA 1WXEA 3X1MA 2D74A 5C0OE 5BOSB 4OAOA 1II8B 5JIBA 1E6UA 2AG5A 3A58B 3B3FA 1P1IA 3BWXA 5DYWA 3TOZA 3MN1A 2Z8XA 4F2WA 1EVZA 3DPIA 3GRFA 4F85A 3OLCX 2QSAA 4H1TA 4RZ3A 2UUAB 2JANA 2O8NA 3HO8A 2BDEA 4Q9JA 5AW4A 4I9NA 3QUWA 4X3PA 3A2FA 1FX0A 3USCS 1ZIDA 3H1EA 4A7PA 1UFIA 3FX7A 1DLJA 4BGVA 4CRWB 3MC1A 3LPMA 3FZEA 3GFPA 5EYPB 1OLUB 4LJ9A 3PQ5A 2WM9B 4G09A 4D7SA 3PNPA 3PNLA 5HX7A 5JPDA 4KQMA 2Q5IA 1BXKA 2L17A 4OJKA 3FKJA 4EHLA 4LDPA 4D8TA 3U49A 4WUVA 3A4TA 4H37A 4MV8A 5BYKA 1QGOA 5IXYA 3DE3X 4PNZA 1YBFA 4YCNA 1BS2A 1UOPA 3IDQA 4EFBA 3PLRA 4AUKA 5AUPB 1RWNA 1IXZA 4NJOA 2NVUB 5KTNA 1VJ1A 1Z73A 3EIUA 3QXJA 1XRLA 4O2BA 1VHAA 2ZTMA 4R3UC 2QTHA 4JL8A 2QYTA 4CH3A 3FETA 3EJ6A 4U7TB 4YP1A 1KO5A 1P2UA 2HOQA 4Y67A 3NR2A 2ZYTX 3E9YA 1RM3A 4G01B 3ICOA 4RK4A 3HXMA 1XEWX 1U81A 3B3AA 5TF0A 3FE2A 2Z9CA 3FSGA 4YRGA 5FPHA 4IDBA 4RXMA 4CFSA 4LTMA 4AG5A 4DMGA 4B48A 3ZWVA 4HGPA 2NXCA 5HMLA 3SKYA 4PSUA 4PEVA 1QGZA 4NXMO 1E6KA 3QPWA 4L9AA 1KP3A 3EZXA 1XVAA 4PIVA 2IH3C 2NR5A 4ZVNA 4YRCA 4LFCB 1CY2A 2DRIA 2G88A 5DNWA 3F7OA 3QUBA 4AMYA 5FIUA 1HFWA 1E79A 2IEBA 2PV0A 3GFTA 1Q1ZA 3PBKA 4B7EA 2P5OA 1FYVA 1GARA 1CUWA 2C04A 3BCSA 3C74A 4NTWA 4L07A 4E2XA 2N05A 1R27A 3C3XA 3EGXA 2VNHA 3MMNA 4UVHA 1FXVA 3F7MA 1YA4A 2QVGA 4XYLA 2CL0X 4XCQA 2LBTA 1SKYE 4N82A 1X7GA 4DNFA 5GJVC 1TF5A 4MGEA 4MROA 4Z0TA 4NOKA 2PSFA 2JGRA 4W5TA 3GLGE 1OCCC 1W25A 3RH0A 5LKAA 1E63A 2FH5B 1ULAA 3N58A 4BASA 4MTCA 1RQRA 2CEAA 3FFTA 5ICCA 3UKOA 4R1SA 1K6XA 1ZCZA 1ZZEA 3NBQA 3QLVC 5TPWA 3TFQA 1TKBA 2C3MA 3ISVA 5DLYA 3WQRA 2D00A 1EVYA 2F59A 3A0RA 1RKXA 4KE6A 4EX6A 1SC3A 5BR8B 1XRGA 2ECQA 2J3KA 4X92A 4AO8A 1Y74A 1K0UA 4F1WA 2AC4A 2G1JA 1BHSA 1PD0A 2GJ8A 3NRCA 4W7HA 3VR5H 5I01A 3IKMB 1V4VA 4GVXA 5D5QA 3G89A 4AROA 1K3EA 1XMSA 4WFHA 3ZJYA 3VHLB 4X90A 3BCCH 1OZ0A 1ZVJA 2P22C 1C3OA 4BEWA 4HS4A 4ARIA 2WWXA 1KTVA 3GX1A 4GSYA 2P2NA 1TGOA 1UDCA 4CMJA 4FPPA 2CCKA 1T15A 2OD9A 3ECCA 3BMCA 3TIXB 2D5BA 5DXJA 1KDOA 4F11A 4IS2A 4QODA 3OZEA 1E61A 4CKBB 2IUFA 2OZEA 1BXZA 1N32O 2CGOA 2FAXA 3SJCC 1EJ6A 5KSPA 3HN2A 4H4EA 5H7XA 4MQUA 4J7UA 1CW2B 4YMSA 2GBOA 3E22A 1U2QA 1GTZA 1NYQA 1XZ8A 2JLQA 2PH3A 2CZCA 2Q8QA 4C4AA 4RWUA 4C4YA 4MT8A 4X1KA 1A8HA 1XKXA 3JYQA 2VNKA 3V1NA 3GLHB 2AHOA 1JMYA 1ZH0A 1R6DA 3FMPB 3BGWA 4G0VA 4U9HS 5DRTA 4D9MA 2PO5A 2OHVA 2X7RB 1G20B 2FW7A 2X8BA 3AR6A 4JB2A 4QQNA 4YAWA 3ER9A 2O5EA 3E3LA 5COAA 3FBAA 2REXB 5K3CA 1G6UA 3RLIA 2R72A 1T6YA 1N0WA 3O26A 4M6WB 5A3QA 2O05A 1XZMA 4YAFA 3N6RA 2NU8B 5BVHB 4EZIA 2OVBA 3OT5A 4M1WA 1Q6UA 1YT5A 3EEQA 3E7WA 4YCDA 5JAQA 4DYLA 1V54B 2QVYX 3E1GA 3HVKA 2ZJ5A 1KA9H 3ET5A 1W0JG 4Q21A 4UMDA 4MGYR 2WU1A 3RS7A 2XUQA 2LJ2A 3I01A 5ESRA 2LE0A 1YZQA 1R37A 2WTXA 1S2NA 3ENZA 3T3GA 2Q3FA 4DWOA 2OQVA 2DEUA 3EIHA 2L35A 4F3YA 2QTSA 1AVTA 2VHVA 5FFMA 3ZIDA 3URMA 3SZGA 1V16B 1N8SA 2DWDC 3HH8A 4FLYA 2HG5C 4J1SA 2OUIA 1XUOA 3ZLBA 4G9BA 3C6YA 4RVDA 3D3WB 4D8VA 2EHDA 1WAMA 4AZ3B 4OBXA 2C7OA 5EIEA 2XNDA 4RFLA 4IH1A 3L72H 1ODJA 2X2PA 3B5IA 3A27A 1FTNA 3PFCA 4PE5B 4FMPA 3CX3A 3EXHC 5JV5A 2XPCA 1EQUA 1BYIA 4RHXA 1SQBH 4Y2TA 5EIAA 4CMEC 4CKBA 5EIOA 2DFDA 4MYTA 3UMVA 3VO2A 1LA2A 4KBFA 1PSDA 1GTVA 4QDZA 4UZFA 3WIEA 1PP9H 4V2IA 3ICPA 5G0TA 3THWA 5HK8A 1TCUA 3KLNA 3KUUA 4NQ3A 1RI1A 3L4BA 3STUA 3COPA 3D3NA 5DF1A 3G67A 1Z0AA 4CPDA 2H5IA 2V9ZA 2H2FA 2CWDA 2VP9A 4OF4A 1VQ7V 1NVUQ 2HBYA 4BJ6A 5DOZA 4MB0A 1N8TA 4NTYA 1SVNA 2CVZA 3SLGA 4BO1A 4C5AA 1XQVA 4WBXC 4C9BA 3GEGA 2HRBA 2R11A 3LFUA 3PV0A 1SVMA 1FXKB 3WB0A 1ACLA 3C7CB 3IHLA 2QSUA 2DQZA 1HURA 1Y0BA 4G4IA 1HGXA 3TXXA 1OCOB 1SGWA 2Q3DA 3K9HA 1Z2OX 4ZO6A 1FNCA 5L3EA 2MOKA 4RV9A 5F3DA 4DUGD 3BA8A 2ZU6A 4BO3A 4MVSA 4X7BA 1T5TA 4OPHA 4LF8O 1OXUA 1TNDA 2QX4A 4M0KA 3CISA 1SOUA 2G06A 1WAZA 4OUDB 4F96A 1HA3A 2ZI4A 1PZFA 1ZMOA 5G1PA 1KMIZ 5LGNA 1VK3A 2Q07A 3QH4A 2BGTA 4NECA 4ODIA 4YO8A 4W9NA 4G81A 4LHVA 4LR3A 1U5BA 1UDBA 2H3OA 2YOGA 2FZ4A 1CVLA 4G4XA 3WL5A 3D0RA 1VP9A 4CDMA 4DV7O 1ULHA 2X2EA 5KO2A 4IIJB 4DV4O 4OB7A 3DCYA 3WGVA 4RHCA 1F12A 3DTUB 3IOBA 3VV2A 2RQ6A 1N3YA 1TRHA 4BVRA 3S06A 1VMDA 2ANCA 1H8EA 2ET6A 2V7TA 2WM3A 3KXDA 2CY0A 4HQFA 4MUBA 3JATA 3ZY5A 4EQ6B 5TC4A 3ABUA 3H3XA 1AHIA 3TXYA 1WSWA 1WQ1R 2X8AA 1J2UA 1LKZA 4FWBA 4RTRA 4UNRA 1QG4A 5JSYA 2A88A 1Q5PA 1TEHA 2H7XA 2HMTA 5DLDA 1WZ2A 2QQEA 5FUVA 3LKZA 2WF9A 3EGOA 1B42A 1YRWA 1IBKO 1U0GA 3MB8A 2BF7A 1MPTA 3I5AA 3OPMA 4JP3A 3TIIA 3KJXA 3GCWA 3DC5A 1IXSB 3L8FA 2EDAA 1P73A 4N47A 2G09A 1HDRA 1X1AA 4MWCA 4DNQA 4LW8A 5BQXA 5IPFA 5JASA 4NWOB 3TNDA 3JARB 2P2YA 1JMKC 3KKEA 1X7DA 4L95C 4YHBA 4AYWA 4C5CA 3T3OA 2HF8A 3FCSB 1W76A 4J2TA 3F5WC 2IYEA 4MVZA 3EC1A 4WRRA 2ZBRA 1OBFO 3MMPA 1R9MA 4BE9A 1Q19A 3ADOA 4UDNA 3UYKA 1Y6XA 1XCGB 5HKBA 4KLNA 4NG5A 2Y4TA 5J9PC 1W4RA 3ABQB 1N0NA 3DTYA 5BV2P 1GPH1 1YB6A 5BV1A 1Z6TA 4JOQA 1JQLB 1NBME 1O6FA 1ADYA 3A6JA 1CUZA 1V1MA 1P7ZA 2EOAA 3HDGA 5CLQA 3MQ2A 5HR5A 3C2QA 2Q1TA 3EWIA 3VSDA 3N2ZB 4J0CA 3HFSA 4R1QA 4RH3A 1WKBA 1N4DA 1IUPA 5FRDA 1SBHA 2GPWA 1QFMA 3ZRWB 2C8KA 1N7JA 3HY4A 1DT9A 4M0DA 4XAQA 4XUEA 3RUIA 4AUEA 1MA0A 5IM4A 4F2DA 3PHBE 3PXDA 3AZPA 4R40B 2VHXA 3GROA 1JDZA 4PFQA 1VQ8V 4JYMA 3KKOA 4YRKA 3J7AC 4QELA 1HE4A 3KXLA 1M66A 2R5WA 4UEJA 1II0A 5CFNA 4AZTA 3M9LA 1IHOA 2MHCA 3V2GA 1G21B 1Q12A 2ID9A 2IRWA 2YNMD 3THYA 4UMVA 4ZMRA 3JALA 4MR8A 5I3ZA 2XDQB 1E7RA 4BP1A 5CXXA 1YU9A 4XSGA 2Q67A 1OSNA 1NVMB 1YZFA 2F00A 2J3JA 5TGTA 4UOZA 4EG4A 1NXOA 2YCLA 1E9CA 2QAGA 4HCJA 1CQJB 2RAPA 2XB9A 1KGDA 2WTBA 3RJTA 4ZV9A 5EESA 3SC2B 1I6KA 1PG0A 1I2CA 4U7DA 5A06A 3CX4A 5HUHA 2QAJA 2Z1UA 2QG4A 1IXRC 3KZIZ 1KO8A 4HNUA 3O8RA 3U17A 1D4AA 3FFAA 4WK0B 4Q4HB 4A0QA 1KERA 1XL1A 2BR5A 1M67A 4HZUB 4IYRA 4NH4A 4NQZA 1OQAA 5CXUA 2F4VB 1FXWF 1QGUA 1WULS 1M8GA 5CHEA 3UK7A 2IJIA 3M3HA 4DRXA 3CKYA 4UHEA 4P54A 3LQKA 3RK4A 1GL3A 3DHEA 3HB9A 3KT8A 2ICAA 3K58A 1FXWA 1PJ3A 4OPMA 5FBWB 1VHQA 5BNFA 1C0PA 3HTNA 1H3FA 1ZUQA 1JSRA 1AZTA 1CXZA 2QMQA 5CDFE 1NLFA 1M2WA 4LFAO 4I0WB 1G8FA 1G38A 4NR0A 1YZYA 3RUCA 1F2VA 3EUFA 4K28A 3GFRA 3OP4A 2QAGC 3MCAA 4KQ6A 4NKRA 2C3UA 1MZPA 1M33A 4JBLA 2GAAA 1Q81W 4C7VA 4GI3A 1DKOA 4MUIA 3T94A 3OONA 1SR8A 1YA8A 3IESA 4FZ0A 2Q6LA 5IJAA 2PMEA 1T8PA 1YJ9F 1KGSA 1WB8A 2PL9A 3P5SA 4XX1A 2XZPA 4LCBA 4OMDA 2BT4A 4Q3AA 5TB5A 2XMDA 3ZO8A 3ROMA 4EGFA 1IL0A 5LYJB 5J3JA 3K08A 2VNJA 1WHSB 2CLHB 2NO5A 2ILVA 2OAEA 3IP6A 3OBBA 3QFSA 1ISFA 4ASUG 1TZKA 4ENVA 4Y98A 1DDGA 1R12A 1V45E 3EA5A 3ETJA 1J97A 4LE1A 2JAXA 3C3AA 2PGGA 4MDYA 1V9SA 4W63A 1U7ZA 5FOSA 2HWXA 1Y5RA 3B85A 4GVPA 1JX6A 2UAGA 5ENVA 5IH3A 4BMZA 2IH2A 4CV3A 4N0EA 2XA9A 3D8UA 4XLLA 1V9CA 1GGEA 3L2OB 3RAFC 4H7IA 4QRDA 4D3YA 3KZOA 3R44A 4FEYA 3HNPA 4QLAA 4B3RB 1JFRA 4MI6A 3LXMA 3PA6A 4UU8A 2X15A 1M2JA 4FEAA 4YV0A 4HDNA 2JLCA 3G6EF 1DGSA 8ADHA 1Q0UA 3ESDA 1BZKA 4WKCA 4YQZA 3NBKA 3RTCA 1QLJA 3AMVA 4I9QA 1E1KA 3CJQA 3L0OA 4FW9A 4DRXB 4RL6A 4P7JA 3D5TA 3L06A 2HP0B 1EIWA 4PICA 4Q4AA 2QXUA 2GBFA 1EGAA 1M2VA 3G0OA 4GMHA 1JLMA 2EFCB 3QEMB 4REQA 5L3BA 3ZJZA 1DXHA 3H19A 3QYFA 4GR9A 4DLRA 2CB9A 3JAMN 1FJGO 4MAMA 4D7AA 2DYKA 2V7UA 1JFSA 1ISRA 1UKZA 3FPLA 1DO8A 2TMKA 1PFGA 1GRQA 4J3JA 3WNVA 3G82C 5EJ4A 3BREA 3VC7A 4DQXA 4OHFA 1ISIA 2IJGX 5ALUA 4B7CA 1W7AA 4KHZA 4L8JA 3GBSA 3WY9A 2JAOA 4QPJC 4ZJUA 1DIGA 3EZ2A 1F14A 5DX0A 2YXHA 3F6MA 5EAIA 5GJBA 3C1OA 2EGUA 2WU8A 1N8KA 1U2PA 4OSOA 1XJWA 1N6OA 3NANA 4FM2A 2EP7A 3H17A 4L0CA 4DNXA 3ZVNA 3UXMA 5GJCA 1FSZA 4E5NA 5A5EA 2XADA 1CK2A 4QULA 5DZSA 3TBKA 3N7TA 4ID9A 2ANBA 3QMPA 1QHHB 2JZCA 2A0WA 3L0YA 3OBIA 5AHXA 2NTYC 1T5DX 5BOSA 2BH2A 4NBNA 3VZPA 1JEYB 2GZ2A 4ZYTA 5JNVA 1ZRMA 5H82A 1UDRA 1U7DA 3DSQA 1ESEA 1G3UA 2EX0A 1RXVA 5CFPA 3RUDA 2A92A 5BPFA 2FE1A 4HATA 1MZEA 1EK5A 3TLEA 1N8NA 2I8CA 4FI3F 4HS9A 1QDEA 4B3TB 1I2MA 2H1LA 2VJKA 2J3LA 4UE3S 5DSTA 4CF5A 4RTLA 5CB8A 3M6LA 4D0NA 3FDZB 3TQSA 4Y2QA 3VPBA 2GCGA 2JEUA 1SZXA 4Y18A 3ICEA 4YK7A 3E89A 3PUJA 3W5IA 5TS2A 3K4PA 4IL5A 2I4LA 4C6TB 3C0KA 1ZVQA 2GM9A 1E69A 4PFSA 2IQIA 4ZOAA 5GVSA 3HKEA 4J4BA 2EYQA 3MCUA 2IPAB 1N3BA 1TKCA 4M7PA 1XZJA 2WLLB 2Q0XA 2R6HA 5T4HA 4P86A 3MWEA 2O1WA 3DB1A 5FA5A 3ZC3A 3AUYA 1QPGA 4EM6A 1ADJA 1JAXA 3FFWA 4W7IA 3S2YA 3E81A 3PEFA 1DVRA 2C0CA 4BX9A 3HM9A 1X6VA 1ZGBA 3IDAA 1U3CA 5EWLB 3U9LA 5BWNA 3LXUX 4Z8YA 2HWWA 3HJFA 1F0NA 1DV1A 4DIMA 1SS3A 2P2DA 1EG7A 4MRSA 3CZ5A 4AJPA 3C6XA 2LBXA 4YBZA 1PVVA 4IHJB 4U02A 3BS4A 4B9AA 3SE7A 1WA8B 3S7ZA 2ZD9A 2H2WA 1N9GB 3PE3A 3GA5A 4I5SA 2JVIA 2QA5A 4IDDA 2FPIA 4IUDS 1TZJA 4ACAA 3G71F 5A5GA 4CF7A 2O7RA 4JCOA 5DBGA 1MQAA 1K3FA 1KC3A 1OFVA 1ZCJA 3AZOA 4IL6Z 3R5FA 2X0DA 1FNNA 5EQFA 1RYZA 3O82A 1U28A 5D1NA 3FNHA 3SYAA 4L0QA 2WLKA 2EILB 4G0ZA 4LISA 1QKIA 4OIMA 2WMOB 3O03A 1EVIA 3T38A 3UPDA 1T26A 4BZXA 5BV0A 3U31A 5IW8A 1CT9A 3O74A 4JMLA 4JLKA 4YRIA 5TEVA 1NV8A 3LNCA 5AO9A 3DGEA 4QE7A 4K81B 1ZIPA 2RGUA 4Q1BA 5G2OA 1DAOA 3WIVA 1XU4A 2M1ZA 1E59A 3LCMA 2WG0A 1ZL8B 1SURA 3IP9A 4MCJA 3AQIA 2QD5A 4JAAA 5IN5A 2KQUA 1XKQA 4RY0A 2QE7G 3RVOA 1H7MA 3HB0A 1PL4A 2QUJA 5CN0A 3KLBA 3KJJA 1JSLA 3KPWA 3PC4A 4MITA 3BCHA 1G2QA 3PLNA 4X60A 4ZARA 4ZHQF 2BM8A 4PBRA 4Y6GB 1YITV 2WPDA 4IILA 1NUPA 5CVVA 3TD9A 3G85A 3QYJA 1Q14A 5I5EA 1A1VA 3QNMA 3CPWF 1HDJA 1OIWA 3BDIA 3RA6A 3I04A 4W5WA 5AIAA 2P1RA 2BI8A 4QT0A 1K7XB 3X1ZA 2ARHA 1PJ2A 3P4XA 1GQFA 1XCBA 4RF3A 3N53A 1GUFA 3S2UA 4EW1A 3L18A 2WMDA 3I52A 2LDXA 3FBTA 4DQVA 3K12A 2OXRA 4QASA 1IOVA 3FDIA 3MJDA 3PF9A 1IM2A 4MCIA 5G0UA 4EK9A 2Z5GA 4RPKA 3AUAA 3BMCB 3H9EO 4TLEA 4HEJA 3U1VA 2H65A 4E1VA 3C3TA 2M98A 3VPHA 1KWKA 3HP7A 5AVXA 2VUHB 1SCDA 2DP4E 4NONA 1M5RA 5FJJA 3A6KA 3R3YA 2XYHA 3QUSA 4BNYA 2M2IA 621PA 4DBZA 2GNOA 4CDNA 1HQCA 4FX5A 4LJYA 5JQGB 4M37A 3K9CA 2F67A 5HJ5A 4X1KB 3TO5A 2QZ9A 3O9OA 2GVDC 2HKOA 3TQRA 1CPYA 3DTVA 3KU1A 3OCYA 3VAZA 1P5FA 1BJRE 4Y9RA 3DWEX 2C4TA 5GM2A 1Z5VA 2GSWA 3L4EA 3RV4A 4MI9A 3TGPA 4J7KA 3I3SR 4D97A 3MWDB 4F21A 4JASB 4AZVA 4CEJA 4YMUA 3AV0B 3S02A 2ALJA 3VJLA 2BFFA 4YCBA 1TJ3A 2W83A 4Z1MG 3TD3A 2Z9DA 2VZ9A 4WFJA 5AI4A 2VHJA 2FUG1 4BB9A 2BEVB 5JAMA 1TC1A 1V95A 2Y0CA 4JT2A 4F4LA 4ZOBA 3BF7A 1YV9A 4NJMB 5HUJA 3WNCA 1EINA 1W4ZA 1E2NA 4YALA 3OD4A 3JXEA 2H18A 1GG5A 3KV1A 3GJ4A 2XVMA 2CFTA 4P35A 5G3ZA 3ZV5A 3C8UA 2HRDA 4BAZA 5CIYA 3AF4A 1BEEA 1DEHA 3Q2KA 3IQFA 1XT6A 1JDVA 3L43A 1M2OB 2BPOA 5GZ1A 4MDHA 3E1SA 1QWSA 3C3JA 1S2GA 2P9EA 4MR9B 3ERCA 3PLAC 3EQZA 3L6UA 2IBMA 4GQAA 1AKEA 3B09A 2WPDG 3BD8A 4KTTE 4D9GA 2QRZA 2OLKA 1NVGA 4W8HA 4BN5A 1GIAA 4R9UC 3BAAA 3GDOA 2A9QA 3B6IA 3KQMA 2X1LA 3QXSA 5DTQA 1GTOA 1NVVQ 1XEXB 4A82A 4BLTA 4YJ3F 3LZDA 4D8XA 2RSLA 3IUSA 2W2OA 4JEUA 4YIOA 3JTMA 4QECA 3SHVA 5C5EA 2B4RO 1OFGA 2B25A 2HT6A 3Q10A 3KL2A 2A3NA 2QLTA 5EJMA 4GNRA 4DLAA 5I6DA 1F20A 1YJXA 3EVKA 4I55F 4CCAA 1AOXA 4ZYUA 4LDAA 5DYIA 1R6AA 1UK7A 3EMBA 1CK4A 1ZS9A 3ZKWB 4C3OB 3V4FA 3APOA 1RQGA 3F6PA 5I4KA 2JIBA 4OHPA 4U00A 1U8TA 1QFSA 2NW6A 3WLPA