4I55B

Crystal structure of tubulin-stathmin-ttl complex
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
428
structure length
425
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular Mechanism of Action of Microtubule-Stabilizing Anticancer Agents.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell cycle
molecule keywords Tubulin alpha-1B chain
total genus 162
structure length 425
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4i55B03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4i55B02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4i55B01
5J2TB 5JQGA 1JFFA 4YJ2A 3VOAA 5M7EA 3E22A 4O2BA 5EIBC 2BTQA 4ZI7A 3WGMA 3RYIA 4IIJA 1FFXB 4EB6A 5LOVA 3JATA 3WGNA 4FFBB 3HKDA 5FNVA 5ITZB 5LP6B 1W5AA 4YJ2B 4I4TA 1W59A 5JH7A 3CB2A 5IYZB 4O4JB 1RQ7A 4LNUA 4XCQA 1W5EA 5EZYA 5EZYB 4YJ3A 5CB4B 4IIJB 4EB6B 3JASA 3VOBA 1SA0B 4HNAA 2RHOA 5MN4A 4X20A 2GVIA 4TV9B 1RQ2A 1TUBA 4WBNB 3RYHB 4O2AB 5KX5B 4ZHQB 1OFUA 2RHLA 3R4VA 4EI7A 4F6RB 4F6RA 3RB8A 4ZOLB 2BTOA 4DRXB 2BTQB 3VO9A 3JALB 5CA1B 4O4JA 5JQGB 4B46A 3ZBQA 5CA0A 4I55B 3JAWA 2VXYA 5EIBD 4O4IB 5BMVB 5IJ0A 5LXTB 3JARA 3C8LA 3WGJA 2VAPA 5J2UB 3VO8A 3HKCA 3RYIB 3HKEB 4WBNA 5IYZA 5EYPB 4O2AA 5KX5A 3N2KB 4O4HA 4IHJB 4IHJA 4I4TB 5KMGB 3E22B 4O2BB 4O4IA 5BMVA 5IJ0B 3RYFB 4X1KA 4LNUB 1FFXA 3V3TA 3VPAA 1W5BA 5GONA 4TUYB 4TUYA 1TVKB 3ZIDA 5ITZA 5LP6A 4X1IB 5JH7B 4O4HB 4U39A 4TV8A 3UT5A 5JCOA 4DRXA 5JVDA 5LXTA 2RHJA 5LOVB 4EI9A 5EYPA 4YJ3B 5C8YB 5CB4A 4TV9A 2Q1YA 4DXDA 5LA6B 5LA6A 1SA0A 4HNAB 1W581 4B45A 4X1KB 1TUBB 2XKAA 3M8KA 5LYJB 3RYCB 4E6EA 5MN5A 5GONB 4ZOLA 5IJ9A 5MN6A 2XKBA 4KWEA 3HKBB 3HKBA 3RYHA 4TV8B 3UT5B 4ZI7B 4I55A 5J2TA 4I50B 3ZBPA 3JASB 3HKCB 3JATB 4X1YB 3JAKB 1Z5WA 1RLUA 3HKEA 4EI8A 1FSZA 5CA0B 4U3JA 4ZHQA 3N2GA 5KMGA 2R751 1W5FA 2Q1XA 3WGKA 4M8IA 5LP6C 5CA1A 3HKDB 5FNVB 5C8YA 2RHHA 3N2KA 1Z5VA 4I50A 5JCOC 3RYFA 2VAMA 3JAKA 4X20B 4O4LB 2VAWA 3M89A 1JFFB 3JALA 1TVKA 3JAWB 4FFBA 4U3JB 4X1IA 3N2GB 5J2UA 5LYJA 3JARB 3RYCA 2R6R1 4X1YA 3WGLA 5JVDB 5IJ9B 4O4LA
chains in the Genus database with same CATH superfamily
2FR8C 4WZZA 2C3UA 3VYTC 2JDIG 3ZCPA 4RIHA 3D8UA 4JDPA 5IAEA 4MPJA 1Q2UA 2ZR0A 5BYAA 2AXPA 1VPLA 4QGFA 1XHOA 1KYXA 1OREA 4UM7A 4IZ6A 4WNIA 4PR0A 2VYCA 4G37A 5FNVF 1QPZA 4IDDA 3K4PA 2OKCA 3SZGA 2F1OA 1U9JA 3ELYA 2I2DA 3V6LA 3PTZA 1WW8A 4ISBA 3VHLB 1EVKA 3D2LA 4Z0PA 5FLXN 1AHHA 2A1TR 1RJEA 1LWOA 3PXUA 3VH3A 2J87A 1P44A 3OJWA 2CV2A 4U8GA 2V0NA 1VF5B 2CCJA 1BW9A 3H8VA 1N1EA 3AETA 3JWHA 3LY7A 3QQ5A 2JFOA 3HCWA 5LDHA 4Q39A 1QLNA 3G2PA 4FFMA 4UCXA 4ZDIA 4FHFA 1D6MA 1K4YA 3PNVA 2F67A 3GWGA 2QX9A 1I4LD 4R1OA 1J4AA 3UQ8A 2R6ZA 2WE7A 4X6UA 2V59A 3TL3A 4A0HA 2HA5A 4OMDA 5J5CA 4BFTA 4W4TA 3JAMA 2ZQYA 2GTPA 4GMKA 4NJMA 4TT3G 2RGBA 2EFGA 5AI8A 4UTVA 1PKEA 3D3WA 4WCDA 4JMLA 2CZWA 1G291 4CS4A 2DYSC 1Z56C 2PBLA 2YXEA 3L8EA 3LFTA 4PYKA 4ENWA 4PELA 2DULA 1R6DA 3ROEA 1OLUA 3JZAA 3GJSA 3EFBA 2WILA 3VZRA 1Z4QA 1OLXB 3N2KB 3A2MA 3HFSA 1FVFA 2O2GA 4HDKB 3BULA 4AO8A 4B3GA 1QKKA 1NUQA 1T8SA 5IT9A 3ZJUA 2IODA 4D3YA 3V3TA 5EUQB 2V4DA 2C9DA 4DB4A 1ICEA 2D0IA 2P6UA 2RGYA 3NC4A 4GNRA 1Q0UA 3EPHA 2VA9A 3QW2A 4MR8A 3G0BA 1ODLA 2X8JA 3MDOA 1KY5A 1WB9A 4IJKA 3CW9A 4B3SO 3U3OA 1YVUA 3AM4A 3OHPA 4FMDF 1NWCA 3WLMA 1N6RA 2IHUA 4V3BA 1K2VN 2F3QA 3SBXA 4JI8O 3LMEA 1IHPA 1QHHA 2GF2A 4V0SA 2XUFA 1D0SA 1I7PA 4G1VA 3STUA 5KINB 1PFGA 2JLYA 4CEHB 3DHWC 3GGDA 5LKAA 2AZ0A 3P4EA 5J5AA 2ASVA 1UPFA 4W7HA 2Q0AA 4R2XA 2W83A 2TMGA 1PWYE 1C81A 1XL1A 4ZWNA 3K32A 1L4BA 1W2WB 1GTMA 3OZDA 4PG8A 2XXAB 1R37A 3RVYA 2FRDC 3NNNA 1SRRA 3EXHB 3SIWA 1QBZA 1WMSA 4Y18A 1VE3A 2UUBB 2FWJA 2JCBA 1Y9JA 3BX1A 2DR3A 4MZXA 4ZDJA 3I2YX 4NDNE 1ES9A 5B5EZ 4JYBA 3IP7A 2Z1EA 2VHUA 3MTAA 1TJ5A 1XRRA 2J0UA 4TQ9A 1XF9A 4RZ2A 3WSTA 5A5DA 2B9VA 3QFFA 3ZX6A 3OP4A 3ZCVA 5JNTA 3J80A 4AXXA 4EG1A 4UV9A 1UBLS 1FUIA 2QVGA 2FOXA 4LRXA 4MQEB 1NW5A 3JVIA 3NRBA 3K92A 2ABWA 4XQ0A 2ZIWB 3ZDYB 1E6MA 3DVLA 2IYVA 4K8OA 4ASUG 2QZ9A 3GEIA 1V43A 2GYVA 1WHSB 1X94A 4PPFA 3W2TA 5L3EA 2NR5A 1E2DA 2PZLA 2Y92A 2EX0A 1MVOA 3PICA 3ZW9A 1FS4A 1TW2A 2GJ4A 2F9ZC 1USIA 2FOIA 3PQ8A 1JALA 4QUDA 2HVKC 1KVTA 4HR7A 1YMUA 5HX7A 1A9PA 2FJ0A 3CZRA 5K6TA 2QE7G 5FUYA 2G80A 1KU6A 5J2TB 5B1DA 1H2NA 1A8UA 1HGXA 1OV4A 2GLXA 3ZZTA 5BV2P 1FBNA 3ZVMA 2I0FA 4NKGB 5CH5A 1GWNA 4DA0A 3ZXIA 4OMFG 5JD4A 4BW0B 5CCEA 4RSGA 1SQXH 2GWRA 1U4SA 1YK1A 4FLEA 4YC7A 5DCWA 1M57B 2Y69C 2QRJA 3WGNA 2D7CA 1Q81H 5AKLA 1XRGA 1PJ3A 4U7HA 5FAKA 3IR9A 4PQYA 5JANA 3R7SA 3VNUA 1JDBC 3V48A 4D99A 3CCSF 2FNAA 1V8DA 2JZNA 2TMYA 4L95C 3WRWA 1GN9A 1E1DA 3AERA 3D8CA 3FUXA 5BWOA 2Z1FA 2R6CA 4TXMA 2N0SA 5DNWA 1HLPA 3GF4A 2JB9A 1TD9A 1ENYA 2O1WA 4YRQA 1NXQA 1G0OA 2F3TA 3BWCA 5A3VA 5A5VA 5EE9A 2HP3A 2Z1TA 3OBWA 4KQ1A 3UPDA 2I4TA 1ADFA 5FDFA 4A36A 1ZWZA 1DQSA 2QMHA 3NRCA 1SEPA 4DR6B 1L4LA 1OT3A 1VJ0A 3JVVA 3O90A 4GMDA 4O63O 2JS5A 4YIOA 1A88A 2VJBA 1NBME 2WWHA 3HCCA 1SU8A 3WBBA 2PUEA 3VV3A 2YYYA 5A05A 1JU4A 3IVCA 2IUSA 1Z68A 5J4VA 3OT1B 2Y0PA 4RQBA 5J2UB 4LTNA 3O4GA 2ECFA 2HRRA 1YL6A 3NP7A 3X1ZA 4MZDA 3T06B 5JY6A 1XEQA 1L1RA 2ISCA 1GN3A 4N23A 4G0QA 3F5WC 1EB9A 1WCYA 4FNAA 3L8DA 2WYVA 4ZDWA 2QL6A 2OTJV 1HNXB 4YMWA 5BYBA 1T25A 1Y8RB 2WUEA 3DMNA 4MWDA 3B9RA 4Q6BA 1WXHA 5FUBA 4LTMA 2BKEA 5D8DA 4PYOA 5CVEA 5KAMA 2DXIA 3DAOA 4DV7O 3BRQA 3HTNA 2PZJA 2V54A 2Y2UA 4F72A 2Z8ZA 3MUOA 3D1LA 4IDPA 4UUMA 2QJOA 3CGGA 3GAFA 4U39A 3BC1A 4Z1MD 2RHJA 2GZDA 3D6VA 2BEVB 2Q3DA 4MWTA 3KQNA 4CMEC 4EHAA 4YAGA 3BICA 4JQYA 3UATA 2JDID 2GFIA 3V7UA 3FHJA 3EIEA 4LFBB 4EP1A 1L3CA 5JROA 3SDZA 2C97A 2WABA 2YIBA 3QBEA 1E3TA 4NFSA 1UZMA 5KWVA 4PONA 5IJZA 3SR4A 3CRAA 5DP1A 3MGAA 3DHVA 5TQJA 1L8QA 1K8ZB 2OR3A 4J0EA 1INLA 1M2VB 1NVPB 4KFUA 3PKJA 3D8HA 3QPUA 3L9WA 4MJ7A 1RJFA 3SEQA 1FSSA 1JVNA 1T8UA 1AOXA 2QM0A 4QZVA 3IS3A 3UMMA 2ECOA 2SCUA 4EVQA 4D98A 3H7IA 2CSLA 3GLHE 4QGPA 2PCJA 2AJLI 5HKKD 4C2TA 1EFLA 1YQEA 5A2QM 1WP7A 1Y1RA 4GZ6A 2BW0A 1Q0LA 3O21A 2XCSB 4H0LB 4TLLB 1YITV 4FYXA 5HEKA 1K63A 2JAHA 1WCWA 2BUBA 1WDKA 1WTAA 1TTQB 1FSGA 1G5HA 2ZIFA 1C0PA 4PSUA 4REQA 2GM5A 3GHZA 5ADVA 2IS6A 4DNOA 2IKSA 2A92A 3I2GA 2XVXA 3HUFA 3SZOA 4CM5A 1I7QB 2VAMA 1BTOA 1PNTA 1ZLZA 1QG4A 3S2YA 4KI7A 3UK7A 3VZPA 1WDLA 1DCFA 1TCCA 4Q9DA 4TL9A 1BVYF 2C4KA 1P6UA 2WLLB 1LPSA 2IW5A 1OCOC 3KOUA 3H13A 1PT9A 1N5DA 1WW2A 2YASA 4C3OB 4BXOA 1JBKA 3H9GA 1J5XA 2HQOA 3A0RB 3H1EA 1FFHA 4UJ3A 4OL0A 1YACA 4YIKA 3FGOA 2CSXA 4ZV4A 3H87A 1LPAB 1PS8A 2NVUA 1IDOA 1QR2A 2VPQA 1GADO 2QK4A 1NBMA 2ZI7A 5G4KB 3VH2A 1Z37A 3QEJA 1U7UA 3G2NA 3AKYA 3D81A 3W5IA 1ZMOA 2FQYA 3WMFA 4JLKA 3RUIA 2C7RA 4ZHSA 1WMBA 1F2UA 4DO2A 3RDPA 1CUJA 1TC1A 5IAJA 2JAUA 1TU4A 1F9AA 4LF9O 1N8RW 1ZJZA 2HPZA 3UICA 4YV2A 2CTWA 3O65A 1T91A 1FPQA 2V0CA 5HF8A 5GANK 1TAGA 4TRMA 9MHTA 3VBCA 1ROPA 1Z2AA 2AR7A 3DTVA 4RM3A 4HUQB 4DADA 1JEEA 3THWA 3CRNA 4RFVA 3THYA 1RQPA 2JFGA 1KQOA 3CR3C 4WFEA 4JEMA 3AF3A 4DQUA 3O83A 4TYYA 2O52A 4HVTA 3DDZX 4OJQA 2QT1A 4C6SA 3JQPA 1X2EA 5AI0A 4ZOLB 3T2MA 2QYSA 3CF6R 2PNFA 3A4VA 3K0FB 1NHGA 4R50A 1AXEA 3HWRA 3LO8A 5HF6A 1T36B 3TQSA 2IUEA 4B46A 2Q46A 1AIPA 4BVBA 3TSOA 3ZVNA 3B38A 2MQEA 2CVOA 3GMDA 3GRZA 1GT91 1QIJA 4GWGA 4CIYA 1FPOA 1RRPA 3H83A 5IKMA 1RLGA 3PRKE 4DEYA 1Q1GA 4L72A 3SC4A 1JYFA 1IH8A 5JZBA 3CRMA 4NFYA 4EM6A 4MW7A 3CP1A 2P4HX 2GD6A 1ISHA 5LMUB 5B4UA 3OJLA 4X5OA 1HDRA 5CAEA 3IEKA 3F6YA 3CO5A 2HMSA 2VTBA 4Q3CA 3AF1A 4B2YA 1SUEA 1PR3A 3MGBA 3QLUC 1UFRA 1H38A 4LVNA 3HZHA 2F43B 2CLKB 3JZIA 1CZKA 2I1LA 3CN7A 5FPSA 4DEVA 2C99A 1A9SA 2QGNA 2J7PD 1AE1A 1ZNZA 1ZQ1A 4QSHA 3TLEA 4URVR 4YIHA 5GAPK 1RYEA 1VCIA 5D00A 2SHKA 4MCAA 5FA6A 4QG7A 1WCIA 1VIBA 3MBMA 1GKKA 1FXVA 1KYIA 1EWYA 2C20A 3NBFA 5LYJB 5TC4A 2GDZA 1FLAA 2H5EA 4BWYA 4IOKA 1K3TA 2DWQA 2ZTUA 3UV7A 3CTPA 3FMIA 2WD8A 3QX3A 4IVPA 3FTNA 2I71A 4LCJA 1TYZA 2WAXA 4KR9A 1Z4NA 1IPEA 1T1SA 3ZU4A 1K6EA 5ALRA 1J1UA 1ND6A 2GSDA 5EMHA 1WAZA 4LBEC 2QZ4A 3ITEA 3JZDA 1RBZA 2HO5A 2PIAA 4OF4A 2C3OA 1CETA 3HJAA 3PUWA 4XOUA 2OHFA 1CN7A 2AUTA 4PAQA 5ALXA 4KVAA 3FAVA 1NNI1 2V7QD 2VWPA 2AI3A 1LR1A 1E6KA 3GU3A 3E8FA 2FSIA 3HB1A 3M9LA 1ESDA 1DJLA 1YB1A 3LNCA 4I6EA 2AC4A 4QVKA 5D6NA 2ZIUB 1S8FA 1W8IA 3CH6A 2BGNA 4HBGA 4JX9A 3U39A 1QIEA 4MKGA 5KJ6A 4YRBA 4CLRB 2PWAA 2W6QA 2EYQA 3KHTA 3MWEB 4GT1A 3HADA 3S2GA 3V1LA 3M89A 3ET4A 3GBPA 1Y82A 4X8HA 4BLUA 2COEA 4YR9A 1A5AB 1PJAA 1GZDA 4F1JA 5HK9A 4BVEA 1WP4A 3ROKA 2BVNA 2A0YA 1EFKA 3OA2A 4TPKA 4TTSA 1XVTA 2B34A 3OCJA 1OW3B 4UM9D 3G79A 3H0KA 3IUJA 3HLYA 4V0OA 3RADC 5CB6A 3FSJX 4M9SA 3WDKA 5EJ6A 5CNIA 1NOJA 2B4KA 4Q1AA 5ICEA 4OQXA 4QX6A 3KJNA 1PK9A 4HH4A 1DCMA 5LMNO 2QHXA 4M2LA 1KKLA 3QLEA 4PEVA 3RS2A 3OKCA 4BUJA 1UI9A 1E6EA 5I4BA 1YOVB 4JP1A 2PFSA 3NR2A 3NLLA 3LZCA 3TAHA 5CD9A 5KSWB 1HE5A 4MS4B 2WZCA 1SCUB 1PR0A 5IYZB 1G3QA 2O14A 1BXKA 1SB8A 1ZP6A 1BJRE 3CUSA 4P2BA 5GJCA 3B70A 2C9BA 3N2LA 3LU1A 3O26A 1X70A 4KN8A 3FBAA 3HU1A 5JQWA 3UJHA 1ZJWA 4RW0A 3O9ZA 3MQWA 5JDCA 3Q3EA 5D2CA 4I5SA 3I9NA 3T15A 2FB9A 3NGXA 2IL1A 4KSYA 1JJ7A 3EXG1 3I12A 1Y37A 1QJCA 2BE3A 2HTEA 3SGIA 5J43A 3JX9A 4LN1A 1WQ1R 3DMTA 5A9SA 5JEEA 2GVZC 1PL0A 4DR5O 1ULUA 1ZJ5A 3F7VC 1A3CA 1O94C 4IUYA 1ZK0A 3K9WA 1SH7A 3H7AA 3AG3C 5BPFA 1YDHA 4RHYA 3VSCA 1MX1A 1PR5A 3OLCX 1IY9A 3MFYA 3WKDA 3BXOA 2LKCA 4BNVA 5KS2A 1NJFA 4S04A 3EPJA 2BM1A 4GYWA 3QK7A 1PD0A 1O58A 3ABOB 4BEBA 3RROA 2AJTA 3SJCA 1VG0B 3F4LA 4FLZA 4BFCA 1JZQA 4PA6A 5HVNA 3AYZB 1YB6A 5D7NA 1WTCA 1MEEA 1Y63A 2CEAA 4TKMA 1NS1A 4TLMB 2WWVD 3RBVA 2EULA 5CDGA 1MB2A 1DT5A 4RLFA 4B4DA 3RWMB 1QHSA 4KH1A 3HG7A 3SHTA 4DW8A 3Q1KA 5HRUA 2YBEA 2GXAA 2E4VA 2NSDA 2R6GA 4KREA 5MFPA 4P7GA 3RSQA 5EQFA 1E7WA 1UM9B 3HNOA 2FMTA 4C2AA 1SVIA 1L7VC 3RUCA 3PUKA 4CS3A 4BLWA 1I0HA 1AS0A 1NF3A 4RZSA 3VR5H 1ABBA 3NK6A 5CPFA 4GMFA 2XVAA 2GZ2A 1VE5A 3G2HA 4RXUA 1Z74A 2PLFA 5CMLA 3SPJA 2W00A 4DRYA 1BQ3A 1XREA 4NBSA 5DM0A 2HFEC 2H9IA 2RB4A 1P2BA 1G9SA 5IC5A 1TW3A 4KQCA 4BMZA 1RI3A 5TQVA 4QDKA 4KIWA 4H7IA 2BFEB 1XP5A 2OXEA 5KWIA 1I5XA 1EFPB 3TIXB 3DXRB 1GQRA 1XMVA 2H65A 2CXSA 5SYNA 2IHYA 3H99A 1B3RA 3ZMTA 1UT5A 2V97A 1DP4A 4XBFA 2QR4A 2GYYA 3A25A 3K5OA 3AJ9A 2Q9AA 4MAMA 3W9SA 2EQAA 2R68A 4ZD6A 2QTOA 2VJOA 1U7WA 4YUWA 1GUZA 1T8TA 2NGRA 2MYUA 1DWQA 2VTVA 1EXVA 4CC5A 1KHTA 1DZIA 2FP4A 1WBDA 3SPXA 4FIPC 3SS9X 2FFQA 1SC6A 3NHRA 1IFXA 4BBAA 2FZKA 3U44A 2JGKA 3L8MA 1GLVA 3UJPA 1KZ6A 4MUXA 2PYJA 1IN5A 1CNEA 1ODCA 3PN1A 2ZKIA 3H01A 2QGFA 2HHAA 3CMMA 2CHFA 2NTJA 3Q85A 5KQLA 1HETA 1GZ6A 1E3MA 1MOFA 1L0LH 3A10A 1VYVA 1JH8A 4DDMA 3BRSA 4AW9A 4HAYA 4BQIA 1SZDA 2YQ5A 2F43G 1NX9A 5T7BA 4YCBA 5F5NA 2WLSA 5E3IA 1QFMA 2ZCEA 1E8DA 5H6RA 1VKOA 1W76A 1WBJB 1XIVA 2C7GA 3ELBA 4K9OA 4WKNA 3RVNA 3W5SA 4YRGA 1XNQO 3DBLB 5B30A 2UUCB 2ID9A 3T7EA 3EZLA 3MWYW 4AKSA 1LSOA 4CF5A 5EJ9A 3D0OA 4IX1A 5AJXA 1H4SA 2BIFA 2LQTA 1EP1B 2QUZA 5KYWA 2EP7A 1G6Q1 4WZAA 4BO6A 3SVTA 1JH9A 4GPIB 2HW8A 3AK4A 2DP4E 2Q9LA 7AT1A 3VI4B 3IEIA 4L5BA 5JCJD 2CFIA 5FLXM 1K73H 1BXRA 2DFNA 3BK2A 2AUMA 5FCDA 1S76D 1M8JA 1T3SA 4MLDA 2E48A 4FFWA 4X8AA 1CUDA 3TLGA 1FNNA 4CM1A 3FFWA 2CVLA 2QB5A 5FBQB 2B20A 4B6OA 1QBGA 2UXCB 4KPGA 4N4AA 3QX7A 3CCQV 4TWKA 1CERA 1SIWA 3KSDO 3LP6A 1C2TA 1CUBA 4NMHA 5D3QA 3ERNA 1TLLA 3BGWA 5IJ0A 3UOAB 3O2NA 5DGDA 1IEVA 4IAOA 5DASA 5EC8A 5H5NA 2X77A 4PSVA 1YV9A 3TRIA 4JK3A 5KTRA 3TGLA 2XKKA 5IDYA 3A6PC 2ZSHA 2Q8QA 4L9AA 2LGQA 1XGKA 1XTIA 4BJ5A 5I7EA 4P58A 1DE0A 2YVLA 4FZ0A 4BEVA 4YV1A 1TTHA 1PEDA 5DTQA 5EFOA 3DL7A 1T5HX 1XEXB 1LB1B 2B7LA 2F64A 4QWWA 3CH7A 3A6EA 5DRYA 3H5WA 4X7BA 3TRDA 4C6TB 1S6YA 1ZHOA 4I55F 1IBKO 2YDXA 2PLAA 3GA5A 4UE6A 1R18A 1G8GA 4E4TA 3FPLA 1UJNA 3UUFA 2WTAA 1F4LA 3CMEV 1PEKE 2A0FA 4OX9O 1TT5B 3A3KA 5AKYA 2QPLA 1UP6A 3PDJA 1Y98A 4QOJA 3TLYA 1ONNA 2OHWA 3W2IA 1HDCA 2GBCA 4HQKA 1IBKB 3FVQA 3QNUA 1A9TA 4OB7A 3KOZA 3NBYC 2DLNA 2UXCO 3OZEA 4HB0A 3FDZA 1W3EX 4RTRA 3RU2A 1YGYA 2GQ0A 4JU8A 3VI3B 3QPVA 4F4JA 2PN1A 1A0OA 1ZINA 2ZSAA 5DGTA 4N5LA 5AW3A 5JR3A 2YJNA 2DFPA 3N28A 1KD1H 3SF8A 1UAYA 2WU3A 1XA0A 3L8YA 3Q8KA 1Y5LA 2W4MA 4MDYA 4UBMA 4ZALA 3TNDA 4B0PA 3H1GA 1HZJA 3UHFA 3LUAA 3IAM6 5IN4A 1A9XB 2XNDG 2EG5A 3LHDA 1EN4A 4X7RA 1RRGA 3RU9A 3IULA 2WF9A 3TH5A 1GVNB 2R5WA 3A11A 3IUBA 3KT6A 3M82A 2VHQA 2R751 3MOSA 4M0UA 4PLFA 3UQZA 3CINA 2FMFA 2AG0A 2ID8A 3L4BA 4BVSA 2AF4C 3ABMB 2R8RA 5FNVB 5CYOA 5DNAA 1QGOA 4FD3A 1Z2CA 1BO6A 3NHBA 3WDMA 1C14A 2OCCB 2DMXA 2CWJA 1QMGA 1X1EA 3DBOB 1GN6A 4GLLA 2ZBUA 3ZLUA 1P91A 5A6SB 4F5YA 5C51B 1T9GS 2BGGA 4QU9A 2BBSA 1AS3A 5KOIA 1GV0A 5LIPA 2XZLA 3TGWA 1T6NA 2KHZA 3S2IA 3HEAA 4YCAA 9LDBA 1SQSA 1QGUB 2EG9A 2IHKA 1C3VA 4YPOA 5SZJA 2VHJA 2DYKA 3DLPX 4X85A 3UXEA 5BQ3A 1II8A 2UYQA 2B2CA 2IT1A 1DTEA 3W4IA 2ZT8A 1P49A 5BWBA 4D02A 5BSUA 3QTYA 8LDHA 1C7QA 1XTPA 3DSQA 1EWRA 2V6GA 3FB5C 3I72A 2ZUTA 3V4LA 1MENA 1Y1PA 2CDYA 3A7DA 2GUZA 1DV1A 2G71A 3I45A 1W0CA 1OF1A 1XZNA 3PUZA 3QYJA 1NYLA 3DJYA 5CX1B 2OYCA 3RR2A 5LZ4A 4MDEA 1SAYA 3P0ZA 2A0UA 3KU4A 4EY3A 3AR2A 1JIQA 3AUYA 5AHKA 1RYBA 2MTBA 4JEHA 5IVHA 2WD7A 4DZRA 4TV9B 3U3RA 4X90A 2HUPA 3TQTA 1U8YA 3Q0EA 2ZNIA 4X64B 2A9PA 3M4JA 1UKAA 3E23A 3TR0A 1N33O 5DKFA 5BXYA 2YWHA 5MF6A 1R0LA 1E79D 1ZY2A 3UPUA 4P38A 2CVZA 1CQIA 2R4QA 3FD9A 2I7VA 3BYZA 1D5WA 1DKLA 3ZRWB 1DUVG 4XIFA 3T7TA 3OJ0A 2PLWA 2FMKA 1PFKA 2B5OA 3P3PA 3HRIA 1ISMA 4FWBA 5K0ZA 3OI7A 4QDXA 1BDMA 1R3JC 5AM4A 3SYAA 4ARZA 5DPMA 3KJXA 3LVFO 1WB5A 4QO7A 2BM0A 1J97A 1H2YA 2W37A 3WB0A 1M2GA 1Y3DE 3VYSB 3OOWA 3DAPA 3ZK7A 5C3UA 4MIEA 4GBED 3KKMA 3VSDA 2Y0DA 3CD6F 2Q7GA 1DAKA 1E3QA 1VQNF 3C6MA 2QTNA 3ORFA 3JD4A 1TIBA 4PHGA 3TM5A 2WSSG 4US1R 1LLFA 4D9EA 4YCSA 5J2TF 3TSCA 7YASA 1ADYA 2HEIA 1U2ZA 4R7CA 1E0KA 1YUBA 3C85A 1P60A 4IX9A 4KLRA 4Y9DA 4B5LA 1AV7A 1BDIA 3ICWA 2X1VA 1ENPA 3C3TA 1KJIA 5DHTA 3J81N 3P2YA 5FLKA 2PUBA 1A9ZA 3M1IA 2Q5ZA 1R9NA 1JSLA 5ISMA 2XNDA 3FCEA 4PGMA 3WPXA 4BMVA 3RKRA 5J3JA 1HTWA 4YDSA 4EPXA 4L5AA 1GGMA 1Z62A 3GLHA 5MN5A 3F7YC 4H0NA 3D6JA 4N0QA 5IC6A 3ZIAA 2RHWA 1A96A 2POQX 2EZ9A 1NPTO 4DR4O 2RBGA 3I56V 2FMHA 5JOQA 2NZJA 4EBBA 3SPHA 4DR7B 4ZJPA 3W7SA 5DNYB 1X7OA 3HJGA 2HGZA 3OX1A 4PLCA 3ZKAA 3DB1A 3DYIA 4I50B 4PS1A 4AUEA 4NMXB 3RGGA 3EC1A 4YJGB 1MCZA 1KY4A 2BEWB 1LU9A 1YJCA 4F4DA 1AMOA 2OQ2A 1V4VA 1ORVA 4IZOA 5KNBA 3FYSA 3FI0A 1GRNA 3G9UA 1GAXA 1Z8NA 5CXUA 3KSMA 1HW7A 1PSDA 4J7UA 1ZW6A 4BFLA 8AT1A 5CIYA 4FDTA 3EULA 5FXMA 2GLZA 2RCNA 3IR7A 2A0WA 4J7AA 4IEIA 4UHCA 1JHQA 5KHAA 3D59A 2EERA 2F9LA 3MAAC 2YUIA 2CVHA 2ZT7A 3GNTA 2OTLV 2WFZA 5IKOA 2OFWA 3QGMA 4I1UA 1F1BA 1SESA 3WOVA 3L6UA 4ZO6A 3PGXA 4TWIA 3R1IA 1V1MB 4NZMA 4KQXA 2ZUFA 3U0ZA 1ISRA 1CQJA 3NT4A 4WL0A 3HWUA 1C3XA 4KI0A 3DO5A 5HZGA 1YBVA 3SIPA 3MRSA 1GQOA 3U5ZB 2O3QA 1XVAA 2W22A 4G5XA 2IV7A 4AQYB 2RMKB 5IVIA 4DKXA 5IDWA 2P9TA 2OTMA 1OYYA 4G89A 1CC1S 4BKUA 4BO7A 4BP8A 4Q00A 4BUCA 2CBGA 5DNDA 1Q8IA 4KXNA 4N8SA 5CDSA 2QQ0A 5EMMA 3M6FA 4M49A 2VK8A 1L5NA 1XUQA 1C0IA 5CLIA 3NHAA 1PGJA 1PFWA 1Q15A 1NVUQ 2R1VA 3C9UA 4FC6A 1QU9A 1SN7A 1DZ3A 2P5UA 3K0AB 3L92A 3MW8A 4ZCIA 5ITZB 1NW4A 1UFQA 4IQ8A 1BT8A 1TQ6A 1LKZA 3OE5A 3HM2A 4PXSA 1HDJA 1UC4B 3OCVA 2R8BA 2ILMA 4YJ3A 2ZVZA 2QLNA 4C20A 5AW8A 5IZCA 5GJWC 2UAGA 1IBMB 1EEHA 3UKJA 2IPLA 2JJ2A 3ANSA 4FUQA 1QOPB 2Q5LA 1OFGA 3KT8A 4MCJA 5DGHA 4B31A 1UBOS 2EIMB 1H6DA 4QU0A 4XYEA 4YALA 4BJ1A 4CNBA 5C37A 1KRHA 5H4GA 3BH7A 1WD7A 4BT5A 3DZCA 3UFXA 1Z38A 2C9ZA 1FOEB 3OZUA 4G6ZA 4WJKB 4UAUA 1JAIA 4DR2B 1MB3A 1VXOA 2AKYA 4IKOA 3CCLF 4FN5A 4BQSA 1RRFA 3I1JA 3ABLC 4UFZA 3ANTA 4BNNA 1Q83A 2WA2A 3DZHA 4YV7A 4BX8A 3EDRA 1U2RA 4D8YA 1XKLA 2G88A 1QO9A 1NSTA 3JYQA 5DISB 3GG9A 4QSMA 3CZAA 4DBZA 5DLDA 5IBQA 4EKWA 1ZAUA 4LHEA 1IY8A 3DEZA 4FHDA 3UGTA 4I5EA 4AJJA 2IYEA 3BMCA 2FVXA 4K46A 1NQ3A 4G88A 1MW9X 1ORDA 3BA9A 3OIUA 4KXQA 1ZUQA 2JFHA 4RGQA 4BJHB 4H7HA 5MHTA 3HWX1 4K5QA 3UANA 1SXJE 3GAMA 5IK2D 3I42A 1H2ZA 1TD1A 3ESDA 1K3EA 3KQOA 3ESZA 3LE8A 4N9QA 3SSAA 4YR7A 3B20A 4MUEA 2QUIA 4GDMA 1W49A 2D1QA 2JJMA 1EFRD 1IHUA 2P6NA 3FF4A 2PKWA 4GQIA 1XC7A 4ZT3A 1GARA 5JSYA 1Z29A 2Z0MA 3RJMA 1OIWA 1VQ1A 2QTVA 3FB7C 3DDUA 4HDNB 3FD6A 4C8IA 4TMYA 4BN5A 4LPSA 3ICCA 4MWOA 4TKLA 3KWFA 4BGUA 4TV9F 2IX3A 4QPKA 2WRZA 1NUTA 2QJRA 4DLBA 2QZSA 3LYLA 4BIOA 1GZ0A 5LD2B 5LBTA 5D1NA 1X1SA 3ZQJA 2H94A 2CMFA 1I3KA 2RE8A 5K3CA 4CBCA 4WFJA 1XL6A 1NXXA 1N32O 5DN6G 1PQWA 1NVWQ 2H4YA 1FFAA 2Z2KA 1DFGA 3NYIA 3NGLA 4AO7A 5KTMA 3IESA 4A0FA 3HB7A 5GTIZ 3JQBC 2CTRA 4KO2S 4LC0A 4I0XA 3T35A 4EG8A 3GMSA 1B0AA 4RFSA 5A0TA 1UQTA 3FGNA 5EP1A 1F48A 3EHBB 3G0DA 2PRYA 4INJA 3LYBA 4LZAA 1ZWKA 3EIWA 5ETJA 4KE8A 3W06A 3VOSA 4D41A 4Z3KA 5K0GA 5F76A 3UMRA 4MKFA 4IT5A 5AVTA 4LHYA 2I65A 3OX4A 3ML1A 3S55A 3UWDA 3GJ4A 1CQZA 1XTJA 3DMRA 1KEWA 1R5JA 2WVGA 3KWMA 5HK8A 4E2FA 1FDRA 1ZJYA 2IEAA 3EUFA 2ODTX 1FYWA 3VIUA 1E6CA 1NZJA 1Y4UA 3G8BA 4PLWA 3VPSA 1V8ZA 2FQQA 3OPYI 4BQEA 2DH6A 2WWRA 2IOFA 3OICA 4QDTA 1Z08A 3AB8A 2JA1A 4P36A 4ZHVA 4KN9S 3B1JA 4EF6A 5HCUA 1EP9A 1GH6A 5BY2A 2AWNA 1SOUA 5HRCA 4C22A 3AG1B 2FPXA 4XCQA 2O0KA 2RK3A 2TRSB 4G5YA 2Q6TA 5F78A 4ZCMA 5JJBA 1ZVMA 3JSNA 3NTLA 2FLWA 2G28A 3OFNA 3SJBA 4POOA 5A0VA 1FUYB 1MRZA 5KPJA 1F2VA 4TS3A 2XQKA 3HJUA 4PHCA 1SOAA 3ASYA 1VQLF 3CC4V 1F12A 1PTKA 4RV5A 3TSAA 1DHRA 4BO4A 4BNLA 1CK4A 2HHCA 4R54A 3B5IA 4QC2A 4DNQA 3JATA 3AONB 4DCJA 3INRA 2OAP1 3LUPA 3PSAA 4B76A 4D9IA 4J42A 3DXFA 1I10A 2FH5B 4XA8A 2GCNA 5EAIA 4XDKA 4GPZA 3LPMA 3V32A 4OGWA 1OAKA 1BS2A 3D3JA 2GO1A 5BSMA 1G8PA 1BKYA 1VJCA 2QG9A 5AUQA 4QDUA 5CG2A 1QE5A 2FKNA 4EA6A 5JMTA 1DU4A 4K35A 2JGAA 3LTNC 4ZTBA 5KVCA 1J39A 1KYYA 3LS2A 3VPBA 4Q9HA 1DKQA 3IB6A 3P9KA 4B6SA 1SVOA 1LRLA 3AEKA 3NB0A 4W99A 5L4LA 1R6VA 4KQEA 4MVJG 4LSGA 1YJWV 1CZHA 1XU7A 3AHIA 3GYGA 2V7XA 3RARA 5JNSA 4YQEA 5LBUA 3ZU5A 3OPVA 4E5UA 2AHOA 4Y2SA 3RD5A 1JHXA 2R6AA 2B37A 3BGVA 4GHWA 4W7IA 1GZ3A 1E2KA 1M2OA 1JILA 3AESA 5BN4B 4DR6O 1BHAA 3TLXA 1AKQA 1N2CB 5KYWB 1JQ3A 3JCMM 1VMKA 4UDYX 3O74A 1ZSPA 1KDPA 2AN1A 2JIDA 2WD9A 3E8SA 1IUPA 4OHKA 4K9RA 5CBPA 1Z5UA 4QGGA 1Q77A 2QVYX 2P41A 4K81B 3B8HA 2QP3A 3ASNC 4WD3A 3IXMA 1S3FA 4OREX 4XRGA 4UBOA 1IV2A 4JXKA 5GOZA 3FCSB 3CIOA 3H16A 5LSAA 1N0IA 4QBTA 3ZC3A 1EK2A 4ALMA 2VIIA 4NULA 2NIPA 3FMVA 3DTTA 2HL6A 2X6BA 2C4WA 3PIRA 4G1MB 4B45A 1G8YA 1LDMA 3NXKA 1TF7A 1R3LC 4DWWA 5KSOA 1E1LA 2J9XB 1YI2V 1RS0A 2MIIA 3A6ZA 3ZXUB 2XQJA 4BMDA 1D1QA 4LZOA 1USVA 4EHBA 4WESB 4OKIA 1AO3A 3WFZA 2YFYA 4FE4A 4W5OA 1AMUA 3FAZA 3R5HA 4FUTA 3K70D 4KNYA 3WO1A 2VZ8A 3ASNB 1G16A 4A2WA 1UKEA 4EUEA 5T4EA 2D8AA 2AIZP 2A0KA 3FNHA 3ZXSA 4I3HA 2OGSA 3A6DA 4N0EA 2I6QA 3QFCA 4DCVA 4KCGA 4EL0A 1ZC3A 4IKPA 4YRFA 1OV9A 2HEPA 1JDJA 2EHDA 1K7XB 3JQFC 4L15A 5DLYA 3T5CA 1X14A 4YXWD 3IJPA 3KVVA 2HD4A 5TPZD 1MAWA 1SWWA 3TM4A 4DQVA 1M34A 1UBGA 1NC3A 4MQBA 4P22A 4X66B 4ACAA 1IM2A 5F1KA 2C57A 1COMA 3VHRA 1XRLA 2JIZG 3WSVA 3RNOA 1T43A 4FDAA 1WE2A 2JVJA 1TA4A 2ZQMA 4H1HA 4S1VA 4HXEB 2PKRA 3H3FA 3I32A 1F2TA 1CJMA 4LFBO 2I4RA 3CV3A 1BA2A 1T8PA 3RI3A 3RT9A 3Q2OA 1NJIW 3W2EA 5JYBA 2QSZA 3KUKA 2PF4E 5KHLB 3CF4G 4J3FA 2ACWA 2CH7A 2VP9A 3H19A 1Q7TA 3BGOS 2QI2A 4ZVVA 2WG1A 4ZI5A 3AH8A 2NZUG 2RB5A 3A4LA 3T3GA 4WFKA 4G0UA 3LBAA 1VQ9F 3K03A 2H7VA 3GJQA 3ZE1B 2DERA 1MFPA 4BMOB 3NAGA 1YFZA 5L3SA 4MUAA 1U0JA 1DGSA 2V4ZA 3AHDA 3ZE2B 1U7HA 3J81A 3J7AC 4DIKA 2R7NA 1E6LA 3L9XA 2P9GA 1V3QE 1W5AA 3M4SA 4LX8A 1UADA 1ZIXA 2VQEB 1Q0ZA 3FPBA 3RUEA 5CB0A 1KC3A 3MFQA 4LPKA 3M99B 4V2UA 4UTNA 2O8EB 5EWLA 1U1FA 4IIJB 3RA6A 4OL9A 3GN1A 4MUYA 3DKKA 1V55C 2IBZH 1VQOF 2JAOA 3PL1A 3IAUA 3MILA 3AG2B 2NTEA 3HBNA 4EEXA 3UAWA 2AW5A 4OM8A 4PNEA 3AC0A 3RJ9A 4C78A 4BQRA 5C1BA 1SZCA 5G3YA 1NAIA 5F2EA 1NATA 1NXOA 3A3NA 4R1PA 3WLHA 2DUMA 5AHOA 1RM1C 1GZSA 5ESRA 1AHPA 5BMVB 3IC5A 1TC2A 2X19A 3KQKA 2HIMA 1U63A 1YJ8A 2Y8EA 2EFHB 4PX3A 4RX1A 3WYDA 4Z9YA 1CFZA 4DV0B 2X9QA 2GLUA 4OP3A 5KHKA 3W9BA 2JASA 4PZEA 1S8AA 1YJ9F 1N5IA 2DPXA 1YJWF 2GWHA 2ZJ5A 3EMBA 1X7ZA 2O7SA 4JOBA 3VBEA 4BLQA 1S01A 5LLSA 4EW6A 4Z4QA 2CXPA 1BAPA 3TUJC 2W6ZA 1G20A 4IJWA 4LXYA 5L3CA 1VM6A 3G0GA 5KDOA 4G0YA 1ZITA 4FJ0A 2G72A 3T95A 3SYCA 3F98A 1WXIA 4YREA 3K9GA 3PVSA 1HMPA 1KS9A 4B79A 3BFXA 4C3UA 2B83A 3AZPA 1GX1A 4U6SA 4HNSA 5TMDA 3TVDA 3ILSA 1ISFA 1U0LA 1UK6A 4K3VA 1IWPB 4OHVA 3H04A 1Y9AA 5G2OA 2C5LA 3HSKA 2GPYA 5IAGA 2FMLA 4G01B 3WMXA 4AJOA 1SVLA 1E2IA 2PSFA 2PD4A 4MLZA 4Z9XA 3TW8B 2WFLA 3G3EA 4II7A 3EG9B 3LCJA 5D84A 3WRYC 3BD6A 1T2AA 3RYCB 1Y6RA 2IPMA 5JVDF 3AWDA 1XQWA 1VHAA 1NXTA 2QPOA 4L9SA 4ETIA 4G67A 1Z8HA 3WJQA 2HIGA 3GZTB 1TZBA 3AK3A 2VDNB 3MMXA 3GRYA 4KAXA 4KVZA 4LWZA 1WZIA 4U9HS 5BYJA 2D1FA 2LBXA 1NBIA 5ESWA 5A3QA 3EZGA 1OR8A 1JLHA 1H1LA 2SCUB 3Q41A 3Q3GE 1FRQA 2ORWA 3PUJA 4CR6A 1RSOB 4HTAA 4YJDA 4F3YA 1MIOB 3L4KA 3U4QA 1G4HA 2W43A 3Q4HB 3DVAA 1AGYA 3O8OA 3UM7A 1PW5A 2WLLA 1AF4A 4IILA 1LRKA 4D7SA 1ZVJA 2AN5A 2VWGA 3E82A 2C07A 4F4CA 2DWEC 3PNPA 1Z28A 5BN5A 2WKRA 3O2QB 1XJCA 1VARA 2ZRGA 1HLDA 2AZMA 5A6VA 3IP9A 1ONPA 4UW9A 1C30A 4PSDA 4Q21A 4WAUA 5L95A 2QWOB 1BMTA 1B06A 1AQLA 3C74A 1OWLA 4QREA 5EIAA 4FLWA 2FPIB 3DA8A 1P7VA 3DQQA 3OIWA 4C7XA 3ZX4A 1F38A 5E9JA 1PJRA 5AW7A 3B4SA 3TZLA 3EA4A 2Y4OA 2ZWPA 3U7FB 1JHMA 2CUKA 3A0RA 1NW8A 2NTYC 1XTUA 1GGHA 2ZROA 2ZUUA 3EEIA 4FK5C 3CMEF 1H4QA 4MS2A 4L57A 4LXXA 3UGKA 4YJ2A 3R66A 2LV8A 2G7ZA 1SK9A 4KVFA 5M34A 2PRJA 3II6X 3QE3A 1KP2A 5JJNB 2Y0BA 3HXMA 4O1IA 2RG1A 5LHIA 4BVKA 5KUTA 4Z1MA 1W30A 3SC6A 4HFJA 3NWBA 3PZRA 3ZHVA 2OK7A 4BHTA 2JVIA 1KD1W 2QRKA 1CWUA 2UZ3A 3VR5D 3FWKA 1YE5A 3CVVA 4WN9A 2HI0A 2XQFA 1RQ7A 1DL5A 3DE3X 5AI5A 4DNPA 1E7RA 4C0LA 4ZU6X 1VLLA 4A8HA 1BKDR 2H5JA 2OEPA 1EIZA 3SD7A 3ZVRA 4W7SA 4O59O 5AI9A 1MC8A 3DEJA 1O5TA 3EUEA 3UWOA 3P9PA 5A9TA 3CCRF 5H16A 2P4QA 4R6XA 4DV1B 1I3LA 3L8CA 3WLOA 1EBOA 4HQRA 4FMTA 1JSRA 4ZVOA 3U62A 2WLJA 1QR9A 1XYVA 2ZTVA 4HSEA 4IRMA 4P35A 5AH0A 1KPIA 4F04A 3NHLA 1LF0A 3A32A 3I83A 1XF1A 5CG1A 4JP5A 2A0LA 2VLIA 2ZRAA 3QMMA 1DMRA 4JLBA 3E5NA 4YMHA 5JHGB 1Q6IA 4Z0NA 3AG3B 5JS2A 2V03A 1Y9DA 4V39A 3ZTWA 3ERCA 4PQEA 4UTOA 4H6XA 1QCZA 3WFIA 1MAUA 3NDJA 3QFSA 4MVJH 4KQ6A 4BFVA 4DLNA 5K01A 1HNZO 3G85A 3UWSA 3FOCA 4E33A 2Z5FA 5J9PC 4L0DA 3ZGNA 4JYCA 1C0EA 2OO5A 5DTEA 4JFRA 3U3ZA 2PUAA 3MT7A 3QXJA 3HY4A 3RSLA 3M4YA 3X2QC 1YIJV 2HX0A 4MSWC 1L7RA 5EO3A 1MHPA 2GYWA 3DZBA 4MLCA 3ZWCA 5C5DA 2VTBB 1N36O 2OORC 3QUCA 4J4BA 2IXEA 4P7BA 1IY2A 1NN1A 4LRUA 3D4PA 2IUFA 4QIHA 3ZCSA 3FHTA 4PLPA 1ESZA 5AW9A 1FJGO 3SXUA 3AJ8A 2LFSA 3HFJA 2EF0A 4XD2A 4ZT2A 1I1HA 3DC2A 4OEHA 1A5TA 1JXAA 2G09A 4IDEA 5DTIA 3TUIC 3UF0A 1QYRA 3CJQA 3H1BA 3BFRA 2BFWA 2EBOA 3ZCUA 1R1DA 5BVHA 3IMPA 3JTEA 4EQZA 1PBNA 1AN0A 2F9FA 2Q3JA 4C7BA 4Y1EA 3LXMA 3WHPA 2F1RA 5FYQA 1EM8A 3SHWA 5HKAA 5KYYB 1AJEA 1JKMA 2X1MA 4U2FA 2BRUA 4F12A 1OT5A 5FULA 2JHPA 3TZCA 3SNKA 3ZCXA 4ZJUA 2QRGA 4UTPA 1VE1A 1YVDA 2EIKC 1M33A 2A88A 1OGJA 4OXSA 1V37A 3WGZA 4AVYA 1K89A 3FUWA 5DH9A 3T3DA 3AK2A 1PJTA 4UVCA 3ECSA 4F4UA 1HE2A 1XVUA 3UG6A 3K6KA 3MTDA 2QPAA 1ZEJA 2PZKA 4E5SA 3A6HA 3H4VA 4HAUA 1MTZA 4NXMB 3R0ZA 3IBCA 1X86B 1UAGA 1XHFA 1U2PA 4JBXA 1HDZA 4YLYA 3DBHB 5CP8A 2WU4A 1NJ1A 3OIGA 4EFDA 5DEDA 1OTYA 4HUJA 3IBTA 3IBYA 4ESHA 3IH5A 1X7DA 3CUYA 4P31A 1R4NB 1K0UA 1SNYA 2WHQA 4O33A 2JS7A 6ABPA 1IXYA 4UTZA 3IV6A 3UJ7A 5I9MA 2WJZB 1P5FA 1S7GA 4B85A 3INNA 1RBYA 4IM7A 5E4JA 4RZXA 5JE8A 4DC0A 2SKDA 3BEOA 5AVXA 4P5PA 4CM8A 4MINA 1RE1A 3C3MA 4P84A 2O4UX 3O4JA 4Z86A 1U96A 4XVCA 5JMOA 2JH8A 1WPGA 4FYMA 4U0JA 2WSBA 2VT6A 3K0DA 4KQ2A 4IF4A 1J0DA 4FDVA 4UCOA 1UMDA 2BGJA 1XBLA 3G5MA 3OEHG 4WY2A 1Z9BA 2CN1A 3KT3A 4GZLA 2YHSA 4IIFA 3LHFA 3LM8A 4RWEA 3SXUB 4EA7A 4DWJA 4ZN6A 1RVV1 3FIJA 4KLNA 4E5VA 4ER0A 1Q7CA 1QGUA 3ZOPA 1V5IA 1K7YA 1JLLB 4WV3A 3P2EA 4OCZA 1E99A 1N0HA 3L43A 4GU5A 4QDJA 2IBTA 5JQGF 1BG6A 4HVAA 2CKMA 3HXPA 1KNJA 1SPXA 3DVQX 5FLYA 1L4KA 1R9GA 5GW7A 3EMDA 3NAQA 4H35A 3GCXA 5DYTA 3TAXA 3R3HA 3VM6A 3TOSA 1I7LA 2R72A 4ZHQB 4MKIA 4MVCA 5ELXA 1JWAB 4PWTA 2YXZA 2I66A 4LOAA 1K2WA 1P1CA 3WLAA 5C8ZA 3FFXA 1EK5A 4WXHA 3L71H 2OTLF 5EP2A 3RHFA 3I6MA 2I4NA 3IAS6 3DB2A 2RDCA 3NBQA 1G5FA 1N36B 2FPPA 2FZVA 4RCZA 3BL8A 3NKFA 4HPXB 4ZGBA 3WGJA 4FKZA 5JC8A 1HT0A 2PT7A 1T0JB 2P9HA 3OZWA 2RAUA 2FYTA 1NBEA 3QVJA 3MINB 2G40A 2WFAA 2Q5OA 2WAOA 1L3IA 2A7XA 4HRXA 4C4TA 2BBWA 5DM4A 4ALJA 5A7FA 5DGIA 3S1SA 2VQDA 1CB0A 4X24A 4NC9A 5H5JA 2OQVA 3JR7A 1RCTE 5SYMA 2FSFA 2HDOA 4B3TO 5AOVA 2GPSA 3JYCA 2YMPA 2VH5R 2UXDO 2V8OA 1E1MA 2J5KA 2ARKA 3D3NA 1VF6C 1AA9A 4HSGA 3TFQA 5P8WA 2FXIA 3GELA 1SQ5A 1CFJA 3SSNA 4D44A 1G4YB 5ANRB 3U4GA 5BQOA 2X14A 5CTAA 2IEDA 3UBTA 3PJGA 4PA3A 3QVUA 4I1IA 4OXXA 4EITA 4Z2YA 1FTGA 2PBZA 5EA2A 2XKAA 1YB2A 2QQGA 3OWXA 1S0UA 2ZRJA 3UGQA 2OFOA 2N1BA 3SEFA 3SX0A 2XSZD 3VDNB 1ODIA 1V1JA 2NT3A 2VHTA 4H7KA 3RREA 2R00A 2AE1A 3R3ZA 4Z0HO 3ZE6A 1NQWA 1IRIA 4FI3C 5FH9A 3X2FA 1M90W 2VAXA 1MP0A 3G17A 3GVPA 1BYIA 4EHIA 3LKDA 1DADA 1M2HA 1OFVA 5ITVA 3UJ3X 3HBFA 1EI9A 2D59A 3D02A 4OH7A 5A4IS 3DE0X 5KIAA 4GC9A 3I5YA 3H5AA 1UMCA 3AEUB 1AXGA 4ZHQA 3FYHA 4E51A 5CBKA 1MZVA 1JCHA 1WL8A 2O8VA 3A9CA 4QBFA 3FWYA 1QB8A 1RADA 2XT9A 1YJNF 1JJIA 2ADMA 1GO1A 2QD2A 3GO4A 4MUFA 4KVGA 5LMUO 1KKMA 4HMOA 4JSYA 4O3FA 4CMKA 1SKAA 3U13A 3TLMA 5DM60 3M6XA 3IMGA 2FU5C 3UMGA 1PL7A 4I50A 3HA7A 3K9CA 1LJUA 1Y3BE 2PFGA 5HJ2A 2ZCVA 1RFGE 3KCQA 1WY7A 2VS1A 3SC2A 1HO3A 2RH4A 3I3OA 1FQKA 3JS5A 1WV0A 4G26A 2DLCX 5A7GA 2R9VA 4Q1EA 4AKGA 3QVOA 3IIKA 4K9QA 3DDHA 5NLLA 1Y1QA 1NW3A 2YIJA 5FWDA 3WGLA 3ZUGA 3KQPA 3KKPA 1B41A 2CTPA 4E3ZA 2R00C 4BW5A 5LQRA 3IRUA 3ZRXA 1JQKA 1MX3A 2VH1A 2CXTA 3H2GA 1O9BA 4M55A 1XXHA 1M9NA 2Q5FA 4J0KA 5HDQA 5JNLA 2UZ4A 1TA0A 4CZ2A 4D97A 4ZI7A 1GSHA 1U9YA 2QN7A 3NTRA 4UM9B 3TLGB 2BMVA 2H4XA 1NJIH 5TX7A 1G5TA 3DE1X 3GTZA 2WWTA 4DUGA 1MQSA 2PGGA 3H1HH 1RXIA 4JVSB 5H70A 2ZPTX 3I5UA 2Q5IA 4WZAB 1G7TA 2OLKA 1DOAA 1N7GA 1EP3B 3B7PA 4QPDA 1BH6A 5FPRA 4H17A 4NZZA 4NIMA 1SVUA 2WDPA 3I55F 2GJAA 1TIPA 3VGPA 1JJAA 5FEUA 4HXFB 3TDKA 4V24A 1RI1A 3F9CA 1I3OA 2CD7A 1KIFA 2BJVA 2JHFA 2ZSBA 5CFRA 4S35A 1SG6A 2HCTA 3EF3A 4F6RA 3DFUA 2VK4A 1JAHA 2YW9A 1T9DA 5KAIZ 4UXIA 2C2KA 4OJYA 3UAVA 4C6TA 2W6ID 4CT5A 1G7SA 2JCVA 1AS2A 1VJDA 2CHGA 4R1TA 5JXIA 3CW2A 4XAQA 5ICFA 3ZZNA 4H77A 1RWWA 3I8OA 2JIPA 3WLEA 3VR5A 2M32A 1G64A 3LQFA 1RBMA 4H2DA 5DXJA 3SZLA 4DARA 4C01A 7REQA 2IU0A 3HCPA 1J49A 2OZPA 3U1BA 4MPDA 3NUQA 1GM5A 1TE2A 3WNDA 3OZVA 1ZN2A 4KL8S 1JR2A 2O54A 1GU7A 3VPGA 4I1PA 4M9UA 5G41A 1GO3F 4HWOA 1IQUA 1VOTA 1HR0O 3Q72A 1LPBB 4G25A 3I4FA 3WYEA 3FI9A 4HHEA 4JBNA 1GKIA 1MGPA 2QUJA 2C4HA 4PBTA 4XWOA 4BASA 5FI5A 4ARBA 5CDFA 4UVGA 1ZLYA 4WASA 3USZA 5AXBA 2AOVA 3JQQA 5D1HA 3WL4A 2BSKB 3H6GA 1SA0A 1TQHA 1I4OA 2XMGA 5EKXA 5LL6P 2YDEA 2F3SA 4WJLA 4F92B 4BBZA 5K3EA 1IX9A 5H83A 4CW7A 3O31A 2PV7A 4E6EA 3GA0A 4EI2A 1UBNA 4CQMA 2WYIA 1HFEL 4LE0A 3IMCA 2QI9C 5FTLA 5REQA 1QO7A 4Z9BA 1U7ZA 3AKEA 5IT0A 2MYTA 1KYOF 2HBYA 1L5YA 4J11A 1EUYA 3HCOA 3DTYA 4GKBA 4ENTA 4UAGA 2DPMA 721PA 2I03A 4HDOB 2ONYA 4K3AA 1D8AA 4BRSA 2V1XA 4I6JA 4MTFA 1QS0B 4O4HF 4MW8A 1VYTA 4XUDA 4MUHA 4NPAA 3O3MB 3KDAA 3SIXA 3JSLA 1AC5A 1OKKA 2ZIMA 1SXHA 2XIJA 1YZ3A 5AW5A 3ZGXA 1SKMA 1MRNA 3HVUA 1QFYA 1CEYA 1ECJA 5JU6A 4JNCA 3N2KA 1RZUA 2B78A 3UQYS 4ALIA 4E1AA 4WMLA 3I3FA 3LOPA 2X8AA 3P2MA 5K2MA 1XKQA 3QV2A 1HG1A 4U7FA 4TYNA 2Y1XA 1V41E 1E3DA 4HDMA 1EAMA 1Y48E 3GRUA 4C0BA 4N8EA 2H1OA 3DONA 1JKFA 4YAOA 1X7YA 2I80A 4GX2A 2A3RA 3KXIA 3ASOB 3ETGA 3DE4X 3L8GA 4B40A 4XFJA 1QU7A 2YJ3A 3QTBA 1Z22A 4FYVA 2DJIA 4V02A 4XCVA 3D0RA 3WK4A 3QHAA 3H5RA 2WJ6A 4I46A 1GO0A 2MK3A 3INTA 4LECA 2VT7A 3EIXA 4PTYA 3H8SA 5KQPA 3EORA 4YO7A 4BLSA 2QY6A 4AY6A 3D3KA 1BGYH 4RKYA 2HOQA 3CX6A 1P39A 2J6BA 4HG2A 3ZX5A 2QTPA 1NDQA 2QIPA 1QLEB 2CNBA 2R4TA 3E1SA 4MV3A 5AVOA 4LF8B 1WB6A 2HDNB 2A14A 1W2GA 2OZLA 2X6TA 1H2XA 1SBQA 2H2IA 4FT4A 2ID7A 2REQB 3MMSA 1BEUB 1Z4MA 3PVCA 2NW6A 3DZGA 4WKGA 4DC9A 5HHTA 3HK2A 1K4CC 1Y6QA 1TB4A 3JQ7B 4L3WA 4NDAA 4HX5A 4MQ5A 4HMPA 3MJVA 3ER9A 1UFKA 4JD5A 4AF8A 3SF0A 2WT9A 4RZUA 1C7ZA 1MDFA 2H0RA 4B35A 3CXCU 1H3FA 1KK2A 3UK0A 5J4KA 1ML3A 1MMMA 1PNQA 2X0KA 3K8ZA 3QUSA 3KXPA 1NU6A 1RD4A 5LL6Y 3UJDA 9LDTA 1E3WB 4MP8A 3HJTA 3KBOA 1JB9A 1EJ6A 3TBHA 3P71T 4UNQA 4O8ZA 1WUJS 2W6CX 1F51E 2Q6KA 1JE0A 5T5QA 5HY2A 1FQWA 4OYRA 1FYXA 3ZV5A 5LJIA 3LCUA 3ENKA 3QO5A 1E3EA 2VWKA 1LW6E 1NFQA 1YASA 4JROA 2D54A 2Y93A 3FDFA 2HU7A 5EPOA 4TZ6A 5GIOC 2ODWA 5L3DA 4OBXA 4P3PA 4C8GA 4PLZA 4JWTA 4OPMA 1UMBA 4D6XA 1J06A 2DVMA 3OTGA 4JITA 1FDOA 2VF2A 3PF9A 4TYMA 2CFSA 4I4NA 2HJHA 1L5HA 2D1YA 1LBHA 1AX9A 3CY6A 4IV0A 4DLPA 2FG5A 5CEEA 4OHWA 4P4SB 2B1IA 3AUJB 3P0EA 1RAFA 4HLNA 2RGRA 4P32A 2Y71A 1E1QG 3HDQA 1MO2A 4TM7A 3UKDA 4ZI3A 2QAJA 2RFLA 2GN9A 4LK2A 4Q3OA 4UQOA 4AURA 2WJ3A 2VA8A 1RWKA 4K0RA 2GVDC 1A9OA 1NMXA 2FWPA 2ZJYA 2ZUCA 3D6MA 2M7WA 4JU9A 4TKVA 2ILVA 5C8DA 1SU6A 1E9DA 3HU5A 2EZPA 2QX8A 1DAFA 2C7VA 2VJCA 4KKXB 3H5VA 4ASUA 4LZNA 2XMZA 5H3CA 4BP3A 3G6WA 1V1MA 2D3OW 4OQZA 5EJ2A 1TEZA 4F5EA 1THMA 4DIUA 3SQMA 1L1QA 3OECA 4QJ4A 5FD8A 1QK4A 1DOZA 5E1MA 4PN3A 2ZGVA 1BZKA 1U3UA 2HBQA 2VOJA 4TT8A 1LD3A 4TSFG 4MMYB 3ZE7A 1DEOA 1R4MB 3DF7A 1I5RA 5LB4A 1RE0A 4B4UA 3ZLJA 1DG1G 3ZI4A 4F8YA 1E8MA 1GUAA 2GAOA 2XE7A 4L8LA 3QYPA 3WIEA 4E4YA 2ZE7A 3RFTA 3T9FA 2H6LA 3UOGA 5KA6A 3ROFA 1SXJA 4DV2B 1X1TA 3NKLA 4KR7A 1NR5A 4RKQA 3VUFA 3QBDA 1U8TA 5CM2Z 1TRKA 1PPJH 1S1MA 2AK2A 5KCZA 1V4NA 4LF7B 3TGPA 2G6TA 3ESCA 1S5HC 1IZ8A 2Y9MB 3IO3A 3P27A 4RS3A 2BD0A 5FOSA 3REQB 5AVYA 1DBFA 3A2LA 2G63A 5KQGA 3QMPA 1RABA 3RRNA 1P9WA 5B7NA 3OCUA 1SXPA 5KDLA 3RE1A 1WOYA 3M7MX 3B36A 3HJFA 4FIDA 1ULSA 4BNMA 3WQSB 4X9QA 1CUGA 3CSUA 5AKHA 4YHHO 1VDMA 2H48A 3A9WA 4KWCA 1S5JA 2QF7A 4FGUA 1P1BA 3ILXA 5E6RB 4RIIA 1R00A 3OLXA 3V7YA 4F2GA 1G3IA 3C3EA 4TZZA 1KO7A 2QJTA 3FFAA 3NDIA 1FA9A 1QIIA 1UCFA 2ZYDA 3DM5A 4FR0A 1XILA 2P0YA 1FRNA 2E55A 3NJRA 4IXTA 4BVJA 1ZX1A 1UPBA 5AD1A 3E3MA 3C48A 1QC5A 2G82A 1RCUA 1XT6A 1XU4A 3MMNA 3AOEC 3HY3A 4IO0A 3R76A 2VRCA 4KP4A 2H11A 1QHIA 2CW4A 2OBXA 3BHJA 3PQ7A 1VQ7V 3H8JA 5DSTA 4Q5IA 1D7AA 1ZXBA 2YZNA 4B6GA 5I7WA 1C3EA 1IG3A 3M83A 2COKA 2IZ1A 1AB6A 2EJWA 3V1YA 2JI9A 1BVRA 1EDBA 1KBOA 2F8MA 2LDXA 2WU1A 1DFHA 3AW8A 3KWJA 3Q9SA 4D9BA 2FR1A 2N1MA 1P0FA 2QMYA 3Q4GA 4LF9B 4YAUA 4IRXA 1IY1A 4D25A 4QEDA 5I7FA 1Y8QB 3O92A 4ZA2A 4RQEA 2YYZA 1YU6A 3EGOA 4U7PB 4M8NE 4ZK2A 4P0TA 3VO8A 4BBJA 1U3TA 1RHKA 1KARA 2IIQA 2JCXA 2QVCA 2JI8A 1O6ZA 3LBNA 2NPIA 3IP3A 5U4XA 4EBFA 1IBLB 2V0GA 3C3KA 4FLXA 1GKFA 1K7CA 1TUGA 3ITKA 4RXTA 3CX5F 3WNVA 5C7OO 1YQ9A 3ORSA 1TEVA 2WC1A 3K5NA 4LRYA 4REQB 3SOZA 4A27A 1JG3A 1U11A 1ISSA 4W8HA 4WVFA 3NAMA 3UHJA 1RLJA 4OQNA 3NFRA 2JLRA 1RYYA 1KAMA 1E5DA 1FRZA 3A4IA 4KHPO 2EU8A 1U2GA 5FOQA 3GP5A 1SBCA 2WBLC 1GTZA 3N59A 4G1CA 4IQFA 4H0FA 2DT5A 3LDEA 1G20B 4A16A 4NJMB 5EI5A 2I2CA 1BU8A 3KZOA 3PR2B 4Y9UA 3IDZA 2H1IA 3H1IH 4DA9A 4C4SA 3WNQA 4J0FA 1BCRA 5JAMA 1U2QA 3KL4A 1N0NA 3D43A 1VC2A 2A7QA 2ZE8A 2DR0A 2HWXA 2I6SA 1OLXA 3O82A 3GPDG 5U1PA 1T5EA 1KQ3A 2HHLA 3NGMA 4XM0A 1DQYA 2RGNC 4DLYA 3H65A 2J5QA 2FN9A 2G4LA 2C0QA 4B6FA 3IT0A 1VPWA 4YHBA 1GZ7A 5KAFZ 1P74A 3ON5A 1EWQA 3V6MA 1KZ9A 4G4ZA 4YTEA 3VFDA 2X7XA 1OA1A 3QU5A 4PGFA 2FSPA 3IQZA 3NHKA 2P6RA 4H37A 2KGWA 1Z0KA 2JAXA 5LMZA 1XJ0A 1OWPA 3GLGE 3GPIA 4BN4A 2AG1A 4CKEB 5BOVA 1GL7A 3O95A 3I34X 5EHGA 3WADA 1TA8A 3K7EA 1QUEA 3N0RA 2OT5A 4ZRMA 3N2NA 1W0JG 4HY3A 3ILYA 4ZXFA 6CHYA 4I8DA 3C5HA 4IIEA 3OBIA 5DK4A 3SS8A 4YRNA 2XJ4A 5ICMA 2PUFA 1Z2GA 1HG0A 1SBHA 1K08A 2E3CA 2WYUA 3TVYA 2X4LA 1HQKA 3KFLA 4FPXA 2M6RA 4PYLA 1YI0A 5A3RA 1PVDA 1KJJA 1N8NA 1V95A 2XDYA 3TDMA 4CKYA 2O1SA 3PFFA 5EWJB 3ELUA 1VQMV 2FPWA 4YJFA 3RFCA 1BCSA 4AX4A 4EJSC 5JEDA 2JG3A 2NUTB 3A9RA 2DYSB 4NTZA 2ID4A 4P0QB 1Z2DA 3OEWA 1VL0A 5ARCA 2JIRA 3AEYA 2QJWA 3H3JA 1I7NA 3WTBA 4EOGA 3G80A 3LCRA 4GLBA 4EYGA 1CY2A 2RKBA 1K33A 2D1RA 3WLQA 1Q8RA 3E5HA 4PNZA 1B8UA 1Z0UA 2I3DA 5TS3A 4AJEA 3R7WB 4AUMA 1XAHA 3QVXA 5FTMA 4ESEA 4YV0A 5BN4A 2NO6A 4YGYA 4DA6A 4W1SA 2O2DA 2IU6A 2CDCA 2XF8A 3KHNA 1B2RA 1A50B 1HZZC 1VI2A 5DP2A 5AM0A 4C6RA 2WV7A 3BJIC 1J2RA 2ANCA 1FJHA 5HP7A 1ULHA 2ATXA 2EP8A 3QKRA 3OC0A 4B09A 1GEEA 4ZC1A 1E4OA 1Z7WA 2P7IA 3D3QA 4Q9JA 1FVHA 3H5TA 2LBWA 4B3RO 4XFKA 4BVAA 4Z0TA 1VMIA 2CLFB 3N75A 1C9EA 1W19A 4HDRA 2GN6A 2Z2JA 1IBCA 1LA2A 4D4GA 1M2OB 2C2GA 1DEAA 1FNJA 5ICCA 4JJ8A 4C4ZA 1ZUNA 2EJ7A 1JQAA 1XQVA 5EGSA 3T7RA 3ZDQA 2MU1A 4G5OA 3K9NA 5CBPB 2O19A 4MQFA 3SYRA 2WJJA 3CGWA 3IBGA 4Z3DA 1V55B 2OSVA 2P7HA 3EOBI 3CRVA 4LJ6A 4NU8X 4P93A 3MG9A 3VHXB 2K1EA 4AFNA 4W8OA 3IQXA 4HYEA 4D26A 2QM7A 2IELA 3W3AH 2Z3WA 1U31A 1SUIA 2A0XA 2VHZA 3NW9A 3CXUA 4BNDB 4DSAA 3AP2A 3IEMA 1G38A 4CEJB 4TL6A 1U28A 5TJ9A 5AW4A 2XMRA 5D01A 2YWFA 2CV1A 3QWIA 5LB2A 3HBLA 2A06H 1NVXQ 3EB9A 3NTVA 5JSKA 2EINC 1RR6A 3RT1A 3AOGA 4QYIB 3LT2A 4Y6GB 4B7CA 3J7TA 4JBLA 3R0VA 3FNRA 1N2XA 4OO3A 3JYPA 4D5GA 4I99A 3KQQA 1K7DA 1L5OA 4TN5A 1AUOA 4MICA 3GQVA 4UKDA 3HABA 2OUKA 2ROQA 3FG9A 4IYHA 4FCTA 4G1FA 4P53A 5HY1A 4IOLA 4XYGA 4DDWA 4KODA 4TSKA 5AQ1A 3PPWA 3BWMA 2AT1A 5D51S 1IHDA 1HFJA 2W0XA 3K59A 3STTA 1J9EA 5BW8A 4D9HA 3X1WA 1GTL1 1JWLA 5LU8A 2ORIA 1DT9A 2XUHA 3MPUA 1V1RB 3CD6V 2WSLA 3OM0A 3AEQB 4F7DA 3P2JA 1Q50A 1MHTA 1G9TA 5EZ6B 4MEBA 3EUAA 3BF7A 3FFQA 2Q1XA 1U94A 2BBOA 3REFA 2PUCA 1D8TA 1F4VA 4GCZA 3LW7A 1FLNA 4L27A 5AK3A 3GOQA 3OCXA 3AGKA 3KR0A 1PVVA 2IJIA 2AMFA 2WSSD 2B2NA 3QPCA 4GF5A 4EUKA 2YXNA 2A9OA 4B3MO 5KPDA 1K6XA 3EPRA 2OV2A 1OI3A 3FDJA 1FXWF 4X61A 1ECPA 3SE7A 2C4TA 3JPWA 1VPEA 3HTXA 4PV7A 3S5UA 2OD7A 4QDOA 3TZKA 2FJUA 4L8YA 4ENPA 4HDCA 4DAEA 3TQFA 2F4VO 2DTXA 2B98A 2BR3A 1R3KC 4G1EB 1LPNA 3MCTA 2PZBA 2QP4A 1GAWA 2XADA 3L0OA 1PWEA 4CI9A 1GKLA 1YCGA 1P18A 1JW9B 3GWKC 5TJHA 1X92A 3AQ4A 2ZG6A 3QJYA 3K57A 4XDJA 3KE8A 3R5KA 4DJFC 3OCWA 3PP8A 4QJFB 3V7EA 4IDOA 3K4HA 5KOYA 4C7JA 1Z4JA 3C8ZA 4Z54A 2ERCA 4HL6A 1D5AA 3U31A 4IFTA 2CMHA 2G77B 2Z6QA 4OHPA 2F1HA 4N01A 5DN9A 2XCUA 4YAFA 2BFEA 3D8BA 3V80A 1XRSB 3P2OA 4C0XA 2IXBA 2HF8A 4ZYWA 1DBVO 4MVJD 1J8DA 2CLDX 2H57A 5FPQA 4BXOB 3OIDA 3ZWNA 5H0IA 1MJ5A 2B61A 4HAZA 1MNQA 2O2ZA 4KBGA 4N7BA 4ZHYB 1ZAKA 3JRNA 2O2XA 5DF1A 4XLZA 5DV9A 2BC9A 3AYXB 5FBHA 5JCZA 4WLFA 4KB5A 2RH5A 3KDSE 3QXCA 3RT7A 1LJLA 5DBEX 5IRCD 3MJEA 5I4IA 3M70A 1RKUA 4PTLA 3HKEB 3KAQA 1OXMA 2ZJ3A 4FJCC 2E5FA 2P35A 3PJEA 3Q15C 5CM8B 3W5DA 4BCDA 4J03A 3BXPA 1EGHA 1QVVA 1EFDN 4FFRA 2P79A 4LVUA 3F9RA 5JMPA 1FXKA 2OB2A 3PKZA 3A3PA 2ERXA 5FKJA 4TLEA 5KVAA 4CUKA 4ZKDA 4Q7MB 3RVPA 1YL7A 1W40A 3EYAA 1NN3A 2O7RA 5B7QA 3DEAA 4IBOA 3E2EA 3MCUA 4BVRA 1RM5A 2VUUA 4RLQA 3CLHA 4YP0A 2W0SA 1J70A 5F1PA 1LCIA 5IULC 3C1TA 1EGVB 3QKWA 4UUQA 3OQBA 5DO9A 3WLFA 2JFZA 5JECA 3B6NA 1XVLA 3BFPA 3FYIB 3FVWA 4JAVC 2DUUA 4LCEA 3RV3A 3CISA 4MYTA 5EWMB 2OESA 4H16A 4ON9A 5B36A 2IW1A 1H2LA 4I19A 5HQJA 4UU8A 3HCAA 2MSWA 4NH0A 4HN2A 4LMBA 1F60A 2VAVA 2HDHA 2V7GA 5H02A 4A15A 1BC5A 3NBXX 2F1IA 4UUNA 3BKWA 1BA3A 2EILC 1HYHA 2EIKB 2CVPA 3K1JA 1C30B 3QVLA 4G2NA 2CW5A 4OQDA 3JY6A 1U2TA 2GN1A 4KFTA 4B62A 1U5AA 3UAXA 1Z5WA 1T3GA 3PDCA 3B6KA 4Y6OA 1QIFA 2NZYA 5KNLA 1X52A 4XVQA 2Z6VA 3PV0A 1EE2A 2CGOA 4K7JA 1FB5A 2D3TA 2G07A 2CAZC 3L70H 2LXNA 2R9AA 3AT1A 3GH3A 3HBMA 3TIFA 3FNBA 4JQOA 5F21A 2IEYA 2FK7A 2MSLA 2O7VA 3K15A 1XJWA 3DXYA 3GUCA 4I5GA 1B1CA 5ALTA 4Z51A 4ZMSA 4URXR 4CF6A 1EXNA 2FFJA 2GPAA 4DJAA 3WP1B 1RKXA 1Q6YA 5F77A 5FT9A 5IM4F 3IOEA 5LNK6 1R6NA 1TJPB 2NV6A 3V7NA 4CETA 4RNDB 1YDMA 3GFFA 4M7OA 3SIRA 5KI6A 4BZZA 3VU3A 1JJFA 4KXVA 5HXAA 4RORA 5L7WA 1L5VA 2C5EA 4XD7D 1QPGA 3RRZA 1Z4OA 1XD8A 1B42A 1DC5A 4MVMA 2PS1A 1M6YA 1GKYA 2D2CB 3H4IA 5IAOA 2X40A 2BDTA 4QHTA 1D1SA 2SECE 4J9UE 2Q73A 1R15A 3TO5A 2HFJA 2Y76A 1C9KA 3VDQA 3N7AA 5L3FA 3U3XA 2GHRA 4P3OA 2HJSA 3UUGA 1T9BA 3KSRA 4OU5A 1E5QA 1Q1AA 3AVQA 2EEZA 2VC2B 1LS1A 1RI2A 4BBPA 1XZJA 3AL2A 1HTBA 3CE6A 3RM3A 5JXGA 1MO6A 2GXUA 1PS9A 3IUSA 2FEPA 3TINA 2ZBQA 4ZCLA 3GUVA 3BEHA 1LQ2A 4M54A 4EJ2A 3I1FA 1WMDA 2FI1A 4R98A 3LWRC 3B2EE 3PX2A 4IQGA 1GCIA 1I6KA 2RHGB 3O94A 2F93B 1FXWA 4TZKA 1VE7A 2A9FA 1TADA 3I9V1 3KS9A 2HS0A 1KXJA 1GA6A 3LYHA 3NDRA 3H1PA 4EQ6B 1XZGA 1WXWA 3CX4A 4L87A 1JEYA 1ZAYA 2B69A 3H9QA 3E9QA 1UBFA 3P9QA 5DWVA 4ARUA 4RO0A 2UYNB 3LPCA 1P9RA 3W7XA 2QZPA 4HDAA 2ZUSA 3C8LA 5EE3A 2QTLA 1E3LA 1KO5A 1NE7A 2VDQB 1LC0A 5K4AA 5BN1A 1EK6A 1P4JA 5IBCA 1LDGA 1V3VA 3GRVA 1VI5A 1Y76A 2Z08A 3WE7A 3FOEC 1KI2A 2EFEB 1AB5A 5HUJA 2PY5A 1W36D 1Y9ZA 2XAHA 1UWLA 3GVCA 2O8BA 1ABEA 2NYRA 2H06A 4FILA 3D36C 1II8B 4D7AA 4H4DA 5B3KA 3OQOA 2GBOA 2B35A 1XNRB 2AG5A 3IUEA 1P3JA 2O0MA 3LIPA 4CTJA 3E86A 2HS3A 5L8VA 2BH9A 4N12A 1RZVA 1Y6ZA 4NU5A 5CBHA 4PS0A 3SVZA 4PG6A 3V4SA 3WB1A 5GVRA 2AJCA 1ONSA 1X1QA 1HQYE 4J80A 1EK0A 1XLUA 4LH7A 4D46A 4EW1A 2CLMB 4IVRA 5COBA 3EGEA 3EX7C 2ODBA 4MS1B 1Y7IA 1CDOA 5HJ5A 3H11A 1L7MA 2XAQA 1QBKC 3L6CA 2YJZA 1PSZA 1KORA 4MVSA 1D2DA 2OWDA 3CLSC 3G5UA 4G1BA 4M0DA 3ADBA 5JPCA 1QU3A 1TKRA 2PRKA 4UTRA 1M2NA 3LYAA 2GS9A 3P9RA 1XMOO 3JRXA 1Q90D 3CF4A 4GXRA 4TSRA 1JS1X 3AKDA 3ZNPA 4H7FA 2VWJA 4UE2A 3AG1C 1UFYA 2WNSA 4FEGA 2OXRA 3OOJA 4GFDA 4J6EA 3CW8X 3GYBA 4P54A 4TYQA 4IWNA 5AW2A 4JGSA 4OYYA 4RFLA 2I6DA 2UZ1B 2CHUA 1P2VA 4AKIA 4JAUA 4LOLA 2Q1WA 1SUCA 1WEHA 3DMYA 3ZW7A 3HN6A 3HQ4O 1OPXA 4RMIA 1B3BA 2C98A 3GGGA 1ZUIA 1AP5A 1JN0A 3LQ4A 3NDPA 4FLYA 1XNRO 3IVAA 4CM9A 2XBMA 5I6DA 3HU2A 4DSOA 3RVKA 4RLHA 3GT7A 4INOA 4YONB 2GAJA 4ND2A 1W36B 3AG4B 2KQUA 1N57A 1UMDB 4KO1S 4NYJQ 3ER8A 4CV3A 3LUTB 5JNRA 1GNPA 2WIGA 4ND8B 4EHLA 4Z7QB 2G08A 1RTKA 3PF8A 4FGWA 3JALA 3NR7A 2E76B 3E8BA 2DECA 2OGTA 2Z57A 3PWTA 4YCCA 4X89A 4XQEA 2CF6A 5J59A 4JV5B 4NE7A 4YBZA 3VU8A 3PUYA 1JHVA 4JUAA 5IABA 5J23A 1TEHA 2YRWA 3I5AA 1W2BF 2BKVA 1DJOA 4O4LA 4FYKA 5HY4A 4Q9LA 2BGMA 5AKIA 5KAPA 4M53A 4EMUA 4H31A 2Q6IA 3K4QA 1PK7A 2P0EA 6ADHA 1WU7A 1YRWA 1POXA 1UJCA 2CJWA 4BCCA 4I3GA 4XW2A 5ER9A 2V9CA 3U37A 5FWYA 1FJ2A 2VPWA 3CSXA 1HK7A 1XCMA 4JLSA 5K99A 2FX5A 3DMDA 5KYVA 3WXMA 3O73A 1J20A 2WJYA 3IVGA 1HSOA 3AVVA 4CV2A 3MOGA 1ULBA 4OHYA 3ENNA 5B1YA 5C3MA 5JADA 3TECE 1V8OA 4DM3A 2NMUA 3GLRA 2BEVA 3IEQA 4MW0A 5GIPE 2WTMA 3PBKA 1NM5C 3IOCA 4BX0A 5JT1A 4B2LA 1Q7YH 2AYXA 3BZBA 4LJYA 1UJ6A 2HB6A 5CLHA 1V25A 2V7BA 3S70A 4PINA 2NO4A 1MOSA 4BT6A 3L07A 1I01A 5DMHA 1DBQA 2NO5A 2WSSA 2VZLA 4KN6A 5CT8A 4EKGA 3GAAA 3T1QA 3N8KA 2BTOA 1HL7A 1AILA 2ONCA 3DAFA 1OIVA 2AFIE 3Q87B 3OKAA 1IEXA 4FJ1A 4YECA 5K8TA 5K8JB 3HFGA 1CZUA 4R9NA 5JBQA 3CRZA 2CEKA 1DC6A 4YUAA 3FBTA 4L6CA 2QXTA 4WUVA 4HNGA 1TZMA 4YJGA 5L40A 1CQJB 3QNWA 3HEMA 3DLBA 2QQEA 1G55A 3I61A 2QG4A 4ZYVA 3SZUA 1VTKA 1VLJA 3RSFA 2G06A 1CV2A 2ZBRA 2QYOA 2XB9A 4A03A 3EODA 5A4FS 4L50A 4TZ0A 2WSIA 4DIMA 4GLXA 3OZGA 1II9A 3I23A 3UIEA 1TI7A 5EXEA 2GUWA 3ZDZB 2G0AA 2IIBA 2R6JA 1S2MA 1ZM3A 4G65A 4LF4B 1TF2A 5ALQA 4Q6WA 5HMMA 3VNQA 4MUMA 3FKSG 3ONDA 4L75A 3TOCA 4DM4A 3GJ6A 4FE7A 3ZU6A 2QA4F 2O5RA 1BD3A 4WUTA 1T1EA 2O6LA 4NF2A 4JYYA 2J4DA 2P9YA 1V9LA 1XAIA 3MT0A 4ZFNA 4BMCA 2N05A 1P4RA 2XZDA 5FOWA 5L4NA 3Q88A 2P11A 4M1YA 1GAQA 4KNVA 2HVJC 1GNSA 2F8LA 3CLUC 4RCVA 3LIIA 5FFNA 1TUBB 1SXIA 3CEIA 1N8TA 3NCHA 4BIMA 4ZICA 2XZOA 3AEUA 1C41A 2I6UA 4OOEA 4URUR 3OIYA 4KWHA 5IWAO 5BSGA 1JZSA 5LVAA 2AJ8A 3EFOA 5JD5A 5LIRA 2WHPB 4LY0A 2YNMA 1WVMA 1F2DA 3O8BA 5JASA 1P6XA 1Y7LA 4PBSA 3IQEA 5CMUA 4XXHA 4Y2TA 5JYDA 1U2DC 2Z4SA 1N78A 1YCFA 3HKCB 1RFLA 3AJDA 3G2OA 3PC8C 4L0CA 4OJTA 5FPTA 5EHXA 1T2EA 1A4RA 3E3OA 2DQ0A 1EA5A 3N3AC 4LQ4A 4E03A 5BMVF 1FDTA 4EI8A 3W3AA 2JZCA 3TE6A 3ZD8A 3MDSA 1Y1TA 4UZSA 4N6NA 1KECA 3MZ0A 4WXRA 1R1MA 1X7XB 5FR1A 2BFDB 4GI3A 3E61A 5EL0A 4M8IA 2RNBA 1WP9A 1JHPA 1G4UR 4QRDA 5HRAA 1A8IA 1CD5A 1LNQA 3GCDA 1V54C 5KWSA 3SQXA 3THRA 4MPTA 5A2QA 4KGZA 3DXZA 1VQNV 4YACA 1D07A 3FX2A 1W55A 2ZVYA 2PQ2A 3AI1A 4J3JA 3G89A 2H18A 2OV1A 2A84A 3DZIA 2DX7A 5JCJA 4C76A 4U3JB 3BSSA 3AG2C 1HH4A 1KO1A 1T36A 2CLHB 2QD5A 4HEHA 1XWFA 1XN1A 4TTPA 1NHWA 5GIPC 1DTWB 2QSAA 3EWSA 3VKWA 3STXA 3L82B 5MGNA 1J7HA 2C5FA 4GI7A 5D3MA 1UK7A 3ZG6A 4X62B 3PC3A 2IVZA 2FUCA 5JQGA 1XZKA 3BEDA 3MPOA 4JB0A 4CCAA 4DMFA 5U9CA 4ZVNA 2XEDA 4IHKA 4CODB 1ESMA 3AR5A 1Z07A 5A02A 5LUAA 5FL7G 2CGEA 1JA0A 3I7TA 1U2DA 3LX4A 4LRWA 4N8DA 4RETA 2WM9B 5EXXA 3X1YA 4FM9A 2PMWB 3JYHA 1YQDA 4UCFA 1UFVA 1G42A 2HT6A 3AVWA 2VJNA 2JVDA 1YNSA 2CHQA 3UCSC 3WA6A 3AVPA 3F5SA 3IJRA 4YQFA 4M1SA 3M1XA 2XA1A 3K16A 4W5JA 1VG8A 5HBGA 3SHFA 3B48A 4DGQA 2ZRPA 2ZIOA 2XLCA 3CCSV 1U5BA 3B3QA 2V7QG 3BDIA 3CQ9A 3EGXB 3IV9A 3K3PA 1HT2E 3ITNA 4QXPA 5E6RA 4DL9A 3GPLA 3C5CA 1UBHS 2GZAA 4AZWA 7REQB 1N25A 2YIMA 3PT5A 3GLFB 1RPOA 1IYZA 1DTOA 4JI5B 1QZZA 2AR9A 2ZWVA 3DGFC 3ONWA 4O2RA 4FQ5A 3JQAD 4C0KA 4E0BA 4DRXB 2X42A 4F2HA 1O5IA 2ZM5A 3FCCA 3NMUF 3FRHA 3MYRA 3TS1A 3AINA 4F21A 3NG1A 4QUBA 2ZUEA 2EOAA 5IUJC 3M1YA 1H9CA 1ISJA 3QOXA 3M33A 3KRTA 2FPKA 3B1KA 2VAPA 5JJCA 1UBUS 3LNMB 3GRCA 2F7SA 2BFBB 1QTNA 3MUFA 4EA9A 4IGAA 1N3YA 1DWPA 2Q1TA 3U61B 4WINA 3I3SR 3DP9A 1HRKA 1JUDA 3I2KA 4HQFA 2XYRA 2O8DB 5FWXA 2HSDA 1CR1A 1W73A 2WF7A 4RVNA 3MTEA 4AMYA 1RJ9A 1GOTA 3B60A 1CY7A 3EXHA 3O8QB 2WZBA 2GSMB 4CQMB 1DC3A 1JJVA 4B3BA 2EW8A 3E9YA 4JBWA 8ADHA 1LPMA 1JG7A 3DZ8A 3ISTA 4G86A 3TETA 4ILEA 2D5CA 2W6PA 1QZUA 1S9DA 2PBRA 2Q8VA 5C2JB 3A0UA 5I5GA 5FL3A 3E1KA 1V3TA 3OHSX 4WX2B 5DVZA 1EX6A 4BVGA 2VQ3A 4P98A 1KL7A 3TXYA 4YY3O