4I55B

Crystal structure of tubulin-stathmin-ttl complex
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
428
structure length
425
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha-1B chain
publication title Molecular Mechanism of Action of Microtubule-Stabilizing Anticancer Agents.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell cycle
total genus 162
structure length 425
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4i55B03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4i55B02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4i55B01
5EIBD 3UT5B 5KX5A 2VAPA 3JAWB 2BTOA 3UT5A 3JAWA 3JASB 4O2BB 3JASA 4O2BA 4KWEA 3RYCB 5FNVB 4O4HB 3RYCA 3JATB 5FNVA 4O4HA 3RB8A 3JATA 3ZBQA 4TV8B 4TV8A 3M8KA 2RHLA 5BMVB 5BMVA 5CB4B 5CB4A 1RQ7A 1Z5VA 4O4JB 5LXTB 3VOAA 4TV9B 4O4JA 5LXTA 4I50B 4TV9A 2RHOA 4I50A 4I4TB 3R4VA 4I4TA 3CB2A 4EB6B 5EIBC 4EB6A 1W59A 5IJ9B 4LNUB 5IJ9A 2R6R1 4LNUA 1Z5WA 5LA6B 3WGLA 5LA6A 2XKBA 4U3JB 3N2KB 4O4IB 4X20B 4U3JA 3N2KA 4O4IA 4X20A 2GVIA 5JVDB 5JVDA 2BTQB 3RYIB 2BTQA 2Q1XA 3RYIA 5J2UA 4O4LB 4YJ3B 1FFXB 4O4LA 4YJ3A 3VPAA 1FFXA 1OFUA 3JAKB 1SA0B 5KMGB 3JAKA 1W5BA 1SA0A 5KMGA 4DXDA 5ITZB 3C8LA 3N2GB 3ZIDA 5ITZA 4EI8A 3N2GA 5JCOC 3WGMA 4FFBB 4FFBA 4X1KB 5JCOA 3HKBB 4X1KA 5J2TB 3HKBA 1W5EA 4E6EA 5J2TA 4EI7A 3JARB 3JARA 4DRXB 4DRXA 4O2AB 1W5AA 4O2AA 3E22B 4YJ2B 4M8IA 3E22A 3RYFB 4YJ2A 1RLUA 5M7EA 3RYFA 5MN4A 1W581 5IJ0B 5IJ0A 5EYPB 4U39A 5EYPA 4ZI7B 4ZI7A 2RHJA 5MN5A 5LP6C 2VAWA 3M89A 3RYHB 5LYJB 3WGJA 3RYHA 5LYJA 1RQ2A 5LP6B 5LP6A 2R751 5MN6A 1TVKB 3JALB 5JH7B 1TVKA 3JALA 4ZOLB 5JH7A 4ZOLA 5GONB 1W5FA 3VOBA 5GONA 4HNAB 3HKDB 4HNAA 3HKDA 2RHHA 5CA0B 5LOVB 5CA0A 5LOVA 5C8YB 1TUBB 5C8YA 5JQGB 1TUBA 4EI9A 5JQGA 4IIJB 4IIJA 3HKCB 3HKCA 4XCQA 1FSZA 3WGKA 4X1IB 4X1IA 2VXYA 4ZHQB 2Q1YA 4ZHQA 4I55B 3VO8A 3V3TA 4I55A 5IYZB 5CA1B 5IYZA 5EZYB 5CA1A 3WGNA 2VAMA 5EZYA 3HKEB 3ZBPA 3HKEA 4IHJB 4TUYB 4IHJA 4TUYA 4B46A 4WBNB 4WBNA 4F6RB 4X1YB 2XKAA 1JFFB 4F6RA 4X1YA 3VO9A 1JFFA 5J2UB 5KX5B 4B45A
chains in the Genus database with same CATH superfamily
1I5XA 1W25A 4UU1A 4UUAA 2L17A 4JOQA 1J7HA 4YREA 2CL0X 4E12A 4EO7A 1N32O 4GKVA 1XJ5A 3DFFA 1SKQA 1R1MA 2VWKA 2F3SA 4CIYA 3JAKB 2ACVA 1XA0A 5CR9A 5ITZB 4P32A 1G5TA 1FU8A 3QX8A 4RENA 5IXSA 3CUTA 3QVLA 2O8EA 2YV4A 3CW8X 3K5WA 2GVDC 3FDZB 4GT1A 1QPGA 2G0TA 5D3KA 3ODGA 4OXYA 1XNQB 1KQOA 4ONEA 2PGDA 1X1SA 4TWAA 5HXUA 4GECA 2CF6A 1AKNA 1ODIA 3HWSA 2Q68A 5AOVA 1Z7WA 1ZH8A 2GSMB 3TVYA 2VWHA 2O7QA 2BEJA 4MVJD 5DN6A 2OCBA 2V65A 2E5LO 5LGNA 3UT5B 5B3JA 4L4SA 2P2DA 1G19A 3NASA 3D4OA 4INJA 3MFYA 5DXJA 2V54A 5HKKD 3SSNA 3P0IA 3ZRSA 2IXDA 3QKRA 3OEWA 1XTKA 3T2MA 4QGGA 2V96A 3LDGA 1EU1A 3PUVA 1V2HE 3C5VA 1JB1A 3DL7A 1M34E 1XTZA 1NIPA 3INRA 2C2BA 4RD2A 4XWWA 2D4AA 1H9BA 1FP6A 1K9MH 3Q8LA 2O20A 4OYLA 2VWJA 1U7HA 4N49A 3ABTA 4NXMB 3HEMA 4XM1A 2RHJA 4JSYA 5DN9A 3JAMA 1PZXA 3MWEB 4P08A 2I03A 4U2DA 3PF9A 2XYHA 1RI1A 3SPHA 3QYPA 4N39A 5F2EA 1K97A 2ROQA 3N6XA 3SYLA 5BXYA 2HA7A 3FYTA 2Z3ZA 1Q1QA 2RBEA 2W8BC 1WA8A 4X1IA 3ASYA 1QU7A 1RI3A 1R0ZA 4ZCMA 1KERA 2HA0A 5KTPA 2DULA 5T4EA 2H6LA 3BGIA 4CIDA 2BHSA 3PSAA 1P1JA 1FSPA 1UOEA 1QGZA 3DZIA 3CRRA 5LYJF 4BFLA 2AL7A 1MQ9A 3SQNA 1ELOA 3A4NA 3LJKA 4EY3A 1BU8A 3CY6A 1TQ6A 1NW9B 3AGKA 2H11A 5KCMA 3Q2IA 4ZYZA 3IUPA 4BO1A 3MPUA 3HI4A 3OMWA 2IZZA 1STOA 1B2LA 4N7MA 4P7BA 4OHRA 4FBLA 2CMDA 2UZAA 3WLEA 3KYDB 4TTPA 1P2VA 3T7DA 4GMFA 2N46A 1CRZA 3RU7A 5GIPC 3W3ZB 5K0GA 1Y81A 1UMDB 5CEFA 3OE7D 5BSKA 1JHUA 2CW4A 4CMJA 3UN1A 4ALLA 1JEYA 6REQB 4WXRA 1QWOA 2D2VA 3VR2A 3D5QA 1BE0A 3ZDYB 5TQ2B 3DQQA 2RK6A 4PAMA 4ZAYA 1L8AA 3VR3A 3SEAA 3R8FA 1BMFG 1JVNA 3DT8A 1AR5A 4LF9O 1CY4A 3NPMA 2F4NA 1CJUC 1PUJA 1VQKF 3KJXA 1U0HC 3CKMA 1UPGA 1RXIA 1M67A 5ARDA 4QGBA 4K6FA 4ARZB 3CURA 5DRTA 2BKAA 4ZZ2A 1T6YA 1SXQA 4IVPA 1NXXA 2P27A 4HYYA 4PX5A 2YDYA 3FB7C 3LH5A 4U2EA 2DT8A 4F2PA 4OHYA 4P4UA 1Q1EA 4KE8A 1IIRA 4XWGA 1HDZA 4FP9A 2AJDA 4I50F 1OI7A 4G37A 8MHTA 2RDMA 1M5IA 1OXBB 1DQSA 1MH1A 3H5LA 3GEPA 2WM9B 3ZTYA 2NOAA 3JYPA 4GOKA 5LBTA 3GNLA 2ZJ4A 3WRYC 4MP6A 3ODPA 1EVKA 3Q7PA 3NETA 1RXSA 2ATIA 1V39A 4TTQA 2QRJA 4A0HA 2YW9A 4UPEA 2V4MA 1BWSA 4GPBA 5YASA 2HBRA 3VR5H 4KGDA 1U0TA 4OBXA 2O2JA 2QVXX 5LMZA 1JSZA 4BN0A 4BLQA 1JBQA 3INYA 3H0KA 2Q3JA 2VVTA 2AQIA 4B3JA 1WW3A 2YJ5A 2R25B 4FYMA 3EBPA 1UDWA 2GI4A 3OOJA 3PX2A 4QOSA 1UPAA 5EJ8A 4HNHA 3TNLA 1B3BA 2ETVA 4MK4A 3CVUA 4JZYA 5JVDB 4KMSA 2WWGA 1YB5A 3H9CA 2CK3G 5ESWA 4Q15A 4DM3A 2V3WA 4ETMA 3S3TA 2CNLA 3JARB 4IS2A 3O03A 3GHHA 3A9CA 3C7AA 3SM9A 1OWOA 4S1NA 1BCSA 4UVDA 4E21A 1XU7A 2O1SA 1GA1A 5FA5A 2WMOB 2QA5A 4DGQA 3LP5A 2ZJFA 1R0SA 4AS2A 1OYYA 2X76A 4P54A 2VJDA 2FN9A 1ZMRA 3IEKA 3SSMA 3X3HA 2B21A 3L71H 1N5MA 3OCVA 1F0NA 4LY0A 2GK6A 1C80A 1DG9A 1CEEA 3N87A 3NHBA 2P9TA 4W5WA 2XKAA 2HIHA 4AS3A 2XE4A 1FKAO 1O6GA 1NVEA 5KWIA 1EB9A 2OAQ1 3CFYA 1K73W 2CFSA 3HO8A 4P33A 3ABOB 3ROQA 3G5LA 1X7ZA 4Q18A 3HY6A 1K4YA 2ZI5A 1H4TA 4FLMA 3A2FA 3A31A 1VGRA 1XQXA 3RTGA 3K5MA 4M1QA 2UUCO 4PSCA 3CR7A 3BTVA 2JK5C 2AW3A 4LIPD 1FRNA 4TWIA 4QOGA 4IWXA 2P5SA 4AZVA 1C50A 4L87A 1XU4A 2Q99A 2IZ5A 5TQ0B 3L74H 3TDMA 2XMDA 1RLJA 1ZI9A 1XDGA 5KTOA 3E3MA 5I7UA 1CEQA 1IC6A 3FE2A 5T4HA 1M9NA 3AJAA 4DR3B 3D4BA 3FH0A 3FB8C 3FPJA 3FCEA 5JNTA 3OMNB 5HDBB 2IFTA 3QMWA 2H7YA 3EQ6A 3TRKA 2I2XB 1QJ4A 3C5CA 2AF3C 3G9UA 1N3IA 4P7KA 4DB4A 5DTIA 2XEDA 4CQJA 2XPCA 1QF7A 5IN4A 2LIVA 1QGOA 2RGNA 4XYLA 2LGQA 3MRTA 5ER6A 4RD6A 1AQYA 2QD5A 1SBIA 2YN0A 2GLZA 4WBXC 2AIZP 2JJYA 5A6SB 1IK6A 1H2XA 2B37A 4N3AA 2IXGA 2GA9A 4UCSA 3OH8A 3L82B 1OFVA 1KOJA 3TZHA 4A3SA 4HZ3A 1UXOA 1TC1A 1KEZA 3KOMA 2PKWA 1BWPA 1IB0A 2VOEA 2ZJBA 1HR0B 2VTKA 4TV9F 4C5CA 4EWLA 1EBOA 2ZVDA 4H27A 1JJ2F 2A4KA 4RPCA 1Q0LA 4F1JA 1FEZA 3DHNA 2HU2A 2OCDA 2XAUA 1ID8A 3KQSA 2HADA 4ENVA 1TIBA 4AZ3A 2QEXF 3I0MA 3K5IA 5GV7A 2XRMA 3W7TA 1OYVA 4FXOA 5I51A 3QKSA 1T9CA 2CLSA 3L8GA 1HL3A 2G25A 4K05A 4DCPA 3W2FA 3ABMC 1HKHA 5A7HA 2NWQA 4GMXA 5I7OA 2O3TA 4HH4A 2FX2A 2A0UA 4B6SA 5L4NA 5L3QB 3F6PA 1QKJA 4R2LA 4C43A 2J41A 2G09A 1FFGA 5IEBA 3KJQA 3H2JA 2AG8A 1JOYA 5GOZA 1CDZA 6PFKA 1NN5A 3RQIA 3NBQA 5A9SB 3I9NA 2OV4A 3D54A 1E62A 4ND8B 1THGA 3FUVA 1SRYA 1ZZEA 2W6JG 3LW7A 4DRZA 3OI7A 1U7DA 3NALA 2QJFA 1BMFA 1PT7A 1N2BA 2XSZA 4PZAA 5D3QA 5E9QA 3HAXD 3V1UA 4PWYA 4QDUA 5EL0A 4BBPA 3L70H 2QTNA 3DMRA 2FPIB 1T4GA 5HIMA 1G60A 1M7GA 2W37A 4RHAA 3Q9SA 3G6EF 5BNZA 3BD9A 4MEAA 2QZSA 4C4XA 5AVTA 3APOA 1T4MA 4LJ5A 5BN3A 3LBNA 2SCUB 3O9MA 3AZPA 3CA8A 3K04A 3D8HA 5CW1A 1Z0SA 2YHIA 2Z2JA 3KZKA 2FK7A 2LBTA 3WLLA 3N2NA 3G5AA 4E46A 1J8YF 1FYDA 1FLAA 4M0EA 1PGPA 1UMCA 2I2BA 3CMAF 4BE4A 4ZT6A 4PDMA 3X1KA 1HTWA 2O8EB 4KC0A 2HPVA 3BFPA 2V4DA 2BFMA 4WFBV 2Q9CA 4QQ8A 4QXQA 1RI4A 3E3NA 1C9MA 3ZWDA 3EDOA 5CFQA 1SKAA 3GDGA 4OQLA 2DLNA 3AUFA 4U4AA 4R6ZA 1GTRA 5DLDA 5LQUA 3WMRA 5AG2A 4UBIA 4Q00A 4GL4A 1H1TA 5KYTA 2ONCA 1KEEA 2Y92A 3STVA 3GZJA 2Z01A 2CK3A 4KI0A 1HXHA 2ERXA 3JAMN 1DOHA 2ORED 3SE0A 2YY5A 4GI5A 3ZUGA 2EIMB 4XUDA 2B1GA 3BGWA 3PFBA 4M0KA 1VMEA 2QRPA 1KDYA 5BR4A 2WLTA 3PRKE 5K3SA 2H1RA 2O4CA 4U2GA 4UREA 1D5AA 1Z83A 3EIFA 2EWCA 5K05A 4QTXA 3NVMB 3WLFA 4ZOEA 5A3QA 1Q82W 4O4LA 4NBSA 2IK8A 3VR2D 2AJLI 3E9NA 5SZKB 4RNDB 1R10A 3H0EA 3MXOA 2IL1A 3ZE1B 2PH1A 3BWMA 3VKFA 4GOND 2CZGA 3VR3D 2G5PA 1E94E 3L0PA 3DKKA 3FWNA 3VTAA 3HHPA 1N25A 2AKYA 3OGCC 3F0TA 4PLHA 1UUFA 2MYUA 2F3TA 2JEOA 1WA8B 3FGNA 4X1IB 5H9CA 1NJ1A 3MJFA 2WQ6A 1PDVA 4HP8A 1XMQO 1Z5UA 3E1SA 1Y7LA 1XEQA 2DR3A 1NI8A 2CGOA 3CF6R 5CIQA 4FGLA 2QWNB 4RCZA 4B79A 4DSZA 1YRQA 4AJLA 2CZCA 4ROSA 3TLGA 3KE8A 1AI6A 3X43A 4AWBA 3KG2A 2ZODA 1ZPDA 1IXSB 1N34B 2FPOA 4LNUA 2VHZA 1IRXA 3DO8A 2I8LA 4LS3A 5K4GA 4MYDA 4HSEA 1Z39A 1SZPA 4K0KB 3F74A 1DKMA 3ORRA 2CWWA 4FT2A 2PH5A 5BZBA 4L8VA 1NT2A 2OIEA 1CVIA 2CXUA 3NS7A 3WG7C 4AF6A 2FWNA 7MHTA 4DV7B 2B25A 1IRIA 3NRBA 3O4JA 2AMLA 4AYTA 4NEQA 2D62A 4F1KA 3M84A 1OY1A 1T4CA 5EMHA 4DCUA 1JEYB 2YFQA 4CH3A 3T34A 1JA1A 2PGOA 2F8MA 2GBOA 2RAUA 4X63A 1H8EG 2NUBA 1DF5A 2GHTA 3GL9A 1HTTA 3FTDA 1F6WA 4K0RA 4TKLA 5FUQA 1TEZA 2G4VA 4MS2A 5DGXA 4NEGA 4BZQA 1JAZA 1QVFU 2QTRA 2ZT8A 3W8RA 2YYAA 1TK2A 4RL6A 2YUTA 4UMEA 2NZ2A 5SYAA 4PYKA 5IAAA 1F7VA 1FFWA 3CC2V 2C9DA 3KFXA 4FGUA 4TMKA 3QTCA 1Y5NA 5SZJA 3STHA 2OZKA 4S2UA 3IPLA 4RZHA 4D7TA 4OI2A 4BOYA 5KHKA 3H1KH 3KWFA 4MCJA 3SQMA 2DAPA 3R0QA 3K1AA 3TI9A 2NTEA 1KF0A 3JZDA 5FWYA 4U7JA 1AK9A 4YAJA 4EFLA 3TNYA 1SQQH 1YDEA 1EGQA 1W19A 2XUGA 4O2RA 3BPZA 3HVIA 1M0WA 2GUGA 3N4ZA 4DPLA 1MNQA 3MJDA 2BSXA 5D7BA 1TZBA 5JCZA 1TW2A 2ZIZA 1L6IA 2W6JA 5DT9A 3QPAA 3WDSA 4HNGA 1ZC4A 1L7PA 4ETWA 4I5SA 1DOAA 1ORRA 2IHJA 2XMQA 1ENYA 4YCMA 2XTJA 1G64A 3KKNA 3S6JA 2AVDA 3S2SA 1RCTE 3X1WA 2XMZA 2X15A 1KEUA 3QGMA 5DCWA 1PV2A 3ZLJA 3OZEA 2GAOA 5KBYA 3RS8A 1GITA 5KJEA 1EVQA 2A1IA 3ZWPA 4OQFA 2XHBA 3CG6A 1Y3IA 2J6CA 1VHJA 1MJ5A 2BGKA 2J45A 1BCSB 2MSDB 1MXFA 1KVSA 3W5HA 3EEFA 4YY3B 4N0MA 5FO0A 2X86A 2XBUA 4IJQA 5AKIA 3B5JA 4H13B 4N8EA 2A5GA 2DFNA 2XXAA 2XQFA 2GKOA 3L77A 4L5IA 3V7YA 3H65A 1H65A 4PVCA 1V8BA 5FTLA 1YHYA 3T54A 1BA3A 2ZAYA 2AUMA 1KWGA 4L51A 5ALJA 4KLNA 1X7ZB 1Z3CA 2OESA 1GTJ1 1LPOA 5B6PA 3OBYA 5CD1A 3ZWVA 1JNXX 1GGVA 1YZUA 2ZITA 2UVPA 4F04A 1NFFA 5AW6A 3KYBA 4CG1A 3EEBA 1ENZA 1SS3A 4QHTA 4K3AA 2D1TA 3V4DA 3ZLUA 3LUJA 2R00C 1M1XB 4DY6A 1H8HG 3W7XA 1VLVA 1G5RA 4CC6A 1L4EA 4PLTA 1YRYE 2XTZA 4E13A 1G8AA 1T9BA 3VHQA 2R9RB 4R98A 1Q6YA 2F66C 3PXEA 3AL0C 1L4BA 2YQ5A 4X5OA 1BC5A 2P2LA 1EVEA 1BMFD 4FLEA 5K3CA 2YC0A 3DEZA 3QBDA 4GKJO 3CYPB 2K5UA 1L5SA 2UKDA 2H2FA 1IN6A 2XSZD 1KQFA 2G6TA 2VZLA 3ZI4A 1PZHA 1GFSA 3DP7A 3QYJA 2MSEB 4EKIA 4X8OA 2QPAA 3A28A 1Z5ZA 1NNI1 1POWA 3PNBA 2WTNA 3A4IA 4EO4A 2PJUA 4AECA 2FV8A 3RGGA 3H9UA 5FT9A 4EG0A 1XTPA 5GINE 5G1PA 4RGBA 2QBYA 3VBCA 4Y6LA 2NVBA 4EUEA 1KOFA 2B8EA 3QF4A 1W75A 3GT0A 4AZ3B 1TA9A 5G4KA 4PR3A 4MVJF 4MYTA 1SQFA 3QKSB 1U2DC 1ZM7A 1VBNA 3LL7A 2OORC 2QZPA 1B6RA 3K57A 2IDZA 3A6DA 2V45A 3AK4A 1J99A 3MFQA 2PFGA 5CBFA 1SD5A 4M8LA 3QUBA 4FM0A 1XHFA 3A0RA 4UCWA 5CFLA 3QUWA 4J90A 3ZBHA 4B7CA 3JD0A 3NRJA 1AMUA 3RSQA 3E48A 2G38A 5GINC 2HSZA 2FWIA 2IH1C 5FBVB 1LBHA 4BV3A 3NK7A 2CK3D 3GGCA 2DT4A 1H8EA 2RHRA 1NJSA 1YGYA 3C3MA 1ZNZA 2QJRA 1N0UA 3V8PA 4JGGA 3N1UA 1IXYA 5HY1A 1QUFA 1C8LA 1JALA 1FY2A 5LP6C 1NUQA 1WMAA 2C7QA 1ULUA 3QBVA 4C81A 1OLUA 2IOFK 4Y1RA 3PNQA 1GYRA 1KGSA 3NYWA 2V74B 4Y2UA 1FQOA 1RPTA 3F7OA 4R50A 1BG6A 5H7XA 2RHTA 4B33A 2DY1A 2IKQA 4BLRA 1X92A 3K8OE 5BN3B 4CKYA 3FYDA 3I55F 2I55A 1JKMA 3G0CA 3CRCA 1NVUQ 3TM4A 1PQWA 3M8KA 5CXQA 4LDNA 2CLHB 5JS2A 2YHIB 3RTBA 3K09A 5GM1A 4KP4A 3IAYA 2DR2A 2YINC 2DHEA 3RRMA 4A16A 1YKGA 1DEAA 4X0EA 3UMCA 2JA2A 1HQKA 1UMCB 4R8MA 3JQFA 1Z8DA 1XZGA 3AI2A 3V9AA 4CG2A 4P4LA 2QX7A 2DQ4A 1TI7A 2X23A 5TGDA 2ECOA 4ARIA 2ECQA 4XEHA 1AQLA 2FQYA 2BKXA 3UWOA 3EZ6A 2JRIA 1EINA 2E75B 3L6EA 3QW4B 1E6LA 5JVDF 1GWNA 3UWMA 2BLLA 4YRPA 1H2SB 2ZRPA 1FQJA 1KEEB 2VJAA 3G7UA 3F9IA 2P6NA 5TMEA 1DSSG 1BEUB 3FW1A 1VBMA 1WXWA 3D6UA 4BHTA 5BSMA 4FHDA 3ZH9B 2J4CA 3MRSA 2CCKA 2C57A 1KDPA 5C5EA 3LM8A 2X42A 2JVIA 3KQLA 4O4JA 5ALSA 4QJ3A 4Q7LA 4IM7A 4GDFA 1CQPA 1NOKA 4OL9A 4NR1A 4PX9A 4FDMA 5JI3E 3Q4GA 3QLUA 3ASOC 4O4LB 4IXDA 1QRAA 3GD7A 3LPNA 1W73A 5G2OA 1WZCA 3CT4A 4FFBA 4HQRA 1OXSC 1R00A 1IPFA 4OHFA 1QX3A 1Z0ZA 1FJGO 4YFVA 1VE1A 4RJJA 1E2PA 2QP4A 3L1IA 4JJ4A 4OP2A 4XGKA 1JFSA 4AZTA 1WCYA 1MZVA 3T5GA 2V9ZA 2YC4C 3L6BA 4H7EA 3U9TA 4RVDA 3AG3C 4FYWA 2W2OA 1IJKA 1SQ5A 1WM1A 1VFPA 4JP1A 1YBMA 1FYXA 1MOZA 2YYZA 1UWVA 3TLGB 1H8HA 2QORA 1G20E 4YIOA 1OZHA 5TXGA 1DT5A 3ZCVA 4LNUB 1NVTA 4RVGA 2ARKA 4BFXA 1EK5A 1L4LA 1NKVA 4BX3A 3U56A 4UBNA 3PG5A 4N0DA 3UJHA 3NXSA 5T41A 3HN2A 2WG2A 1GU0A 1NT2B 1C5KA 2Z4SA 2W6JD 1X8JA 3INGA 2B6HA 3F2IA 2MSLA 2HR3A 2WYWA 1Q8RA 4MAMA 2V3CC 2X8WA 3JVEA 4ND6A 2WQ7A 3ME5A 4UFOA 4MCHA 1M6NA 2OOSA 1VCMA 3QIAA 1T4CB 3VVCA 4RDIA 1FNSA 1A7KA 2WAXA 2GBGA 2Q5ZA 3NVDA 4AUEA 1QE3A 5IWAB 1XN4A 1U0FA 4IWYA 1VQMV 1FDVA 5KREA 2ZTMA 1M2OA 4XIIA 1TGYA 2OGTA 1P84F 3O31A 2O0LA 2MWMA 3DZCA 1YI0A 3QPDA 2DPMA 4Q4CA 4CMIA 5I4BA 2D0OB 1FTSA 4EA8A 3H5TA 3NYIA 3COJA 1X94A 1DIRA 2ZRGA 3HVUA 3ONNA 3MWLA 3PNVA 2GEFA 3UENA 1W5BA 4BX2A 1EVZA 3CNEA 3PFIA 5IXYA 3JX9A 4LV8B 1IDOA 5E9JA 2WMNB 5LBQA 1U96A 2XUJA 2X6QA 3IP7A 5A4KA 5KSOA 4Q37A 2AZ4A 4HUTA 3CXHF 3K1AB 3PWKA 1Q0RA 5EVJA 1HLDA 2PUSA 5FWYB 1RQRA 4PZUA 3P2KA 1Z2EA 4HN2A 3KDPA 4QVKA 1YVWA 1PEYA 2M7WA 3QU9A 2C78A 2YZMA 1Q7GA 1CY1A 3JQBC 4NZYA 5EXSA 1LX7A 3SKYA 1L5KA 1R5NA 2ZE5A 2P9QA 4DEYA 4L0DA 1VHLA 3B5IA 2HRUA 4HDNA 3P97A 2M6RA 5CLJA 4G5HA 2WA3A 4G8CA 1EDDA 1AA9A 1ZM2A 4N5IX 1E58A 3BJIC 2WF8A 4B6OA 3EIXA 1JWAB 1CR6A 4FJ2A 3REQA 4HLUC 1ICIA 2W0MA 1H6AA 5BWBA 3ED5A 1FMJA 1I33A 1NQWA 2ZWAA 2P2CA 3E27A 4JI5O 2BBSA 4QLBA 2BSKB 4ND4A 4UVHA 4YUZA 2HF7A 3FPLA 3L2OB 3KZNA 2BOVA 1F17A 3CRQA 2R66A 3Q7IA 4ZAFA 4CXMA 1FUKA 1K3FA 1G9SA 4OMDA 1L6RA 3M89A 3HZZA 3W9UA 1U1GA 1MTOA 2OUIA 3AHFA 4H35A 4XBFA 4I1OA 4BKQA 3NZEA 4ARSA 1KNKA 2VPPA 1RKBA 4DADA 1Z06A 1PZEA 2IU4A 3H1BA 2D5CA 2XXAB 1A95A 4BIZA 2IEBA 1ZRSA 3CTPA 1OPXA 1KMQA 3PPWA 4C7MA 4MQBA 1H4VB 4YA6A 2V7BA 2KM1A 4BTLA 3DMNA 1QKKA 1DBQA 3T95A 2W2TA 1JG4A 2MYPA 3GPCA 4IUDS 3T61A 4XPZA 4LBVA 4DLBA 3ES9A 4MLZA 1LSUA 2JARA 2UVPB 1WY5A 5K0JA 2GEUA 1S7GA 1VB5A 3QEBZ 4HY3A 5HKKA 5JAMA 4XD2A 3V1NA 3X2SA 5B6JA 3RRNA 4F8EA 4FN4A 4PY2A 2X7RB 1VEWA 1VQVA 2K4MA 3H9EO 4WINA 1NRXA 4D02A 3DONA 1HOXA 1Z18A 4LMRA 3FGOA 5MN6A 1E98A 4RTJA 4EGSA 5E7IA 1F7YA 2IBTA 4C78A 4RANA 4DLNA 3W06A 3ZZ1A 2YSUB 3V4LA 1E2JA 4HQKA 4CETA 3GY0A 2EIKB 1VARA 1H8ED 5G4VC 2AJBA 1TJ4A 2FH5B 2GFIA 5FPHA 1W8DA 4RH3A 2BDEA 1PZMA 2EW1A 3P3PA 4XCVA 1XD2A 5ICFA 2WJVA 3ZV6A 1QRDA 1JU9A 3ED1A 2ZWMA 2QAJA 4XSVA 4PPNA 1PK7A 1ND5A 1QPZA 3LC7O 1UJ5A 2C2AA 1QQ6A 1DJQA 4G8JA 4LJYA 5LB2A 5P21A 1XU9A 4CKWA 2VQDA 1FLVA 1AZLA 3UJAA 4KLZA 2ZYTX 3EFBA 3X2QC 5J4HA 2OQIA 5EZSA 4M54A 3VDXA 2R6HA 4JB3A 1KSHA 3CCUF 4J7UA 3H1IH 1PBTA 3PHGA 3WA7A 1A1SA 4EG3A 3F9RA 2NZWA 2QBYB 2BUCA 5A5GA 1Q82H 5DNVA 5H4GA 2K2WA 3QF4B 1PJZA 1FS5A 3L73H 3HKCA 5G4KB 4AT1A 4DWOA 5CFPA 5I8ZA 3DMYA 5FUMA 3UO3A 5F7JA 1U6JA 3KWMA 5EHIA 5C5DA 1XEWY 2O0MA 4V1CA 4TROA 2CGEA 1H6CA 1PF5A 3L6DA 1Q1ZA 3VZPA 1J95A 2R7MA 3A0RB 2RHBA 1GO0A 2G8LA 5KO2A 3CX3A 2ET6A 4G4IA 2XMPA 3IX7A 3MGGA 3DE4X 3RYIA 1A9PA 4E5DA 4HXYA 4YQFA 4B7EA 2QX8A 2VBGA 3U13A 1WMEA 5J23A 1B06A 1GCGA 2DWPA 1K6EA 4EFEA 3ZNQA 1ZNWA 1QVZA 1OLUB 4Y1RB 3LYUA 4F2DA 1S5HC 4C4OA 1AS0A 2WK1A 3V1KA 1KC3A 1QK5A 2Y69C 3LSYA 2PUHA 3T8YA 2J07A 4NCKA 2VPQA 2FZEA 1W41A 1O87A 3UM9A 1UJWB 3DYBA 1T35A 4O33A 2AXPA 1KUQA 3OD1A 3QUQA 3ONDA 1F5SA 4F45A 4JEIA 1WRBA 2VK1A 4I1YA 2FFHA 4UE3S 2RN9A 1NYLA 3COZA 5KNCA 1CHDA 1U8UA 4TTRA 1O7JA 5DCYA 3ETLA 3DZHA 1T3HA 2PWAA 3ZE2B 4G07A 4ZT5A 5B6IA 3G9XA 3IBFA 1P2DA 3ZHVA 3R66A 1H8HD 1DUSA 5FFMA 1U0LA 3U7JA 2JB9A 1OMOA 1P7YA 4C4SA 4WVFA 1W0KA 5HF6A 3W7BA 1YR8A 1JLMA 4OQDA 3R23A 4RTPA 1TB4A 3DDNA 1YS4A 5AFSA 1MX5A 4IRXA 1KI7A 3D6NB 3G89A 3ZV4A 3SCZA 2ZSDA 4FLTA 1T13A 3BL6A 1O97C 5IJWA 2GKGA 4V39A 4EJ0A 1EK0A 3OQIB 2O0JA 1JAYA 1CULC 4WAUA 2HQOA 3FY4A 3OQVA 4HDCA 4PBSA 1V35A 4Y9TA 3VC1A 4O4JB 5C52B 4MVCA 3SLGA 3LVBA 5IKOA 4AULA 1B16A 3D7LA 1HYHA 4M0PA 1VRWA 3OJLA 4P93A 2RGYA 2D3TA 3GLKA 1MX1A 4HRXA 4KR0A 3BT7A 5K9ZA 5AT1A 2IYQA 3QVSA 1W87A 3DBOB 5HGJA 3AWIA 3SC6A 1RRGA 1V1JA 4FFBB 3VPSA 4S0XA 4URWR 4DRXA 5KTNA 1Y4MA 2GPBA 4EJSC 5LIRA 3U7HB 4F5YA 2O3UA 2EILC 1ZSNA 1NZJA 4DR5B 1XJCA 1JJBA 4GLLA 2RGCA 4ZOQI 2IDKA 5CPBA 3ANNA 4YGYA 1UM9A 1SCJA 2QVYX 2ZJ8A 2ZBDA 3PJRA 4JTAB 4HV4A 3EWNA 1VQ5F 4WK4B 1BDIA 3G0IA 1Y6GA 2JFUA 1NMSA 4ZDJA 2OMEA 1VJCA 3FD6A 2PCJA 1Z7YA 4AJJA 1XMIA 3BXOA 1G38A 1KARA 4YR9A 4L8GA 3EPRA 1RZVA 2H8GA 2RG1A 5LLTA 1VJ1A 2VAXA 3VR1A 1QM5A 5E4YA 1VDMA 3T0IA 1O57A 1OF1A 3NHUA 3BQMB 3N6VA 3ZIDA 4J80A 3KC2A 1XPJA 2VH1A 4R16A 5CMUA 1ECGA 3F71A 2CD7A 4AMUA 1WDWB 2HRRA 1IOLA 3VI4B 3C97A 3DWEX 4JB2A 4GZMA 4OQNA 1J8QA 2OK8A 4RIEA 3AGPA 4NYJQ 1F0YA 1Z0IA 1VKZA 1LDEA 4J1QA 3TD5A 3AC0A 1S8OA 5ALLA 1CRPA 1W4LA 3A6LA 4FZ3A 4ABTA 3S2EA 4QBTA 4RHUA 1IM8A 3CCLF 1ZJ6A 4AG5A 2J7KA 1JFFA 4W4KA 3OR7C 4L4YA 1M2OB 2ZJ7A 3DXXA 4HB0A 4F12A 3FHTA 3K30A 5K6AA 2Y8EA 4CMIB 5BY2A 3WMGA 3OCJA 3BTUA 1U0SY 4Q21A 3N58A 2PSHA 5AI8A 3LSTA 1PUIA 2FHPA 4ARUA 1TJYA 3D2CA 4DA0A 2H57A 4EVSA 5KJCA 1RM3A 3CCVF 4DLRA 3FROA 5AYVA 2DWQA 4QO8A 4XIFA 4IILA 3LTEA 3HA3A 3T4PA 2VPXA 4IVRA 2IV3A 2PS9A 3QKTA 3PP8A 5U9CA 1XJWA 3OUUA 1XTIA 4MA5A 2VLBA 4UBLA 4G4SO 1T5IA 1O3YA 3ZHBA 3I53A 1JAHA 1HT2E 4P3YA 4RV9A 4RQFA 5B1BB 4AYXA 4J42A 4ZVQA 3U3RA 1DXQA 3MWKA 4A03A 3NJ4A 1VIVA 2PIAA 5ALOA 3R6GA 1S4QA 3NGXA 2I4LA 3PEYA 1DQPA 4HDNB 3THXA 3HCNA 3AK1A 4AP6A 4GGOA 4YV2A 2X4DA 2C20A 4B40A 1UC4B 2RB5A 2BFNA 2ERYA 2JIRA 4L28A 3M81A 3IJ4A 5AM5A 3REQB 1OCZB 3K4HA 3M1XA 4A8HA 2PBFA 3OY7A 3WNCA 5KYNA 4NMHA 1GPWB 1QHIA 5DT2A 2F1HA 4JCCA 1NP7A 3LPAA 3DM9B 3IVCA 4YJ3A 3HJUA 1LLDA 1TUIA 3C8LA 5JCOC 4CDGA 2QAIA 2D7JA 3K0FA 1ZN7A 1NMYA 4NONA 1I14A 4PC7A 2DGDA 2C88A 1PNTA 4FI3C 4CFYA 3O75A 2ENUA 3GPIA 3S1AA 2C5HA 3IJEB 4MS4A 1OGYA 5PGMA 3FD9A 1RXYA 2X6CA 5GIPE 3VOBA 2KSDA 3CYOA 1Z15A 2I6FA 3KEFA 1DNPA 2Q2QA 1TLFA 1M76A 1ZJ4A 5TEVA 4G28B 2Z2YA 4HNUA 3OQOA 1FNMA 4PYQA 1PHRA 3Q10A 2RHDA 1PL6A 1NSFA 1LVGA 4JLDA 1LPPA 1EZ1A 4FPXA 1JIIA 1R6UA 5HRAA 1Q6IA 1DBVO 1EVIA 1OIXA 3FGZA 2C00A 3GFBA 1R15A 3IBCA 2HDHA 4X8MA 5GADl 3EGEA 4ZDIA 1CUDA 1DQYA 1KK3A 4OMFG 3ADDA 3HB3B 3VA7A 3O7WA 1NQOA 1PWHA 4DA9A 2QS9A 3RWOA 4BO8A 3IOCA 3MWFA 4OXIA 4CDRA 5AKZA 4HDRA 3NGMA 2X5OA 1RIIA 1B0ZA 3RKRA 2WYHA 4HNAA 3NB0A 4O4LF 5EJ5A 3HP7A 4IZHA 3JSXA 1QGUA 4ZV9A 4PWZA 1HTBA 1KORA 1FE8A 1KU0A 3N7TA 1QU3A 3MCAA 3KUKA 2YUAA 4WFFA 1XD2B 5CBKA 4JC5A 1M93A 4FHZA 4MZXA 2I65A 5E2AA 1KVRA 5CB4A 2ISQA 2YHUA 3GFFA 1I7QB 1TPYA 2QT1A 1D4ZA 2FK8A 4YXFA 3C3DA 3H16A 2UZ4A 2OXFA 3VZDA 2Y99A 3EJ6A 4CKWB 4BO9A 4BEJA 4M0UA 1GZHB 1QCEA 5FA6A 1Z7EA 1DIGA 2FPMA 2CJWA 2JAPA 3AW8A 5E2IA 1W1IA 3INNA 3PI6A 3HL4A 3VI6A 1L4HA 2OWOA 1VQOV 4PYOA 2O5VA 3TG2A 1HDGO 1A72A 4F3NA 1B04A 1ZM4A 2QT9A 3ENVA 3BAFA 4MP8A 4MKXA 3Q1KA 3HKCB 2JASA 1J42A 4PLYA 4GZLA 5F5XA 2ZR3A 4FMPA 5KNCD 5B58T 3DMFA 2WR8A 4PYMA 1BS3A 4G3XA 2BGUA 5U4QA 2VR1A 1X6VA 3ZHZA 2O2CA 2OG2A 4MULA 4V1CB 3COSA 1RI2A 3FLEA 3BL5A 4A0FA 5JZMA 3H19A 3UJDA 3NHMA 1W0KD 3Q12A 3AJ9A 5KQLA 3FJOA 1PJSA 2LR0A 1VJDA 3RYIB 4GE0A 5EERA 1BHBA 3A3PA 3FN4A 2Z3YA 2ZNIA 3DHVA 3I9MA 5ECWA 1I7LA 1SZJG 2ZIGA 4N0QA 4LF4B 1F8UA 4JA0A 3OFSA 3L41A 4UPVA 1QFZA 1VQPF 3ETJA 3C9RA 3RSSA 2G6BA 2VWQA 1L8LA 4AHCA 5JNLA 4ZMBA 3DC7A 1XEAA 4YDHB 1PYOA 1WO8A 4ZZIA 4Z3DA 5K8UA 4M7RA 3A05A 4QUKA 1UFRA 1N2GA 1A2QA 1CJKC 3SYRA 2GZRA 1BMTA 5EWLA 1WSAA 1G8JA 4MVWA 2DF8A 4EA7A 2JANA 1WE2A 2IYZA 4EHJA 2UYOA 5IH7A 1SC4A 2YRFA 1YJ5A 3OJWA 1SQPH 3FAZA 4L9RA 2E4XA 4U00A 4I4IA 5ENZA 2ZI9A 3L5KA 4JI0B 2WLMA 1HY3A 3EG9A 3HYSA 1UXJA 2PH3A 2IU3A 2V7QG 3H2GA 1KFJB 2WV9A 5AW1A 1E2HA 4BVLA 2OTLV 4QPNA 1TUEA 3I5YA 2HJSA 4EGQA 1Q3EA 4N47A 1KY3A 1AQNA 2Y0PA 3EH2A 4IHKA 4C0SA 1H3NA 2ZULA 2D2EA 3NC0C 2ZAIA 3A1VA 1A4UA 1CY8A 1QC5A 5D51S 5HILA 2WUGA 1OR8A 2ZE8A 3R3XA 5DWDA 2NV0A 2ZUUA 3RYTC 2MTBA 3QNMA 3WKBA 3L05A 1M74A 2P5TB 2GZ1A 4MQLA 1U2EA 1TZKA 5FULA 4LZPA 1KKUA 4LXTA 1R7RA 1JHVA 1GQRA 4FYVA 2FPXA 2AG1A 4YO8A 2OV3A 4K9DA 1AQIA 1E8MA 1V9LA 1XD9A 2LBWA 1WQ1R 3CBGA 1GT91 3N2GA 2ONJA 4MV7A 1XQ6A 2CJYA 4BE7B 2B4TO 4DRXB 2IPXA 3S5UA 2X0IA 4MVYA 4QU9A 1JV2B 4ZCTA 3NPAA 4ZDKA 3WWEA 4JV5B 3U37A 4JI4O 5DW0A 2I7CA 5CXUA 2W4MA 2GS9A 4D3YA 3F8WA 1UM9B 2VZ0A 4ETNA 2RARA 4O02B 4HQOA 2DYSB 4QD3A 3U0ZA 4AY2A 1VG1A 2UZIR 1E9BA 2H1OA 1MEEA 4X00A 1TZ2A 2QWOB 3PCTA 4XKJA 2JHGA 3S28A 3WOHA 2DFKB 3OBIA 5F9HA 4CT5A 3IVXA 4B44A 4J4BA 3RUIA 1ZH6A 4AJ4A 4DM7A 2HCRA 4RKYA 3WFZA 3AR5A 2VHUA 2Z9CA 3IUEA 1IBKB 1D6SA 4F3KA 3L7OA 4FFDA 1NC1A 4LH7A 3P9YA 5EEGA 2BHLA 2QR2A 3IPYA 2JH3A 2C0QA 2C7OA 5HCUA 3EMKA 3UHPA 3HCEA 4FLFA 3CZ4A 2EJVA 4LF6B 1CDOA 5A2QM 1RKUA 7YASA 3TOVA 3P10A 4MGEA 1VJ5A 4UEOA 5EMJA 2ZR9A 4EMSA 4Z0HO 2FDCA 3IUSA 5AOAA 4F6EA 2XMGA 1N8KA 2J0QA 3LYBA 2O7VA 3N4YA 1D6NA 3EA5A 1JFFB 2J4FA 4KHPB 4EYEA 5JU6A 4KRXA 1KVUA 5BW5A 1W55A 2Z2KA 4DQLA 4JUIA 4IOJA 3I30X 1KZYC 2G9UA 4GSKA 1YR1A 3CH7A 2R7NA 4NBNA 1D07A 4MPPA 1LRKA 3ELDA 4QTUB 4NWIA 2COUA 1OXUA 3VTIC 3TIIA 1W4RA 3ZWMA 1RKVA 3TJZA 5KWEA 4HEHA 3HB5X 2FL4A 5LQRA 5JZSA 1U97A 4JVSB 5ALRA 4QGPA 4HAYA 4C14A 2BDUA 2AMVA 1KETA 3AF0A 2WB2A 4PG5A 3ZRWA 1RPAA 3PSHA 4YYZA 5KSWB 2WSMA 4D7SA 1BXGA 2VNHA 3ZNPA 4Z4IA 1WKVA 1Z0FA 1XN1A 1WB9A 3LDDA 2BOBC 4KQMA 4BVJA 1OB5A 3KDSE 4DTIA 1Y4AE 1VXRA 4RFVA 4U7TB 3THXB 5F3WB 4ARCA 5JECA 2X9LA 2OTMA 2WLIA 1AO3A 1E69A 4YEDA 3HU1A 5C46F 4KR7A 2Z43A 2PG3A 4KUMA 2XLCA 3U3JA 4DG8A 3ZWQA 2RD2A 4ER6A 2PKQO 1A5TA 3PJEA 1EDOA 4MWGA 4YJ3B 3WK8A 3A14A 2OC4A 4CKXA 4XQGA 1Q11A 3EDCA 3C3BA 1KVQA 3H9JA 1QLJA 1IBSA 3RRBA 4M9XA 1J2EA 4YJHA 3K0FB 2V7TA 4R9RA 3W7SA 3A32A 3WL4A 5ICEA 3DL0A 4BKMA 4R1LA 5D6NA 3S1AB 4MS4B 2GZ3A 5TPZD 3LRTA 3E5RA 2HMUA 2O5EA 3PL5A 4DV4B 4ZO9A 3HU2A 2PBZA 1WN7A 2VJYA 4EKGA 3CLRD 3JQAA 5CT6A 1VQ9V 4HRYA 5ESDA 1GP2A 4C06A 4BQFA 1W93A 2V7QA 4L6IA 2VJMA 1B8PA 4C1NA 4WA7A 3UJ8A 5L6MB 1CLUA 1X4TA 1CY0A 1A8QA 4GVXA 2LXNA 4DIOA 3AG2B 2LZ0A 3WGQA 3LGAA 1EFKA 4DNFA 2VYCA 4NFSA 2ZDHA 4U3JA 3BIXA 4ZRDA 4GZRB 2ZYDA 1TO2E 2GUZA 1QMGA 2C4WA 2H4XA 2IZ6A 4QYMA 3WK6A 1TIKA 3KQOA 1YONA 2XVZA 4MW1A 4QUAA 3LA8A 3PGA1 2XZDA 3C8UA 4YRLA 5HWSA 4QJ5A 3E1KA 2REQA 4O4JF 4HDRB 3AI7A 4KR9A 3Q72A 4LK3A 1ZCAA 2PF4E 2GEBA 1LUAA 5MN5A 4Z3OA 3EVAA 3C6QA 3JYNA 5IFKA 1SKUA 3GRYA 5G1OA 1RP1A 2HX0A 2V3VA 2FFAA 4HNAB 2BUAA 3SYNA 3K5LA 4DKXA 2OHJA 1QGUB 1KJNA 3QVMA 3F3SA 3QWFA 4M60A 2XHZA 3MGCA 4K9SA 4YQZA 5JCPA 2J9RA 3MCAB 5JRJA 5DGIA 3GGPA 3RAEC 4OFWA 1M2FA 1M0EA 3PBKA 4UNQA 1OCOB 4OK3A 2LUOA 1IH8A 3K0CA 1N2CA 3HN6A 3OTFA 1E32A 3DZJA 5CB4B 2IHVA 3UGJA 5CNIA 1KYZA 4QQFA 2HL6A 1JI3A 2OD7A 2F4VO 4S2EA 3TSOA 4MRNA 4EKEA 4ESOA 2CE7A 3KOWA 5GPBA 1MHTA 2AT1A 2GVIA 2QGFA 2AMTA 3BL8A 3D2AA 4C7UA 4U2FA 3E3OA 1NVAA 1SFRA 3KJZA 1GLNA 5E3IA 5ALDA 2GZSA 3GAFA 2HJ9A 3QKUA 4JI1O 2NSLA 3N07A 2Y2UA 2CJWB 1WDLA 2GBLC 5IUKC 4I1RA 2NSJA 2OP0A 4H37A 3LFHA 1C0EA 3B6KA 4P3KA 2C4KA 5ECYA 4WOPA 1QV9A 3A6JA 1XALA 2G77B 2P5UA 3KB6A 1Z82A 2OGWA 3H3JA 2IHYA 4IL5A 1E66A 1NY6A 3CD6F 5LFAA 1I6MA 4U7OA 4YDSA 4GC9A 2XQGA 4C76A 2XCIA 4CTKA 2R6AA 3KKMA 3ZVKA 1UBJS 2G8NA 3LIIA 2NSHA 2RE8A 3B8HA 3NHYA 3GRRA 4DR6O 2IPOA 3Q5EA 2BSKA 1GRJA 5ALMA 4BMVA 1VSBA 4KGZA 1P7PA 5I7AA 1BYUA 1WZNA 1W2WB 1CXZA 1WU8A 1KWKA 1OTXA 2JI6A 1YZTA 4CL3A 2Q8NA 4Q9NA 3V1LA 3ZWAA 3W2GA 3U7EB 2PPLA 4TTJA 4CL8A 1L9XA 2YXPX 3TTYA 1H2MA 1VE3A 2FDRA 1D4AA 1QCCA 1ZK2A 2G36A 5AW5A 4ZVPA 1CIJA 2PN1A 4FCTA 3LL4A 1V25A 4ZU3A 2EJCA 4HAXA 3MMZA 5IT9N 2UZ1A 3HWWA 5IAEA 4Y6RA 3M0EA 4EHBA 3HYRA 1QD9A 5EZYA 5EWLB 1H66A 3FZYA 2ILTA 1XTQA 4PZ9A 2VSFA 2XQKA 1MB3A 2Y1FA 1FIUA 2WVHA 5CLIA 1K9VF 3I72A 5E38A 2ZSFA 3D6MA 1KRWA 1KK0A 1RLGA 5K0CA 4I1SA 2O59A 2RK3A 1GTOA 2YI8A 1LI7A 1E7QA 1OWNA 3SSOA 1CQJA 3IUMA 2MR5A 2H9AA 3L4BA 3EG9B 2XT0A 3EZNA 4BMZA 3CH4B 4O0MA 1UWCA 4U8HA 1KGDA 3GO4A 3TD6A 5TV2A 2VT2A 2XT9A 1XEWX 1TUEB 3TLXA 4EDHA 1QAOA 4NESA 4NVRA 5CCBA 4QXPA 4XJTA 3WQHA 3PIDA 4ZYTA 4YN3A 4WCFC 2XQVA 2GXQA 3H8WA 4NNPA 4B43A 5ICSA 1OCCC 2B34A 2AQKA 3VVBA 1QC5B 4JL6A 2MQEA 1RZRA 4G63A 2Q7HA 1VZ2A 4ZHQA 3CG4A 3O2QB 3HJFA 3O2SB 2AZ0A 1SVLA 2VYFA 4KXXA 2QWQB 1IEXA 4KQ2A 5ABPA 1FZQA 4GXTA 3DVQX 5A3JA 4Q1EA 1G21A 4NFLA 3KALA 1U0EA 3WRXA 1NQTA 2B3DA 1NAIA 5FBKA 1E1QG 3H4VA 3KJJA 5KHAA 4KNWA 3N2GB 2ZB3A 2FEXA 3IUNA 4JROA 4QOJA 1SC5B 4KV7A 5A4IS 4NG5A 2EBWA 4YRQA 3JTEA 1KDZA 2QYOA 2TMKA 2I6XA 1GU7A 4DCJA 3OTOO 4S04A 5KYUA 2CNDA 4OTZA 3GEHA 3Q6IA 1CDDA 3RSLA 4M21A 3CVYA 1SB9A 3TN7A 4Y6QA 4WZZA 1TNDA 1ZGHA 1U2GA 3ENQA 3KVRA 1WB4A 2PNJA 3C1TA 3UXHA 4M46A 5IULC 3UXMA 4J4TA 1J09A 4ENQA 3LW8A 2E1PA 4DVJA 1FMCA 1N4DA 5E79Z 4NVPA 3UWSA 2YXHA 1OGIA 4FLUA 2H07A 4EEXA 1E63A 2AEEA 1M8FA 1WPGA 1SEVA 4FSXA 1KC1A 3TLEA 3S3WA 3KT6A 1U0RA 2IZ7A 3MN1A 4LI3X 1Y9DA 2D7CA 3ESRA 4Z4CA 5G1NA 1TAGA 3VU0A 1P1BA 4R7GA 3QFSA 1L3CA 3CX7A 3E22A 1KSGA 2I78A 4QU0A 3RUFA 4B2IA 3AHCA 5IZ4A 3P0HA 3BD6A 1H3EA 4UUQA 4F5ZA 3CH5A 3GC6A 4PZZA 4BT6A 1E92A 2GFHA 3F5WC 4LF5B 2D1SA 5DFAA 4KDRA 4JQOA 1ZITA 3GQVA 2YH2A 3D36A 4MYSA 4QNMA 4GOXA 3O9ZA 3CN7A 4WY2A 1E9AA 2CL7X 3IVGA 4G5OA 1QLNA 2FMUA 2RJOA 3H1GA 2GV9A 1LUVA 2GN4A 2JFFA 3KELA 1DJLA 3ENKA 1PJ3A 3AZOA 3BWXA 2B3TA 2R2GA 5HIIA 2KQXA 1EAYA 5AOBA 4DA4A 3NOQA 3UAXA 4J9YB 1RFYA 1CG6A 1FJHA 4YIKA 2P7TC 1PEAA 1BH2A 1BHSA 4PCUA 5EG5A 1TYEB 3T7TA 5EPOA 2X4IA 2VHYA 2R4QA 3JQAD 4PNPA 5BSGA 1J8FA 1BZYA 2ZGVA 4RIHA 2V7QD 2J8ZA 2QKSA 4L5AA 4RVHA 3U09A 4K46A 2ZD9A 4J94A 4HDSA 5JY6A 3ROTA 3ZRWB 1RAGA 4Q4DA 2RAFA 3OBBA 3ZY5A 2PSJA 4DV1B 2ZQYA 4KLRA 2V9YA 2C2MA 221PA 1BXGB 4K6KA 3I8XA 3SQWA 3LUTB 4G09A 3OQIA 1J8MF 5IAOA 3V6LA 3ASZA 3IAS6 1VJTA 1QR8A 4IG4A 1JLHA 3IP6A 4CC5A 1M54A 3O4FA 1ZD8A 4AO7A 4PPFA 4BW0B 1ZL0A 4FK8A 3AR6A 1FL9A 2YV3A 1UANA 5I8WA 5C3MA 1SHLA 1GRRA 2WLIB 4LOHA 4LSWA 2PVCA 4LY3A 1EA7A 2GHYA 1ZICA 2OA0A 1P7GA 5JXGA 2X14A 2G0AA 3DR3A 1E3TA 4D96A 2R5FA 5A2GA 3JCMM 4BX0A 2JAQA 4Q34A 2CKDA 3SBEA 3QVOA 4EI8A 3ZXIA 1GQQA 4YJHB 4PNHA 1AKRA 2NSYA 4X66O 4H77A 3MG9A 4QHYA 3OOSA 1I94O 3VYUC 3I4CA 2RGGA 1DT9A 6ADHA 4JNKA 4MTCA 2WE8A 1GTVA 2NPFA 2NU6A 4NYMR 1XVUA 3W1EA 2FYUH 2XQIA 2CCGA 1HDCA 4DMHA 5FJ4C 2EGHA 1Y3DE 2VRCA 1NW3A 5A0FA 3EPJA 1RVV1 2WABA 3GLQA 3DMTC 4Z4HA 1QQBA 2WWIA 4OXRA 3UV7A 5IXJA 2WUVA 3GFQA 4D9CA 5SY6A 5HKOA 1AKYA 3VOUA 5TGTA 3A2KA 2YWXA 3JQAB 1V9CA 4DLAA 5KNLA 5DBHX 2GZ2A 1EFDN 1KXJA 2VJMB 1UIRA 1BZKA 4L5BA 4X88A 4RD1A 4RJKA 5AM1A 2W48A 3I76A 4DV0O 3MBKA 4WKCA 4FEAA 3BXXA 3FDXA 1MB4A 2WUEA 2O8CA 2D1QA 4XI9A 1K73H 4IGEA 4U3JB 2YCLA 4KPEC 4JJZA 2ODWA 4S24A 2GUZB 5DHQA 2E4UA 2I8AA 2GZLA 3A1UA 4JP8A 3NDIA 2BKLA 2PA0A 3FTQA 2PMDA 1E1DA 2JIBA 5FP0A 3NR2A 1RMQA 4RK7A 3KDAA 1UKBA 4B85A 2REQB 5AVRA 5IJ0A 3HVJA 4DS3A 4C03A 1Q1NA 2PUWA 4YP6A 1CJSA 2CJPA 5FUVA 2JLZA 2QAGC 4HGNA 4TYYA 2NP7A 3UB3A 3F5DA 4X92A 4IMRA 2WOOA 3BFKA 3UTCA 4NL4H 3WO0A 1E1QA 1NTMH 4EAAA 4RTNA 2QT0A 2P8SA 2ZUTA 4B0OA 4MWCA 3BHJA 3IAUA 4M8NE 2Q49A 3ETGA 3W7VA 1N2CB 1N5RA 3FLBA 3X0DA 3U4MA 3Q3EA 2QKAA 3LXRA 1GCOA 3VU3A 4GBGA 3RT1A 2AD1A 1GX1A 2R2AA 2XCSB 4NV3A 1P49A 1MR3F 1I1HA 2WJHA 3B8MA 1XMPA 3PEUA 4BBAA 4RACA 1HOTA 3TTTA 3HJTA 3LXUX 5COBA 3QNEA 2AMJA 4MTXA 4P38A 2D0IA 3ZDFA 2VTEA 3EEQA 4ZPJA 1IEVA 1N2XA 4PIPA 5EB1B 3FYEB 2OXIA 2BCGY 3EVCA 2JFYA 1P3Y1 2AKAB 4RZIA 1XZQA 4HB2A 4I8XA 4OBBA 2H8CA 2WLKA 2CLFB 1NJGA 2CYAA 4B82A 3RVMA 5CCDA 1UKAA 5BSFA 5JUWA 5A7GA 1SKVA 2MW2B 2O06A 3WGGA 5B1AC 3I3FA 2PK3A 1W0KG 4TRRA 3H0CA 3I6QA 2JFQA 2QX6A 1VQ6V 1B76A 4RJLA 4Y2HA 1IZYA 4UARA 4L73A 1PS9A 5IUNC 5HJEA 5FEUA 2X0JA 1Q14A 4L76A 1YHQF 1NTOA 1P7CA 1RZRD 3AU9A 1B4DA 1CXZB 2GZMA 2VRBA 1YDWA 3IQIX 4O59O 3V8RA 5JNSA 1FAFA 1P3JA 4N3CA 4D8WA 3UJNA 2PIDA 2JS5A 2A84A 4JJFA 4DCVA 5ALGA 3RVRA 4AB1A 4DA7A 1XQYA 1GN2A 4RPIA 1GGMA 4ZI2A 3ZNNA 5EXTA 4DCOA 2NPIA 3EFHA 1ZL2A 1ZUHA 1TAQA 2UZ1B 4UOQA 2UUAB 1SUBA 2X58A 3MCTA 5AVXA 1QTQA 2WM2A 3FBTA 3PICA 5EZYB 5KTMA 3RLFA 5EVCA 4N0PA 2O54A 4D6YA 1GZSA 5CT5A 1SHKA 2LGJA 3BXPA 4LVCA 1C8KA 1D1QA 3SZOA 5FOVA 3EUEA 2JS7A 5IMBA 5TT1A 2Z8ZA 1E61A 3W1WA 4OM8A 2WG1A 1F5NA 2KHZA 1CQJB 1DC7A 4UDXX 1ESEA 4GEKA 2FGYA 3MT7A 3TLYA 1YCHA 1GV0A 1OHHG 2J3KA 2QRLA 5IY5B 3O8CA 2Y71A 3GFPA 4DIFA 1KQ3A 2F62A 3G5TA 4IR7A 3V2HA 4YCBA 4PA9A 2YXDA 3PS9A 4HK4A 1QJCA 1Z28A 1HV8A 1IQ0A 3QX7A 1DEHA 1FS4A 3GD5A 1E1KA 4D1YA 4GZ3A 3FKSG 3TOCA 2AUNA 2PFKA 2BO1A 3PDCA 1Z8HA 2A35A 3KXPA 3QX9A 4YJ3F 4R9NA 4P7JA 2HVKC 1ODFA 4X3MA 4ZHQB 4AY3A 3TOSA 1T8UA 5JEEA 4QZVA 4HBGA 1P62B 4D8UA 4PGAA 1BGVA 3F1KA 1EWVA 1NTKH 4F4UA 1H6DA 3F5MA 4PZCA 1YVDA 3FKQA 2PU5A 3VSAA 4ZHVA 1JYSA 4LFAB 5CG2A 4LVNA 3DKVA 4NULA 4ZVNA 5LP1A 4ERHA 3BCSA 1G21B 1DC8A 4NV1A 4A27A 1ZK3A 3HNRA 1QE0A 2ADPA 3R7SA 4B80A 1P4SA 3O4GA 5B3AA 4ETIA 1N6KA 1US8A 4O63O 3VNBA 1V8OA 3IA2A 2VT7A 4BMNA 2EAUA 1VMKA 1Q15A 4PRYA 1W52X 1PX0A 1GPBA 5KYUB 4IGGA 4OX9O 3S81A 1U1CA 2O5CA 3LDUA 3FWKA 3RABA 1AH2A 2BHNA 3BXEA 4BMYA 2P2NA 5GONA 5F7OA 5GJWC 2YIVX 2N04A 2IJGX 2VO1A 4GGMX 5IF3A 2HJRA 3LOQA 4GOMD 1FSZA 1JDTA 1IDN1 2I4RA 3ZCXA 2WVAA 5KU7A 1PV0A 4MOWA 4CU2A 4HGYA 4MI3A 4NK4A 4MWOA 5H02A 1JT2A 1XVLA 3KQYA 1NU8A 2X6RA 1AN9A 2EW2A 4RGYA 3TZ6A 1DCMA 1PJLA 2PMCA 1LZLA 2PX8A 2KPOA 1LPSA 3HABA 4OB7A 3OLXA 4NU5A 1AXEA 1D9XA 3VOAA 3DL4A 3CBQA 4BMSA 1EG2A 3AOGA 1H94A 1L5YA 4A1OA 1XZPA 3QA3E 1N8SA 2EJUA 2CYCA 2BTEA 4QTYA 4D4LA 2Q3BA 4MKIA 5GM2A 2Z6QA 1NX6A 4RXMA 3F49S 1CYDA 5LZ4A 2V9PA 1I2BA 5JZOA 3E22B 2Q45A 2JCSA 4NH4A 3S0YA 5CB4F 3LPDA 3LU1A 4ZMRA 3C8ZA 2BGMA 1NI5A 3DTTA 1OT5A 3W5AA 1XEXA 1N57A 3HA2A 1J5PA 2EF0A 2WUFA 4NABA 3TQFA 4D3DA 1MDFA 1A7UA 1AU9A 1KMNA 1OX4A 1UDAA 4F3TA 3FPBA 4R1NA 4LBZA 4DUYB 2D2XA 1E1CA 4X7MA 1GD1O 3FGPA 2D2CB 1MJHA 2VRCD 4QYTA 3MSXA 1CX9B 2QTZA 3CCSV 2WYIA 3IHKA 2JAHA 1KA9H 3NEAA 1SK9A 1M2GA 3MS4A 3OKPA 3SJBA 3QBEA 4JR0A 4MWEA 3T7SA 3STYA 3NEYA 4HTFA 2PRJA 3IB3A 1P5FA 5AXBA 1E7SA 2ZQZA 4EG8A 4JOBA 4E1VA 3Q7EA 4HDSB 3TB4A 2WKRA 2FB5A 5HIKA 3CUKA 1GGJA 2IXEA 3F6BX 1N2SA 3GNQA 3R5SA 3ICVA 1JFVA 4I1VA 1Z4QA 4S0ZA 1MV5A 5JD3A 4I5DA 4ZQGA 2BEWA 2F8LA 1NWCA 3IIKA 3OP1A 4XWTA 3JWHA 3SIXA 1D2AA 5K3AA 2IXAA 3ANXA 4ZJUA 4M3NA 3E9DA 3CLVA 3BF8A 4DAEA 2ZB2A 4UXIA 3MBIA 2JEYA 3OZVA 2M9MA 4G5YA 4PXSA 4PAQA 4Q3LA 2ITDC 3G4SV 4BNWA 3GYQA 2VDKB 4WLOA 4JA2A 4YJGA 4GSYA 4C20A 3AO0B 1RM1C 4YP1A 3ZD7A 5K7SA 4AG3A 5B37A 1E89A 3BH0A 5FI0B 1Z74A 2WD8A 1E1QD 3NBMA 1HYGA 3NBAA 2QA4V 3LC0A 1GT6A 5IBRA 1U8AA 1CZOA 3WHPA 3EUWA 1U3UA 3LRPA 1IMOA 4GFDA 1FPOA 4XYGA 3K9SA 2C4TA 2NU6B 5KYYA 1F20A 4G4ZA 2J6HA 2B7BA 4B5LA 4C0XA 5IABA 1K3TA 4E70A 3RNOA 2X22A 5LYYA 4D97A 1PR1A 3I5MA 2GTSA 1XYYA 3OZTA 1XA3A 1OHHA 2ZPAA 1MRZA 4D44A 4PLFA 3RSGA 1B6GA 1YL6A 4IINA 4JI8B 4BQRA 2ZBQA 2PANA 3R20A 2O8CB 3DFZA 1T8YA 2IBSA 2CVOA 5EZ6B 2HU5A 3FKSA 5IM5A 2AFRA 2OZVA 5J9FA 2VLIA 4ZAWA 5J4VA 5EUCA 3ZBTA 2WHEA 4FYIA 3RU2A 3BKWA 4FHCA 2ZWVA 9LDTA 1GGNA 2WKSA 5DHSA 1S6YA 4LCKA 4QPCA 2C2WA 1AQ6A 2PXCA 1CUFA 4X60A 5IJ0B 1UMKA 5IWCA 4RA9A 1HDJA 1N6IA 2QMUA 4Y18A 3CQ9A 3HYNA 1RR6A 4X44A 2H1FA 2BFAA 2N48A 2OT5A 4PGHA 1EG7A 5ITSA 4R6WA 3J7TA 3EF3A 4CCSA 1HG0A 5JARA 3JY6A 1AF7A 4FN5A 4E2YA 4URVR 2RCNA 3WISA 3IHLA 1LI5A 2DBZA 2XB4A 4JLBA 4IF6A 3V4ZA 3W8EA 2JLBA 1CUBA 3KPYA 3ZD8A 1URFA 4WLUA 5CFNA 5DH9A 2FQWA 1C1DA 4K81B 4PA4A 1T0HB 3B7GA 3F3YA 5TQJA 1N7HA 1GPAA 4Y2GA 3JD2A 4ER7A 1FXVA 2PGXA 2IUYA 4N21A 4KMOA 1XQ8A 3ZS8C 1Z5PA 2BM9A 4D9GA 2G83A 1GEGA 2W9XA 4TYNA 4DQ0A 3AEQB 3EC1A 4KMRA 2UUBO 4EBFA 4KXRA 3U5ZB 3ZW8A 4UHFA 3L1KA 4K5QA 2UYJA 1OB2A 3IMKA 1MRSA 5AI4A 1FOEB 3L43A 2OCXA 4DG9A 1BE6A 5FQNA 4X9QA 5JNWA 4OJNA 4WY8A 4Z4QA 5A62A 3H4MA 1EXDA 3F0DA 4YRMA 4PVDA 3DE2X 2ERCA 4RV4A 4DJFC 4U2KA 1GKUB 4PTZA 3PX7A 4MW9A 3OQPA 4MTGA 1H93A 2AFIE 4BUJA 3FPHA 5FO1A 2DTEA 2XKBA 4R2IA 3N2KA 3RHSA 1ULBA 3R6TA 4OHUA 3BRSA 2JGNA 3B7WA 4YLYA 2AZ2A 2FSVC 3QE9Y 4GLBA 1XDDA 3KZVA 5M34A 4OFXA 3IAHA 3RUPA 1JY8A 3WJRA 4W9NA 3Q3IA 5L4SA 3RYHA 3GP8A 4N3GA 1KH1A 1L7QA 4D3SA 1JZTA 3GDFA 5JZ9A 3RBXA 3RODA 2V6IA 3AFOA 4HQNA 3PD1A 2AG5A 4B71A 5JWOA 2IYFA 2P7HA 2B61A 3D6VA 4D4MA 3LLCA 4HEJA 1DRUA 3A58B 2CFIA 3FPCA 5DCUA 2R60A 2QTVA 1DWPA 2AHRA 2HMVA 4HWSA 1DAGA 4F97A 4JSTA 1WUTA 5F3RA 1R73A 4EJFA 3BMXA 4N7JA 5ALEA 3FFTA 1ZLZA 2X0FA 3GDOA 4BGIA 5DRYA 4WZBE 5LGUA 1JU4A 1M2NA 2B4KA 3C3EA 2AIRA 2CXXA 1D8AA 3V9PA 1HUQA 4B6RA 1EX1A 2WF5A 2AN4A 3RIHA 2QLLA 2QOEA 4KQGA 4JJ8A 2A14A 1HO3A 3ZR4B 5A4MS 1YHZA 3R8XA 5K4HA 2NSDA 2OILA 3EXHA 3SDLA 1I4LD 3L7MA 1NSTA 1RHQA 2X2FA 5TPZA 2NO9A 3A3NA 3G71V 3GEIA 4EG7A 4BW9A 5IYDO 2RIPA 3E0XA 3CF4G 1RHRA 1S0VA 1T91A 4LNAA 4OCZA 5EC2C 1Z5VA 3NBZC 4E5NA 1KD1W 2WF7A 4AILC 3YASA 3S27A 1PNLA 4HJXA 4CL2A 4B5CA 4BB0A 1US8B 3RFFA 3RIYA 1ZCJA 3KU1A 5HOQA 2CUNA 4KFCA 2CNBA 3SXJA 4IOMA 2UYPA 2V4UA 3R5TA 1JR3E 3ICQB 3DGEC 5JV5A 5EPEA 3DDZX 1N33B 1WVIA 2E4YA 1BN7A 3PXGA 3B82A 3F8SA 3P4EA 5GONB 1AI7A 5DNAA 2JJQA 1IEQA 4L4ZA 1OAKA 4LMAA 3N70A 3EFOA 1OX6A 4OGGA 2VDJA 5FPQA 4DSUA 1LGYA 2E5FA 3LVQE 4II2A 4BLWA 2IH3C 2IYUA 2XCLA 3KVYA 1E99A 3UATA 5HP7A 3TZLA 4YCNA 2C58A 4EFBA 3BRQA 1HEYA 3TUZC 4CLEA 2WYOA 5IDVA 3RGBA 1W5TA 3CE9A 3LHDA 4B3SO 5JJ5A 4MHTA 3TO5A 3D3WB 1GO2A 1L5FA 4NH0A 3M83A 2XV1A 1KY2A 1T0BA 3B38A 3C6ZA 5C1DA 4H6WA 1JD1A 4BFTA 3B36A 2Q0HA 1PVVA 4W5RA 1V8FA 4Z7OB 4LF8B 4O08A 3TD3A 4Y8VA 1U7UA 2AK2A 4H1UA 4P0TA 4R2WA 1XEXB 1EDZA 3PQEA 2ODQA 2RSLA 3U17A 2Y1GA 4LRTB 3S8YA 1CD5A 5L40A 3TMKA 4RYDA 1J21A 2IEIA 3DLBA 4DNPA 1OX4B 3G2OA 3GVXA 1K92A 3BBLA 1JVBA 5GVRA 2ATKC 4L3VA 1UBLS 2UYGA 3ROZA 2ZYRA 1E1CB 4P81A 3QLTA 4KOEC 5HE8A 4ZI3A 4P9PA 2C0CA 3DHEA 1EHIA 2GRUA 3O4HA 3CB2A 3JD4A 4YBZA 3SMQA 1HF3A 2O05A 3P94A 5IT9A 4BO2A 5TMDA 1X7PA 1NSYA 1TQ4A 1WB6A 3WJ2A 4HTFB 2ZRHA 1N0HA 5GAJA 1OHHD 1N1EA 3KZ1E 2B9ZA 2ZUCA 3EW7A 4K40A 2Q9LA 1H2AS 3Q9UA 4UJ3A 2AYXA 3N9IA 4DR1B 2PL5A 3NNDA 2VPYA 3VYSB 3WLIA 2NT3A 2FN8A 1ZC3A 4Z9FA 2XUDA 1HA3A 2MJLA 4JR2A 1L5QA 2BMDA 2FX3A 1R0KA 1LNZA 4RETA 3KEGA 4O1IA 3VSCA 5ALQA 3FBGA 3FKSD 4CI9A 2BEWB 4LR3A 1WCIA 1G8GA 3OQ1A 3CONA 1FPQA 3Q1LA 1CNMA 3G17A 2AG0A 2RB4A 3CHYA 2EIJC 3M6UA 2NIPA 1J2TA 1HT0A 3TTXA 2CB0A 5JYEA 1TCBA 1Q5OA 2LDXA 2PD6A 3H6GA 2ZZKA 3OJFA 4ER5A 1H2GA 4F72A 2DQZA 4MHSA 4BT3A 3EPLA 1WQ4A 2DPGA 2REBA 1AXRA 1QR9A 2EYUA 2X1VA 4YJGB 4YC7A 1JYEA 2ZSUA 2C5LA 1VQ7F 3OOWA 3IERA 4KFSA 1SB8A 4IUBS 4N7RA 4PFJA 4XQCA 5B2EA 2PZMA 1UXGA 1Y33E 4Q93A 5EZYF 3H2HA 2DG2A 4JBIA 3BE5A 2Z8YA 1BS2A 2OHFA 1X0XA 4BEWA 521PA 5FI3A 3EZLA 5IX8A 4ILKA 1A69A 2YFKA 2Y6VA 1GYPA 5KYYB 3CNHA 2FPRA 5L3FA 2MYNA 3N2YA 4DYHA 3L8MA 1TM4E 4IQGA 5HPYB 3M4YA 1KO5A 4OBWA 1XZ8A 5AJVB 5FV4A 2IOQA 2CJXA 1DV1A 4UOEA 2BYTA 3DH0A 4CE6A 5TVKA 1SRQA 3GA7A 4NJOA 1N3LA 4FNGA 3G5MA 1X3SA 3I3OA 5FBZA 2CXRA 2WLSA 4AKIA 4HNSA 4J3NA 4HNQA 3G8YA 2JCBA 3UM7A 1TQ2A 5HKBA 2ORIA 1KY4A 2PKYX 5HFJA 3JCZA 5E3HA 1EESA 3EXAA 1BQ3A 3WLSA 4YUWA 5C5IA 2DERA 3PAFA 2HC9A 4DV5B 3SHWA 3Q7RA 4R9UC 2YMQA 3F46A 4ZQHA 2P1DA 5L3SA 1KHHA 4ZHQF 3ELWA 2PHNA 1XT6A 1ZM9A 2EX0A 4DBVO 1G8FA 4L8YA 5TX7A 2P67A 3TZKA 4HR7A 3E9QA 1JG2A 1HYEA 3M33A 1I2AA 1JSRA 3WJPA 3W5DA 3S03A 1W4BA 5EE5B 3PZRA 1T3SA 3C3PA 3JZFA 3TUJC 3CF4A 1K7YA 2Q8PA 1DWQA 5FPSA 4D41A 4RA9B 2FR8C 1RQGA 2JI9A 2M6YA 5BQ5A 2H85A 4R1PA 5D8DA 3T0FA 1E2DA 4FEEA 4YRDA 1R8QA 3K05A 1F8FA 1OKKA 1CRQA 3LUCA 2GAIA 2I3ZA 5AKKA 2OLEA 1KBZA 4Q9KA 3KSRA 3ENWA 2QJWA 1SU4A 2FSFA 3AINA 5B55A 1TCVA 3DA8A 5KYWA 3C3SA 1I3NA 1NVXQ 3DE5X 1Y8RA 1ORVA 4FYXA 4RIGA 3PNOA 2Q5HA 4IMIB 4G41A 2XUHA 4RTQA 1C4OA 1C1DB 2ZRLA 2BKUA 2ZI7A 4B81A 4N65A 4LXIA 2DR0A 5A9TA 1G3MA 4BCCA 4BIUA 1AZTA 1HT1E 4QPPA 4CV0A 4MH0R 1RBZA 3QUSA 2P22C 2I4MA 3WYEA 1YUNA 1YZQA 1XP5A 1A9YA 3CC4F 3HDHA 4TL8A 4OY3A 4YECA 1NT4A 3RC9A 1SC9A 1KO4A 3E3AA 3UJ3X 3LT1A 2E2WA 2E6UX 1G3QA 5C1PA 4BGEA 4TMVA 3ZHSA 1YQXA 1JR4A 1XRMA 3UJPA 1RD4A 3QK7A 3C16C 3C7CB 4PHGA 2PX5A 4DMCA 3I1IA 2HMTA 4PC6A 1JDZA 3IC7A 3LMEA 4AF8A 1T3GA 3SIWA 5IFLA 4O2BA 4A5SA 2WJAA 2Q6VA 1KJWA 4XJXA 5BRNA 4MARA 4IWNA 2A06H 2I2FA 3VZBA 2ZAUA 4DLVA 4MUNA 1NFQA 1SG6A 3O92A 4E5PA 3SXUA 1N0NA 1NU6A 3N2KB 3EGCA 2R1UA 4INPA 2BTQA 2PI4A 5LIPA 3C3JA 1Y3BE 3MIZA 3OICA 1ZMXA 4GM1A 5IHPA 2HOQA 1EP2B 1XI1A 1W1UA 4XFDA 4WGFA 4B4KA 3M8AA 1KB9F 3L7BA 4DCNA 4Q1CA 2HWKA 4ZT3A 3RYHB 4D3XA 1TYZA 1RBQA 2B1IA 4DWVA 1U2ZA 3AKYA 5H59A 5JAPA 4OJYA 4RVUA 3VSDA 2CLOB 1E2FA 3E53A 3AVXA 6ABPA 5DHPA 3QJGA 5CCXA 5JSQA 2GJKA 3USZA 3PTAA 1RMYA 5AKEA 1UBSB 1IV1A 4QNNA 1GU1A 1YOVA 5KA5A 2HNAA 2PT9A 5LU9A 4JAVC 5B1HA 3V2GA 5J1SB 1P7WA 4JVLA 2EARA 1M1KW 1QPBA 3BSFA 2QTVB 4GQBA 4IOKA 3BGOS 4FQ7A 3K6RA 1N8RW 3OLZA 1V54B 2V6BA 4LI0A 3P9KA 1CUYA 2CT8A 4KV9A 1YUBA 1MQSA 3NW9A 4IQFA 3KUUA 1P3DA 5FBRB 2GYUA 3EQZA 3BAZA 5T8KC 2BZGA 4M36A 1CRWG 4GICA 4DEVA 1OCRC 1UBTS 3UQ8A 4BLSA 1E6CA 2IHUA 3SIUA 2VPTA 1Q5PA 2ZDIA 4BU1A 1HZZA 1L5RA 2E55A 1D1TA 4A26A 1KYXA 3EXHB 1U0GA 3H2SA 4E32A 4A0GA 4L02A 1EUCA 3CE2A 1MGOA 4GI7A 1J5XA 1LX6A 3GR6A 4UHDA 4LOAA 5CEEA 1M6VA 4TQ9A 4FTWA 3QE2A 4HEA6 4UBOA 3QNWA 3D6TB 1KIMA 1TO1E 3ZRXA 1BS1A 1M1NA 4IDHA 3ETQA 4GSLA 4BY9E 4KN6A 4IP0A 1F51A 1FVXA 4HVAA 2A5JA 4RELA 4H0FA 2AX4A 4PZ0A 1FUYB 4W5JA 1ZOSA 1XRSB 4KSBA 4TM7A 2Q3HA 2DETA 1UJCA 3NHLA 2OWEA 1R6TA 4ZVTA 4BFCA 1KP2A 1E3IA 2QG6A 5FRDA 3LO5A 4DL9A 4NPCA 4QHSA 4HUQA 2HDOA 3M99B 1HNXO 2IXTA 2O3QA 4HZIA 1XCMA 3HUFA 3LWVC 3IE0A 1TUGA 4MV1A 1PNRA 3ZZUA 4ALKA 3TM5A 4IL6Z 1M66A 3EFOB 3KSBC 3N5CA 1HE3A 2P6JA 1SETA 4EVQA 1FQWA 1QQAA 1OC2A 2BFDA 3HDYA 4OAPA 5BXQC 2JCYA 3APQA 2TMGA 2ZAOA 3SICE 2CD9A 2I5PO 5CFRA 2NO6A 1G63A 3TGWA 3UMRA 1B3QA 1S4MA 5I9SA 1SBYA 2QTSA 3BE8A 5C7IO 2KB1A 2OHHA 1E7WA 3ND9A 5BN5A 4OJQA 3TX2A 1M8JA 2IOYA 3AEKA 2ZR0A 4RPHA 1MHPA 2CWDA 4BNTA 4YUXA 1AJEA 3EWIA 4C89A 2CXTA 1JJIA 1G55A 4YFYA 3TEJA 1Z62A 5EIXA 1DX6A 4ALJA 5CCEA 5ALHA 3UB4A 3TKAA 4RVFA 3C74A 3T1HO 5C51B 3VYVA 3AP3A 4DDUA 2QTAA 4DUZO 3A26A 1PYGA 4OJTA 1M56C 2OBXA 5H3LA 1G41A 1D5CA 2AR7A 3NCHA 4WFHA 3WMWA 2RH4A 2ZT6A 1R0WA 5MGBA 3U19A 1CUWA 2HSWA 3KO8A 3JSLA 3RANA 1ANKA 2A57A 2BR3A 2C3OA 4EFDA 3RK4A 1E8DA 1XCPA 2F6RA 4NMXB 4YI3A 3PGMA 4AF7A 5BQ3A 1W44A 2P0EA 2H9IA 1XQWA 4MCAA 1GKFA 2OFFA 1JWBB 5BY1A 3RS7A 4LYYA 1T6XA 4V0KA 2UYCA 3AVVA 2Z3VA 4DC1A 4LYGA 4A8JC 4OATA 4CNBA 4X97A 2IV2X 1LV8A 3TYXA 3T41A 2WAYA 3HDQA 1K75A 4D57A 4RDHA 3OZXA 3ABLC 1IBLB 2ZREA 1TT5A 1X1TA 4GH5A 4P0QB 3G5UA 1XZDA 5I7EA 1MPTA 3K9FC 4M55A 1U43A 2DFPA 2VC2B 1WCIB 2EV9A 5AIBA 4IDDA 2QMOA 3LK6A 4Q6GA 3FLMA 2WTEA 2CE4A 4P84A 5B7NA 3HUTA 3RAGA 1J07A 3BRWA 1FVHA 4QBFA 2FZWA 1U9IC 2VF4X 4UQLA 4NOKA 3CWBH 5ADHA 1KZ1A 2R85A 2EFYA 1U4NA 1SQSA 3PPXA 4ZAZA 1YFZA 1UK7A 2MSKA 5DYTA 1J0BA 3CLTC 4B08A 1OKKD 2VDUE 4ON9A 1GM5A 4OP3A 3G68A 1L4NA 4QYWA 3LPMA 3FVQA 3F6RA 4RLFA 4X7BA 3GIWA 2OPBA 1J0XO 1A5ZA 3DZBA 4DXAA 5JYBA 1HGXA 2QU7A 1C29B 4QNRA 5SV2A 1GRVA 2H1WA 4NAVA 4CIVA 3VDNB 1IQUA 5AM3A 2ZF8A 3W77A 4DBLE 4YRNA 1X74A 5G53C 2H59A 5KKAA 1Z73A 2QUIA 5K0TA 1H2YA 1EGMB 4L4XA 2FN4A 3U11A 5LKRA 5C34B 1Z6PA 3AI1A 3WKEA 4B46A 2WU0A 2FN3A 4ENUA 3DOFA 5KYKA 3T5MA 4Q4AA 5CJJA 2JPDA 1KK2A 2W6ZA 1P1FA 4FC6A 4L50A 1RACA 3B3GA 2Y77A 1X1QA 5JSHA 3OZRA 4GXRA 1XMVA 5AUNB 3L8EA 4QPZA 2HLNA 5L3SB 3PNPA 1M2EA 2ZYWX 1K06A 3LWPC 5JDIC 1ODKA 3TAUA 1XOUA 3CISA 2OCAA 4DBLC 4RTOA 3UUWA 1YJNF 3UOWA 2AXQA 1WA5A 4DV6O 5AVOA 2PYZA 2QDKA 4PBTA 3AHHA 2FPPA 3EOAI 2EJWA 2D3OW 1XXHE 5DVZA 4EENA 2ZVPX 2IKSA 4X7RA 2X0LA 1E4VA 4MIEA 4UCQA 4GUNA 3H4TA 4BGUA 3OU2A 4Z5XA 4R2XA 2HSJA 5KYWB 2G1JA 4B84A 1Y8RB 5HQ3A 1LPMA 5AD1A 3L1JA 3RA5A 2PX6A 4C9BA 3GA5A 3TW4A 4XQ9A 5GONF 2G9RA 1H4QA 1TA4A 1KK1A 3KXKA 1SBHA 1PLLA 1VG8A 2PRYA 5MFPA 1XPOA 4EHLA 2C2XA 5H3CA 1JF8A 3U4IA 3I32A 2C0PA 3GJYA 3NAZA 3K9BA 1M3SA 2FTKE 2WAAA 1S3SA 1RWNA 5KTSA 4EG1A 1V4VA 3TTSA 3P1JA 1ZU4A 3P4XA 4R4JA 3QO5A 2Q4PA 3LHIA 1NXPA 4J4HA 2Q67A 1P33A 2H2AA 2ZSKA 2R3SA 1X38A 1U7ZA 3NIGB 4EEKA 2PLFA 1MJGM 2X9NA 2LFRA 3ZU4A 2B4AA 3EIQA 1S76D 4DLZA 3E2PA 1D2DA 4D92A 4WWHA 4G84A 4G1CA 3LDEA 4F3YA 4O2BB 3WLNA 2H2DA 4FYKA 5FLEX 1JBEA 2P9EA 3ZXXA 3P2EA 4LF7O 2PKCA 2DX7A 2ZRKA 3QEAZ 1ZIYA 1HFEL 2HS4A 3SXUB 4C4TA 4CLOA 4G25A 1QH1A 4R40A 1JTVA 1GFZA 2ZT9B 2BTQB 5H1YA 1TVEA 4KLAA 3CG0A 1DELA 2XNCA 4IGKA 1E0SA 5FXMA 3RNLA 4PSUA 2UYQA 4AIRA 4JLMA 5IUJC 2VWGA 2R72A 1KSJA 2JBWA 3LKZA 1NOIA 3H1HH 4C3ZA 1QIKA 1VL5A 3SJUA 1OXXK 2GHRA 3QFRA 2GVZC 2G9ZA 2NT4A 5ERGB 3LQQA 2BELA 2ID7A 1WUIS 3OZ7A 1GFIA 4Q3OA 4EYGA 4NXNO 3O94A 1ZHHA 3OW2F 5C32A 1RE1A 1YOVB 3QQ5A 4UNSA 2E87A 4BVSA 1ZK1A 1EWQA 1AGRA 1XROA 4OYRA 3CX5F 1EXNA 2JEXA 5DP1A 4DIDA 4HXFB 3OIUA 1WAMA 2PUAA 4AZSA 1MG0A 3AVWA 4MS3A 2C96A 4ABMA 4MTFA 3MK31 3PFKA 3OC6A 4BBZA 1DLIA 4R2MA 4ICGA 3SGLA 1KAGA 2CDBA 3NNSA 4EGAA 4PZDA 3QXHA 1G1AA 1XDZA 3TZBA 4OQPA 2AXEA 4EK9A 4S3MA 4YJKA 1WB8A 4LYAA 4CIAA 3VTKA 3JW8A 2E82A 2ZJOA 1GL3A 1ZLYA 4UFNA 3F6EX 1RKQA 5B7QA 2OB1A 2C9MA 2VCYA 1U28C 3D8NA 1EUCB 1S2OA 4NCBA 4BNYA 4UEJA 1JLKA 1J25A 3VO1A 1EH5A 1M6VB 2PV0A 4E1AA 1MENA 1UBHS 1UDCA 1UL1X 1G4HA 1IJEA 4LFBB 2RDCA 4AO8A 3MJHA 2HJHA 3UK1A 1M1NB 5JNRA 2XDYA 1F2UA 3KQQA 3MJVA 1GPDG 1RYHA 3QPWA 4R8VA 1T9AA 3AEQA 4N0EA 1IZ3A 2FWAA 2CHUA 2PGLA 2ZTVA 3ADPA 1H48A 4F96A 3HSYA 2GESA 1ZIPA 4BKPA 1D4FA 121PA 5I45A 4M38A 3VC3A 4HUQB 1Q6ZA 4I81A 2BCEA 1BHQ1 4FZ5A 3HCRA 1A50B 2O52A 4WADA 3AKDA 3UOAB 2PX3A 1QFSA 3AG7A 1TGOA 4RQBA 4Y2RA 1KDOA 4LJ8A 1FTYA 2PT6A 1JLRA 1G4AE 3A6HA 1HKUA 3MPOA 2IP4A 2BFDB 2BH9A 5HKLA 2CBZA 2IWHA 1DHRA 5KSZA 3E9RA 1W36C 5EFZA 1L5WA 5H16A 4B83A 4KH0A 2WT4A 2PMBA 4ZK7A 3JRWA 4C7KA 4Z51A 1J1IA 1GO3F 2Y1EA 4XGRA 5BN5B 2JK0A 4M0LA 5EIBC 3RHZA 2PE5A 2ANBA 2Y1DA 3AEKB 4IDBA 2A88A 1GYQA 2ZB4A 2CHTA 2AWOA 3U1BA 3BRWD 5HP4A 2OO5C 3WKCA 3AY7A 1QU9A 4X41A 4LMPA 5G02A 4ZK2A 1PV4A 5B2FA 5GJCA 3K0HA 5AR1A 5CVDA 2UXCO 4JYAB 2DJVA 2ATEA 2BE9A 4FQ5A 2YHAA 4Z7QB 2ODMA 3GK3A 1LLFA 2JD2A 3BVPA 1XOIA 2D2FA 4F84A 3FCUB 1LUWA 2JIMA 5B12A