4I55B

Crystal structure of tubulin-stathmin-ttl complex
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
428
structure length
425
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular Mechanism of Action of Microtubule-Stabilizing Anticancer Agents.
pubmed doi rcsb
molecule keywords Tubulin alpha-1B chain
molecule tags Cell cycle
source organism Rattus norvegicus
total genus 162
structure length 425
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4i55B03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4i55B02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4i55B01
4ZHQB 5EIBD 5CB4A 1SA0B 3WGNA 5ITZA 5IYZB 3RYIB 4O4LA 5LYJB 3ZBPA 3JATB 1OFUA 4EB6A 1FSZA 4HNAB 2VAPA 5J2UB 5MN5A 3JAKB 3RYHA 1RQ7A 3JARA 3VOAA 4I50B 5J2TA 4X1IA 5M7EA 2Q1YA 4O2BA 4DRXA 3UT5B 5MN4A 5EZYA 5JCOA 4FFBB 4O2AA 4O4HB 4M8IA 3HKEA 1TVKB 5BMVB 4LNUB 4YJ3A 5LA6B 3RYFA 5LXTA 3ZIDA 2RHLA 4EI7A 1Z5VA 4X1YB 2RHOA 3N2GA 2BTOA 2BTQA 4X20A 3HKCB 2VXYA 3E22A 4IIJA 4O4JB 4X1KA 5CA0A 5CA1A 1W5AA 1W59A 4U39A 4YJ3B 5LP6B 4ZOLB 4IHJB 3N2KA 3VO9A 1W5BA 4WBNA 1FFXB 5IJ9A 4EI9A 5JH7A 2GVIA 3JASB 5JQGA 4TUYB 1TUBA 1JFFA 5EIBC 4O4IA 2Q1XA 3JAWA 3RYCB 5IJ0A 2RHHA 5CB4B 5ITZB 5KX5A 4O4LB 5LOVA 3WGLA 1RLUA 4DXDA 5JVDA 4I4TA 4EB6B 5EYPA 3RYHB 3JARB 1JFFB 4U3JA 4X1IB 5J2TB 4O2BB 4DRXB 4YJ2A 4TV8A 4I55A 5EZYB 3VO8A 4O2AB 1RQ2A 4F6RA 5FNVA 1W581 2XKAA 3HKEB 5KMGA 5KX5B 3RYFB 5LXTB 5LOVB 3HKBA 3CB2A 5C8YA 4TV9A 3N2GB 5GONA 1W5FA 4ZHQA 2BTQB 3HKDA 4X20B 1SA0A 5LP6C 4B46A 4E6EA 5IYZA 3R4VA 3RYIA 2R6R1 3E22B 4IIJB 4X1KB 5CA0B 3JATA 5CA1B 4KWEA 3VPAA 2XKBA 4EI8A 2VAWA 3VOBA 4HNAA 5J2UA 3JAKA 4ZI7A 4I50A 2RHJA 3N2KB 3UT5A 4WBNB 5IJ9B 3C8LA 4FFBA 5JH7B 4O4HA 5JQGB 3HKDB 1TUBB 3WGJA 1TVKA 4XCQA 4O4IB 4LNUA 3JALA 5BMVA 1W5EA 5LA6A 3JAWB 5IJ0B 2VAMA 4X1YA 3RB8A 4ZI7B 5JCOC 3WGMA 3HKCA 5JVDB 4I4TB 4O4JA 5EYPB 3M8KA 3V3TA 4U3JB 4YJ2B 3JALB 5MN6A 4TV8B 4I55B 4ZOLA 5LYJA 4IHJA 5LP6A 4B45A 3M89A 1FFXA 2R751 4F6RB 5FNVB 3JASA 5KMGB 4TUYA 3WGKA 3HKBB 3ZBQA 5C8YB 1Z5WA 3RYCA 4TV9B 5GONB
chains in the Genus database with same CATH superfamily
4AKSA 1DOHA 4OL0A 1TZJA 1L4MA 4OLBA 4YQEA 1MUUA 5DDIP 4KHPB 3S03A 5AVOA 1L1EA 1QYVA 4XCVA 3T4UA 3KLMX 2J6IA 2DYSC 3AP2A 3WGZA 2M6SA 3VU8A 5EB0A 1SOMA 2X3UA 2DWPA 4NE2A 3QG1A 1I7QB 1N5JA 4FSHA 1P9RA 1A5TA 5IEJA 4IOJA 1ADFA 3V48A 5IJXA 2C1XA 2QPOA 3L70H 2EVWX 3TAUA 4B44A 2CJFA 1D8AA 3DXRA 3SF8A 3LPMA 5IM4F 4POOA 3QG5A 4LKRA 1Y3AA 4OP3A 3SPCA 3ILHA 5D3ZA 2I3DA 4JLMA 3ML1A 3MUNA 3HFGA 4ZZ2A 3JWEA 1HR0B 5KHJA 3T1OA 1RPAA 4FFVA 5CT8A 1VQ4F 5JNWA 1XAHA 3OOHA 5EHQA 4IGAA 1RLOA 1N8KA 3OTHA 2ZM6B 4LFAO 3I83A 3CNHA 4O2RA 2NSJA 3ZOKA 1RZVA 3GGCA 3ROEA 1OTHA 1KZ1A 2F1OA 5JCOA 1U9CA 5BW8A 5ESRA 3OUUA 1F9EA 4TL8A 1FDVA 2O5EA 1PS0A 3ITKA 4MRAA 4NXNO 1R1DA 1XAJA 3ABKC 4LBYA 3G2NA 1ADBA 4ZOLB 2NNLD 1WPBA 2X6BA 3UY4A 3WGYA 2QRZA 5K8VA 4RAQA 3MC1A 5FL3A 3VGJA 5IDYA 3F0GA 4PGHA 2F1RA 5DW0A 1Q84A 3VO8A 4ON9A 3VKUA 5DCWA 3IIEA 4DLKA 1F6DA 3IMFA 5E7JA 2Z2IA 2R84A 3IP6A 1KU6A 3CH5A 2C0CA 4RD1A 1N3IA 4UFPA 4DHEA 3CR8A 1SCJA 4F5DA 3LK7A 3HWUA 3LO8A 2G1JA 2YJTD 3FTEA 2BZSA 4C0BA 2W11A 4O4JA 2FTKA 3MINB 5MN6A 2X6QA 4UASA 2AD1A 3N4YA 2C8LA 4H6XA 4JTAB 3NBUA 1ORDA 1G20B 2V5AA 3CEIA 4RPGA 1JIJA 4X93A 4DUGD 1DJOA 2A1TR 4AMBA 5JXJA 5B3SC 1C0IA 3T4XA 4ZZIA 3T1VA 2ZUFA 3OO1A 1FU8A 3JXEA 2JFQA 1U0EA 1ESMA 4MB2A 2NU6A 1PQ4A 3GLHE 3L49A 4ARBA 3CNQS 2NR5A 1W55A 2ZI7A 1SUSA 2ZYGA 4DARA 5C3MA 3BULA 2BSQA 3B52X 3ZKWA 3ICOA 3FETA 2LIPA 3PC7A 2EV9A 2PANA 3FPSA 3NKFA 3GNQA 4AF8A 3AG4C 5ITSA 2Y67A 3W6OA 3WBFA 2ZB4A 1KXJA 2EJCA 1JVBA 2FCAA 1C4XA 4PYRA 2VK2A 5CX1A 3MHHC 1QE3A 2DQ4A 3VNAA 2G1UA 2H0RA 4DNFA 2HRQA 1PG2A 4RVHA 5HQ3B 1XL6A 3R7AA 2OL4A 4TMKA 4HYTA 3KYDA 1ZFNA 1JDBB 3GJ4A 4BE9A 3CXCU 1X1DA 5DBIA 4X00A 1JKJB 3I55F 5CFQA 5ITVA 2Q29A 1NJ8A 4TMVA 5SY9A 2HHJA 2HSJA 5EXPA 5AHRA 3PGA1 1WETA 4O4IA 3TETA 5KUTA 1BE8A 1MIOA 1XA4A 1E9EA 2GM5A 2ZRCA 2UUCB 2VUUA 3V4PB 4RCZA 3RG8A 4GF5A 2UYOA 1C5KA 4M87A 1N2CA 2O0LA 5JEDA 2V55B 4B3TB 1MJHA 2ZI4A 3G8DA 1C3JA 2WTNA 1AB3A 2QNBA 2CYCA 4J91A 3WXBA 4OQDA 5JAZA 2QL7A 3BICA 1UP4A 1V8ZA 5HIIA 4J29A 3IKEA 1RKVA 1WUHS 3C45A 2BO1A 1YQGA 1UMKA 4WCFC 2IPAB 1QRTA 3AOGA 1JHZA 4ZEVA 2AIRA 1VRCA 1XRRA 3GMDA 5AVJA 1CZRA 1OR8A 1Z37A 1HKHA 3AGQA 2YFHA 2IXDA 3VSDA 1PW7A 4LRYA 3O73A 4PHTA 2CNBA 3U40A 3O4VA 2GEJA 1X1TA 2H2AA 2NLOA 4OSEA 2XXAB 5BY1A 3WHKA 2REBA 1E1QD 4REQB 3CXCF 4Q1AA 4OX9B 3FHJA 2ZRHA 3ZJYA 1PEAA 3CFYA 1J56A 4X3LA 2BGIA 4HFRA 5JCXA 3AHDA 4PZZA 1G1XB 2YUTA 2GWRA 3U10A 1H1LA 3UM7A 5D84A 2OLEA 1IEXA 4IO0A 3CLRC 4TS4A 2Q2QA 4CKBB 2O2DA 4P08A 4FC6A 4PD4F 1XRJA 1F0YA 1R6KA 1NOIA 3G8BA 5KQMA 3GUHA 2JJ2G 2YXHA 2VHXA 1QTNA 3AR9A 4ACAA 1O94A 1YZQA 4MV3A 1NRXA 5IVIA 1SFRA 3T9DA 4IH4A 2BD0A 5JMPA 1M3SA 3JYNA 5KTRA 1UBMS 4C0WA 1JECA 1IXSB 5EE3A 4G2TA 1RJDA 3QBJA 4F60A 5F9HA 3NAMA 4MYUA 3SQXA 4FEEA 4Z0NA 3K0KA 4EYKA 1V7ZA 4WZBA 1SUPA 3PJSK 1M6YA 3RD5A 1EHCA 4ZVKA 2XBLA 2OOSA 3JQEA 1ZJ5A 1J9ZA 3HU1A 1JHXA 4YJ2A 1I5RA 4TMWA 1PR1A 1FP4A 1Z25A 2QZ4A 1GRQA 1MJ5A 2V54A 3FVQA 2XI4A 3ZXUB 1BA2A 4Y1RA 1SZXA 4BVAA 5B4UA 5ICFA 2EXXA 3LUKA 1H6AA 4UV8A 2OBXA 3M34A 1I7NA 4FLVA 4C4TA 1R27A 1ETHA 3B5JA 4G23A 1Q7CA 3AR2A 1OIWA 1RXUA 4IDAA 4WXPA 3HH8A 2PLNA 2BJWA 3ZGXA 3BTVA 1QZZA 1JTFA 4BIUA 2QW8A 5F2VO 1YB7A 5A0VA 3UV3A 4MWTA 1GRJA 4DQUA 1PWEA 2QTPA 1L5LA 5FOUA 3H17A 2VBIA 5BOSB 2OV8A 1G21E 1SUCA 2RFLA 1DAHA 4A6DA 5MDHA 1D8TA 5IS2A 1MP0A 3W77A 2SBTA 2DWDC 3RC3A 1NNSA 3IVMA 5LCXA 2B82A 1PFUA 3VM6A 1OHHA 2H54A 4R2KA 4DQLA 1JFFB 1Z3CA 1K2VN 1WB4A 4EMUA 5J1TB 4J0FA 5LQMA 1G5PA 4MV1A 3K9WA 3ENKA 1OAOA 1FCJA 4J1TA 2X0LA 1GAEO 1MAHA 5I48A 2QLMA 3OKFA 4TV8F 3IC9A 1K8XB 1X25A 1NV8A 5LMUO 1KPGA 3M33A 3L06A 4RUKA 4PA6A 2W2LA 4LCJA 1ECBA 3EXFA 3DBLA 3KE1A 3RAEC 2HLHA 5MFPA 3T5PA 2D6FA 4DRYA 4AN1A 4LJAA 4JYCA 1LD3A 4LDAA 3WRYC 3SKXA 4PG7A 4ETWA 4JT2A 1BGYH 4F85A 4HNHA 3TF5A 1VSVA 1R7RA 3OEED 4A91A 4MTFA 1OCCC 2PFGA 5KYWB 4H3HB 8OHMA 1EX7A 2V6JA 4ND7A 5EE9A 4PG8A 3AG3C 1FEZA 3P4EA 4D45A 1VQLV 1GMGA 4PM4A 3OZSA 3PHCA 1QGAA 2Q0OC 3L7LA 1HE2A 5DT9A 4HAUA 4CLOB 1USVA 3ASNC 5KWIA 4L15A 4NEHB 4MPRA 4TWAA 2W6JA 1HQYE 1WVMA 3GIDA 5DEIA 2AXEA 3AIOA 5JZVA 2X22A 3P9KA 2SHKA 4OU5A 4NR1A 3T9EA 3NDRA 2V9CA 1AI6A 3KALA 2QVBA 3JPWA 4H37A 9ATCA 4DR2B 1N0IA 2XXJA 1NUUA 1RSOB 5IF3A 1VMAA 5A4DA 1XTKA 2FLWA 4DMMA 4GWKA 2H4HA 3P1JA 1JDUA 2B3DA 1E5LA 1QO7A 1OLUA 2P4SA 4KR3A 1NQWA 4EGFA 3Q98A 1PWZA 2X6AA 1QU7A 3OQVA 5DK4A 2MSKA 2B0JA 4PQFA 1R64A 4OV6B 3O91A 1JG2A 2CV1A 2JAXA 5K6TA 3ZHVA 3HJCA 3GRVA 1KP9A 4QYIB 3U3OA 4IVRA 4G36A 3DMGA 1KVRA 3JQAA 4UQOA 5IC4A 4JYBA 4CLXA 3BSYA 4ZHSA 3OQBA 4YTEA 4FT2A 3C3MA 3AL3A 5KWSA 1W3EX 3K0TA 2FZKA 4BOYA 2JD2A 1X9IA 3I34X 2QU7A 4J1NA 3O3OB 1TIPA 4WLOA 4LRSB 3RRZA 3W7WA 1Z0ZA 3OTQA 1YZKA 2J3LA 2F4VB 3DBOB 2XQGA 1U7DA 2RBKA 3WQRA 2Q6IA 3AV0B 3D8UA 2CVLA 3CCQF 1YR8A 4KMSA 3E53A 4B3CA 3INGA 2WM8A 4C6TA 4PZAA 3WICA 2AEMA 1GDDA 4DIEA 5CVJA 1YFLA 5DPMA 2IHVA 2P5UA 3F7OA 1FS0G 1AJPA 1GARA 1B8NA 4L4SA 3U4AA 1AO0A 3DTVB 3TUIC 4FYJA 2AD5A 4PAGA 5J9PC 1Q22A 2BP7A 4RABA 3RA6A 5FUVA 4HNUA 4PQRA 2WUDA 1BEUB 2M6RA 3Q3IA 3D4BA 4MP8A 2VHYA 4EPVA 4CEIA 5KNDA 1K0FA 3CX4A 3WBKA 1KDPA 1BMFA 4JTCB 2B9EA 3CVXA 4BW5A 4QWMA 4IDQA 4JA0A 1JJIA 3PHGA 3P0IA 3UWSA 4TKUA 2Q0XA 3P3PA 1CR4A 3JATB 1ECCA 4W7IA 2PG3A 3VOAA 4EKYA 4ISBA 1ENOA 2OO5A 2X5OA 2J30A 1G3IA 5CHEA 3QSGA 1Z5VA 4MW3A 1ORQC 3OE7A 3FVTA 1LJLA 5L53A 3S1AB 4K3UA 4XD7D 4YR9A 1DBPA 2JH3A 1LEHA 2ZVQX 4AMYA 1K5GA 1EK5A 3LXMA 3CS5A 5KNBA 4ALMA 3AG5A 1BN7A 4P58A 7ABPA 4IVNA 1JEQB 2DFNA 3H5IA 2P2CA 3TX2A 1AKMA 5TX7A 2B7LA 4IEIA 5BWMA 2F90A 2XLCA 5GTHZ 4QIWF 4YREA 5LQJA 4ZVQA 4CM3A 4EW6A 3ANXA 3OQNA 5K0JA 2R7LA 3QJYA 2BWJA 1XDUA 2B1IA 3IHKA 4AQ7A 1SH7A 4JITA 3T7CA 2FQQA 2C5EA 4KQKA 1XZKA 3WGUA 2A0WA 1Y89A 1U28C 5K5EA 1Y63A 3INRA 1ZAUA 2QR3A 3G4SF 4EZBA 1ZX1A 4O2AA 2GPSA 2ACKA 5JMOA 2AQKA 1CERA 3TJTA 5KIAA 1Z5PA 1UODA 5AW3A 2I1VB 2R9VA 1SQPH 3F3KA 2XA2A 3CBGA 1JX9A 2BC9A 1X59A 3WWCA 2PT5A 3LUFA 3TSYA 4HDSB 1JJBA 1W0KG 3K2QA 1LF5A 5BN4B 2YY5A 4N3NA 1QUEA 5A7HA 2OZLB 2B8NA 4PFSA 5HUHA 5A9RA 4JB8A 1EGQA 1G8GA 2HHCA 1DIAA 4LQCA 1IOZA 4J9ZB 4YRBA 2C2BA 2BR4A 4G84A 1QIGA 3NTXA 3H1IH 1M2VB 1Y7PA 4BQFA 3L7MA 3FRIA 1U9IA 5FPYA 4D9NA 4YEDA 4QNHB 3T12A 3W8FA 3IUEA 2XUIA 5KOIA 1IWBB 5EJ2A 1GZ7A 1IZZA 2H4JA 4J6FA 4FGKA 2O7VA 3AEUB 4JLPA 3F78A 3OIYA 3HZOA 4Q9LA 4EPRA 2UZHA 1P7WA 4FYIA 1LF0A 4JJ8A 4P93A 5H02A 1KEEB 4TXLA 3IV7A 3ZIDA 2Q0AA 1U2QA 2JHGA 1G5RA 3Q7IA 2O05A 5KNLA 4IYHA 1P5FA 4H7KA 2G71A 3WVNA 3K57A 4H18A 2BUBA 1UWLA 1IXMA 4UJ3A 3NC1C 1H93A 2BEVA 1F38A 1ZSYA 2D1RA 3HSSA 2AFIE 1IPAA 5A9SA 1OAAA 2XMPA 1LK0A 2ZIAA 3HKEB 1VLZA 1ZK3A 1XDZA 2WIGA 1K27A 1WNFA 2DMRA 3FFXA 2JFPA 4RD6A 5J59A 1NXXA 3VZBA 2R6HA 2GEDA 5K8TA 1YF2A 3K94A 3I4FA 2ZCEA 5I01A 2EJBA 1VE3A 3NETA 1CIPA 3NBZC 4MR8A 1YDEA 2YYYA 2RG1A 4RZ3A 3H2HA 2AR9A 4QJ3A 3OZCA 2KGWA 5JWOA 3I1JA 3FCAA 1UK7A 2HJGA 2ORED 1DINA 5D01A 1KMHA 1FDRA 1VLVA 3HRKA 4UTRA 1T6ZA 1YO6A 1CFJA 1QPZA 4HB0A 4R5MA 3UK6A 5DN6G 1NZFA 1XO1A 2ZB7A 1RPJA 4PE5B 3S3TA 3CJRA 5LWQA 2CVPA 4V1CI 2AZXA 4S04A 3JTMA 1EDBA 1BCRB 4ZK6A 3AVQA 1NVPD 4OGFA 2ZBPA 4M7PA 1ODSA 4Q3LA 3RUDA 1PO7A 2GGSA 5T3YA 3C2QA 3N5CA 3Q8KA 1GGFA 1ISGA 4LDJA 2XWPA 2JRIA 5D7BA 1YRYE 4MWZA 4N01A 3L1HA 2LCAA 4U6SA 3BH6A 4CG0A 4RL6A 1JSLA 3BKWA 5ANRB 3EWNA 2UXDB 3R6DA 4L6CA 4NUTA 4A0FA 3GZTB 3J7AU 4XJXA 5IXJA 1E8DA 1XX6A 2QNRA 1V4BA 2B7CA 3BS4A 2YOHA 2CLSA 3AEKA 1SVWA 3DGEC 5BMVF 2KWIA 4DLPA 2PBLA 1ZBQA 1KERA 4QULA 3CF2A 2GYUA 4NKRA 2X8LA 3K09A 4QEDA 1VBMA 1F17A 3C5VA 1S02A 3IO3A 2LP4Y 5BW5A 1EMDA 1SESA 2IELA 4BFLA 4MUEA 2C9CA 1IBMB 2IC5A 2MT9A 5LLTA 3EZ9A 3G0CA 4Q1DA 5ALGA 4DKXA 3NBXX 3FN4A 3TZLA 4PYIA 1VSQA 3L71H 3OP4A 2DEUA 3D3NA 5L9AA 2ZRAA 1HYHA 3BAZA 2KSDA 3U3RA 4XDGA 1VFNA 2VYVA 1GN4A 5CDFE 2CXHA 1NHGA 3G17A 2YV1A 3BM5A 4LNHA 1OVGA 3NUZA 2H63A 1VF6C 2C4TA 1A9RA 4AS1A 2X0EA 2IITA 2E4ZA 2Q6LA 4W7SA 1WO8A 3NJ4A 1PS9A 4KWIA 2CJWB 2Z09A 4N0QA 3LDEA 3AEIA 4MB6A 2ZR8A 2C04A 4C04A 4C7OA 3CR3C 3K7EA 3FSGD 1Q17A 3BHIA 4HQLA 3BXXA 2GAAA 4HJXA 4Q1EA 1DVRA 5ESDA 4MVMA 1QQ5A 4FMDF 4W5RA 3G8AA 1I1OA 4RKYA 3SQNA 3SG0A 3OMNB 1WG8A 1Z4LA 4LZJA 1EK1A 1JRLA 1MA3A 5BQFA 2GBFA 4JI1B 3M1AA 3OE1A 4KVFA 5E8RA 1R3JC 3I9V1 1NE7A 4ZAFA 4BZQA 5F73A 5TJ9A 3K14A 2I4MA 5TB5A 5C8YA 4R2XA 4IIJB 2HFKA 1GDTA 3PUIA 1W9MA 3HJTA 4R0MA 4L75A 4PAOA 2WJAA 1JIUA 1PQUA 5FR1A 4A2WA 2HM7A 3Q3CA 1D04A 5BYKA 3IHWA 1X19A 4FE4A 4XUGB 1UT6A 2ZWMA 1Z62A 2XADA 4B84A 1W87A 2K5UA 2NAFA 3RYIB 5AIAA 2QQFA 2CK3G 5HY0A 3HVKA 2XNDG 1XROA 3I1YA 2YVKA 2L17A 4IW3B 3CCLV 2H1LA 1PK9A 2VJOA 4HDNB 4LE0A 1BAPA 4K9QA 2Y4UA 1KY3A 1T6BY 3R41A 4C6RA 3DTYA 1VQNF 1YJ9V 1P8AA 3TW0A 1P2FA 2XXBA 1QDLB 2GSMB 1SBIA 1UZAA 3K3WA 2ZK7A 1TYEB 1GK9A 1YZFA 1S0UA 5IZCA 1X7WB 4XQCA 3T8YA 4QJFB 2Q21A 2FPGB 5B53A 2QPLA 2GFQA 5JANA 3V8EA 2ZRDA 3KDPA 3HJBA 3DC6A 3WKCA 1EBBA 3WYEA 5B58C 5BR4A 5TJHA 1S9DA 1T5OA 2JIZA 3AVUA 4KH0A 1T2FA 4OK5A 3H01A 3PGKA 3DDHA 1U1IA 2YVAA 1II9A 5HW0A 1RQGA 2P7TC 3REQB 4CT4B 3UWKA 3AJEA 3OSZA 4Q4CA 5B5SA 2W58A 3UIEA 3CE6A 5CGZA 3M3PA 1XCMA 4MVXA 5LA6B 2CHEA 3I09A 2VQEO 5A3QA 2HLNA 4D46A 2ZCVA 2WSSG 4BVKA 1AKRA 1OX5A 1DG9A 2F9LA 1A9SA 5SZHB 2V58A 4MX8A 4Z1OA 3SR3A 3WKDA 4Y0AA 4LN1A 1ID8A 4OHVA 4WH0A 2JD1A 2QM4A 2JI6A 2PLRA 2JIPA 3SHVA 1WJZA 2QROA 2HX1A 2EFGA 2JFVA 2CF6A 1GN8A 2B4RO 1VPEA 5EXTA 3ABLC 2YQ4A 1BFKA 2JK5C 3ZCCA 4HBNA 1XJ5A 1S3JA 5KHIA 3IBYA 4CN8A 1JLHA 5JS8A 4R1QA 1N2BA 2XYGA 5KHAA 1DC3A 2XMZA 3DR5A 3EBPA 1PS8A 4C07A 1PFGA 1M56B 1DHRA 2OHFA 3HPQA 2D0IA 1CVLA 1WB7A 1VQ7F 1RYEA 2BHRA 4W8HA 2V7UA 3S5JA 1AR1B 3SIPA 1DX9A 1Y1LA 3F9RA 2CNDA 2OP0A 3D2AA 5AKZA 3MHPA 1P5RA 2D2IA 3DBIA 3SJCA 2B99A 1UMBA 2YXLA 3LL4A 4YRJA 2ORVA 4ZGGA 2W0FC 5E6SB 2GZDA 1W93A 3PE3A 4AY5A 3GBSA 1AY0A 3LCVB 2YRWA 4WPGA 3R7WA 5CDUA 4GOLD 1XZAA 1VCNA 2PUHA 4RIGA 3T1YO 2IXAA 2XITA 4PR0A 1FNCA 2NU7A 4DADA 4M83A 3B3FA 3TLZA 5FL7A 1BJTA 3TW4A 2HWUA 3NASA 3ZRSA 3KR0A 3KAQA 1M6EX 4M8SA 4PGAA 1JQ0A 1VRWA 3HKBB 1VCIA 2VZ8A 3FKSG 1UKBA 4LPKA 4OH7A 4AZTA 2HW8A 3PK0A 2O9JA 1G5FA 5LBQA 1NDHA 2VJDA 1EUCB 3I28A 3VQTA 3NCHA 1SG6A 3OBYA 3RE1A 4IRMA 4MO9A 3KVVA 1TUBA 1DXQA 3SM3A 2P6NA 3O8BA 1XA3A 5GY7A 3EFBA 3ONDA 4F8EA 1NASA 3WIUA 4UTXA 4M0KA 4AJ2A 3ZHCA 1XNJA 5KYNA 2VK4A 4MS4A 3KIZA 1KDRA 5KU7A 3I3SR 2X1HA 2BSXA 3OQJA 3O4FA 4Q1FA 3PQ2A 1OCRC 4D4JA 1ZWLA 3KQOA 1XMPA 2FZGA 2WRZA 4RPHA 4WFIA 2ID8A 4NFHA 1YCIA 4H59A 2QZ9A 2OCDA 2Z8ZA 2GN6A 1EFRD 1NMQA 1NR1A 1F51A 5HJ5A 3FFBA 4DCCA 1XZMA 3VKGA 1KBOA 1TEHA 2RDMA 5IWAB 4I50F 1MZFA 3BWXA 4B5CA 3TAXA 2V1XA 2PUJA 1MN6A 2XX3A 1H48A 1DQRA 1BS2A 1H8HD 4ZYVA 4ZMRA 2LR0A 4MINA 1QYIA 1XP5A 4J2TA 3D2LA 3VO9A 1BHAA 3IRVA 3GLTA 5B1HA 3AG6A 3ZWKA 1VQ5F 2J41A 2R7NA 4MUBA 1TQ4A 4OGKA 2EQ5A 3I12A 3A6DA 3OECA 5H4HA 5KYTA 3WNQA 3KEGA 3JARB 3UJ9A 2UVPA 1P1JA 2PMFA 4ZZ1A 2XDYA 3L40A 3WYDA 3TVTA 1ZWIC 3CCMF 4QDUA 2F43G 3QENA 2OD2A 4I4IA 3E22B 5I4IA 3EBOA 3AOEC 5G40A 4EM6A 3A1VA 3C85A 1AR5A 1T6XA 4CKWB 4J7JA 4N8EA 1PV2A 2RH4A 2ICAA 3TEMA 3FYUC 3BE5A 5HK8A 2OHJA 2QX9A 3ODPA 3UB3A 1U8YA 4D7AA 2FL4A 1R5BA 2FQYA 4PC6A 3B48A 3CLSC 1M7BA 1TEVA 2IYPA 4FYHA 4LZAA 5GINC 1IZ7A 2ES4A 4FZ5A 2I8AA 4OU4A 2WTEA 4B3SO 4UULA 5JROA 2Q9AA 4XIFA 4FFBB 5CB0A 2AB0A 5F21A 5FLYA 1QRSA 4RELA 2W2XA 3T52A 1XNGA 2B69A 1QV7A 1Q77A 5BR8O 2QL6A 3O84A 1MZVA 1IIRA 4KX3A 1Z38A 3WLLA 3VV3A 2PBRA 2K7FA 4B32A 2A7QA 3L4BC 1TYDE 1Z4NA 2ZSFA 3FSJX 1LBQA 4BNGA 3LVBA 2AW3A 3KQTA 4AG5A 1H5NA 1WLSA 1XU4A 4PHFA 1DAPA 1UFRA 3U61B 2G72A 2ET6A 3TLYA 4ZCPA 3RRMA 2CWDA 3GZNB 3KKMA 2Q3HA 2HCFA 2Z2ZA 1S8NA 1V7QA 1YB6A 2BVNA 2IYAA 5IKOA 2Z3WA 2WVGA 4DDMA 3DM9B 4KXYA 4EGSA 1DOAA 3O2QB 1V9CA 2DVMA 1JHDA 2GTIA 1QSGA 3CRNA 5ENZA 4D96A 3KKPA 3NWPA 1CZHA 4V2UA 4E1BA 2NN4A 8GPBA 3V7YA 4UDNA 2XNJA 1E4EB 3R0VA 3X1ZA 4CNBA 3KTDA 3RAGA 4D8WA 3FZNA 3TKLA 2I99A 3U9SA 4BB0A 2ZYDA 3DDUA 4GGOA 4NV0A 4U2KA 3ROTA 1RKXA 3I0NA 1A77A 4CKCA 4KBYA 1U8FO 2ONKA 3ZOPA 2BOCC 5ALKA 1I94B 3R7FA 1NLMA 4O5AA 1KSJA 1HNXO 4C7KA 3HWSA 1JKXA 1HY3A 1CUFA 3R7SA 1U3FA 3P9ZA 4UCOA 2CWWA 1W5FA 2OHOA 2VNAA 2FW6A 5B3JC 3T3HA 4MA4A 3NEJA 4ASUA 4YAEA 3NHPA 4XVRA 2QTWB 1Y6GA 1FRFS 1FYWA 5REQB 3CNLA 2X2PA 1QHYA 1T15A 5M5BA 3EGDB 1E1MA 4PXSA 2ONJA 3DV0B 2IEIA 2AZ4A 2VH5R 5ECYA 3TKYA 4HDRB 4D99A 3FVWA 2P4VA 1PU2A 1T2EA 3WYFA 4LV8B 4DSAA 2UVQA 4JJ6A 1KU9A 4Z4GA 1U40A 2VYCA 7AT1A 2ZINA 2FSFA 3O1HB 1SQFA 4S35A 5HK9A 1CJTC 1N6RA 4HV4A 4DBVO 4U7NA 1RJEA 4QHSA 2XB9A 2C4WA 1ZOOA 1O77A 1RBZA 4L5JA 4GAEA 5FOSA 3KEOA 3OFSA 3ONWA 1SERA 3MRTA 1R8QA 1XVTA 2Z1FA 2FR8C 3FROA 4JX8A 1M10A 4Z2WA 1ZD5A 1YQNA 1CR6A 2E6KA 3ZP4A 2XSZD 2O8DA 1E69A 3UMMA 3ELWA 5B1SA 4XPIB 1P44A 4GECA 1XEAA 3G71V 2A79B 4TM7A 1MAWA 1ZGZA 3ECAA 3CC7V 4YJGB 2B6NA 2L26A 4JBGA 2OESA 3G67A 1NX6A 2IHJA 4BKOA 3FGOA 4ND8A 4B6EA 2DLDA 2JJ1A 5CPFA 5IC6A 3PS9A 3OD5A 1QH8B 1CV2A 4C8GA 1UKEA 4ZO6A 3AGPA 5E6RB 1JZTA 1Q6ZA 2PAAA 5C32A 3TQIA 2BKAA 3CSXA 2PZLA 3EASA 1QIFA 2C20A 4R81A 3NPAA 3UAOA 4AJHA 4U9UA 1WPRA 3SC6A 4Y98A 3WAGA 2YHAA 3FKJA 4WI1A 1GZSA 1OY1A 1Z8DA 3QO8A 2IEDA 4DXDA 1BOOA 5KKNB 3ZX4A 2RJNA 3IDFA 2WA3A 4R4JA 2UZ0A 1MC1A 3X1XA 5AUNB 2V7QG 4NFLA 2B5OA 1J33A 1TAHA 2DT4A 3FYEB 4AO6A 1OWLA 2PUBA 4XJTA 1KMIZ 2ZB3A 4ZKDA 1JWBB 3IFXA 4G9BA 4PYKA 4KIWA 1X80B 1AKUA 3W8NA 3HDTA 4LRUA 4WK4B 3FOFC 2PZEA 1X0XA 1J5EO 3GHHA 4YIPA 2X0FA 1LDNA 2R1VA 1Q5PA 2HV8A 2H31A 3GEPA 4FPXA 3OLZA 4QYSA 3HL4A 1RVDA 4XYEA 4QUDA 2QLBA 2AOUA 4D9EA 3UG6A 3PF9A 4NE7A 4QTXA 5FBKA 1Z5GA 5JMWA 4H35A 1R12A 4CL3A 4B85A 3GUVA 4ENSA 1AA9A 2X19A 2BFCA 2OFXA 1OX4B 3EH2A 1P2SA 4DDUA 3DHEA 2M6KA 3OQOA 1DI0A 1SQ0A 2GM3A 3WTBA 2B4TO 3R3HA 1X13A 2DPXA 1JT9A 4NQRA 1N36O 3ESAA 2ANBA 1XZDA 4RDHA 1NBIA 5FWXB 4L8FA 1V5IA 3VHQA 3DVAA 5HX7A 5L3DA 3GJZA 2JS3A 4I14A 1O9HA 2IXFA 5JCOC 1TMOA 3M4SA 4PZDA 2AT1A 4CG2A 2N9UA 5T7BA 1CQJB 2PA0A 5HZHA 5AJTA 3GLGE 2WD8A 3H1TA 2XA1A 4A92A 4JCCA 3A8TA 1WN7A 1M73E 2B5UA 2I22A 1Q3EA 1XD2A 3RW0A 1FBTA 1DRUA 2RKOA 1FFCA 1AHPA 3R1IA 3P9YA 4N7RA 5AD1A 4Z8XA 3N28A 4HH3C 4U3FH 3B5EA 4KFSA 1DBVO 5FTNA 3UFXA 5HKKD 3SBXA 3N2NA 1DFHA 1VDZA 5L3QB 4IF4A 2VDNB 1WUIS 4INPA 4X6LA 1QIEA 1NVWQ 2PVPA 3FHCB 1U6KA 2BJVA 3WLFA 2PWYA 1QP7A 1X52A 1CXZB 5EXEA 3T0GA 1KKDA 1T6YA 4DV1O 3VC2A 4FLFA 4H0NA 2C03A 3S1SA 1ADYA 4Y3UA 1Z6QA 3QIVA 1M6WA 3NHBA 3ESQA 2ZWIA 8ABPA 1K73W 1N6LA 5CNKA 1ORWA 4MR7B 1X7YA 3MDOA 1PZXA 1NI4A 3FAVA 3T1TA 2KB1A 4B2IA 1I2DA 2B4KA 3SJZA 2DYSB 4ZPJA 2D5BA 3AK3A 1C3XA 3IE1A 3HCNA 4XYLA 1SD1A 3HCCA 3QGMA 4AX8A 3PTZA 1JYSA 2H8PC 3OBWA 3DFMA 5FPPA 3O4RA 1JA8A 1OGIA 3UMFA 1WMAA 4DRXA 3NMUC 3OFVA 3T34A 4Z1MD 4GOXA 3BOSA 5LKRA 3AB7A 1YQXA 4QQFA 4XB6B 3RTGA 3AB8A 1ORIA 4JJFA 4KXQA 2HC9A 3EIWA 3H2YA 5FI1B 3ITDA 1H8EG 4DF3A 2CF5A 3KLPX 4ZTUB 5B55A 2IKQA 3OU6A 3FWHA 1BWQA 1UL1X 3KCYA 2VP5A 3TPCA 3A6HA 2BI4A 4O29A 2Z3VA 2CC2A 2YN2A 4E5VA 1TVKA 4OHOA 4BQPA 1AK1A 3CHYA 4AUNA 2D3OW 4N40A 3QA3E 1Q6HA 5TQ0B 1UR5A 5IT0A 2GHQA 1H2KA 1XCBA 2QHXA 4ZU3A 3ABKB 2ATXA 5B7NA 5BNZA 1KECA 4LC1A 2DAPA 1NVUQ 1Q12A 1GRVA 4BO8A 4R2JA 5ALWA 1J0DA 2XDQA 4MQBA 1U3WA 4CM8A 2IU0A 1GWNA 2JLUA 1E2GA 1Z0KA 3DMFA 1KPHA 4HADA 1I3MA 3PFGA 3PNMA 3WLNA 1M2OA 4KR2A 2A9OA 2HT1A 2WHEA 3HMKA 3F0FA 2ZBUA 1JSZA 5JU6A 3IR9A 3PPXA 1BDBA 4DG5A 2V3VA 1Z12A 2DZDA 1IBSA 3QW4B 5L51A 3HXPA 4NPAA 2A9RA 4DR7B 3ANNA 1KJWA 2QKCA 4JI2B 5B3SB 3HDVA 2PUTA 3R0ZA 1M2GA 2X0NA 4F5ZA 3DKIA 1BKYA 4IDCA 1RAFA 5JCPA 3ZJTA 3R8XA 3B6IA 1DO0A 3VYUC 3W05A 4I9WA 4EVQA 2IXBA 5PGMA 2WOOA 4YO7A 4YQZA 3OCUA 1EAYA 1HFEL 4D8VA 3EA4A 5A4MS 1N0VC 4P35A 2QLJA 3C6ZA 1GXSA 2ZIWB 5AYVA 4EO4A 4U2BA 1EWQA 4XFDA 1V3VA 1TJ4A 3WQQA 3P19A 2Y2VA 3WJ7A 4B9AA 3AG4B 4L85A 1CW2B 3GOHA 5KTSA 4P4SB 2GAIA 3UA3A 1WZIA 5ALFA 2F9MA 4TXJA 1F6BA 3LE8A 1YZLA 1L8XA 4XWAA 3V7FA 1NURA 3NUGA 3Q5GA 3UMCA 1BZYA 3ZCSA 4O8CA 4P9PA 1VPLA 3DYIA 5I9NA 1O94C 1OCZC 4JLSA 3HDQA 3VMFB 1ODFA 3F7YC 3OM3B 4C4RA 1IMJA 5AW7A 1IM5A 3FLEA 4PBSA 2OXFA 4MS1A 3TDNA 4ZYZA 1O95D 2HS0A 3D5QA 1OBFO 1J25A 5KS2A 1U8CB 3ETEA 1NG1A 2VR1A 2FN8A 2WSMA 2GEFA 3CB4A 1NW7A 4X89A 4NABA 2QMQA 4QRHA 1T4CA 2NUAA 4H0LB 2VHEA 4KMMA 4OBEA 2HLDD 1NTRA 2FRXA 2QGNA 3CZ5A 4RZUA 5J4LA 3BRWD 1DEKA 2ZBQA 1Q8IA 3G2PA 4EG1A 3V2IA 4J7CA 4KPFC 4DDTA 4RFSB 1AUXA 4R7ZA 4LF9B 4URVR 1E6MA 3BH0A 2G8LA 3D7KA 4QDJA 3ON1A 4ZT2A 3K5IA 4WCFB 5B1IA 5DEOA 2OCPA 2C98A 2Y1FA 4DQKA 4MVJE 4C3VA 4RM2A 2EZUA 1VMKA 3EMDA 4X1YA 1E5QA 1AG9A 2YKGA 3EF1A 1JEJA 1E3WB 2H3OA 1JN0A 5BWBA 2R1TA 1VPTA 1BRMA 2JLWA 3ZBUA 3HVUA 4JP1A 5GM2A 4M3NA 1QYDA 4WACA 4QBGB 3AM5A 3R5KA 3K3PA 4HFNA 5LBTA 4HDQB 2G88A 4PI2A 4G0XA 4H60A 4G86A 2VQ6A 2IOFA 3VU9A 4D42A 1OAOC 4QA9A 2O3TA 2B2XA 1RMQA 3KHNA 4J1TC 2DHRA 1K33A 5CDTA 5JSUA 1HOXA 3A9TA 3CNNA 1QFYA 4ZANA 3F97A 4O2BB 3NRBA 2CGEA 5FT9A 2RGRA 4AAYA 1GGNA 1IG0A 5HZKA 3WSWA 1DQNA 4J9VA 4WA7A 4OM8A 1OV4A 3QVLA 5AW5A 3IP9A 5TPWA 4J2HA 3CX7A 2JCSA 2HREA 2PYIA 4CDGA 1G8SA 2QX7A 2YR0A 3MAGA 3V1TC 3LT1A 6Q21A 3HDYA 3INNA 3ZTWA 1D7OA 3WRWA 4QOJA 5KWEA 3IUYA 4Y9SA 1BHBA 2IUYA 1B16A 5EWMA 3ZZMA 2QTNA 5B2ZA 2NP7A 1NQ3A 1AS2A 2X9QA 1HE3A 1IBKO 3LSSA 1AU9A 1YGPA 3PSHA 1XWIA 1I7LA 1U11A 2H1IA 1L5HB 5JH7A 4L3OA 2EAUA 2Q3MA 5ER9A 2RKWA 5ELLA 3C3JA 2POQX 1Y8ZA 4OD0A 3S2SA 3ZUGA 3T7KA 3UJ8A 4XBFA 3HR7A 2GZSA 4HLQB 2ZIXB 2DCUA 1I4TD 2WHQA 3HBAA 1SELA 3H5TA 5IABA 3CR7A 3S8YA 2XUQA 1KOLA 1V6SA 5EJFA 4D74A 2X0IA 4MVJF 1NN3A 1AKQA 4UOZA 4YV1A 1MG0A 1C81A 4KUGA 2JF0A 2QRQA 1RWMA 2VQFO 2DPYA 1YIJF 1YS4A 1W0JG 4G0UA 2WU4A 1EG7A 1CF9A 3RTBA 3ZBQA 1X8XA 3K6KA 3IR7A 2VYNA 3I92A 4GZ5A 4DV0O 1O0SA 1FSGA 3SPJA 4FCTA 1RQLA 3DLAA 1Q19A 3C3PA 2UXCB 5EIFA 1RBQA 1K8ZB 1AQUA 1K97A 2OC4A 4EB3A 5JWRA 1HA3A 1W4RA 2FFBA 1KYIA 1W42A 1FLAA 2LO1A 4E13A 4GMGA 4WKPA 2MSLA 4ZT7A 5B1NA 2I2CA 5HXZA 4RCYA 4FK5C 3C3CA 2HQRA 1M8PA 3QITA 1JDVA 4L2IB 4IKEA 3IVXA 1BD4A 1GSAA 1UFQA 2R8PA 1FYJA 4F2PA 3AIKA 4Q7EA 4WFJA 3OVMA 1LDBA 4IUBS 4Q4LA 3OG9A 3RUAA 1G6OA 3KC2A 1DWPA 3R6TA 1ABEA 4B71A 5INTA 1Q95A 3G5UA 1JHMA 3I2YX 5BSVA 3E9RA 2NU8B 3ZVRA 2J09A 3SJQC 2XE4A 2BBTA 1H2RS 3ZTYA 1FP2A 1VQ9V 1XGKA 1KEUA 1OCCB 3KHTA 1P1HA 4JI4B 1H4TA 5F4BA 4AJIA 1DWQA 3DBRB 2YJZA 2QP9X 4QU5A 3FG9A 5IPFA 3IE0A 3AG3B 2DERA 3MJHA 3SZOA 4WK0B 1KE1A 4Z4CA 3ZGZA 2P4HX 1LDEA 2D8AA 1Y67A 4JR0A 4WA8A 3IHLA 1L4NA 3ASNB 1EVYA 4TSFG 1NMEA 4YAJA 4Q3BA 5I9SA 5CYGA 1QHHB 6YASA 3AT1A 1ZK4A 4LVCA 4NBRA 3F6YA 2LE0A 1WHTA 2AE1A 2GKGA 3GEGA 4M8LA 2OO5C 2VYFA 3QWBA 2X4GA 3E5HA 3E9MA 4F91B 3AWDA 5I4BA 4P3XA 3LWNA 1UAYA 3RWOA 1K7XB 4PDVA 4B43A 2KTVA 2VP9A 3SNHA 4I1YA 1ZGJA 1E32A 1NW9B 2QVYX 1ZH6A 4OHRA 1XTPA 4ER3A 3W5BA 1CDOA 4RZQA 1BOFA 5CA1A 3CVYA 4HXEB 3LIPA 4NSNA 3RWMB 2DPHA 5I6DA 3K70C 3LWOC 1BS3A 2PH1A 3ND8A 4FDVA 2UYCA 5ALYA 3ZXSA 3UBTA 3P5BA 4RLSA 5DWQA 3AJRA 1P3JA 2EEPA 3WMEA 1DKUA 1PL7A 1CDEA 4DMFA 5MFZA 2V6BA 3IS3A 1QRUA 2CUZA 4BTEA 5F64A 4XXHA 3CCVV 2JLBA 2ZANA 4NKGB 1YRHA 3GWGA 3ZJZA 3O85A 5CH3A 1MAVA 4M6WB 2DUWA 5JNSA 5CTJA 1MVNA 3UAWA 4RVFA 1ABFA 4ZRMA 3M4NA 1S96A 3W90A 1DAEA 3BHMA 4MW9A 4UEWA 1QB8A 4IF6A 2VPWA 4RMNA 2QYOA 3CWCA 1R6NA 4YUYA 5HFNA 1GZ3A 1TW2A 3GLIA 4D3ZA 3C1TA 3LOQA 3L7BA 5IHXA 4LF7O 4MO2A 2HA3A 3RU2A 3G1WA 4DW8A 2V9ZA 3KT0A 1EA7A 1UZMA 1RKUA 3NQ41 1G98A 1B8UA 1P6XA 4BMDA 2OWDA 2D7CA 1AZLA 1CY6A 3FB6C 1O5TA 5BSHA 3AP3A 3LH5A 3DPIA 2QVGA 2ISCA 1U9IC 2JRCA 2I6RA 5A71A 2ZZKA 1WEHA 3KUUA 4UVBA 3CZQA 4WY8A 4TYMA 2OFFA 4FCVA 3D00A 3P2EA 4IDGA 3KAJA 3G6EF 3HI4A 2CE2X 2HJDA 2Z95A 1M75A 4OREX 4GX5A 1J39A 2BZGA 1RJ9B 2X4LA 3OPYA 4B0OA 5AM2A 5KKAA 5JAHA 5GONB 1N7HA 5H9CA 2UXBO 2BIFA 3K03A 3H0KA 1ITZA 5THQA 4TVKA 1WBBA 1H1TA 3ZO8A 3N8NA 4DUZO 1LWNA 4FMBB 2ZJAA 2OGTA 5EMHA 3KXPA 2FETA 3R5JA 2Q5LA 3PZRA 1MB0A 2UKDA 2ZKOA 5D5PA 1GKFA 1CB0A 4F3RA 4M86A 1WCIB 4XQGA 3GDWA 1XMOB 5J47A 2VNJA 3G2IA 1AV7A 5ENDA 4G4SO 5BNFA 4K0RA 2HSDA 3EY9A 4JIMA 5AVZA 1CNEA 3N2KB 2P3QA 4F3NA 4O4HA 1ACJA 5JQGF 5IJ0B 5AQEA 1MJFA 6AT1A 4TL6A 2UV8A 4MUHA 4GCZA 3JR3A 3PUWA 1QU9A 4LGYA 2UYNA 3TZ6A 2ORWA 2LPMA 1YK0A 3WADA 2OBBA 5LYJB 3U81A 3O95A 3IO5A 1ZITA 5CFOA 2LBXA 2VJCA 5DX8A 4GGMX 2IZOA 1KH1A 2VJMA 4UDXX 4IJKA 5CBPB 3UG7A 1WMDA 2ZT8A 4NENB 3JQRA 1ZIDA 5AVSA 5H2FZ 1J2TA 4TN5A 2HIMA 1YJNV 4ABTA 4Q21A 2YS7A 1MV5A 3V2UA 5F2KA 1BZKA 2NTNA 3OTIA 4QSMA 1V6AA 3QTTA 4GL2A 2FE4A 4BBZA 4YVFA 4IMPA 3S70A 2Q68A 3S2YA 1JJVA 3PKJA 3QYFA 3MUEA 3RHTA 2GA8A 2BMDA 2WP8J 1ZUIA 4UXNA 3O75A 4FC7A 4XSHA 3RC2A 2VLBA 4NDAA 2RGUA 3AX6A 4FFWA 4YT4A 4CC6A 1FP1D 4CMAA 5A1JA 3ZCPA 4W82A 1KDOA 3KZ1E 4CMBA 1IV2A 2YDEA 3NNSA 4XIGS 2OFOA 3QF4B 4TQGA 4E07A 4AMZA 1JDPA 1Y1PA 2V03A 4OB7A 4GD3Q 4IDOA 3K09C 3O4HA 2ZVPX 1P0PA 3HEBA 3ESYA 2JBAA 1XJCA 3MEQA 4CM4A 4HN4B 4C08A 4Q9NA 5C34B 1K8AW 2DBYA 2EQAA 4H7PA 5G1OA 4A1FA 2BJHA 2OZPA 3AJ9A 5I8ZA 1XTZA 2W6IG 3C8HA 5AR1A 3MS7A 4XARA 1X1BA 3M7MX 1O03A 4UCQA 3R8CA 4QBHA 3F9IA 2D5AA 1VKZA 5ISMA 1P72A 5AMXA 2VDVE 2XLBA 5FAKA 4L8JA 1C7EA 1VQMV 4LX0A 2QZZA 3EGVA 4YXWD 4JQZA 5DGHA 2F7SA 3B70A 4LCEA 1QCEA 1R8JA 2LV8A 3OEWA 2GK3A 2YI9A 3I9LA 1E2MA 4R3WA 1QNLA 2FQXA 3N6VA 3DDZX 1TM5E 5JYEA 4B46A 2PDAA 2JRLA 4M60A 4P1ZA 3V4DA 1QLWA 3L7OA 4CF3A 3M9LA 2IV2X 3ZE6A 2JZCA 3HR0A 2GNOA 4FGWA 3AZPA 2UUBB 1LLQA 5AK0A 4C0XA 13PKA 1COWG 2J7PD 1YDXA 3DONA 3EY4A 1G8PA 1NUTA 3EOBI 1CTQA 4NH0A 4U7JA 1L4FA 2IK8A 2CEKA 4DLVA 5BSMA 2EFYA 3NHFA 4O4LA 4OXIA 3SAJA 2PMBA 4YCJA 1YS1X 3PB3A 1HTBA 3E0XA 2EDCA 2O8NA 4EY6A 1GA1A 4I1PA 4N3GA 1RAEA 2BFOA 2PS1A 2QZPA 1H5UA 1RI3A 2RJOA 2JARA 3DLTA 3EFOB 2JIDA 2Q7HA 1BX0A 4GG1A 5EJ4A 4GVPA 1MOPA 3EDQA 1GNQA 2ECQA 3MLAA 3D1JA 3SICE 1RRMA 5DTRA 3T3PB 4E6PA 3U3JA 1WUKS 2JFHA 3ZW8A 4FLUA 4FZVA 5EVCA 4X9XA 4J0GA 3I04M 3U17A 1QFJA 2YINC 1OB2A 1HNWB 2Z5GA 3WLEA 2MU1A 1IIBA 1CY1A 3FB4A 3Q6NA 4W1SA 3QEAZ 1R4ZA 1UMCA 2H8EA 3TN7A 2FJUA 3MUFA 4JLNA 1VQ1A 1EFPB 5IT4A 3RIXA 1QWOA 4JMLA 2A33A 1LI5A 4MVJG 3GT3A 1TM2A 2V59A 2Y3IA 4MTXA 1F8YA 5CLQA 4BT3A 4R50A 5JY6A 2PTGA 4CRWB 3ZIUA 3QU5A 4LWSA 4JQYA 1S72V 3QVSA 4Q0MA 3H5LA 4NCHA 5IZCC 1J7KA 2ON6A 2Z57A 3CPSA 2I5PO 4YHBA 3CVUA 3BA9A 3IDAA 4HQNA 5KNDH 2RONA 5JVDA 4LZZA 4NNJA 1QLHA 1OI4A 5DM60 4BFVA 2P4QA 1WQ1R 2RH5A 3DT6A 4EEXA 1E0KA 5MF6A 1EDEA 2JG3A 2FP4B 1L5SA 1MZPA 2YV2A 4J2OA 4CIWA 1ZAYA 2ZSAA 2WB4A 4LQ4A 3LQFA 3TG2A 2IHZA 1J0AA 3K58A 1GYPA 3GFVA 3EUWA 3HCPA 2WPDG 2CJXA 3PUVA 3ICQB 5EZ5A 1PNMA 3LHFA 1EP3B 2VSNA 4XB1A 1C3OB 2PWAA 5LLSA 4WLEA 1K1EA 1OH5A 4V0RA 3TYXA 4FUQA 4M88A 1WW2A 2W2VA 1W2GA 4L74A 1XI1A 1DUSA 4R1UA 1XZIA 4R1LA 3C6QA 1Y6FA 3PWZA 3QFTA 5B66Z 3BRCA 3QYAA 2ONYA 1R6XA 3NGLA 1JILA 3RV3A 1AO3A 3BXGA 3UJHA 4JV5O 3V00A 3QU2A 2Z0MA 1VQPF 3CC2V 4IDDA 4OI2A 4TTVA 4PO3X 1RP7A 5IH3A 3MQWA 3TPZA 1ZO8A 1E8MA 1V7CA 2O14A 1XV2A 3FW1A 3TSAA 1G8AA 1C8VB 1C9JA 3G0IA 4IXNA 4B4WA 1T9ZA 2IOHA 1UM9A 3FOBA 4CH5A 1R0WA 4N0PA 3WZ2A 3AB3A 2XOEA 3RS4A 2CWJA 3DZ8A 1FJXA 1P29A 3NHSA 5B7GA 2BKXA 1EVKA 1XI2A 2X6CA 2I2FA 1Y4UA 5HY1A 5HTKA 4K9RA 3HBJA 3DW1X 4JCOA 2UXXA 1W4CA 2Z2XA 3IT1A 2W6QA 4FS8A 1TYCA 2PX8A 2HCRA 2VRCD 1FNDA 2NMUA 2YWGA 4DJEC 1C9KA 4CCSA 2LNDA 3WLOA 1IB6A 4LXYA 3SJCC 5HFJA 1YAHA 1AHIA 1P49A 3K9BA 1L4HA 1D4OA 3WV4A 1T36B 1Q20A 4QOEA 2HJFC 1XTQA 5E4YA 1B42A 1YI2V 3ZNNA 1USUA 4RK1A 4B79A 4AI6A 1P3Y1 1YTFB 4MICA 1Z74A 2R6ZA 3EVBA 2I76A 4CH6A 5BPHA 4F96A 4ZJZA 2R8OA 2VHTA 1K8YB 2RDCA 4JT4A 4ZT6A 2Z04A 4BAGA 4ZVPA 1YHQV 1NE2A 5JFOA 4YRZA 3RVDA 3GN1A 4G85A 1NIJA 4L8LA 1PR5A 4DXHA 2UYHA 1OBVA 2DU8A 1PL8A 2WUWE 3RHZA 4DYDA 4KHPO 4Z9BA 1V3TA 3T5CA 1UXJA 1ONPA 1TDJA 1D2RA 3EIXA 1YS9A 3PQ5A 4MP3A 2IE8A 3MMPA 4R3UC 5H70A 5FUMA 3BWCA 1JVMA 2IHKA 1ZESA 2Q6AA 1LPMA 2YCLA 1NXSA 4ZC1A 2PH3A 5G1NA 3K06A 4HNAB 3GQBA 3TECE 3VKHA 4LG1A 3ON5A 3WDSA 2OOKA 1O7JA 3NEAA 1THZA 1CEXA 3OUZA 2WZBA 2GNPA 3PHLA 3ABLB 3UT6A 4Z9XA 3OWHA 5KX5A 1NRIA 2Y27A 2FX5A 1FLNA 3ESXA 1RDFA 3VGPA 1XEXA 4Z54A 2ZM6O 1Y9ZA 2NTYC 5GJWC 2NXEA 4WIAA 4OPAA 2E5WA 5ICGA 3OQMA 1E58A 4G97A 4IV0A 2R2GA 4WE3A 5BQXA 4W9RA 4TKVB 4QPNA 4UXHA 1Q0HA 2JCXA 2GN0A 2WTBA 3Q7QA 1DCFA 2ZVYA 1MAAA 5FTWA 2CKMA 1NH2B 2BMJA 1QRAA 3C3YA 4N7JA 2Z6VA 1L5YA 4FN4A 4RK6A 1KY4A 2AOTA 1Y3BE 4NV1A 1N1MA 1SHJA 1F0NA 3PPIA 1OA0A 4GT1A 1V4VA 5CG2A 3WGOA 1Z56C 2XBMA 3LUGA 4OGLA 3CH7A 1D6MA 4J0JA 4L16A 4N3BA 5ICMA 5DN9A 1H05A 3GDGA 2ISQA 2XY4A 2JH9A 3RTCA 1FX1A 3N0TA 4NYIQ 4YA6A 1DJNA 2RSLA 5DHSA 1U2PA 1KAOA 1EVJA 1G2IA 1QV9A 3LZDA 2J4DA 4QOSA 2ZYHA 4MUGA 2W0XA 1FXVA 2ALJA 3UMSA 4KSYA 3IEIA 1CK4A 2FZLA 1LRLA 2R85A 4WASA 3ZCVA 1NNEA 5LQNA 3RVYA 5JLJA 3OCZA 5E3HA 3T4PA 4OSOA 3BABA 5EAZA 2CTRA 4NAHA 4W1PA 1K73H 3OT1B 4HNVA 2QRGA 4RTLA 1WSDA 1V8OA 2CUTA 3G0DA 2LGJA 1L5QA 4LUCA 2PKXA 4NOLA 1U0FA 1XQ1A 1GUBA 3DPUA 1NKTA 1OCRB 7MDHA 4BTVA 2XT9A 1DBFA 4EG5A 5AW8A 4GVLA 2QTVB 2CZQA 3H19A 3E9YA 4X1IB 3MCAA 4L73A 3ZCXA 3NH6A 3KT3A 2H57A 4W1QA 4ZOAA 4FIDA 1HO3A 3L7NA 1SA0A 2XYRA 1FKAO 1TQ6A 4IDPA 1T6NA 5FOTA 3L5OA 2TMYA 3T1HB 3EARA 2A5DA 4FM0A 4X8OA 5ALRA 4DGQA 1CRLA 1MX1A 3TNLA 4FI3C 3AUAA 2AG0A 4HGNA 4NZYA 1T0IA 1EEXB 3BSSA 4BECA 2J32A 4ETIA 3FYIB 3I56F 4TLBA 1WVGA 2C4HA 1EH5A 3RCBA 5J2TA 1AQIA 4M1MA 2PWBA 2FW0A 1SZTA 1OYWA 3FD5A 2Q3JA 2C2MA 4LPSA 5E1AC 3ZV7A 3QYJA 4P4TA 3STWA 3DC2A 3VSBA 3D5TA 3LSQA 3VPBA 4CUKA 4MXDA 1L5WA 4IS3A 4C0HA 2I4RA 5HF6A 2IW1A 1N92A 2Z8XA 2WF5A 3OZBA 1FDUA 5MGBA 2WF9A 2CHGA 4QGAA 2AEEA 1QFMA 3FYUB 3GD7A 1VPVA 1VM6A 4MQFB 1F2UA 2CN1A 4OHMA 1E2UA 2EF0A 3CH4B 1YULA 5AESA 4OFXA 3O1LA 4XVQA 2NYAA 3EXG1 4OSPA 2ZTVA 3WJ1A 2RHJA 4NCNA 3VR0A 5IK2D 1VLQA 4EWLA 2CVFA 1E1YA 1C2TA 4YONB 4ZXPA 1CJUC 1L8DA 3DSRA 3QEMA 2OB1A 1S4QA 2NV2B 3K9QO 3M89A 4J0KA 1U5BB 1M33A 3E48A 2QLTA 2FB9A 1FRVA 1U2RA 4GI2A 2FYTA 2IJHA 3IR5A 5J2UF 1HL3A 1UCFA 3AHJA 4BLUA 1SOUA 1U7WA 4F9EA 4I5GA 4S05A 3UV6A 1LI7A 1WNSA 4MRMB 5SICE 4BO9A 4MQ5A 4R5HA 3C6KA 2O6LA 4QXQA 4IS2A 1X7XB 2CVOA 2II6A 3DOCA 1K5SA 1DQYA 3HBMA 5F3DA 5JJKA 3L43A 1NS1A 4DMKA 1NLYA 3KK0A 1U7UA 4LVUA 1AH2A 4XRRA 3VPFA 3NGMA 4MHSA 1XB2A 1XUQA 4XDJA 3WDMA 2HSGA 5TPZA 1HDJA 1FQJA 2HHHB 4NBLA 3DO5A 3TB4A 1FU7A 5TS2A 1FL9A 4CL2A 1ZY2A 2AZ0A 5LXTF 2QTZA 1IZ3A 4G2KA 4BVRA 4MW6A 3GJYA 2ONZA 3VHXA 5K8UA 4N1AA 4HLCA 3CMMA 2XUKA 2Z4TA 4RO0A 4IRXA 1Y9DA 3CXRA 3U5TA 4F86A 1JHRA 3FNHA 3JRXA 1LW7A 1I6MA 2WM2A 3KT6A 4EH1A 2VTBB 1C7QA 4U3JB 3FCOA 1XL1A 3K92A 2HOQA 2O7SA 2FWIA 3GARA 1KS9A 1DIHA 1ONSA 1DDIA 1Y5MA 4RY2A 3RVZA 4L4XA 2EJTA 2BUCA 1ODIA 2CL0X 1M1ZA 4UUOA 5LQRA 4J7XA 3KJKA 1KAHA 4UOQA 3OONA 4KSBA 4RO2A 2C9BA 4N5LA 1GKKA 4ND3A 3BMOA 5LP6F 2AHYA 1K0UA 1CRPA 1WF3A 1HQKA 1U0GA 2HU2A 1URPA 4ZOQI 4H4CA 2QTAA 3GZ4A 1Y7IA 1RE1A 2E3JA 4BFCA 3HU5A 2MOKA 3DAGA 3O8QB 4X88A 4KQCA 2J0SA 4DY4A 1JQBA 4G5XA 1XMVA 4QARA 3O93A 1TTPB 4DR6O 4HWPA 1MC5A 4W7HA 4JBNA 5F1OA 4J0DA 1PJ8A 1S8AA 4ESVA 2PL3A 4B34A 1G5HA 5HBGA 5DLDA 3M1IA 2NMVA 1D09A 4FGZA 5JWPA 4FJ2A 2AKAB 1SHTX 1RR6A 2HP8A 1L8AA 1SRYA 1DFIA 4HLDA 4AURA 4OA8A 3ICWA 4DCSA 4IEFB 2NO0A 2H65A 3M6MD 1KDYA 3RQSA 2X4IA 3WBJA 4V03A 1VCHA 1RU3A 3K5OA 3AY3A 4E88A 3W8RA 4JYAB 5FFMA 4HX9A 4MP6A 2JJYA 3OW2U 4DV4B 1N8RW 4XQEA 1UJ2A 1U9YA 3IIJA 1SUDA 1OGYA 4KITB 4B3GA 2NXJA 4O02B 5AVKA 4HMPA 2C4UA 3NTOA 3C74A 1TA9A 2HRDA 1DT3A 2X9LA 4MKRA 1Z82A 4CETA 2CSLA 3HABA 3HU3A 2O8FB 2ASVA 1CCWA 1PRYA 1YR7A 5JATA 2NVBA 3GFSA 1I2ZA 2MYNA 3ZCRA 1L9XA 3VC3A 3BTUA 1CS0B 1YFJA 2F1MA 1DWOA 4RHFA 1XDSA 2OUKA 4PWZA 2Y1KA 1KAQA 2K4MA 2O3SA 1K98A 2GHIA 4JN6B 3RF7A 3IIIA 4BX8A 1CU1A 4PQGA 5JYBA 5K3FA 2G67A 1L7AA 3CD6V 2I9PA 1C0KA 2RHTA 4CI9A 3VQVA 5IC5A 4ZK2A 1OJLA 3WKEA 2PPVA 2Q8PA 2HT6A 2VAPA 2RG7A 4DA6A 4AKTA 4DNOA 1P1BA 4Q7JB 1RQPA 1NQ5A 3D6TB 3ACDA 1UPUA 2A67A 1U02A 5C0OE 1JR3A 3V8RA 2VZ0A 5DRYA 3G7SA 5B57C 1E2QA 1QZUA 3QLUA 4QXRA 2AIFA 3BG5A 4RTMA 2R8BA 2OSVA 2DHQA 1WABA 3IERA 3OW2F 4UJ5A 1SBNE 3Q9NA 4MYDA 5KVQA 2M7WA 5L4LA 3UKDA 5J4YA 2O5VA 5BV7A 4PXYA 2V3WA 4TSRA 1SQVH 2FMFA 3WRXA 4UEQA 4DR2O 3LUBA 1ZRNA 2QRVA 1BX1A 2HWKA 3G2LA 3OZGA 3H8VA 2GXAA 4UC0A 3G02A 3LBYA 4UBMA 1FX0A 3ROPA 2Y93A 2J1LA 3QX8A 2ZSBA 1HYQA 4F4FA 4TV9F 1Y1QA 4H16A 5IYZF 3UTCA 3DXRB 3V7NA 1EK6A 1U8EA 3QVOA 3LPCA 1VJRA 4X97A 5TEWA 3UKMA 3EDOA 2ZJBA 1EXMA 1Y1TA 1K66A 2Y0CA 4WN9A 2H3EA 1UQTA 1DHTA 2R8RA 4V0ME 3AZOA 3F9CA 3EMBA 3CS3A 1BQEA 4LOLA 3C7CB 4BJ3A 2P5TB 1BJRE 2GDSA 5DYTA 5I4CA 1ECJA 1PNLA 1HGXA 3L0IB 1JQJC 1E64A 2Q6VA 5K3SA 1K5HA 3EUEA 4GKKB 2F4VO 5CRIA 4LDNA 2IE0A 5K0LA 1LDMA 2WABA 1PPJH 4GICA 9GPBA 1O2DA 4JI5O 4Y67A 3MMXA 1X3LA 1R50A 5GPBA 3BRSA 1QAOA 2ZKIA 1TM3E 4E1AA 1V8BA 2JIOA 2V6FA 1ZRSA 4TTRA 4INJA 2H1CA 2XQVA 2CXNA 2SICE 1NNI1 5EN4A 4F6EA 4KQXA 5BT9A 1T3SA 4K81B 1YC5A 2NZYA 5GAPK 3O8CA 4O4JB 5K4AA 2Q0HA 3EWAA 4L8VA 1M8KA 3DKRA 1S5JA 2OCXA 3SHTA 3RS7A 3MBMA 2P4KA 1S76D 4BNXA 4P98A 4LFBB 4YY3B 1IZ0A 4EUSA 2WW8A 3CCUV 1RM1C 1EWVA 1QQ7A 1OD6A 4IV8A 5IN4A 4OHZA 1CRWG 1SKAA 3A0HZ 1RYHA 4EO7A 4L7QA 3SZUA 2B7BA 4JELA 4TWKA 1SHZA 4B1FA 2J67A 3L8EA 3LQYA 3RVKA 3UUWA 4Z3DA 4POAA 2OM6A 1EB8A 1DTEA 2ZI3A 4FOSA 4MUMA 2FQWA 1JPVA 2HD4A 4GP7A 3ZKWB 1XVIA 3WSTA 4J41A 2DTXA 3EG9B 1V8FA 3O8DA 5I7OA 1DKMA 4KYUA 3TOXA 4AO7A 4BT4A 4U8HA 1JR9A 1SQ5A 2AXNA 4FDMA 2BMFA 5HF8A 3EVGA 4I4LA 1PFYA 3G5LA 2X3YA 3B1JA 1Y76A 1SBTA 3A9VA 3LCCA 1OZFA 2BKUA 1KSHA 4CUJA 3OJFA 1Y8RA 4U7FA 1POWA 2EGHA 5CH5A 3KYDB 3UB2A 4PRLA 3AU9A 4KGXA 1AB6A 5CITA 5H6QA 1X1QA 3ORFA 4DWJA 3EISA 2AJBA 2H9YA 5LNK1 2VAXA 1SO8A 4CQMD 2ZSKA 1I2AA 4W99A 2VP3A 1E6LA 1HMPA 4GDMA 1UXOA 4O4IB 1F2VA 1II8A 5CLJA 3VPHA 1MIOB 2L35A 2ZBDA 2B4AA 4E30A 1VQVA 2QGFA 2XZTA 2PJDA 1B23P 1TVCA 3QVUA 3QKWA 5JS7A 1OFGA 2H94A 3R3SA 4TMZA 1XXLA 1N2CB 2ARHA 3I8OA 2DUJA 3STTA 4F4UA 2GCNA 1BFUA 5I9TA 4O59O 4GR9A 4YJ3B 2AJ8A 4LY6A 4P4NA 2ZQ5A 4FMTA 2VNKA 1DX4A 1KY5A 4H31A 1CKEA 2OZKA 3ENZA 1Y9AA 4CTKA 3JRWA 2D00A 3NK6A 1Z7WA 3CC4V 3IVAA 1KI1A 2GCIA 2P11A 2XDWA 4IHAA 4H1WA 4GEGA 2YWRA 4E51A 5EJ8A 4EHIA 1RC1A 1Y4SA 2WSIA 1H1LB 2JFYA 5SYNA 4OUDA 1UIMA 3H1PA 2WT9A 3F46A 4ML3A 1WCWA 3ZV6A 3BWMA 2WLTA 5EZYA 2WIAA 4PCVA 4M36A 2WWWA 5IKMA 3IPYA 1M7HA 4JKOA 2FG5A 3WLMA 1CUJA 3OQIA 5GJCA 2YNMA 1OCZB 5G1PA 2FWMX 3LYAA 3LRXA 4ZOEA 1VLMA 2XUOA 1YD7A 3HN2A 4FEAA 1H3EA 2WINI 4YRSA 4MGZR 3EGIA 1FTGA 5GV7A 4FLXA 1G5IA 5KEIA 1QIKA 1KYVA 2PSSA 4G5HA 1GNRA 4NEQA 3D54D 1SC9A 4JWKA 2REXB 4RQUA 4WZBB 1C8LA 4E70A 1XZ8A 4QJ5A 5F5LA 1MHTA 4HFMA 1WBDA 4RSGA 4M0MA 3KPVA 4YJ2B 2AUNA 3HCWA 1FP4B 4BEVA 4DLAA 1ATZA 2XUDA 4BY9D 5ALUA 1E7MA 3O2NA 4CTOA 2VF7A 4Y1RB 2P62A 4ENQA 1SD2A 4I6GA 2R5WA 4N8SA 2Z43A 2IYUA 2JFWA 5BUQA 1GU0A 1NXVA 4WZAA 3TM4A 1AB5A 4MTLA 2FR0A 5K0TA 1DJQA 4MKFA 1E3SA 1W5AA 1D4ZA 1LS1A 2OHHA 3A0RA 5M3BA 4J1SA 3ZC3A 4Q15A 5KVSA 5KI6A 1BWRA 2OTJV 4DPLA 3NVKE 1YQWA 1SBYA 3AFIA 3ICCA 2UXDO 4WXHA 1JIKA 3CSDA 1AP6A 3FSEA 1CY2A 5LHIA 3GA0A 1DNPA 4YV2A 2HBQA 4KSCA 4TXHA 3IP8A 2JLZA 4MV9A 4EATA 4DEVA 1YQTA 1AZTA 3OI7A 1V54C 3RC8A 2Q4OA 3U9LA 3I01M 4PANA 2P1ZA 2PMDA 4BUCA 4ZAZA 2FB5A 4IUCS 4X24A 4H6VA 1B93A 3IURA 1IBMO 3R7DA 3IQEA 3IBFA 5M7EA 1YB2A 3M6UA 1J1UA 4OL9A 4DGSA 4TWIA 4WY5A 5D1HA 1X39A 3PPYA 1N9GB 5EQDA 1SC4A 4NCAA 2IYNA 1PGJA 3BJZA 2FMTA 3MMSA 1NBME 2P6PA 2EIXA 3L7DA 4UD6A 3PFFA 4MWGA 1MFPA 1K8AH 1ZU5A 5DXAA 3RAJA 2OORA 4INOA 1U2DA 3EXFB 4J0CA 3DBLB 4G9GA 4EG8A 4BQOA 4LOKA 5LN1A 2W6ZA 4MV8A 2L6LA 2QY6A 2HXYA 2JANA 4PZ0A 1OF1A 2WMYA 4DMCA 1IPHA 3ZJ4A 4C7MA 1H9CA 1U7OA 2WHXA 4YI3A 4A9AA 2PMEA 2OLKA 1V5EA 3CONA 4YNBA 4D98A 2LCIA 3VNBA 2AI1A 4AP6A 3CKKA 1MOSA 3GUCA 3OBBA 2H5LA 3ESCA 3LQ4A 3RARA 4D7SA 3IFSA 2QF7A 3R3ZA 3AR7A 5EWJA 3TCXB 4OQXA 5LU8A 3TBFA 4TTIA 3MJRA 3D64A 4BEBA 2V4ZA 5K0NA 4YUVA 4BB9A 1TCBA 3KKZA 1V11A 2Q50A 3E84A 1DAKA 1NPTO 4LJYA 3C43A 3STXA 2VDMB 1V2GA 2NVOA 2QA4F 3G6WA 2JK0A 2TYSB 5ALJA 2UYJA 2HDHA 2XUPA 1V47A 5AVVA 3F0EA 3E8FA 2H85A 2MK3A 3CCRF 3N70A 2O3RA 3H8WA 3FDJA 4XUCA 1TGVA 3SIVA 1OLUB 3KL4A 3AF6A 3ETNA 4BNNA 3PITA 2CAZC 1QBZA 2J3IA 2UYYA 1T0JB 1ZINA 3AP1A 1IONA 4N5MA 4LYHA 1NMSA 1ZL8A 2P22C 1BJKA 3ONFA 2CSUA 1G20E 2ST1A 2FSPA 4F12A 1O1YA 3M99B 3OJ0A 4G89A 4P53A 4Q19A 4Z4HA 2JLYA 2JHFA 2I4TA 5JDCA 2UYQA 2QEXF 1OPXA 4TLLB 4M7RA 3K9LA 1WUTA 1MCZA 5TMEA 4NYJR 4J8PA 2GXQA 2JI7A 4RHUA 4UUNA 1YHZA 1A88A 1CS4C 1QRRA 4HWOA 4HWGA 4LOHA 2HF2A 4QRIA 1TRKA 5DTIA 3CRRA 4NCIA 2XVMA 2IKSA 2BFDA 5EIHA 2WYIA 3DAOA 1QIHA 4TYPA 4O3MA 4C6TB 1CNFA 5TQJA 1Z83A 3L6DA 3U3MA 3DXFA 4BE4A 1ZL2A 4YP6A 2EWCA 4M1YA 5D3KA 4IQGA 1A95A 2MSDB 4JBIA 4DW1A 5IVDA 1FFGA 3W3ZB 3K9AA 2X5NA 1G7SA 1AQLA 3JR7A 3N4ZA 3IGFA 2XUFA 3MMNA 4KJXA 3CU5A 1UPFA 4KXUA 3G9XA 1WMBA 2BP7B 1GKIA 1N0UA 3L04A 4A73A 2PEZA 2CFSA 4Q3AA 2IHUA 4FWTA 4DCPA 1LLDA 3FNBA 3BGDA 5HFAA 5IW8A 5TIIA 1FDIA 4D6YA 1YDFA 4CEIB 4Q4JA 1JD1A 4PPYA 1EFLA 4JKYA 1B1CA 4BVQA 2X9GA 2ZWOA 4ZOLF 1N2IA 2MCFA 4RESA 4TKUB 4OGWA 5D6OA 3C7TA 3EQ9A 1V3UA 5ED4A 2WFMA 4AIRA 3Q2OA 3ADCA 5EBWC 3CINA 4RDIA 4CBVA 1IEQA 3LP8A 1UOEA 3I8SA 5AOAA 1OLOA 1ENPA 3ENQA 1DO8A 2C5SA 3J7TA 2IHYA 4JEHA 2NTEA 4EAQA 3QI7A 1KZGB 1R74A 3FTCA 3HTNA 3MTEA 4F5WA 3JY6A 4JODA 1UC9A 5CFPA 3PG5A 2JAPA 4RFLA 1U8AA 4JL6A 4JI3B 2K2WA 2OTLF 4B6QA 4H27A 2BCJQ 3K70B 4KRFA 3I9V6 4GOKA 4D43A 3JYQA 2P68A 2H07A 3ORYA 2XWBF 2GRUA 1ZJ6A 2Q6TA 2QE7D 1U3PA 4RORA 4M9ZA 1PLKA 2JDIG 2OA0A 3RO7A 1OJ7A 2G70A 4QOGA 1U3GA 2IY7A 4IJ5A 1ZNWA 3QELA 1KYOF 1EBFA 4GKBA 5CB6A 4HUQA 4O2AB 3H1EA 2PMCA 2CB0A 3O92A 4UVCA 1Z6AA 3D4LA 1PJ3A 1FVHA 4AWBA 1J2JA 2VHZA 3DE3X 1XQ9A 3N2ZB 1P1FA 3OT5A 1SN7A 1PJSA 3W2FA 2XOKD 3RVBA 1TCUA 3L46A 3IRUA 1PE0A 5EUMA 5FO0A 3AVXA 2H52A 1V1RA 3KB6A 1MORA 4FCCA 2OAQ1 1DAOA 1AI4A 1DOZA 3H5RA 3TZEA 3FTQA 4JI0B 4IR7A 2R8XA 2YW9A 4FCWA 3D6VA 4E3WA 1S5LZ 1DLJA 3ELBA 4NVPA 5FLXN 3QXCA 3PFHA 1S9HA 4YQFA 3W4KA 1SU7A 4UARA 2BFEB 1F12A 3QF7A 2DG2A 4QLBA 1YACA 3DQZA 3QKTA 2NZWA 4XM1A 4R8LA 5EMMA 4CBCA 3KQYA 2JA2A 4CJXA 2F3TA 5A1TA 2N75A 4XVUA 1KNKA 4UVGA 1BU5A 2DTDA 1XV5A 3BF7A 4ITRC 1Q6UA 1YUMA 4UV9A 3C9TA 1U0TA 3W5HA 3EIOA 3ADDA 5IWAO 5ALMA 4FFMA 4BPBA 3EWIA 4RIEA 4D82A 2IS1A 4DCOA 4OY3A 1P1CA 3EA5A 3L7CA 3OCXA 2CLEB 2BEVB 1NW8A 1Z0DA 3WZLA 3NONA 3ASUA 4MLDA 5KAPA 5A9SB 4MGKR 1OXSC 1KQNA 4YRTA 3TJRA 2EIKC 1GO0A 1A9QA 3AO0B 3M81A 4RXMA 4K8RB 1JCHA 5MN5A 2Y66A 1N2GA 1GR0A 4MQ6A 4FM9A 2AZDA 3BXPA 2HYDA 1P5ZB 3O26A 1FQKA 2O48X 3KVOA 2CUKA 4MR8B 5KTKA 4LMAA 1FS6A 4B3FX 1VBFA 4MVJI 2C9ZA 5SZIA 2ATIA 3EXG2 3TGUH 4PN7A 4QBTA 4X9QA 2ZAIA 1C8BA 4UCVA 2VDLB 5DYNA 3M4YA 5JI3E 3GRPA 1KBHA 3GCGA 5CBKA 2PSJA 1KMHB 2V7PA 2Y76A 1CQZA 1T9CA 2ZAOA 3L75H 3OUSA 1FTWA 1DADA 1M2JA 5DSZA 4LYDA 2BONA 4ZHQA 3AFHA 1TKAA 2PKQO 2OCCC 3FKSD 4EHJA 2QT9A 1R9JA 3LVFO 2N47A 4W9MC 1ECPA 1M1KW 4GBED 4I36A 3W9UA 3IA2A 3VJLA 2W83A 3WFIA 1Z7BA 4C5BA 4AN0A 2L82A 3L74H 1BWPA 1EUDA 3M3HA 4JI8B 5C1BA 3LX6A 1DXYA 3IAXA 2WJ3A 5F7JA 1IB0A 2GA9A 4GKJB 4BAYA 2VBCA 4D4IA 4U2EA 1ZICA 4PLPA 1QVZA 1V45E 3DE1X 1X42A 3O3NB 4DW0A 2G7ZA 1E0DA 4FFNA 1D1QA 5D7NA 4OYHA 5ALXA 1ZI6A 4US1R 1HT1E 4OHBA 3AEKB 3L5KA 3IELA 2Y0DA 2RB9A 1OTYA 4BNFA 1HEIA 2QD4A 2VG8A 1R5OA 3NVDA 1N2XA 1P19A 1QIIA 3W1VA 4MIYA 3UNXA 2REQA 3MAJA 3B1WA 2EHDA 3IQHX 4BNTA 2PUCA 1NZJA 4WK2B 1JG4A 4PZEA 4DUGA 3FGNA 3KQWA 1DK1A 4CF5A 3I5MA 3IV9A 3F5MA 4HLUA 4Y2QA 5LR6A 5FX2A 4BO4A 3SXUA 2R9IA 2BFNA 2GPBA 2D0OB 3MTGA 1XK7A 4JOSA 2K7ZA 2GJ8A 4WUTA 1ZNZA 4ZYWA 3WIBA 4C2TA 5KYYA 1JR6A 1O0CA 2AUMA 3TNFA 3AIIA 1T9BA 1ZWZA 4C2AA 1XMQB 1V95A 3ILVA 5IAKA 4FKMA 5LHHA 3QK7A 4C7OB 5EBLC 1SKQA 3UPDA 3CHXA 3FPHA 4CIAA 1SC5B 4GOOD 1IY2A 7YASA 3GUUA 2BBSA 3NAGA 4H7IA 5ARDA 4HAMA 4R8RA 2P3SA 3AHEA 5B1BC 2CDYA 4CHTA 1E3LA 4K1LA 1CD5A 2XWSA 3IIMA 2W00A 4C0AC 2OKGA 1GLVA 5C8YB 2W2OA 1FMTA 3WGNA 1XRQA 4U5XA 1YXBA 3GUYA 1RPNA 2Z83A 3EB9A 1N5OX 3UHPA 2Q7OE 1B00A 1I2CA 1WDLA 2IYVA 2AYZA 5BW6B 4EG4A 3Q3JB 5CLHA 4RIFA 2BUAA 2Q2OA 4BVJA 3BX1A 3AM4A 2H8KA 2PSFA 1DKOA 4GP6A 3ITNA 4BGIA 2E55A 1OXTA 4X6YA 1GNPA 4BEJA 2FEWB 1PT8A 4Q20A 1YZTA 3OLVA 4Q3OA 3DE7X 1DKQA 1YUNA 1P60A 3DPSA 1DELA 1VE9A 4BNUA 3ROXA 3G7UA 1W36D 1PJ4A 2J87A 4QFBA 1CP9A 3OLCX 1QH1A 4FFRA 2R62A 1LRJA 1H38A 1XZFA 3I05A 3MQ4A 2WLIA 3WLTA 1Z5NA 3PIDA 3WHLA 4IIDA 1POXA 3GAMA 1BN6A 4WCEV 3B7PA 4M7WA 2PGAA 3QFRA 2V9PA 5ADHA 4M1OA 2V8BA 2HY7A 4TZ6A 2FNAA 4YCSA 1N2OA 2WMNB 5DXFA 1WOMA 3DB2A 1HRDA 1ZGBA 4D6PA 1VZ3A 3FVRA 5DBFA 3AY0A 1W25A 4Q82A 5HQTA 2F3UA 1O96A 1ODKA 4NU6A 2MR6A 2R60A 1CQWA 3OZAA 5J9FA 3Q87B 4PPNA 3PQ6A 5ECDA 5BYBA 2WJJA 1M72A 4RV4A 3N07A 4N8DA 3UATA 3LDDA 2XCTB 4Z49A 4WRRA 3FDIA 2W22A 2MJLA 4X45A 2A5YB 2QD1A 1A3CA 1P4JA 2X0RA 2VEDA 1NBMG 4LY0A 2ZT5A 1Q7YW 2GCOA 4ZV4A 5KNBH 3P0JA 2OHIA 3SS8A 2YWHA 4KUMA 2PQ0A 4MA0A 4UB8Z 1V8DA 5T41A 4FX2A 2FX2A 2Y4TA 1FFTB 2BGLA 2GLTA 4ZQIA 2H59A 1IHPA 2C82A 3JSLA 521PA 2PH7A 4UE3S 1D5WA 4YCAA 1JXQA 3C7KA 5EMJA 1XYYA 4G09A 3W7BA 8LDHA 1I1QB 4AROA 3VVLA 3UENA 1DE0A 3M6WA 2EX3A 4DLZA 1FIUA 4EK9A 5TRTA 1LA2A 3HFJA 4KNYA 4IH1A 3HCOA 4KPUA 1A71A 3B2NA 3K0BA 2GN4A 3RLIA 1H7MA 5SYMA 4OHYA 3VTIC 2IHNA 3AG2C 1USWA 1DAGA 3V34A 4YIHA 1E9FA 4B3IA 5B7QA 3SZRA 4YUXA 4DR5B 5BYJA 1RQRA 2FU5C 4HH4A 4KQGA 1D6SA 1Y82A 2NM0A 2LP7A 2FUEA 2ETXA 1UMBB 2ZPTX 4GUAA 2B9VA 2W0SA 2F17A 1OZGA 3HVHA 1U0HC 1DMRA 4RETA 4WADA 2GFHA 3NOOA 4NRDA 4KOEC 4HTFA 5KTTA 3NH9A 1UPCA 1NU8A 3R7WB 1B0PA 2IZ0A 3NHWA 2VLIA 1EGAA 3KUXA 5IRCD 1A2KC 2NU7B 3T4ZA 5ALQA 4GQAA 1PQYA 3S1LA 2OXCA 2VXYA 3TNYA 2EP5A 4G3XA 5LGTA 2DQYA 2X6RA 3CYFA 3T06B 2OBYA 2KLBA 1SRRA 3CF4A 1BGVA 2L0XA 4MKXA 3QP9A 4B5KA 1QVGU 1YJ8A 2AZMA 4ZAWA 2AS0A 2X9VA 2IBZH 4QATA 5KTOA 1E7SA 4F71A 1EWRA 2XT6A 1L5FA 4RD4A 2WY2D 3STUA 3CUUA 4YB8A 3IUQA 1U0SY 4FYMA 4L7VA 2GH1A 4XW2A 4EYOA 3H1FA 2HADA 1OBHA 3CN9A 3I04A 1TUBB 1ORRA 1QO0A 3IALA 3IEQA 3ANSA 1UWKA 1PWXA 4JSYA 2BHLA 4IJQA 4BFWA 4CS2A 4MS4B 3EIEA 1FMCA 5KDOA 4EA7A 3ZX5A 3WLIA 3HB4X 3JZDA 4EHLA 5FKJA 5SY4A 4G0YA 1STOA 5EY5B 1JU3A 4QOHA 1B2RA 5H5JA 2XZOA 1PNRA 1HR0O 2FJ0A 5LYJF 4JB0A 1WPXA 2G80A 3QTBA 2CLHB 2F8SA 1PZHA 4UMVA 3D4NA 1PX0A 1E9RA 3SIUA 2OO7A 1EIWA 4H13B 1V25A 4C4XA 3QVVA 5DTJA 2VAVA 1L7PA 3NHAA 3B8EA 2OGWA 4MNTA 4OXKA 2H11A 2EIJC 4PHGA 4ADSG 4XGIA 2B6HA 2PGLA 1QVGF 3UH0A 1T0AA 1TVEA 3BYZA 5EK0A 4PC3A 5TVGA 1KZYC 4UCUA 3HI6A 5M34A 3HR4A 3LOPA 2BMWA 2I6QA 5EP1A 1IHOA 2UVPB 3QBTA 1ZQ9A 5CXUA 2FPOA 1E9DA 5BRNA 2F3RA 3RSFA 4K8XA 3GY0A 4F3CA 4XWKA 1J09A 5TISZ 5FTLA 3V7EA 3D6JA 3B1KA 3M4JA 3B2EE 3USES 1Z34A 4Q3CA 3OQPA 4QT0A 1U63A 1EZJA 4PA3A 3CUVA 4Q00A 4M22A 2OV6A 4L9AA 3LXUX 2JIRA 5AKEA 3GLQA 4DR7O 1E5DA 4JI2O 1UKZA 3RNOA 1XQXA 1SQ6A 4XWGA 4TLAA 1MDFA 1P62B 1LDGA 4BLOA 3OTOB 5CXQA 2QM7A 3AEQA 4B3DA 1O57A 1CLUA 4EQ6A 2NO1A 2Y8EA 5BZBA 3F1LA 1PSWA 2WILA 3MXTA 3COZA 4OHUA 3FPGA 1E1RA 3EOZA 2CFCA 4JK3A 4XLZA 3SXJA 3B1YA 2RHDA 1EX6A 3RHFA 1SUIA 4BNKA 1ZBDA 1RT9A 3MIIA 1L3BA 4FHDA 3F8SA 2X76A 3T7EA 1U2ZA 3QX9A 2ZUUA 2G76A 2G0TA 5KC8A 2NLJC 3WFJA 2ZT7A 2JGKA 1VIBA 4EECA 4DPMA 2WAAA 4WF9V 3L8FA 3CYPB 2HMWA 3CXUA 1PNQA 1T29A 3CKYA 3V1UA 4OP2A 2VPTA 1MH1A 1LNZA 4ENRA 3A2KA 1ZX3A 3D3KA 2QP4A 1QF7A 4ESOA 3WIDA 3G1TA 3RG2A 1SGWA 2TS1A 2CNWD 4J3FA 2XTJA 2ZAUA 4GZ3A 4UUMA 5DSTA 1M5RA 2XYQA 3ETHA 3EVDA