4I5BB

Structure of human mhc class ii protein hla-dr1 carrying an influenza hemagglutinin peptide partially filling the binding groove
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
192
structure length
192
Chain Sequence
DTRPRFLWQLKFECHFFNGTERVRLLERSIYNQEESVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGVGESFTVQRRVEPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
publication title Disruption of hydrogen bonds between major histocompatibility complex class II and the peptide N-terminus is not sufficient to form a human leukocyte antigen-DM receptive state of major histocompatibility complex class II.
pubmed doi rcsb
source organism Homo sapiens
total genus 44
structure length 192
sequence length 192
chains with identical sequence E
ec nomenclature
pdb deposition date 2012-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4i5bB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4i5bB01
1RUML 1DQQA 1B6DA 2OJZH 4XBPA 1PG7X 4P2CG 1W0YT 1AO7A 2UYLB 1OAZH 4LLUB 2OCFD 3BQUB 3H9SA 4MAUH 2FH6A 4BK4A 1I8KB 4Z9KB 2EDRA 1GHFH 5DD6A 4HIHA 4YHKH 2QSCH 4YWGL 5F1IB 3KPQA 2X4QA 1CL7H 1MIML 1UADC 4WU5B 4WWKC 4RA0C 3RAJH 3FKUS 1D5MB 1LP9E 5E7FA 2AGJL 2DDQL 3OJDB 5IBLD 5GGUA 1KB9J 3CXDL 4OGXH 4HJJH 1MVUA 2ICEA 2XT1B 5J12C 2FRGP 4LSRH 2YXMA 5MERB 5KANI 1NCWH 3VXUD 5J8OA 5D5MF 1NGPH 4D0CA 3OWEA 4GMTH 4LEXL 1CXEA 3KPRB 2F9BT 4EDWL 4PJIB 4RAVB 2MKWA 4L8DA 4OZFB 3W2DH 4B7LA 5JUEH 2LV4A 4JQVC 4U1LA 5E8DH 1NGWA 1K8IA 3IU4H 4PJEA 4MJIA 4GBXB 3TVMB 1IGCL 1CGWA 2PW1B 5K59F 4Y1AD 1JNJA 5ADPH 5DQDH 1A3RL 5JMRA 1EMTL 4M4PA 1DBJH 1EFXD 3EFFB 5AUMA 1SBSL 1XR8B 3MFFB 1PY9A 3T4AB 2A38A 1LILA 1BVKB 2R4RH 3HAEA 1V3JA 1XF5B 4GAYA 5D1XD 5HI3C 2DTMH 2OMBA 2WW8A 3DUSA 3BP4B 3DXAD 1DQQB 2YD8A 4HSQA 4XBPB 3QCVH 4AQOA 2Q6WA 3GMNB 2EEAA 4RMQA 3H9SB 4GXUM 5DHYA 5FM5O 4JO1L 1NLDH 3L3DA 1FVDA 2EE2A 2D7MA 5BOZG 4HIHB 3MJ9H 2EH8H 1OGAB 1S7XA 3K80A 2MNUA 4LP5A 5SX5K 2Y5EA 1FVEA 2X4QB 4ONHA 1ZT1A 4F7CA 3S5LG 4YE4H 1BFVL 4RGNB 3QUYA 5JHDE 4Y16C 3CMGA 2ZUSA 4M00A 1UKSA 5GHWH 3O2VH 2XFXA 4WCYH 2FBOJ 2FEEI 2ICEB 4YHPA 1OAXL 2Z8RA 5I1DA 2ATKB 3O3UN 3ZTNH 1WIOA 4PTUA 2ZCKH 4RISL 2FHCA 5HVGB 2GEEA 4P9HH 3AXLA 1QSEE 3SDXA 4LGRB 4OD3H 2DD8H 3DMMA 5K9QI 5F6IB 4EOWH 3VXNA 2LQRA 1VADA 4ZPTA 5E00A 1MY5A 1WFUA 3WEXA 5HHME 4L8DB 4I18B 3QNYA 4LHUA 2AJVH 4PGEA 4Q9QH 3A6CL 5J3HC 2VZ1A 1FAIL 4M48L 4U1LB 4P3CH 5FOJA 1ZE3C 1NGWB 3RDTC 1K8IB 3KS0H 4NO0A 3ZDYE 4PJEB 4MJIB 3QPXL 4KUZH 4KFZC 2FLBT 1R5IA 2YD7A 4QHUB 3HUJF 5CP7A 3FTGA 5ACMA 4N8CL 1XIWC 1M05A 4U1MA 5K33A 1L7IL 3UC0H 3VA6A 1RIVL 5GRZA 3PV6A 1D9KC 5EULV 3SJVA 2BOBA 3GRWA 3HAEB 2J6EL 5GQBA 5J1AB 1PGRB 4GAYB 2Z35A 4XMPL 1G6RH 2Y7QA 1DE4B 3DUSB 3IJHA 2IMNA 3RGHA 4AY0A 4DKAA 3AM8C 1N3NA 4PRIA 1A3LL 2V5MA 3CDCA 2Q6WB 2DQGL 3QFDA 3O6FA 1MSPA 1BPVA 3QG7L 1LNUA 1MCSA 5CP3A 1NFDF 3L3DB 3VDBA 4WW2F 4PRBA 3UXFA 3OMZA 5I30H 3AU1A 5BVPL 4A2MA 3DV6A 1S7XB 3J8F7 1FVEB 4ONHB 4ZXBC 4F7CB 3BP5A 5DDHA 5I0DA 2R0KL 1A6VH 1WISA 3IFOA 5D7IF 3QUYB 3WUWG 1GGUA 3DIFA 4HCRA 5CLWA 4WUUA 5LJYH 5JOPD 4W81A 1PW3A 1ZS8B 4YHPB 1ETZA 2V7HB 3UTZA 4OQ1A 5DVNA 1RJLA 2A1WL 3RRQA 4PJDF 4PTUB 2VLMD 5DRWB 2B1HL 1MFEH 1KBGL 3F7RA 5HI3D 3FRPG 3DMMB 3VXNB 1G1YA 3JTSA 4XX1G 5E00B 3MC0A 4RQQA 1LDSA 4RMVA 3LEYH 3QNYB 4LHUB 4GRWE 4IS6A 4PGEB 4XVUC 3RI5F 2XA8H 3S37H 3L5JA 4NO0B 4KV5E 3QWRA 5HHOD 3PWVB 1AIFA 4MDIA 1MCOL 4M5ZL 5TQ0H 1P5UA 3GJEB 2VZSA 3ROLA 2PN5A 3C5SA 1GC1H 5LBSH 4C57C 4EXPX 1M05B 3AY4C 4HWZA 3ULVH 4Y16D 1UFUA 2NTFA 4U1MB 4ETQA 5JDJA 3HKFA 2NZ9C 4PJGF 4B53A 4PJ9A 2X1WL 4WI7A 5KVDL 2IBZX 1PDKA 4WW2C 2R0ZL 3KHOA 3DYPA 1HQRA 3PV6B 1X5GA 2L0DA 5CZXC 3VFSA 3SJVB 4B0MM 2FATH 2BOBB 5HHNA 2Z35B 3C9NB 2FH8A 1A0QH 3AS2A 2WIMA 4R8WL 3IJHB 3G9VA 2NY6B 3SKJH 1J1OL 4K71C 4HXBL 4L4VD 1N3NB 4PRIB 1P7QD 3QFDB 3O6FB 1FIEA 4JPVL 3M8OL 4GW5B 1TQCC 4NHUA 3RZCA 1A14H 3PDDA 1UA6H 1WEJL 4PRBB 5IVXE 2AK1H 1FP5A 4P59H 3AU1B 3RDTD 2PTTB 1FO0L 1AFVL 3ZHLA 3FHAA 1BD2A 2J2ZA 3WNKA 1KPUA 3STLA 4MB5A 3BP5B 5DDHB 5GZOC 2W9DL 4PIRF 4KRMB 4ELMF 3CIQA 3O0RH 5DVLA 2I5YL 4WFFD 4YPJA 4BFBD 5IVNA 4WUUB 3PXJA 2F8VA 1ETZB 1FFPA 3EO0A 4I0PC 3ZE2F 4G8FB 1RJLB 3WD5L 1A7RH 1JGVH 2BOCA 2E7HA 3UZQA 3U30B 3OB0K 4JFDD 3OV6A 5FGBC 1LP9F 1RK0B 4Y4KD 1I7ZA 1YPZA 3HRZB 4NC1E 1PLGL 1IEAB 25C8H 4G8EB 5TFSL 2VDMH 1S9WA 2AJSL 3AREC 3JTSB 4LLVA 1M7IA 1QLEL 5JORB 2OQJA 3QH3A 35C8L 3KPMA 5BCAA 4C4KO 1RQ5A 4IS6B 5SWQB 2XWTA 4JKWA 5FA4A 5E6IC 4YQXL 2DQUL 4JRYE 3V4PL 5GGTH 1N5AA 1EVUA 3KPOA 1H5BA 3V0VB 5DK2A 3ROLB 5BV7B 5EU7C 4BFIA 1OAQH 2NTFB 4ETQB 2DL9A 1SYSB 3EW3B 1KCVH 4R7DA 4PJ9B 3E8UH 4ZAKD 4JDTL 3L3KA 3HG1E 4X4YA 4LQ1A 1DSFH 4ZDHA 2G2RA 2ICES 5HDBE 4KKCD 1U8QA 5HHVH 5EU6A 1S7SA 1HH6A 3MZGB 3VFSB 2VC2H 5D70H 2C7UA 3ISWA 3LKOA 1QSFA 4OKDA 3JZ7A 4YR6A 2PF6A 4G6ML 5DT1L 4NHUB 3RZCB 4MB4A 1JNLH 4OCYH 3N1QC 1KC5H 2VXQH 5FHAL 4WVRA 3NAAH 3FQWA 4H1LG 5D72L 3AS3A 3MRNB 4RWYH 4E0RA 5HPMB 1UKQA 3QDJD 4TNVF 3WKNA 4LRNL 4FG6C 1KTKE 4PJFE 4YHYC 3STLB 1PKQE 2DQCH 3FQNA 2P43B 3WIIL 2Y72A 3WO4B 4GRLC 1KGCD 1NJ9A 4YDVA 1OQOA 3WSQH 4MXWL 1JHKH 1Q72L 3EO0B 1AGDA 5DA0B 1INEL 3BD4A 1XGTB 1CFSA 1JPFA 4OFIA 2DI7A 4LSUH 4Y2DA 3SE8H 5EC1A 3S36X 1YYLH 1B90A 5DEGA 3PNWA 3GSOA 3LQAH 1KLFA 4NHCL 5DO2C 1S9WB 2ZSWB 3G6JE 5H37H 2HKHL 1PYWA 5E4IA 3GDBA 3L3GA 2OQJB 4OAWA 3KPMB 4PJ7F 1QBBA 1VGEH 2MWCA 4UOJA 5FA4B 4X6DA 5H35B 1EVTC 1N5AB 43CAA 3KPOB 4FXGA 1M1SA 1ITCA 4YDKL 4LARL 4R96A 4YXKH 4KDTC 4KPHH 1V3LA 5DK2B 4N0UA 4BFIB 5BOPA 5I1GL 5ICXA 4Q9RL 4CN6A 4GW1A 1VKXA 1BOYA 4IHOA 1RZ8B 1WVZA 4OUUA 1IAIM 4ODXB 4ZDHB 2G2RB 1Z2KA 1KCKA 1U8QB 5EU6B 2W0FB 3P4OA 2FBJL 4GUPA 1I8MA 2C7UB 3LKOB 4PJCE 1LE5A 2A73A 3HNSL 1S3KL 4XVSH 5EBMA 3VFMA 4ONOA 5GJTH 2AS5M 1MCRA 4X4XA 5E1AA 3P0YL 2BNUA 5M95B 4TN9A 2ADGA 3G6AA 5HHPB 5B39G 1K4CB 5FA3A 1BJMA 3ZT6A 1W72A 2D7TH 4JO3H 2VDNH 2ZUTA 1PZUB 3FQWB 4X6BA 5ACZA 1F5WA 1MCJA 2OLDA 4HDIB 4KK8D 3UBXA 5I1CH 1WUNT 4E0RB 4KMLB 2NY4B 2H8PA 1IC5H 4RFOL 1GOHA 4IOSD 3W9EA 1LO0L 4ZUSA 1NJ9B 4YDVB 3B8YA 3E2HB 5T3ZE 3VXQA 1IQWL 4DVRL 4Z7NF 3FZUC 1CFSB 1JPFB 1EHAA 2EDXA 4PG9A 4Y2DB 1NUFA 1HILA 3BPOB 3QWOA 5I8KL 3FT2A 1A4KB 5AG9A 3ALPA 3GSOB 1EHLL 1OWRM 1A4JA 2E6JA 4NZRH 2CKBH 2YC1A 4KDWA 4CVWA 1PYWB 3MRIA 3VXMB 3L3GB 1LO5B 4OAWB 3UJJL 5SWSD 3VD4A 4WI4A 2ZJSL 3GSNL 2IWGA 3VGFA 3QO1A 3QNXA 4X6DB 5CJ5A 3IF1B 4PFEA 1U92A 3ARYA 3V52L 43CAB 4AG4H 3OZ9L 3U0WH 4R96B 4PGDA 2OI9B 1F3DJ 3UJTL 1KENH 4Q0XH 1BF2A 3OJVC 4ENEC 4S1RL 1GOGA 4KV5F 1DANT 1U8IA 2QSTA 3FFCA 5E8OA 1CD0A 5ICYA 4GW1B 1VKXB 3CAFA 4IHOB 3JV5A 4WI6A 4OUUB 1I9JL 5CJOL 2PYEB 1OP3K 2HRPH 4L9LA 4ZFFB 3P4OB 4GUPB 1I8MB 1U3HD 1LE5B 2A73B 5C0BD 5BQ7A 5B38G 1MFDH 5E1AB 4X8JA 3QI9D 1J87A 4EIGB 4YBLB 3VJ6A 5HDQL 3IFLL 1W72B 3BWUC 2JK5A 1RSFA 5GS0D 5F44A 1I1RA 2YPVH 3EOAA 1XR9A 2DN7A 2ENSA 2EE3A 4X6BB 5FHBL 1IEBA 2VDKL 1KB5L 3UBXB 4YK4C 1TCRA 4KHXL 1V7ML 5KVFL 3HR5A 1T21B 2H8PB 3T3MF 1D5IH 3VXRD 4F7EA 2B5IC 4JFPA 3I6LD 2DWEB 2X7LA 4JY6A 4XHQA 3UTOA 1OB1B 3W9EB 2VH5H 5F8QC 1I85C 5LGJA 4HLZG 3C09B 4M6ML 3VXQB 4YHZH 3Q6GH 4I3SL 4ZOBA 4P46C 2YD6A 1HILB 3VWKA 3TBTB 5LWYH 2H9GA 3QWOB 3C6LD 2IJ0C 3FT2B 2GCYB 3CSYA 4KWUA 3U1SL 2ZUXA 1T1ZA 1OAUH 4OZGE 3UTTA 1A4JB 1S5IH 5CD5D 3O3DA 5I8OH 2YC1B 4K07A 3MRIB 1BFOA 3BJ91 2DKSA 2HH0H 4RFNB 5I1KL 3QEGL 3O6LL 5DUMH 1X5ZA 3RHWF 3QNXB 1YEDB 1U92B 3HC3H 1YJDH 1X5LA 1ZA3A 4P23B 1NMBL 4KKLD 2FJHA 4PGDB 4FFYL 4HWEL 1FCGA 5IQ9A 2JE8A 5EIVA 5JW5A 1ZANH 1U8IB 2KDGA 4HIXH 1TDQA 1A6TA 5E8OB 5ICYB 1BMGA 2YPLA 1LHZA 3P30L 1FPTL 4QHKI 2PO6A 1MNUH 2ZG2A 3FZUD 1J8HD 2EYSB 4L9LB 3VWJC 3QHTC 2JCCE 3OXRA 1T20B 5I71B 3IRPX 3KPPB 2Y07H 1SY6A 4PP2A 1S9VA 1C1EH 3PGCA 1PY4A 4M03A 5ALBH 3O41A 3SO5A 3RNQA 3ZKSD 5DJ6A 4AL8L 3MBXL 3EDEA 1HDMA 1JFQL 1T0MB 1KEGL 4K7PX 1K85A 2JK5B 3IT8D 1TIUA 2OSLA 4QRUA 1I7TA 5F89A 4TTGA 4RMSA 1XR9B 5HI5D 1L0YA 4ORZC 1L7TL 4LDOB 1IEBB 1CBVL 1HK6A 1TCRB 4LIQH 4ISVA 3KYOB 1WAAA 5I76A 2X7LB 3C2AH 1IGJA 1X5XA 3BWAB 5TF1H 4XP4H 3EAKA 1F4WH 2K7QA 5I1EL 5LGJB 1OAKL 2R1WA 2NY7L 3TT3H 1R3LB 4NQED 2NPLX 5E03A 1TVHB 1EEYA 2DLFH 2FSEA 4NIKB 1AHWA 5C0FA 4OF7A 1U0QA 5FYKL 2EECA 1SJHB 3CSYB 4BFEA 1EJOH 1QTYT 3UTTB 1JRHH 2BNQA 3O3DB 1FDLL 3RX7A 3DO7A 2HP4A 3MJ9A 4XMLL 1BFOB 1CDYA 2DIJA 3GIVA 5EA0L 4LF3B 2NY1D 1AXSA 3JWDL 5DHXB 5FCUH 1NCNA 4KJQD 4S1DC 5FYKD 1NAMB 1DBAL 3LOWA 1CS6A 1ZA3B 5LGHL 4QTHA 4WRLA 2ATPA 2NX5D 4MCYA 2YMXH 4HT1L 4JFHD 2FJHB 4J12A 4LSQH 4P2QD 1H3GA 1SEQH 3WDHA 5IQ9B 1EIBA 4N8VG 3RTQA 1QFHA 4RSVA 5JW5B 1OAYL 3QFJD 4LPCA 4F2MA 1A6TB 3MOAH 2YPLB 3ARWA 1TQBB 3T2NH 4JKPL 4MXQC 5J11B 1NCCH 1QUNA 1IC1A 1RIUL 3EO9H 2DI8A 5I1AB 2IH1A 2MCG1 5CIPH 4QHLB 3WKMH 3FMGL 4OGYL 2I24N 1Q0YH 1ZGLB 1EA9C 4KVCH 3REVB 3O41B 3HR6A 3RNQB 5DJ6B 4PRPE 1S5HA 1CLYH 2FX9L 4HK3N 2OSLB 4QRUB 1I7TB 4W4OC 5F89B 5IW1A 3WJJC 3MRLB 3QIUA 4XI5D 4J6RH 2ORBL 2HTKD 5IFHH 9CGTA 4KMTH 1FFOA 2KUTA 1KIRB 3FQXB 2CPCA 2ICWI 2WUBH 1EZVY 2GTWA 3P77B 5I76B 1IGJB 1YMME 2GI7A 4H88L 4L4VE 4EI5C 3OKMB 4QRQA 2DLEA 1MCNA 2R1WB 2OR9L 3C87A 2F58H 3OKDB 1XAUA 3D48R 1EEYB 4XNXH 2FSEB 5HYEA 3UO1H 4F9PA 3GKWL 3EFDH 2N4IA 4JQXA 1IBGH 3NZHL 2XNAA 5EOCH 4PS4H 1OSPL 4QXTB 4CUCA 4ZPVA 4PB9L 3BD5A 3NPSB 4AMKH 2JB5H 1OLLA 5HGBA 4H0GA 5DQ9A 3MROB 3LQMA 1AXSB 4DTGH 4WFFE 4UT6L 3GBNH 5E2UH 5C09B 2DKUA 2R0LL 3AB0C 4QTHB 3BIKA 4IDLA 3MNZA 4POZC 4YIQA 1GIGL 4DN4H 3RFZC 2OXHA 4C54A 5A16A 1U9KA 2D0HA 3MV8D 4F2MB 2ZPKL 3QULA 5C0AA 5EZLA 4CN4A 4ZFOL 4NC2B 4JM2A 4Z7OF 3EHBC 2ED9A 4NWTL 5C71A 4Z6AT 4PUBH 1GGIL 1C16A 4LAJH 3S36L 3T0EC 4BK5A 1T04A 3HC4L 1VFMA 3NFSL 1Z6JT 2P48B 1CDUA 3DJ9A 4CDHA 4P9MH 5T5FH 5B39B 2X10A 3WIFA 3TN0C 2FR4A 4G6KL 5EORL 5LXGL 2CMRL 3GSQB 5CKAA 4XCEB 4MX7A 1S5HB 3KR3H 4XPAH 4DGYL 15C8H 5IW1B 1MCWM 4G8GB 4M02A 3QIUB 1VPOL 2VDOL 4G7YH 1KN2H 1RZKH 1UQSA 3ZE1E 2NY5C 1D5BA 2RJMA 1FFOB 1IKFL 4EN3C 1G7JB 32C2A 4OZIA 5FYLL 1ZLVH 2GTWB 4BSVB 2Y36H 3H0TB 1I1AA 5JOEA 4MJ6A 1A6ZA 1DL7H 1OD7A 4XP1L 2VR9A 1MRDH 2IAMA 3WLBA 1MHHA 4MXQD 5MHSE 1UVQA 3KLDA 2OP4L 5FYLD 5IT2L 4V1DD 2X40A 2X41A 1SVCP 3SDDA 5HPOA 5IMKA 3WBDA 4ONGH 3QDJE 5E08H 4GSDH 2R2CA 4Y5XC 1OP5H 4DFIA 4ZPVB 2O5ZL 5CJBA 5HGBB 1F4YH 2DMKA 3OXSA 5DQ9B 5F96H 1IILE 3ZL4L 3LKPA 2Y1VA 1KGCE 1JZ3A 3LD8B 5D7LB 1YUHA 4MA7L 3BEVB 3BIKB 4YX2L 4OLXH 2D03H 4LFHD 1RFDH 5FUOH 4YIQB 1HHIB 5A16B 1R24A 4S1SL 2J8UB 3MQIA 4MQXC 3A67H 1CLCA 3QULB 5EZLB 2P49B 1OSZA 1PX3A 4DKDC 1NLBL 1KFAH 4JM2B 1WBXB 4KTDH 3HI5H 3EYOA 4WUKL 5A2JH 3G04A 4QKXB 3TZVC 2XZAL 3RJQB 1IM9B 3MLRH 4NJ9H 3VFNA 1RJYB 4Y19D 5D2LE 4RGOH 4DK3A 5C9KA 4MCZA 3WIFB 3NCJL 2MQ0A 3MODH 1G0XA 3QXWA 2FR4B 3MBEC 4LLWA 2X4RA 3H6JA 5KG9B 3PDOA 3TJEH 5L9DH 3DI3B 4Y5YA 4OCSH 4S1QH 5EN2B 1UQSB 3GHBH 1D5BB 2YA1A 3O2DL 5A2KH 1N5YH 3CMOL 32C2B 4OZIB 1ZA6A 2J5LB 2GITA 1I1AB 1VEOA 3PL6B 4XC1L 3ZKNC 5GSRA 1A6ZB 1NC4D 1KCLA 3FL7A 3O3BB 3LMJH 2XKUA 4YZFF 2BVEA 1E6OL 2Y06H 1UVQB 3F62A 2NXZC 1RZJH 2X9XA 1IARB 4QRRE 4ZO8A 3T0ED 4KRNA 3TV3L 3SDDB 4NN6C 1X4XA 1UGNA 2EIDA 4PJHB 5IMKB 1G9NH 1MCWW 1F8TH 3CFCH 2VNCA 1VHPA 5DMGC 2NY5L 3TN0D 3O3AA 2Y4SA 3QUMH 3OXSB 3RUGA 4DEPB 1IEHA 3LKPB 4IDJL 3RU8H 5HGHA 3IB4A 2P8LB 1YUHB 3BVNA 3VFGL 5DJYA 1T83C 5SX4I 5HYSG 3MUGB 3ROOA 4EN3D 4OGAC 3P9MA 3WL9A 2ADFL 3C08H 3OQ3B 3ARZA 5FYJE 3S34L 1FFQA 3R8QA 4OIBA 1A5FH 5SWSE 3K3QA 4OF3A 3T0AA 4WO4C 1IC4L 1XGPA 4YBQC 1VA9A 3EYOB 3G04B 3MJ6A 4A6YH 1YEEH 4N5UA 4JG1H 3O8XB 3ORJA 1ZHNA 4UTAL 3VFNB 3U0PA 3PHSA 4GMSH 1QO3B 1MHPH 3G9AB 3PJSA 3ZTJG 1MH5B 2XN9B 5DJDA 3QUXC 3SKUD 3PDOB 1AKJA 5JW4Q 4TULL 4AEHH 5B8CB 1OGTB 4K94C 4EXKA 2FCBA 2VIRA 2BMKB 5JR1H 3DROA 1LO3H 1OCWH 3G6DH 3T0VA 3WIHL 1ZA6B 3SDCC 2GITB 4JDVA 2AK4D 5C0BE 1BBDL 3OG4B 5DR5L 2PW2B 1QFWM 5GSRB 3QRGL 4MQXD 2DYPD 3TVMC 1LO2H 3IDIA 3W39A 1ZLSH 3BGFB 5SX4H 3MRHA 2IPTH 4H1LH 1MCPL 5F71A 1KJ2A 3T4YA 3OB8A 1L0XA 5KW9H 3PGFL 4NOBA 3T2OA 3TZVD 1CD8A 2HWZL 5FOBA 4ZSOA 1MREH 3TFKD 3TBSA 4MJ4A 1HHGA 4PJEF 3I6LE 3WNOA 3MBED 5L6YH 4EIZC 5CEZD 4MVBC 4LKCB 4K7PL 2RQ8A 3ETBF 4NGHL 5I74C 5DZLA 3BVNB 5DJYB 4NPYA 4OZ4A 1M4KA 1C7SA 3LKSB 4GAGH 3QUZD 3ROOB 3VFPA 5M7QA 2IQ9L 4G7VL 2C1PA 1G9MC 3O6ML 5IHLB 5JA8B 1U41A 1AY1L 2NW3A 2ZUYA 5K9OA 1OPGL 1DQJA 1NCAH 4ZTPL 3CH1A 2YK1H 3CFJA 4KQ3L 3U7AA 4CGTA 2FB4H 2CDFB 4MNQD 4X0KA 4TOYL 4WJ5B 3FOLA 1ONQB 1S9XA 1ZHNB 4HLJA 3U0PB 4UB0L 1S7UA 1CTNA 3RVTC 2FO1A 5HSFA 3MLTA 3PJSB 5ETUA 4H25A 1Q9KA 4M5YH 4KVNH 2HLAB 5DJDB 2W1NA 1KEML 2LFGA 2EKJA 1DN0B 3GM0A 1OD9A 5DWUL 4WTZG 3TJHD 4Z7UA 2VIRB 2UV3A 2X9YA 5K93A 1J8HE 3BQUD 1N6VA 2WANA 1U8MB 1XGRB 2QSQA 2PYFA 3SE4A 1NBYA 5DUBA 1U3JA 3VD9A 3ZE1F 4H8WC 3SDXF 2ED8A 3W39B 2XACC 1QACA 3I6KA 2D7PA 5C0DA 4HG4K 4YBQD 5DS8A 1KJ2B 4FQPA 2R29H 1A7PH 5IHUL 5IB5A 5FOBB 4K94L 2IMMA 5EPMA 4LP4A 1CDIA 3TBSB 4CAGA 4LU5H 4P48A 4NO3A 5D8JL 1X5AA 4UUJA 4MS8C 4K9EH 1U3YA 4XGZB 4ORGA 1INDH 3EYQC 4HJGA 1BAFH 3KPRD 4IRSC 3HMWH 3VMPA 3N85L 3BAEH 4NPYB 4R97B 3OF6A 2X1OA 4OLWH 2W65B 5T1LA 2C1PB 1B2WL 2BVYA 1WBYA 4X4ZA 5EBLA 8FABA 2NW3B 1NGYB 2BC4A 5K9OB 1A1OA 3TVMD 4BSJA 1QBLH 1MJJA 3OKOA 1WTLA 4KMQA 2YA0A 3MXWH 2E3VA 2UY7A 4H5SA 3CFJB 1D6VL 4JGJA 1TNNA 3L7FA 3QUYC 2FX7H 4WEUD 1CFQA 1JTTA 4R90H 2HVJA 4X0KB 4OQTH 2XRAL 1UWXK 4JN1L 3ZE0E 3FOLB 1S9XB 1ZSDA 3P4MA 1S7UB 2DQTL 5ETUB 3BN9C 4J8RA 1MHEA 3MR9B 2I07A 4MVBD 3QFJE 4KZDL 3DMMC 1ODAA 1G9ML 5D2LF 4ODVL 2IG2L 4ZO7A 3RWDA 2BFVH 1I3RA 4NFDA 4BQCA 1AO7D 4Z7UB 1S8DA 4KH2A 4FQJL 2HA1A 1DZBA 3H9SD 2P5EA 4KJYA 1WT5A 4XHJD 4HAFA 2O5YH 1TJHL 1MAKA 4LLAA 2X6MA 5CSBA 1KN4H 5DUBB 1DUZA 4I13B 4L3EE 4R0LB 3DARA 4B5EA 3MV7A 4TQEL 1ZLUH 3L1OL 3LPGA 1MWAB 1YEGL 4M7JH 3O4OC 1XF1A 4KROC 3JV6A 2J8OA 5DFWH 5C0DB 5CFHA 4PJ5A 4RMWA 1N4XL 4RGND 5DS8B 5T5NF 3NA9L 3D39E 3F5WA 5C7XL 5IB5B 2X05A 2VAAB 5DRNA 3RVTD 1Q9WB 5LG1A 4UUJB 1VACA 4HUVA 1YZZA 2FJGB 1SBBA 4HLZH 1JPTH 4XPGH 4HWBH 4LASH 4TVPD 4H8WL 3FB5B 2R2EA 5D93B 5CJQH 2H32A 3WXVH 3TO4A 5JOFA 3UPAA 3HI1A 3MXVL 4F57L 1LK2A 2X1QA 3S4SA 1WBYB 2UZYB 4JY5L 4WIQA 3D2UA 5EBLB 8FABB 5C9JA 1NQBA 4MJID 2BC4B 1A1OB 2RR3A 4GT7A 5JZ7C 1ZEAH 2MSPA 1NGZA 1N64L 2YD9A 1INQA 3GFUA 5L2KE 4G3YH 3MV9A 2L7UA 1ZVYA 3F7PC 5D96B 1CFQB 1F4XH 1J0KA 1E4WL 4RBPH 5F3BA 4NUGL 4X99A 3EUUA 3EIFA 4XP9H 1ZSDB 3V5KA 4YPGA 1T22B 3P4MB 4JR9L 3U30C 2DB8A 4UOW0 1JMXA 2XG4A 4OLYH 3WS6A 2VDLL 1BIIA 4FQLL 2I07B 4GQPH 4UZGA 3V7AG 3EYQD 2BDNH 2DQFA 4EJ1C 3K46A 3PWPE 4WHYG 5FV2A 3RWDB 1M6OB 1H3XA 1S8DB 2D3VA 1IL1A 4CBPA 5DVKA 5IKCA 2GY5A 3ZLQC 2P5EB 5IK3A 4YUEH 1EJ6A 1T7WA 2ARWA 3VG0L 3KAAA 3VDAA 2H3NA 4N0RA 3WE6A 3T8XB 1DUZB 4FFVC 2R4SL 3D87B 1YPZF 1A1NA 3RL2A 3NH7L 1P4LA 3LAFA 5FGRA 5GJSL 4HUMB 3UZEA 3JV6B 5KSBE 2D7NA 4PJ5B 3JVGA 5HHXL 3QUYD 3QEQB 4Z0BL 1X5KA 5GRWA 4HKBA 4ZS6D 2QBWA 4RAUA 1NMAH 4LSTL 1IFHL 2R0WL 5DRNB 2DBLH 3U2SA 5BRZE 4XMKL 4XPHL 1VACB 1UYWH 4HUVB 3BN9D 1MRFH 2QQKH 3FO1B 5D7SL 5KSAA 1QRKA 1NKOA 3DMMD 3SCMA 1BQHA 1MELA 3QBTB 1KCRL 4AT6A 5EBGA 4RCAA 1N6QH 5HYSB 2R2EB 3D0VA 4FQHB 2H32B 4QTIL 4DUWA 2E7MA 5JOFB 3RZCC 4P4KC 5KBNC 4LHUD 1DLHA 4XC3L 1DBBH 4XNMB 3MLPA 1UCBL 1LK2B 3IDMA 3SKOA 1D5XB 4W70A 5FK9B 1MCEA 3S4SB 4NO0D 4BQ8A 2V17L 2A6IA 3SO3B 4F37K 1YNTA 5C9JB 4NZTL 1QNZH 4YHIA 1WLHA 1ITBB 3TEUA 3KNBB 2K9UA 1FLRL 4D3CH 1INQB 3GRWL 1F2XK 3MV9B 1TTFA 3ABZA 2PCPA 1MQKH 3OKEA 1N6UA 3CUPB 1AGCB 4D0DA 5EC2B 4X99B 3V5KB 4YPGB 4OKVA 1Z5LA 1FRGH 2Z8WC 1T89A 5IROA 2IANA 3SJVD 2FGZA 2AXFA 1BIIB 5FECA 4PRDA 1DTUA 2VITA 1AE6H 2VRAA 4LAQL 5DYOB 3IAQA 1JP5A 4CRPA 1CR9H 4PRID 4HKZA 1HNGA 3O6FD 3BESR 3JWOL 4ZUUB 3U36A 2LVEA 4OLVH 1A7OL 5D71L 2SEBA 4XBEH 4JFFE 3KXFE 4K8RH 5TE6H 4HCRL 3NTCH 2YRPA 5JPNA 5D2NA 4Y19E 1H5BC 5MEOB 3MYZA 1A1NB 3RL2B 2AXGA 4ODHL 1P4LB 1JK8A 3X13A 4I77L 2EICA 3UZVB 3D85A 2ZUQB 2WUCL 4D9LL 1R6VA 3FOMB 4HKBB 2QJDA 2VDQL 2BY3A 4L5FL 4RAUB 4WUUD 3SQOL 4TUOA 3VFUB 4M61A 2FO4A 4UAOC 3SPVA 3R0NA 4Q6IA 3VFWB 4FABH 2C4FU 1Q94A 1T1XB 4XNYH 5AZEH 5LVEA 3ALXA 1CD9B 5C0RL 5J6HA 4GRWH 4GOSA 3DSFH 4O2FB 1BQHB 2CK0L 4O58L 4GKNB 3D0VB 3BUTA 2XPGA 1L6XA 1TJIL 5F1SA 4LVHB 4DOHB 1HCFX 4BKLA 1OLZA 1IAMA 4TRPH 4WWKA 1U8PA 4XVJL 2FZ3A 2HFGH 2E7BA 2KZ1B 1ROWA 4OTXH 4LSPL 2A6IB 1RJZA 4Y4HA 1YNTB 4G6FB 1FVCA 2DWDA 5FKPB 3IDYB 3N1FC 3O9WA 4YHIB 1YNLL 2X2YA 1MCIA 5GSVA 3VFRA 2NLJA 2PCPB 5FYJU 1ADQH 3KYKH 4WY7H 3E2HC 5L88H 2GIYA 3MMEA 3DXAB 4M7LH 4PJ9D 3V4VL 4D0DB 1BQUA 4Z78A 3GMRB 1YN6B 3QDMA 4YHOH 1M7DA 1EX0A 4WEMB 4OKVB 3CD4A 1S7QA 4Y2DC 1E4KA 3WFDH 3WFZA 1ZWIA 2IANB 1FSKC 2AXFB 3BGMA 3NCYP 5FECB 3W9DA 3V7MA 4GXVL 4IRZH 3QXVA 4OCWL 2IF7A 3RA7L 5E8PA 2WWKT 2YZ8A 3B83A 3U36B 3RZCD 2HFEA 4KK6C 2SEBB 1HIMH 1OARL 4N9OB 1DLFH 3NGBC 4YXHL 2KL6A 3MREA 3RWIA 2EDHA 4M1GL 3RPIA 3UX9B 5JQHC 5D2NB 3D69A 5EU5A 2EXYC 1HYSC 4FQCL 4YHMH 5EZOH 2AXGB 1JK8B 3X13B 1XF3A 1RUQL 2OL3H 6CGTA 3D85B 3NN8B 1QQDA 5KTEH 3GI8L 2JJTA 4HC1H 5DD0L 4R4BA 1CDJA 5CZVL 3QB7C 1HXYA 4LMQI 2QV2A 4YBHA 4KQ4H 4MA3A 4GG6F 1FIGL 5C0CB 3SPVB 4X80H 2DF3A 3S8WA 1I3UA 1Q94B 2A77L 2AK4E 2APXA 4I3RL 3FHQA 3L3IB 3LRHA 3QIBA 4ODSL 4OT1H 4NDMA 4HBCL 5D5MA 4Z18A 4Y2OA 2IBGA 2MTPA 4NQSA 3O11A 1KNOA 4PLJC 4BKLB 2CRMA 1CFVH 5AYUL 2F8OA 4WWKB 1U8PB 3WFCH 2F5BH 1R0AH 1Z9LA 2FZ3B 4JANA 3V6BR 5F9JA 4ETYA 4TNWF 1RJZB 4HPOL 1FVCB 2DWDB 4DN3H 3O9WB 1EGJH 3BIAX 3LB6C 5CEZE 3VFRB 3VXSA 3WXWL 4HULB 2VXSL 3LPWA 4KXZI 3VFOA 1JTOA 4M93C 4ODWB 3I02A 3MMEB 4Z78B 3K4DA 1R5WA 4CMMA 5H94A 3QQ3A 2VQUA 1FNAA 4BZ1H 1M7DB 4D0BA 3QIWA 5TDPA 1A9BB 1S7QB 5EU6D 1PKOA 4OZHE 4TSBH 3ARDA 3BGMB 1HINH 3MLSL 4AIXA 4HMCA 2DL2A 3ARVA 1JPGB 5E8PB 3DVNA 5E5RB 4RFNC 4I9WD 1UJTA 1XGQA 3VD5A 4M3JA 3UAJC 4MNQE 1H3PL 3BW9A 5DMIL 3MREB 3RWIB 4QHMA 1JGEB 1FGNL 5EU5B 4MA8L 3DETC 1YEKL 5ICZA 2NY4D 5TQ2H 1XF3B 3CVHA 4PLNC 3CFDA 1J1XH 3QEUB 1QQDB 4HK0B 2A6JA 3IFNL 3HZMA 1D9KA 4NBXB 3ARXA 4M6NH 4R4BB 5E1HB 4E42B 3QCUL 4Q2ZB 1YYMH 2YZ1A 3ZKQD 4IMKC 1CFBA 1P9MA 3IDXL 3CX5J 5T3XE 4L9LC 5I73C 2F15A 4Y2DD 5I1JH 4LKXB 4U2YA 4YH6A 4NN7C 2CIIA 4NC0B 4KXZH 4OJFL 3QIBB 3HE7A 3NIDF 1LK3L 4MDJA 5D5MB 1CTOA 4NQSB 4XAWH 1Y6MR 1GGBL 1KNOB 3O11B 4YFDB 2IADA 2FL5A 1BM3H 4JANB 5T33H 3U46A 4X4ME 4D94A 5FO7A 5BXFA 2V6HA 5C92A 1NSNH 3WFHA 4LSVH 5JLZA 3VXSB 2BRQA 5ALCL 1X6LA 4LDLB 2VLJA 4M43H 2Y5TA 3K74B 4PJIE 1UWXH 3GGWA 1R5WB 2A9NH 5H94B 5LQBH 5IBUB 2FHFA 3HUJA 1MLCA 4N0CC 5TDPB 4U3CA 4Z7WF 3FO0L 3GZKA 3VWKC 1W72L 5ILTL 5IV2A 3B2UC 2A9MH 5AWNH 1WAAF 2ZCHL 3G08B 5JW4N 3RI5K 4YDJA 1VFOA 1XGQB 1GPOH 5HYJA 2MPAL 5ISZA 2Z92A 3EZJB 3I3EA 3BW9B 4JFYA 5FM5M 1XIWB 3D18A 5T1KA 1CK0L 1MCDA 4XPFH 3TYFA 1UCTA 1FO0B 2BJMH 2MHAB 3ZTJH 4QXUL 4Y4FA 4PV8A 4AJ0A 3CVHB 3CFDB 4O5LH 3LB6D 3UYRH 3ARSA 5FXCH 1A6WH 4JFDB 4ZNEA 2A6JB 2EE6A 1D9KB 1CCZA 2E8ZA 4CW1B 4Z7QE 1MCQA 4LL9A 4K7PY 4JAMA 1JL8A 2PO6C 2B0SH 2H26B 4JZOB 5D7IA 1FL6A 1OGAE 2OR8A 3S88H 2EYRB 3HE7B 4QHKJ 1GYAA 4PJDA 3I85A 4YWGH 2KZWA 4MDJB 4N0YL 5F7YC 4ZXBB 3OAYH 4I3GA 4UBDD 2FL5B 5EWIL 2A0LC 3LHPL 2AGJH 2DDQH 5EUOE 5GISL 4P23D 3U46B 3CXDH 2ZKHH 3RQ3A 5BXFB 3EYFA 5A2FA 4I0PA 4JB9L 5B22A 4ESKA 2MMXA 1KIQB 5I15H 3B9VA 5FGBA 2C4XA 2VLJB 4TVPE 2Y5TB 1P4BL 3DYOA 3GJFK 3QXDA 3P40A 2XWJA 3QDGA 3TNMA 1KCUL 3GGWB 5I18L 4QWWC 3AREA 1WSST 3HUJB 4NZUL 1MLCB 1KPVA 4YFLI 1AHWC 3BH8A 2WQ8A 3AVEA 2YR3A 2ZOLB 5IV2B 4PJBF 1XCTB 4PJGA 4Y8DC 3BDYH 5F9OL 5DEFA 1JWMA 4MJIE 5E6IA 2GJ6E 1WWBX 4ERSL 2MQ3A 1EAJA 3NPSC 3PABB 1M71A 1A2YB 2FD6H 3L3HA 4HFWA 5HYJB 5ISZB 1IZKA 1QFWL 2Z92B 4OLZH 1A3RH 3MRDB 4JFYB 4GS7B 3PP4H 2IQAA 1EMTH 3D18B 2AI0L 2NY0C 4X6FA 4NM4L 5T1KB 2HVKA 3DO3A 3TYFB 4OQTA 5F7MC 2AEQH 1SBSH 1I1YA 2EDNA 5EH1A 2GSGB 3VXTB 1JTPA 1OAZL 4JM4L 4WW2B 5D7KD 4MAUL 1MVFA 3RTQC 5HJ3A 5J1SC 4F7MB 4N68A 4X6CF 3LVEA 2VXTL 1U8HA 1DDHB 4WTWA 4JAMB 1GCFA 4YHKL 1T80A 2OX5A 4J3TA 2QSCL 3T77A 5J6GB 5D7IB 5JO5A 1PQZA 1DJSA 4DUXA 1TQCB 4JO1H 3VWKD 1SYVA 4LCUA 3RAJL 1T2QH 3GJFA 3UTTD 12E8H 4UTBH 4PJDB 1DEDA 3QXUA 4OGXL 1UKTA 1BZQK 5TH2B 1LP9A 2KQNA 4LSRL 1NCWL 1A1MB 5FEBA 4NCC1 1NGPL 5KVEH 2ARJQ 3QIUC 3D9AH 4NRZB 4CU8A 3NBNA 4WHTA 4AENA 4JJ5A 4GRLA 3T0BA 3EYFB 4I0PB 2QLVB 5DRZA 3MGAA 4RISH 2HTLC 1K9TA 3W2DL 4PY7A 3C5JA 1IVLA 1X44A 1IAOA 1A9EA 4AQ1B 3QXDB 2YPLD 3QDGB 2A74B 4FRWA 4HWBA 1SY6L 5E8DL 3TNMB 3IU4L 4ELKA 1QVOA 1X9QA 3ARRA 2PO6D 5CLTA 3AREB 5FGCE 3ULVF 3FN9A 3P11H 3BH8B 4F9PC 4JQXC 4UMGA 3FQRB 4JFXA 1U95B 5DQDL 4PJGB 4N90E 4OZIF 5DEFB 1FAIH 5E6IB 4JHWH 1H15A 4M48H 1DBJL 5IFAL 1K6QH 1LQSR 1KTLA 3QJHA 3QPXH 3BYYA 2AEWA 1IGML 2H1PL 2O5XL 4KDTA 4HFWB 1YC7A 2R4RL 1RURL 3LD8C 3VI4E 2A0LD 2IQAB 5CD3A 2HVKB 2LU7A 5IR1A 3QCVL 2VZVA 1KB5A 1I1YB 1RIVH 3AFLA 1VSCA 5JW4R 1D6EA 4JO4L 2YXFA 4L4TA 1AC6A 1U8HB 5IWLC 2V9QA 3LRGA 3ARBA 3MJ9L 4FN0A 3RJDA 1UC6A 3T77B 3I50H 3U7YH 4ELMB 4NKIH 5JO5B 1PQZB 1CG9A 2HFTA 3CX2A 4LCUB 4YE4L 1I1CA 2CJUL 4DW2L 5HYQA 3KJ4C 3GJFB 5CGYC 5BVPH 2BNQD 5GHWL 3EOBA 3LZFL 4WCYL 1LP9B 2YKLH 3CK0L 2VDRH 3DGGA 5E94B 1G7QA 3WDIA 4YHYB 1NAKL 1T66D 1U8OA 1GC1C 4HFUH 3L6FA 2R0KH 4X5LA 4K2UL 3ULVC 4NNPH 4LFHG 2V9RA 2DD8L 4OD3L 4WHTB 4AENB 4JJ5B 2C26A 4GRLB 1QSEA 4EOWL 1DP0A 4F15C 5JXAH 2J5LC 3M1BB 3RTQD 5DMYA 4R4NC 2JJVA 4OBRA 4PY7B 2O26U 1KBGH 5I8CB 4Q9QL 1IAOB 2YSSB 4WV1A 4ELKB 2BHZA 4XZUA 2IAMC 4KUZL 4HUNB 1ZGLP 1RIHH 2RCSH 5IB3A 4JFXB 4LLDB 5DC4B 4G80A 3KG5A 4HF5H 1CDHA 1K5NA 3MV11 5I1HH 2EKSA 1KTLB 3C5ZA 4JKKA 5HGAA 1MCOH 4DEPC 1VFBA 5CJXC 5B3JE 5E56A 5BS0E 2VE6A 1NL0H 4G8GD 4JZJA 5F1KC 3QIUD 3BPLC 2ADIA 2AJUH 3V4UH 5CD3B 3NFNB 2R69H 1AP2B 1KB5B 3WFEH 3MLUL 4IOIA 3UTQA 4WHYH 1UM5H 4L4TB 4CDGC 4FXKB 3RUGF 4J3XA 4KI5E 5I30L 3NMEA 3QG6B 4G43A 3ARBB 1J1OH 3QHZH 4JPVH 3M8OH 1CG9B 2ESVE 2X4PA 1CDBA 2B1AH 4GKZB 2LU4A 3EYUL 2VISB 4CVZA 4WHCA 3Q5YA 1OP9A 3WS3A 1MFEL 3L6FB 4Y5YC 5CEYA 1F3DH 1GSMA 5D7LD 2I5YH 3CPLA 1XFPA 4ZQKA 1JZ4A 1I85A 3QQ4A 4LPXA 4PJ7B 3ZYIA 5K9KA 5EUOF 1AGEA 1LMKA 3MTRA 5F7DB 5HHMB 3G5XA 1ZVHA 5C0AD 4WV1B 2W07A 3S37L 4APQA 5IJVB 4XZUB 4HS8H 2E7CA 4NN5C 3K2UH 4NP4H 3VGEA 4JM2D 5TQ0L 1WICA 5GRJH 5IB3B 5IEKB 1GC1L 5EG6C 3CVIH 5F7NC 2X4SA 4AYFA 3ULVL 5CGYD 4GQ9H 3V4PH 1BVLA 2WINA 1J9CT 5EU3B 1TMCB 2HLFC 1WCBA 3RHWK 5F8RC 3VRJA 5GS3A 3WLWC 2VE6B 4JZJB 2BNRA 1QZ1A 1ADQA 3SKJL 4CN1A 5ENWB 1NEZG 4N0FA 3IJYA 4CNIA 4D9RE 2IGFL 4NQEB 1I1AD 3UTQB 1A14L 3BRGC 3VWJA 3PXHA 5IB4B 1UA6L 1WF5A 3DV4A 4P59L 3W0WA 3LQAC 4G43B 5IVXA 2O93L 2IAMD 2G9HB 4XCFH 3O81A 3T04D 1QA9A 2BSSA 2X4PB 2FIRT 3SDDD 1B6UA 1YDPA 5A2LH 3O4LA 1IGTA 4XB8A 3NCBB 4DZ8A 1FNEA 4LRNH 1HZHH 1JGVL 3MCG1 2EH7H 4H26A 1XCQA 2B5IB 3WS3B 1F58H 5L8LB 3C2SA 3NOIA 1ZHKA 1UZ8B 3CPLB 2KH2B 2H2SD 4IIQA 3HE6A 4ZQKB 3NZ8A 2VDML 3QQ4B 5KAQF 4P2RE 1E6JH 5K9KB 3REWB 1OL0A 2VUYA 2AQ3A 1K2DB 4P46B 1AGEB 3G5XB 3MRGA 3VXME 4GRWB 1PG7H 4NHCH 3DYMA 3OAZK 2HKHH 4JRYA 3V6OE 2JB6A 4X6DE 4UT7H 4P0DA 4M6AA 4U3XA 2HMIC 2QQQA 2X4SB 1OAQL 2GK0A 1BVLB 2X4NA 4PJAE 4QYOA 1KCVL 3Q48A 1ZT7B 1N0LA 2WINB 3E8UL 5MEQB 2V7NB 2XN9D 3EGSB 3DTXA 1EGJA 5HHVL 4YHLH 1ES0B 2AJXH 4HIEB 1BZ9A 2VC2L 5CJ8A 2BNRB 1RMFH 3TO2B 5I1GH 3F58L 4OF6A 3CLEL 1UH4A 2PYEE 3D6GA 3BP6A 5GRYA 3EZ8A 4N0FB 3OKYA 2P4AB 3IJYB 4XAKD 4CNIB 3U4AA 3VI4F 3QXAA 4JPWL 1XF2A 1JNLL 1ACYL 3VWJB 2FBJH 3DV4B 2AQ2A 3NAAL 3W0WB 1JHTA 4DJMA 4RWYL 4XTRD 3P0YH 4KRPB 1S9KC 5HI4C 2B2XL 3JUZA 4CJ0A 5DI8A 2DQCL 1QA9B 3PHQA 5AZ2H 4OI9A 4PJFA 4R3SA 3O4LB 3B2VH 4YAQA 1PKQA 4W4OA 1NBVL 3WJJA 1IGTB 2J3SA 1MRCH 1RVFH 4DZ8B 4K3DL 1S7RA 3EDKA 3RVXC 3QCTH 4RFOH 4H26B 1XCQB 3SE8L 2X1XR 2BZDA 4M6OL 3WLWD 4OZFG 1ZHKB 1LO0H 1NCBH 4IIQB 5CILH 4JFEE 3NZ8B 5FYJH 4EI5A 3T0WA 3TYGH 1X3DA 1IQWH 5SV4A 4DVRH 2XV6B 2AP2A 4EUPH 4XX1E 3G6JA 3SE4C 1HH9A 4NNXA 4QRPB 3MRGB 1EHLH 5DUPH 3UCRA 1EZVX 2ZUUA 4JRYB 1QG3A 2JB6B 3QDAA 3JV4A 3PWLB 4KPHL 4QRTA 4U3HA 4F7TB 3GSNH 4K3JH 1Z0MA 3X12A 4HWUA 3BKJL 4LCYA 4QYOB 1NGQH 3RVUD 2YN5A 2XTJC 1W0VA 3GUTA 3DTXB 1ORSA 2WNGA 1Q9LA 4AM0A 1AKJD 1BZ9B 4MA1C 4LQFL 5B21A 2XICA 2GYSA 1HE7A 4XVSL 5GJTL 4PJCA 2CIKA 5B3JF 4XP6H 1KJ2L 4PREA 1BP3B 3QXAB 4G42A 4P4RA 4V1DB 3WJLC 4BQ6A 2P45B 2D7TL 5GS0H 4DCQA 4JO3L 2VDNL 5GRXG 1CXIA 2W91A 4ZG1A 2W9EH 5I1CL 1I9IL 2CRYA 1S78D 1IC5L 4JPIA 5DI8B 3BO8A 5HDQH 3IFLH 3MRRB 4YAQB 2HMID 1LEKA 1V7NL 1YJDC 2HYMA 4LNVA 2VDKH 2DQDH 3H2WA 4KHXH 1V7MH 4BQ9A 1J18A 5KVFH 4DKEH 5B4MC 1L4IA 4NQCE 5DRXA 4NFBA 4U1SA 3H9YA 3HC0A 6FABH 2P7TB 4U7MA 2NY2B 4GXUN 1F42A 4EI5B 2QR0A 5E2JA 1NUDA 1WT5C 1SJVA 4I3SH 5KS9E 2P46B 1ZHLA 4IOFC 1Y0LA 4GLRI 1IKNC 4NNXB 1RZIA 3ELAT 3U1SH 4YGVA 3BOVA 4Z7VE 4RZCA 4RWHA 4AG4L 5HI4D 3U0WL 4AEFA 1RHFA 2CGRL 1FNSL 5C2UB 5GZNC 3PP3K 1KENL 4Q0XL 3X12B 3BD3A 5D1ZC 3GB7A 1SM3H 4JN2B 4XB7A 5EDXA 3HAEG 4XPTL 2EDJA 1FGVH 3MOBH 3AB0B 3ZDZE 7CGTA 5EZJA 3GIZH 2YWYA 1OT1A 1HYRC 3RVXD 2UVFA 1W0VB 2ARJA 3ZKXC 1ORSB 4FFYH 4JLRA 2HRPL 1Q9LB 4HWEH 2PNDA 4AM0B 1P4IH 2YPLE 1OOAA 3GMLA 5JXED 3SOBH 1CI5A 3TO4C 1XT5A 3PIQA 1MFDL 3P30H 4UQ3B 1FPTH 3QNZA 4FFZL 3E6FB 3RGVA 4P4RB 4G42B 3TWCL 5EO1B 3T0EB 4DCQB 3MRKA 2YPVL 3WNNA 1RZ7H 3NVQA 1MFBH 5CWSA 2M8XA 3VI3F 1F3JB 4HMDA 1UWEL 4Z77A 1OT2A 5CSGA 5CS7A 1D5IL 3MBXH 3BO8B 1VFUA 2OS7A 1JFQH 1KEGH 4I4WA 1FV1A 5HVFB 4PP1C 1L7TH 1MAMH 4NZJA 2YUXA 4YLQT 1CBVH 5BO1L 3NCCB 1JPSL 2AKRA 3WS6C 2XTJD 5ITBL 3Q6GL 4D9QE 1FZKA 4EN3B 2DM4A 5DRXB 1FG2A 3QR2A 2C3GA 3FFDA 3U9PL 4LHUG 2ADJA 1WC7A 3UTSE 4U1SB 3HC0B 5I1EH 4NT6A 2YD4A 1OAKH 3EOYG 3OF6D 4MXVE 4JPKH 2GAZB 5I8OL 1F13A 2CR6A 5CBAA 4OZGA 2HH0L 2IFFH 1MJUL 2HJFA 1ZHLB 1T5WB 1Y0LB 2CSPA 4HUUA 4NUJA 3UMTA 4X9GA 1RZIB 1TZGH 2E27H 5LCVL 1BQLL 2HJKA 2CUHA 1FNLA 1YJDL 4YGVB 2N1KA 4RZCB 4X5WA 2APTA 4M7ZC 3GBLA 3JVGC 1CFTB 5KZCB 5C09E 1MI5E 2ZSVB 1HHJA 3ULUD 3JWDH 4D8PA 1CD1A 1IAKA 1K4DA 3GB7B 3DRTA 3BZEA 1ZANL 5DMJB 1X5YA 4K3EH 1S9YA 5LGHH 2Q7NA 4E41A 3FJTA 4EVNA 1BQSA 3MO1B 4V2BA 1MNUL 5ID0B 3HCVB 1FC2D 5KSAC 3KHQA 2ITDA 3SCMC 1FZMB 3UDWA 2J12B 3AS1A 3M07A 1OAYH 4PJAF 5DD1L 5F7UA 1WJ3A 2DQEH 4Y8AA 2Y07L 3PHOA 2IC2A 3PIQB 3VMNA 2XQBL 2P5ED 2X4OA 1C1EL 1OTTC 1MFNA 3LS4H 4U6XA 3QWQB 4WO4A 1RIUH 3RGVB 5I75C 4GRMA 4WFGE 3VGAB 4IOFD 1CICC 3MV7D 4C56E 3MRKB 5C70A 3IDYC 4YC2B 3TZVB 4AEIL 2VXUH 1NFIA 3IGAA 3Q6FA 4LIQL 3CU1A 4PJ5D 1QR1A 4Z77B 4U1GC 5GZND 4G8GE 2C1OA 1JGUH 2WP3T 2FX9H 3FAXA 1FV1B 2X5PA 4GKOA 1F4WL 2VKWA 5HYIA 3BJLA 1FJ1A 1T89C 2AKRB 1TJGH 5IROC 3S35X 3ARUA 3TH2T 1WFTA 1FZKB 2DLFL 4RA3A 3BZ4A 3UPRB 2D7QA 5GGSY 1FG2B 3SDCA 3FFDB 4J1UA 1BJ1J 4P3WA 4PB0H 1WC7B 2XXMB 5I1LA 1J0IA 3RWJB 3DGCR 1X7QA 2YUZA 4NT6B 3TO4D 3MLXL 1JRHL 3HFMH 3P4LA 3PQYE 4LRIA 2N7AA 5JMOC 2E5EA 4IEFB 1CIDA 4HZAA 2VLKE 3OKNA 1A6PA 4OZGB 3N9GL 2NXZB 2C9AA 2HJFB 3K0WA 43C9A 4AIZB 3NZHH 4L8CA 2FEDC 4AEEA 5FCUL 4NN6B 3S3SA 2HJKB 2GKIA 5BW7A 3VCLB 1KJ3H 4X5WB 2V9TA 2NNAB 5LAXA 4PBXA 2LTQC 1KCSH 3MV9D 3V5HB 1K8DA 3SEPA 1SEQL 5D7LE 3ZKMC 1GZQA 4UT6H 1CD1B 4D8PB 4NNYA 3DRTB 3BZEB 3L5IA 3FN0H 4PP1D 3TBYA 4XPBL 3VD7A 5D4QA 3MOAL 3M45A 4O2CA 1S9YB 1T0NB 4Q6IC 1VESA 2GT9A 3Q0HA 4E41B 3MCLH 4EVNB 3RWEA 2IBBA 4XNUH 3SGDI 1JN6B 2J8UE 4RGMB 1UJ3A 3EO9L 4K55A 2DMCA 4H20L 2ITDB 4WW1A 1T6WA 3SGKA 2ZPKH 1A6UH 1Q0YL 3P9LB 1R3HB 3PHOB 2AV1B 4XWOD 4JREB 4KVCL 4CU7A 1TETL 2R9HC 4RDQG 1EDQA 4WO4B 4QT5A 1GGIH 3S36H 4X5XB 1CLYL 5E9DA 4Y4HC 1Q0XL 1E4XH 4PRPA 5JW3L 3O9WC 1FG9C 3T1FB 3HZYA 4J6RL 3IYLW 3F7YB 1NFIB 1DQLL 5IFHL 3IGAB 4KMTL 1QR1B 4ODTL 1JGDA 5LXGH 2WUBL 2K3TA 2C1OB 4IM8A 3QUXB 4E5XB 4S11A 1AI1H 1HXMA 3FN3A 1YMMA 5CEXA 1FJ1B 1KACB 1H0DA 2F58L 1E4KC 4L4VA 3HB3D 3HZVA 3MPCA 5MENA 3FB6A 4XNXL 3BZ4B 5KSAD 3UO1L 2RIKA 3RBSA 3SDCB 3SCMD 4J1UB 1A3QA 3GI9L 1RD6A 2OZ4H 4NO2A 5D7JC 5EOCL 5I1LB 4PS4L 2JF1A 3ZYOA 3SDAA 3IRZA 1BZ7A 1H8OA 3BH9A 2E9IA 2A6KA 1H9VA 2JB5L 2V5TA 4AMKL 4PJHE 3T3PE 3QA3A 43C9B 4L8CB 4DTGL 3RL1A 1IT9H 4G6FD 3E3QE 3O45A 4I48B 3UP1A 5LAXB 2O5ZH 5KS9F 2JJTC 1K8DB 4HKXA 1YC8A 2YRZA 1MCBA 1R3JA 1GZQB 2NQCA 4PRHA 5MEPA 4Z7VF 1JNNL 4Y4KA 4IRSA 1V3MA 4LVNC 1G7MA 5I74B 4MA7H 1AO7B 4O2CB 4BH7A 2GT9B 5CCKL 1E28A 3RWEB 5IFJA 2IAND 2VSCA 1CN4A 1UJ3B 4FTVE 4Y89A 4PUBL 5EOQH 4WW1B 3QIBC 3KWWA 2BVPA 3H3BC 5DD6B 1A8JH 3WHE1 2WWMD 2Y25A 1AXIB 4U1HA 3WFBL 3KPQB 1RULH 3GEWB 3GHEL 5BMFL 4QT5B 1RZJC 4OSUL 3AMLA 3ZYZA 4WUKH 2FEDD 3KR3L 3P73A 4XPAL 15C8L 5E9DB 2JELL 3G5VA 4FQQA 5GGUB 2HT4D 4CMHC 4YDLB 3ES6A 1G9NC 4QOKA 1KN2L 1MVUB 3D85D 4HG4J 2XN9E 1LVEA 4LLYA 3NCJH 1T6VN 4F7PA 1B0RA 1JGDB 1N0XL 3CX5K 4D0CB 3ZKMD 1CU4H 3ARQA 1HXMB 4Z0XA 1HKFA 1MFCL 1DL7L 3QIWC 5C0CD 5CEXB 2VJXA 3A6BH 1MRDL 2LABA 2EXWC 3ARDC 3CMOH 3HZVB 3GSWA 3O6KH 5MENB 3FB6B 5E99L 5E2WH 4XNZC 1XH3A 4ONGL 4I2XA 3F7VA 4GSDL 2EO9A 3SDAB 1KELL 1BZ7B 3BH9B 1E6OH 2A6KB 1DN2A 1F4YL 4IMLA 2C3HA 4WWKD 5F96L 3QA3B 1OTUC 2DQJH 2IALA 3TV3H 3RL1B 1S7TA 3O9WD 3PWNA 5AUMB 4B50A 3O45B 4N9GA 2ZZUT 1KTRL 4J3VA 1MAJA 3VRLE 1IM3A 4RNRA 2D03L 4FS0A 2CQVA 2F5AH 5CZKA 1TXKA 4HKXB 5FUOL 5KN5A 1R3JB 3BRDA 4PRHB 3BHBA 3QDMD 4IRSB 5EUKA 5IHZA 1P9MC 4BH7B 1VEPA 1E28B 4ZS7H 3CFKA 1KFAL 5IW6A 5IFJB 5DHYB 1FVDB 1H8SA 1UWGH 1HKLH 3KWWB 1DBMH 2ADFH 2BVPB 3HE7C 4LHJB 4A2LA 4O2EA 4S0TD 4KHTH 3MLRL 4WFHE 4NJ9L 1MCLA 3N1PC 4RGOL 3D3VE 1MJ7H 3UBXG 1ZT1B 1O7SA 4AZ8A 3PWJA 1IC4H 5D2LA 1X5IA 1EAPA 5DXWA 3P73B 5L9DL 5E8NA 1CWVA 4QOKB 2XFXB 4U7KA 4MZ2A 2Z93A 5I1DB 1S7WA 4LLYB 5LGKA 4ZYKA 3ZO0A 2GQHA 1NGXA 3AXLB 3SDXB 4BA8A 4Z0XB 1OQXA 1NMCB 4JDZA 3P9WB 1VADB 3LMJL 4ZPTB 4Z8FH 1TZIA 1JV5A 1YY8A 3WEXB 4KGJA 4XT1C 1GXEA 3IFPA 2Y06L 3WIHH 2JTDA 3TBWA 1RZJL 1O5DT 4JEGB 4QXWA 3QIBD 2YHGA 5CKGA 1XH3B 3V6ZA 1D7FA 5E8EA 1G9NL 2AERT 4QRRA 1W8NA 4I2XB 3F7VB 4NKMA 3BKYL 2ZWLT 5EO9A 1R5IB 4RFEA 3O4OB 5IUSA 3ARGA 4IMLB 4KROB 5CP7B 3FTGB 5CEZH 4GS7C 1G7HA 5FAAA 1WFOA 4QLRA 3N50A 2EIZA 1T4KA 3N0PB 2HWZH 1S7TB 4L8BA 3PWNB 4Y4FC 4N9GB 1LWRA 4HEPG 5DHVH 2GTZA 3MNWA 1TVBA 3L95A 3VXSD 1IM3B 1QFUL 5I8EA 1VGKA 5D6DC 4K7PH 5KN5B 5HGGS 3MRQA 2Y7QB 2VDPH 1DR9A 1KOAA 3C08L 3BHBB 5GS1A 4RMUA 4NJAH 5IHZB 3HA0A 3CFKB 1LNUB 2EXWD 3ARDD 4P4KA 3B5GA 1EK3A 4G7VH 1JZ8A 3OAUH 5EO0A 5SWSA 5J3HD 4EUPA 1Z3GH 1YEEL 4M8QA 4JG1L 4O2EB 5F97E 3IU3A 1OPGH 2Q1EA 3DV6B 3CVHL 4FQ1H 5HD8C 2F8XC 4GMSL 4U0QB 1MHPL 3PWJB 4WGVB 5D2LB 4MLIA 1XIWD 3IFOB 1EAPB 4DKFH 1OTUD 1YECL 3DIFB 4HXAH 5E8NB 1MCFA 2GSIA 1CDCA 4U6VL 2Y23A 3UTZB 2Z93B 4UB0H 1S7WB 3OR7A 5JR1L 4FZ8H 4PGCA 4ZYKB 4M1CC 1D9KD 3G6DL 4K9EC 5T3XH 1NGXB 2V2TA 4Z7UE 1KEMH 1RUKH 2D2OA 4CADA 1U3HA 1GVIA 1BF8A 5GGVH 1EUTA 4RQQB 1TZIB 1JV5B 1YY8B 1ZLSL 3QI9A 2HKFL 3IFPB 5CAYB 2AEPL 4UV7H 2VWEC 2OTUA 4QGTA 4J3SA 4BSWA 3HE7D 3MACH 3NABH 5L0QB 2F54A 4BH8A 2P47B 3V6ZB 4QRRB 1JPST 1JWSA 4POUB 1AIFB 4MDIB 2UWEE 4ZXBD 4NCC2 3ARGB 3C5SB 5L6YL 2Q3AA 4KKAC 1G7HB 4GW4A 4HWZB 5F88A 5C0NC 1KYOK 2EIZB 1QFOA 1FYTE 4HMEA 3MJ8A 1MF2H 1GAFH 4K94H 1XGYL 5HXMA 2GTZB 3MNWB 4NFCA 1NUNB 4OZFH 5D8JH 1HQRB 2VLJD 1I9EA 2WK2A 3F12A 5HHNB 1F6FB 2DOCA 3JSSA 3ECBA 4UDTA 3EKCA 2QKIA 1G7PA 1P6FA 1NCAL 1Q9OA 3UYOD 3S35L 3KPSA 1NDGA 4P4KB 4M62H 2YK1L 1LO4H 3RVVC 4XVUD 1VEMA 1X6NA 5EO0B 4LMQE 2CLZA 2FB4L 3I2CH 1B9ZA 2CKNA 3IDJA 3IU3B 1BD2B 4P5TA 2Z31A 1CXHA 1KPUB 5HYJD 1CLZL 5ISZD 3ULUE 3VFTA 4M5YL 4HH9A 4KVNL 2NTSP 5T1KD 2NZ9D 4KKNA 2GSIB 1CFNA 1K3IA 1FFPB 3LKQA 2BOCB 5CZXD 4DWHA 4Q9CA 3S96A 3VE0A 1J5OH 2V2TB 4LPTA 4KZDH 4F8QA 1I7ZB 1J8HA 1YPZB 4ZO9A 4UNUA 2IG2H 3NA4A 2P5EE 3WN5A 4FQJH 5D1QA 5KOMC 4LLVB 1M7IB 1UM4H 3QH3B 2OK0H 1TJHH 2XWTB 4ODBD 1IGFH 2R29L 4B41A 2F54B 1BOGA 2XQYG 2YBRA 4BH8B 1A7PL 4EEEA 4KZEL 1H5BB 1JWSB 4GAJH 4NO5A 1P5VA 5HTSA 5J1TC 4LU5L 3MZTA 3QEQE 1ZVSA 5GZOD 3B5HA 2H41A 2HJLA 1N4XH 4GW4B 1AD0A 3NA9H 3ZDYF 5F88B 4I5BA 4RRPA 4TVPH 5C7XH 3MJ8B 3HMWL 4R7DB 2P1YA 1JGLL 3L3KB 3GMQA 4I0PD 4X4YB 4XVTL 4UAOB 4OLWL 2VZTA 1S7SB 3PDGA 1HH6B 4M1CD 4EI6A 3F12B 5ACLA 3HNVH 1N59A 5E2TH 1QSFB 3QDGD 3ECBB 1CQYA 3ARBC 4H8WH 2D7OA 2UZIL 3VRLF 3IVKA 3ARED 3MLYH 4XCCH 3EDDA 1QBLL 3B9AA 4YR6B 1BEYL 2J1KA 1Q9OB 4UIMA 2JLLA 3KPSB 1GZPA 3MXWL 2IEPA 3BE1L 4F57H 2Z9TA 5E6ID 2CLZB 4OQTL 2DQIH 3HPLA 4DAGL 1MCHA 4P5TB 3MOQA 2OJEA 1MUJA 3FQNB 5F7EL 3HAEH 4O4YL 3VFTB 3NIFE 3AS0A 4KKAD 4TNWK 1LGVA 3EJZC 5C0ND 1QD0A 1E4WH 5DC9B 1CFNB 2BFVL 1NC2A 1NBZA 4MQTB 3THMH 1AGDB 4JR9H 3LKQB 4WI2A 5L7XH 4JO2L 5EC1B 2O5YL 3S96B 3VE0B 1FSKB 4XCNA 4BYHA 5DEGB 4WV1C 1KN4L 3PNWB 3INUH 1OF2A 5F7KC 5DA4A 2PUQT 1U8LA 4X7SL 4ZUWA 1W8OA 1QKZL 4YDIH 5D1QB 4L3EA 4M7JL 3K4ZA 3UJIH 2R8SH 3RIAF 3VG0H 1U8JA 4LPWA 1F4AA 3NGBB 2YBRB 3VGHA 4GG6A 3C5ZC 5BZDA 2BSRA 5C3LD 2DRUA 4FXGB 3VW3L 4FG6D 5GJSH 3D39A 4GRWF 3VXUE 4N0UB 1ZVSB 3WNPA 2HJLB 4JZJC 4HX1A 5HHXH 1AD0B 4HGWA 4Z0BH 1JPTL 4XPGL 4HWBL 5ICXB 1FN4A 4GRLD 4I5BB 4LASL 3VXPA 4ALAL 1OM3H 3C60A 2Q8AL 4LSTH 1IFHH 2QQNH 3GMQB 5CJQL 2J8HA 4WHDA 3VDCA 4IMKA 5DC0A 2QTEA 5BZWA 3JUYA 1PVHA 1CGUA 2YOCA 4J3WA 3S3PA 1H3UA 3VFMB 5EBMB 4OFDA 4LSSL 5DO2D 2EIBA 4X4XB 4DOHE 1CVRA 4PYGA 4OCRH 3TA3A 5B3NA 2BNUB 4Y1AE 1ZEAL 2ADGB 3G6AB 5HDLA 1GZPB 4X7CC 5FA3B 4DUVA 2AAVA 4G3YL 5DZNA 4K8RC 2QADC 5L2KA 5ACZB 3N1MC 3U82B 2V17H 1RV6X 3HPLB 4HZLA 4NZTH 4FNLL 4U6YA 5SX5H 5HVHC 2OJEB 5IVXF 3X3GH 5DLMH 3QJFA 3DXAE 2P44B 5IBTH 2BDNL 1RU9L 4ZUSB 4M93B 1NC2B 1NBZB 2NZIA 2IANE 2F19H 5EB9A 3PWPA 5CP3H 4PG9B 4YUEL 3MX0A 4L4TD 4XCNB 1HQ4A 1K3ZA 4APQC 1OF2B 3ARBD 2P8PA 3TM6A 1U8LB 4ZUWB 5I6XC 3JWOH 3TT1H 1U8KA 1X5JA 2VLRA 1A7OH 3OBAA 4XRCA 1HSAA 4U0RC 5D71H 4HPYH 4ONFH 3DX9A 5D2NE 4PG2A 1U8JB 5TE4H 1D5ZA 4OIIH 4HCRH 3QO1B 4N5EC 2AXJA 5FUCE 1B4JH 2HAZA 3A0OA 4GG6B 5GS2D 5BZDB 2BSRB 4ODHH 2MJWA 5DF0A 1V5JA 3D39B 2DBLL 4D9LH 1UYWL 2YPKA 3S7GA 4HX1B 1MRFL 2QQKL 2FIKA 3EYSL 5BRZA 3CJJA 3ARTA 3EJZD 1FN4B 3VXPB 4L5FH 3FFCB 1PSKL 1QSED 5C0CE 1DQDH 3C60B 1N6QL 2UWEF 1T03H 5INCA 1UB5A 1JUFA 5GGSA 5I73B 2XQYK 1DBBL 5BZWB 5HHMD 3RWHA 5IVOA 3DVIA 4NN7B 3MGOA 5ID1A 3DRQA 2WP3O 4KAQH 5BQ7B 1PEZA 5HDBF 4O58H 5DGQA 4KRPC 4X8JB 1G1CA 2OZ4A 5KJRH 1QNZL 4OCMC 3TA3B 3RKDC 4F9LA 5BV7H 4CL7A 5DD3H 3SGJA 4D3CL 5C86A 3VJ6B 3LV3A 3K8KA 4JQIL 3TCLA 1C5BH 3EOAB 5AAWA 5L2KB 3OR6A 3Q5TA 4LSPH 2GJJA 2D31A 4Z7WA 1PX4A 4HZLB 4U6YB 3HR5B 4F7EB 4JFPB 5F9WC 2NW2A 3X17A 4JY6B 4ENED 3OGOE 2DJUA 4IIQC 1AE6L 3HE6C 2XZQL 4PJFF 3V4VH 1UXWA 4NC1C 3CFEA 4ZO6A 2NCMA 3PWPB 4DGVH 4OLVL 4QHNA 2H2PC 4XBEL 1JI1A 3VWKB 2H9GB 4K8RL 5TE6L 3FB7A 3NTCL 1HQ4B 4X6EA 2A83A 1T1ZB 2P8PB 4JFFA 3KXFA 3RA7H 3B9KA 4DK6A 4X7TA 4J7RA 3U79A 1C08A 1U8KB 2VLRB 3TH3T 4XRCB 1HSAB 3DX9B 1OARH 4HBQA 4K8RD 5L2JA 5JOPE 1QPXA 3G6JF 5C2BL 2HG5A 3QUKA 4WENB 2IH3A 4TPRH 5TE7L 2VLME 2WLYA 2FGWH 1HN1A 4X83A 4FABL 1EO7A 2DBJA 1WWCA 4XNYL 5TF0A 5AZEL 5F9DC 2DLHA 5DD0H 5CZVH 3DSFL 4X98A 5IM7A 4QRSA 1B4RA 1MY7A 5INCB 2OYPA 2PO6B 3PG2A 1JUFB 4CJ1A 2Q86A 3U7WH 5GGSB 4P46D 5H37G 3RWHB 4TRPL 4UNVA 3HNTH 3OXRB 4HJ0C 1QYGL 4WI3A 5HHOE 3DRQB 1UB6A 2HFGL 4ODSH 5D5ME 4APQD 1J12A 4PP2B 1S9VB 2P5WA 3CSBA 3R8BB 3PGCB 4DQOL 4JCMA 3GSXA 4PJCF 3LV3B 2EIEA 1HDMB 2OBGA 2YN3A 4EZMA 1PBYA 5C6TL 4H0IA 2DLGA 3BDXA 4N5ED 3CLFH 3TCLB 1ADQL 4U1KA 5DJZA 2D0GA 2Q76A 1JWUA 3OR6B 4WY7L 3T0DA 2D31B 4Z7WB 3SE3A 3VXSE 4PJBA 4ISVB 3RY5A 4QO1A 2BHYA 2NW2B 2BNRD 2W9LA 2VQ1A 4IRZL 3W11C 5K59E 2NY2C 1AH1A 1G6RA 1CLOH 3O3EA 1UXWB 4JG0L 1JE6A 3V7AE 3LH2L 1CGXA 3CFEB 3F8UB 3AAZA 1Y6NR 1UENA 3OB0H 1AHWB 5C0FB 5AEAA 5IESL 4ZFGH 3VWJD 1BFTA 1DLFL 3EBAA 3MLSH 3LS5L 3FB7B 4J4PA 4PPTA 4X6EB 3W0WD 3J7HA 1G0DA 4JFFB 3KXFB 2BNQB 3B9KB 3DO7B 4KRPD 5KSVA 2WBJA 5EZOL 4YHML 1C08B 4NBYB 4ZUVA 1FC1A 2OL3L 4S2SA 3GIVB 4X6CA 3RKDD 1PG7W 3S98A 4UT9H 1P69B 3O4LD 2XTLA 4WDIA 1U2HA 1H3PH 1F97A 4HC1L 1FGNH 1OTSC 2NY0B 1P2CA 3MUHL 4MWFA 2VO5A 3QUKB 4WU7A 5C07A 2IH3B 3V2AR 2ATPB 4JFDE 4MCYB 4KQ4L 4NKDA 3RY6C 4X80L 4IBLT 4Q9BA 1BGXH 1Y18A 1MJ8H 3RTQB 3IFNH 2AABH 3I75A 2YD2A 3GO1L 1YNKH 4MD4A 5J7CC 5IWLA 4OT1L 4OD1H 3UBXI 4X98B 5IM7B 4EBQL 5I16A 5D6CA 1RZFH 1JYXA 5SWZA 2Q86B 2IH1B 4OGZA 4POYA 3CSGA 4QRPD 5FO9A 4PRNA 1R0AL 5TPWH 2F5BL 2MCPH 4OJFH 4U49A 1UB6B 3P0VL 5KAQG 1V8HA 2P5WB 3OL2A 1GOFA 1LK3H 4JRYD 4DN3L 1EGJL 3OJMB 1GGYA 3GSXB 5ESVA 1GGBH 5IMMA 5AYQA 2K7PA 3SKNA 2E7LC 4Y5VA 4S1DD 3TBVA 4U1KB 2OTWA 2Q76B 4HS6A 1JWUB 2PKDA 4F8TA 2ITCA 4PJBB 2OMNA 5DHVA 1ACZA 1QOKA 1WWWX 5ALCH 4TSBL 1AJ7H 3QRFM 1CF8H 1F90H 2EEDA 2VQ1B 5DJAA 5I1IH 2BRRH 4OZHA 1LEGA 1G6RB 3VFVA 4QRQB 3O3EB 4MAYA 4BZ2H 5F1NA 1PZ5A 1JJUA 3AAZB 3FQTA 1BWWA 4L4JA 1W72H 4MLSA 1TTGA 2XNAB 3WYRA 2ZCHH 4HJ0D 3SKMA 5KSVB 2Q8BL 5HGDA 3SN6N 5TQ2L 1P7HL 4S2SB 4X6CB 2CRZA 1J1XL 1XGUA 4OF0A 1J05A 4HAGA 5CJXA 3CCHA 5ADOH 1I8IA 5DK3A 2MPAH 5DSCA 4WDIB 2KPNA 4OZGF 1N7MH 4M6NL 1NFDE 4MWFB 1P2CB 1CK0H 5C07B 1YYML 5FO8A 1JHLH 2NXYB 3MNZB 4OB5H 2UYLA 4NKDB 5GRUL 4LLUA 3AGVA 5I1JL 2WBKA 1IJ9A 3I75B 4OFKA 1T2JA 3W11D 2NY2D 4EI5D 5C0AB 1XMWA 2X70A 4X7DC 3D0LA 5D7IE 3MSPA 2O61A 5I16B 5F1IA 5SWZB 3DX7A 3RGVC 2XA3A 1E4JA 1CXKA 4XAWL 5E4EC 2APWA 3VGAC 3RIFF 3LKRA 1C16B 1QFWI 1HHKA 2EDTA 1T04B 2FX8H 4PRNB 2G75A 4YC2C 1I8LC 3KJ4B 3ZSSA 4FQ2H 5JTWA 5GGTA 3MRFA 3IETA 2AJYH 1NSNL 2EEBA 2JCCF 4N0YH 5CINL 4L9DA 2WBWB 5IMMB 3Q1SH 5L8KB 4MX7B 3SKNB 4Y5VB 5D1XC 3TBVB 1EPFA 2OTWB 3LHPH 4HS6B 1OTSD 5IQ7H 3ZHDA 5JHLL 2A9NL 2EDKA 5LQBL 1ZTXH 4F15B 4P49A 4PJIA 4POZD 1UACL 4EKXA 3WV0A 3DHMA 2A9ML 5AWNL 3BEWA 4YFEA 1CE1H 5DJAB 3DI2B 4MJ6B 1G6VK 1BX2A 1LEGB 3VFVB 4MAYB 5IGXH 1KCUH 5F1NB 4JE4B 2IAMB 3WLBB 4NZUH 4GBXA 1MHHB 4PJGE 1J1PH 3EHBD 1UH3A 5GPRA 4JCLA 1GPOL 2EC9U 1QR4A 1YEIH 4Z95H 2VR4A 4LCIL 4P2OA 4ERSH 3KGRA 2BJML 5HGDB 3MFFA 5EU7E 5T3ZL 4O5LL 4LCWA 1J05B 1A6WL 1I8IB 5DSCB 4PRAA 4S10A 1O0VA 2Z0BA 3BPLB 3BP4A 2B0SL 4OUOA 5FO8B 1MQ8A 2X89A 3GMNA 4PGZA 4RGMC 2GK2A 4JM4H 1PAMA 2CUIA 5C8JA 4RAHA 5T3ZD 2R56L 1C5CH 3UDWC 4W68A 1MPAH 5MP6H 1UT9A 1R24B 1UM6H 2VXTH 4PGBA 4MYWB 4JREC 5E70A 3S88L 3S4SG 4ELME 2X70B 1G9EA 3D0LB 1OSZB 1ZMYA 1OGAA 2O61B 2EE9A 3DX7B 2X4UA 1OP3H 5IW3A 3ZE2E 3LKRB 1DUYA 1RPQA 1HHKB 1NAMH 2G75B 3IJSA 1P53A 1HNFA 4PR5A 2ZKHL 3WUZA 4MCZB 1LDPL 3NCMA 5EUOA 3MRFB 2BSED 3IETB 4DGIH 3WHE0 5KZCD 2ATKA 4LLWB 2ZCLL 2X4RB 2EDQA 5I15L 1J86A 4Y5YB 4BUGA 3UPCA 1FL3A 2WMPA 5F7FA 1EXUA 1HSBA 4I18A 4JFQA 4LGPB 3BEWB 1DANU 3BDYL 2MKLC 1BX2B 1TENA 4HQQL 1SY6H 4LRIC 1U3ZA 3STZA 3QZWA 4TVSa 4NN5B 2GJ6A 3RGVD 4PJXE 2FD6L 2UUDK 4QHUA 2HN7A 3HTLX 4OLZL 3W5MA 3NPZB 4MB3A 1A7NL 2APVA 3PP4L 5BW7C 3AMKA 1FYHB 4P2OB 4G6JL 4OM1L 3SY0A 3LKNA 5IFAH 2AEQL 3VXRE 3OSKA 3O3AB 4N1HB 4P57A 1KXTB 1IGMH 2H1PH 3RUGB 1DQTA 2O5XH 4LCWB 4PRAB 4OBSA 4ZD3L 1RURH 5J1AA 5HGHB 1DE4A 1C7TA 2BXYA 1BQHG 3RPKA 5EZIH 3DUHA 1UJ3C 4L4TE 5C8JB 4JO4H 3F7QA 3P9MB 2J4WH 3SGKC 3WL9B 3ZKND 5L8JB 1SMOA 4PGBB 3V0WL 1T2QL 1CIUA 1GGCH 12E8L 4OFYA 4UTBL 5HVWA 1WZMA 2YRLA 5I17A 2CKBA 2COQA 4Z76A 2X4UB 3HI6L 1XGPB 2NXZD 1DUYB 2CJUH 4YDLC 4DW2H 5KVEL 2F53A 4YO0A 5C08A 3IJSB 3D9AL 4FZEH 4PR5B 5DMGD 3LZFH 1ZS8A 3R1GL 3CK0H 2V7HA 4L3AA 2G5BA 5EUOB 2KQMA 2W38A 3NCEB 4NOFA 1QBAA 5K9JH 1NAKH 5DRWA 1YEFH 1AKJB 4YEFA 5IF0A 5CSZA 4K2UH 4PJ7E 4MHHI 3K8LA 1FL3B 4E41D 1NBQA 3DROB 1A7QL 1EXUB 1W0WA 3P11L 1HSBB 4JDVB 4JFQB 4OGAD 3BUYA 3BT2H 1GRWA 3BYTA 3H9HA 4JHWL 3T2PA 3SDAC 3IDIB 4LVOC 2WIIA 1K6QL 1XEDA 3STZB 2B4CC 5DMKA 3QZWB 3PWVA 4MNGA 2GJ6B 3MRHB 4WO4D 3QAZB 3GJEA 1MFAH 3H7LA 3T4YB 2HN7B 1AQKH 1B3JA 3QHFL 1IC7H 3H3PL 2NYYC 4ZSOB 4UQ2A 5I19H 1KF9B 3SY0B 3LKNB 4M7KL 2AV7A 1HHGB 4P57B 3B43A 1R3IH 4P3DA 2FJFA 4M3KB 3QUXD 1FZJA 4Y4KC 3C9NA 4NQEE 4WI5A 3BKMH 3BSZL 4OZ4B 4LLMA 3I50L 3MLUH 3U7YL 4MZ3A 3VFPB 4NKIL 4GW5A 3K1KC 3SDCD 3MRCA 5DJ2A 3WJLA 3TCXA 4LOUC 2X09A 1IAIL 2PTTA 1DQJB 5JQ6H 3SE9H 3CH1B 5I17B 2CKBB 2YKLL 2VDRL 4Z76B 3BIBX 2DM3A 1EERB 1FORH 1IQDA 3BISA 2EDFA 5FYKE 4Z7NE 4HFUL 1G84A 2W0KA 2F53B 4YO0B 5C08B 1NCTA 3VH8A 5GGRA 4NNPL 1G7LA 2NX5E 4JFHE 1AXTL 3EYUH 3TP4A 4ZAKC 1AGFA 4P2QE 4P5KA 2G5BB 2DIBA 3MLTB 4G8FA 4H25B 5JXAL 4KKCC 5T1MA 1Q9KB 3RWGA 3TNNA 3KLHC 1WZLA 1RK0A 5IF0B 3FO9A 3O2WH 3GK8H 5CSZB 1NMCC 4U2ZA 3HRZA 1UEYA 1IEAA 4G8EA 3OTTA 1JF5A 5INDA 1FHGA 1DBKH 1W0WB 3V9FA 5JORA 1RIHL 2RCSL 5FGCB 2PYFB 3BUYB 5SWQA 1NBYB 4UV4H 1BBJA 1IKNA 4M7LT 4HF5L 3H9HB 5I1HL 2WIIB 3L5WA 5DMKB 3I6KB 1EH9A 4MNGB 4HHAA 1JYNA 5E95B 3V0VA 5FDYA 1JZ6A 5E9DD 4UINH 4MD0A 4R6UA 1NL0L 4PRPD 5D1ZA 4RMTA 2AJUL 3ARFA 3V4UL 4NKOA 4UQ2B 1SYSA 5EPMB 2R69L 3MFGB 5BS0A 3WFEL 5GRVL 2AV7B 4NO3B 1G7IA 3HMXH 2XTJB 3GSRA 2BNRE 4P3DB 2FJFB 2R1YA 4ORGB 1FZJB 1UM5L 4QY8A 1TPXC 4HJGB 4MA1B 4I0KA 3FT3A 1YMMD 4JVPA 2HT2C 1DCLA 4XWGL 2B4CL 5DD5L 3KPTA 4LLMB 4MNHA 3AUVA 5MEND 2IGFH 3QHZL 5T1LB 5TJWK 1ND0A 5IHBA 4P99A 3MRCB 4HV8A 3W0WE 5DJ2B 3T3ME 2B1AL 2ESVA 3NACL 3SDAD 1KXQE 3JV0A 3MRNA 1MJJB 3OKOB 2PR4H 1FL5A 5HPMA 4TSAL 1C8PA 4H5SB 3O4LE 3L7FB 1IQDB 5IB1A 5C1MB 2DKMA 2QHRH 2HVJB 2NYYD 3VH8B 4FMKA 5GGRB 5C0EA 1G7LB 5A1AA 3VGGA 1AGFB 4P5KB 4MS8D 5IBUG 1XGTA 4J8RB 5T1MB 1MHEB 3RWGB 3TNNB 5FIEA 3MV8E 3C8KA 2AJZA 4PRHD 3FO9B 4JRXA 1JZ2A 1A64A 1CXLA 4IRSD 1I3RB 1IE5A 5TDOA 5INDB 4HS8L 2ZSWA 4KJYB 3K2UL 4NP4L 4QRPE 5GRJL 3LEVH 2OR7A 1GGTA 5L0QC 3B9DA 2FNBA 2V5YA 1BBJB 3L5HA 4LOUD 5CIPA 3CVIL 5H35A 3MV7B 2R1XA 3VGBA 4GQ9L 3L5WB 4KK8C 2Q87A 3ARGC 2VSDA 4HHAB 5FUZH 4MD0B 3F5WB 4QOKD 5CUSH 5D1ZB 1TVDA 1O7VA 3ARFB 7FABH 4NKOB 1V3KA 4M1DL 4W6XB 5BS0B 4YHNA 1RZ8A 4PJXF 4JY4A 1G7IB 4ODXA 3CFBA 1KV3A 3GSRB 4XXCA 3V79C 2R1YB 3ZKXB 3IKKA 3KLHD 2W0FA 4O9HH 1QBMH 3QSKB 4QY8B 5GS1C 3FT3B 3F58H 3L5XH 3CLEH 4JZNA 3MCKA 5CHNA 1F6LL 3TO4B 5FYLE 4V1DE 5C0IA 4MNHB 4XCFL 3HI1B 4TSCL 4NWUL 1ND0B 5HHPA 1K4CA 4JPWH 1GH7A 4HV8B 1FH5H 5MHSD 1ACYH 5E2VH 1CICA 3D2UB 2ESVB 3TC9A 1JMZA 4UOW1 2KBGA 4JHAH 3I3BA 4HDIA 1FL5B 2B39A 4WEBH