4I5BB

Structure of human mhc class ii protein hla-dr1 carrying an influenza hemagglutinin peptide partially filling the binding groove
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
192
structure length
192
Chain Sequence
DTRPRFLWQLKFECHFFNGTERVRLLERSIYNQEESVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGVGESFTVQRRVEPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
publication title Disruption of hydrogen bonds between major histocompatibility complex class II and the peptide N-terminus is not sufficient to form a human leukocyte antigen-DM receptive state of major histocompatibility complex class II.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 44
structure length 192
sequence length 192
chains with identical sequence E
ec nomenclature
pdb deposition date 2012-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4i5bB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4i5bB01
2OTWB 2F8XC 4KTEL 1KCRL 3GBMH 2E27H 4JO4H 2ED7A 4I8DA 1OPGH 3TM6A 4G6FB 3OWEA 3ARDB 1DSFL 4S0TD 4YWGH 3TT3L 3HE6B 2EDLA 3PQYA 1I9JH 1GVIA 4ZAKA 1UB5B 1J86A 4A6YH 5F8RC 5IJKA 2QR0B 5E0QA 5EC1A 1RJZB 2F15A 4KGLA 2FZ3A 5HPMA 3BP6B 2W9EH 1CK0L 4ZTPH 4MLSA 1FZKA 4ELKB 2V7HA 3CJJA 3VFSB 4NC1C 5EOQH 3MR9B 4JPWL 5EU7C 3E0GA 1ERNA 1DBAL 1RUKH 1MAML 1H3WM 5D1ZA 5CJ8A 2Z31B 3MRBA 3FB8A 4WW1B 5T33L 2OZ4H 2H3NA 1JHKL 1HQRB 3MRQA 4N0RA 3GIZH 1KPRA 3LKOB 4KRPD 4AM0A 5I9QC 1QKZL 2VIRA 5ITBH 1RZ7L 5TE6L 4HS3B 5F7NC 4XP5L 1F6FB 1MJUL 3DV4B 3BHBB 5HGAB 3VDBA 5CP7B 2WLYA 3RDTC 1AE6L 1DEDA 3UZQA 1T0PB 3K7UA 2W92A 2AEQL 2YPLE 5DS8A 5IT2H 3W39B 4PUBL 1YNLH 2ED9A 3J8F7 2DIAA 4IDJL 4ZAKD 3BPCA 4A6YA 3GSVB 3EYOA 2ARJQ 4Z7UB 4JZJA 4LLUA 5TH2A 4FFVD 2KZWA 2HVJA 2ENYA 1MJJA 1RHFA 1WCBB 4PJ5D 3QDHA 3KPSB 4ZUWB 2IPKA 1UYWL 2YOCA 1WFTA 3BIKA 3CD4A 3VXQA 1XF3A 3V5KA 4KTYA 2Y36H 4EUPH 3GFUA 4OZFH 3G6JB 2OZ4A 4HKJA 2GHWB 1RIVL 2YSSA 5D5ME 2EICA 1D9KC 1FSKC 2V5RA 5ADOH 4O51B 2DB8A 2JB6B 1E0OB 1T5WB 1EGJA 2OL3B 1MFDL 4NGHH 1DDHB 4UNUA 1PYWB 5I76A 4N0YH 2D3VA 3TNMB 2MQCA 1AR1C 4NQVA 1BPVA 3DX7A 1FC1A 4UBDD 3T77B 1OTTD 4F7EA 4P2YA 5DSCA 1ACZA 3LHPH 5E9DB 2EXWC 4OCYL 3DVGB 3LSOB 3VXOA 5I73B 4OZHA 4L1HA 4LIQH 5CUSL 5F44A 4OV5B 1K4DA 3X17A 4BFBD 4S11A 4AT6A 3T2PA 3FB7B 3MLUL 3UTSB 3MXWH 4QY8B 5ILTH 2HFGH 5EZIL 1G9NL 1I9RL 2BVPA 3DVNA 4OZFA 5B8CA 5BMFL 1JWUB 2APFA 3VD4A 1ZWIA 2CK2A 2VLLB 1EO8H 3SE9L 3BVNB 2OTWA 4HDIA 1BEYL 3BH9B 35C8L 3B8YA 3I2CL 1QRKA 3U0TB 3IJYB 2DLTA 1BJ1H 3SPVB 3KJ6H 3WDJA 1JHLH 4FMKA 5JXEC 3FB6B 4HCRH 1JBJA 4PLJD 1UB5A 4XTRD 5GGTL 1MQ8A 1KCUL 1RJZA 1GHFL 1Z0MA 4ISVB 1A7BA 1I7RB 3INUH 4NQSA 2FJFA 4K3JH 4XPTL 2BZDA 3RWDA 3VFSA 2RIKA 4J3XA 2ZCLL 5H2BA 1EEZA 1MNUH 5I9QB 2Z31A 1AXSB 1CT8B 1QSEA 4HXAL 1JVKA 1HQRA 1N59A 5IB3B 3LKOA 1KN2L 1B6DA 4N68A 4LRIA 2EC9T 3VGEA 4Q7DA 1JK8B 2X7LB 3TO2B 5KSVB 4X6DB 1I1YA 3RDTB 2GUOB 3SDCA 3GI8H 4OLWH 3RX7A 2QHLA 3D85D 5HGAA 4JN1H 4MZ3A 1FV1A 4CN4A 5CP7A 5EORL 5IBLC 3LKPB 4NQTA 1NMBL 4HCRA 3MLTB 5I8OH 1ZVSB 3E6FA 5HY9B 4NQCB 3DRQA 2VXQH 5DMKA 1YMMA 1J0JA 5IWLC 4KI5E 3FN0H 5M7QA 5KSUA 4MCZA 4GSDH 4XVUD 5HYSA 5D6DA 5A1AA 3BKCH 5D6CB 1WCBA 4Y8AA 2ZCHH 3LQAH 3KPSA 5ALCH 1RULH 3RBGA 2BRQA 4WHYH 1QA9B 3Q6GH 3HNTL 1MHEB 3L3GB 4S1QH 4NO2A 1D9KB 3G6JA 5E00B 4WFHE 1QSED 1FSKB 3Q48A 3S37H 4LCWD 4V1DA 2R4RH 1ACYH 1J9CT 2AXHA 1S7UB 4Y5VC 4UT7H 2DQCH 4NC0B 2DQGL 3MRLA 1KIRB 4O51A 3GM0A 4OCNC 2HVKA 5F7WC 3SDCD 3FT2B 1DDHA 1UG9A 2E7BA 4JQXA 4G5ZL 2I07B 3TO4D 2HRLA 3TNMA 4M6NH 4XPGH 4CRPA 3Q1SH 4MQXC 5K9QG 2ZPKH 5LGJA 2RHEA 4DUWA 1CBVH 5L8LB 4LLWB 3T77A 4U3XA 4AIOA 5J6HB 4EN3C 1IC7H 3DVGA 1YMMD 4UIKL 1MCPL 4P0DA 3JWDL 1IARB 5HYQA 4EBQL 3LOWA 3ZKXC 3FB7A 4GLRI 3D3VB 5C0JA 2ATPA 3UTSA 4QY8A 1S3KH 3F6IA 3AY4C 3ZO0A 3DURB 1JWUA 4R8WL 4HIXH 4R90H 4G8EB 5JZ7D 3C5ZC 5I1AB 5DYOB 3EYUL 3BVNA 2MCG1 1A3LL 4HWZA 4KMTL 3BH9A 1O5DT 1Q9KA 4V1DD 5DZNA 3U0TA 3IJYA 4KKBD 3FT4A 3MLZH 1ZLWH 3QRGL 4NM4H 2CIKB 2B8OT 2D7MA 1RUQH 1Q72L 4XC3L 4PYHA 4S2SA 4U2YA 2UV3A 1H3UA 3EZ8A 3TA3B 4YUEL 4JY4B 5CZXC 3MGOB 1EMTL 5E2WH 4HKBA 3U48A 3QEQE 4AMKH 1I7RA 1TZIA 2X6MA 5BCAA 1J0KA 3C87A 4UV4H 3T0VA 1HWGB 4F7TB 1S9XB 1AXSA 3WMSA 1CT8A 3QUKB 3QFJE 3S3SA 2P47B 3PWUB 5A3IC 3BP5B 4POZD 4YXHH 4ORZC 2HRPH 5IB3A 2WMPA 4O5LL 1E4XL 1VGEH 2QBWA 4HMEA 3CFEB 2UY7A 2X7LA 2ITCA 3ARTA 4PLKC 2JJVA 2IAND 1QBAA 2XNAB 3RDTA 1OARH 1QYGL 4XCFH 4FQCH 3QWRA 4Z7OF 1N64L 1KB9K 2Z91B 1NMAL 2OR9L 4NZTH 4OD3L 3U7WH 3WEXA 2XZQH 1F90H 4P4RB 1Y0LA 3FO2B 4XCCH 4MA7H 2GJ6B 4ZOEA 2EYRB 5CGYD 1CDIA 1ZTXH 3KWWB 5M94B 3H7BB 4OF7A 1MAJA 4OLZL 5IF0B 4YHIA 5B3JF 1PBYA 4QXGH 5CILH 4KZEL 1CIUA 3DPBA 3CMOL 2K1MA 5J1AA 1U42A 4P9ML 3CX2A 3QCUH 4QOKA 2AQ1A 3L3GA 5JORB 1ED3B 1D9KA 4Z7VA 1HK6A 1AJ7H 4Y5VB 4PJ9A 3KYKL 1OOAA 5FOBB 5C07E 4JCMA 1G7MB 1OGAB 2AW2A 1FNGB 2IAMC 4QF1A 4WI3A 2R8SH 1S7UA 2E3VA 2IFFL 4GBXD 4K8RH 5I8CB 1OCWL 4F3FB 5D93C 2MSPA 2ERJC 4OFYA 1ZHNB 4HWBL 2DKMA 2I07A 4EN3B 3R1GH 3LB6D 3L9RB 3PWPE 1MIML 4ZS7H 2GFBB 4CMMA 3VFGH 1F45A 5L2KE 2C3VA 4WHTB 4GAJH 2VLRE 1B0RB 4TUKH 1YJDL 3QEUB 4LARL 5J6HA 1AI1L 4CVWA 2VZUA 4RWHA 4U1LA 1OP3H 3ZKXB 4HUVB 4NPYB 3U0PA 1PLGH 4NP4H 2NXZC 2DTML 5JXAL 3ARYA 5JUEL 2OK0H 1B4JL 3C5ZB 3QO0B 4P2QB 3VRIB 1F2QA 4QOKD 5I18L 1RSFA 2X4QB 3PQYE 1DQLL 3G6DH 4PJ9D 5DYOA 5IFAL 4LGRB 3L5IA 4R96B 5JXEA 2Q7YB 2H32H 1CDJA 1PSKL 1KCKA 1AC6A 2EE9A 2F53A 1U36A 3QWQB 1ZLWK 1DP0A 5DD5L 2CIKA 3WUWG 3QIUC 1DLHA 5HHXH 5FUCC 4D3CH 1CLOL 4HIHB 1UT9A 3MLXL 1Y6KR 1I8KB 2EXWD 3G5XB 4AEHH 4Z7OE 1UWGL 1KCLA 1NFKA 2FBJL 3TBWB 3MGOA 3QP3A 4GW4B 3H3PL 2YRPA 4MNGE 4Q9RL 3MA9L 5A2JH 2G60L 4PGEB 2P4AB 5T5FL 3PXHA 2QEJA 1BLNB 1T22B 2FX7L 3Q5YA 3PWUA 1EDQA 1RK1B 3BP5A 1N0XL 5B3JE 3QJFB 5C6TH 3VXRA 3LMJH 2RFXB 3RA7H 4CVUA 4NT6B 4DN3L 1T2QL 1YN6B 3WE6A 2BJML 2YD4A 5DQ9B 1R24B 3C2SA 2ICWB 3VXTA 3V6BR 3BX7C 3B6SB 2XNAA 4LLQB 1HHIB 4YHZH 4TVPH 1M7DA 4L4TA 3PWLB 2Z91A 4K8RD 4KKLC 1REIA 2EDJA 2F53D 3D18B 4BUHA 2D0GA 2L4OA 5DJ8A 2GJ6A 2EYRA 3SDYH 3VXME 3DNKA 4H1LG 4WEBL 2VKXA 1FZMA 2MKWA 2RR3A 3H7BA 3MRMB 4WHCA 4YIQB 3U7YL 4OF8A 2OXGA 5K59F 3U83A 2EDFA 5D1QB 5C0BB 4MCYB 5DD6A 3C8HA 1A6WH 1KCVL 5EOCJ 3MUZ1 4NCDA 5FO9A 1MRCL 3RY4A 3SQOL 1G0XA 2C1PA 4P48A 1VADB 1JYWA 1HEZB 4NSKB 5L7XH 1KT2A 1ED3A 2IAMB 4KY1H 5JW5B 1D5MA 4Y5VA 3MV01 3BDBA 4OFDA 4Z7UF 3ZKSD 2EDXA 3VXRD 3DGGA 3WV0A 1OGAA 5D93B 2IH3A 2YK1H 4U1JB 3MRHB 2ERJB 5D2NE 4E41E 4ZD3H 1RVFH 5D96C 1RZJH 4WEUD 5FUOH 2HG5B 4EUPG 4QT5A 2XKNA 3LH2L 1ZS8B 4F3FA 1MFAL 8FABB 5IBLD 3G6JF 5ENWB 4NFBA 4EXPX 5GZOC 2H8PB 4L4TD 4PJIE 4EN3A 3L9RA 2GFBA 3S6CA 3RI5F 4AH2B 5IKCB 3EJZD 1AD9A 1N3NA 4WHTA 3NA9L 3QEUA 3I75B 4K2UL 3CSYB 1G7JB 1WIPA 2NXZB 4M7LL 2YRZA 5KANI 2FO4A 5AWNH 4HUVA 4NPYA 4JRXE 3SKMB 3R0NA 4EDWL 1D5BA 1IM3B 3MOBH 1NGPH 2CPCA 4PD4J 4RGMC 3VDCA 3IDMB 5T1LA 3QUZC 3C5ZA 3BUTA 1E4WH 5KN5B 4OF5A 4P2QA 3VRIA 1I3RB 1P7HL 4M5ZL 2W0KA 3VFMB 2ADIB 4HZLA 5D7JC 3RPIB 2UVEA 4R96A 5GGRY 4TRPH 3DYPA 3QIUB 3UTZA 3HMXH 1INEL 3N85H 1XMWA 5C8JB 1RMFL 4F9PA 4HXBL 4X0KA 4DGIH 4HIIB 4OTXH 2BK8A 5FYLH 1O0VA 4HIHA 3QUYC 2PN5A 1FLRH 5JHLL 1I8KA 3G5XA 1ZT1A 4YDJB 1CGSH 4M03A 4AIXA 1TETH 1R3HB 1XGPA 2GAZA 4Z9KB 1IGTB 5IHUL 2AABH 5DWUH 3ULUL 4PGEA 2V6HA 3MCLH 4HJ0C 4BKLA 2RCSH 1BLNA 1T22A 2XA3A 5AD0B 1MLCA 1RK1A 4KH2A 4YX2L 3FN9A 2QQNL 5K59E 1WLHA 5DDHB 5T1LD 4NT6A 5HHOA 4F58L 3WKML 3AU1B 5B21A 2CJUL 1H5BA 1R24A 4GRMB 3B6SA 3IDGB 4ODXB 3VA6A 1KGCE 1HHIA 5IV2B 4R4ND 3LS5H 4RAUB 4H5SB 3HMXA 2DQUL 4W68A 1INDL 1EO7A 4TULL 4Z7UE 3W0WA 3D18A 3NCYS 3OBAA 4MLIA 3VXPB 2O5YH 5C70A 3KPSE 4X6DF 3QDMB 4H20H 4KVCL 1SEQH 2FWOB 3MRMA 3PGFH 2H1PL 4CJ0A 2WIIA 3IB4A 3GSRA 5FYKE 5C0BA 5A16A 1KF9B 2PW1B 1MEXH 2V5SA 2FRGP 3WS6C 3DX9A 1BVKB 4Q9QH 2AQ2A 2XZAL 4ONHA 1DBBH 1H3VA 2IAMA 5JW5A 3H3KA 3BH8B 4PP1C 3TYFA 3ZYJA 5D96B 1MCIA 5FKAB 1OQOA 2VR5A 4YEEA 2R0ZH 3MJ7B 1LP9A 5HHOD 2VXSH 3B5HA 3O3UN 4U1JA 4OLVL 3MRHA 5ESQB 3NACH 4OM0H 2NYYD 5E9DE 3IFOB 3VD5A 1ZS8A 3ELAT 3GSWA 3QULB 4OQTH 4Z7VF 2G2RB 5ENWA 3S3JA 2XI9A 3TNNA 1NLBL 5D7SL 1NDGB 5J56B 2B5IC 1L9NA 3W0WD 2VL5B 1G7IA 1JTTA 3V4PH 4AH2A 5KBNC 4M6AA 12E8H 1NGZB 3D0LB 5GRVK 1CXIA 2NX5D 3OB0K 3TESA 3I75A 1IAIM 3WFEH 4PTTB 1G7JA 5FYLD 5E8NB 4RGMB 4HWEH 3VMNA 3QUZB 4RFEA 3DJ9A 3SKMA 3BKJL 1QQDA 1IM3A 2FJGA 1IKNA 3EFFA 3SGEH 3IDMA 3GSNH 3OG6B 1ZHKB 4RDQG 4WFFD 3ARGC 3QJHB 3F6LA 5D7JB 5DLMH 4YXKH 1T89C 4WUKL 3JZ7A 5BW7A 3MCKB 1I3RA 3QDJB 4ELMB 4NNPH 5ADPL 4DUXA 4DGYL 3VFMA 2ADIA 4K94C 4KWUA 3RPIA 2I9TB 5EB9A 1NEUA 5EU7E 4WFEE 3QIUA 1H3PH 3MTRA 1P4LB 3CFBB 3QUYB 1JGUH 3EOTL 5C8JA 4OQTA 1D6EA 4ODSH 1F4AA 3WFZA 5IMLB 5DJ6A 2VDQL 1A14H 1UM5L 4CVXB 3QFDB 2EIBA 5ISZB 1HNFA 3NFSL 4FABH 4YDJA 1T1YA 3KDMB 1R3HA 4H0IA 5IQ7L 1IGTA 3OKMB 1U95B 1U8IB 3VA2C 4OUUB 4X6DE 2X09A 5FB8B 2WWKT 2DQJL 2YWZA 5F9JB 1BWWA 4JFOA 5BV7B 1HXYB 4FQ2L 4LCUB 1QLFB 5EZOL 5CINH 3S7GA 2CIIA 3AU1A 1PKQB 2R0WH 2B1AH 3GK8H 3R06A 5FUZH 5CGMA 4XBGB 3SKJL 1CGTA 4GRMA 3GBLA 4NQCE 5IVZA 3IDGA 2KPNA 4DZBB 5IV2A 1TENA 4FFWD 4H5SA 2BSSB 3STZB 4X6CB 1FYHB 2V5YA 4XVJL 3BDYH 3P73B 3SJVB 3QDMA 1OLLA 2FWOA 2YUXA 4RIRB 4MQ7B 1A6TB 3SKUD 1H0DB 4E5XB 1P53A 4DTGH 1X5HA 4UV7H 1FZOB 5IJVA 4KTDH 4JDZB 3QEGH 4R0LC 2VDPH 3TJEH 4QKXB 2I24N 3BI9X 1X9QA 1T03L 5DMIH 2EDEA 3QAZB 4U1MB 5E1HB 4HK3N 2BERA 4J7RA 3VD9A 4U33A 4EDXA 3BEWA 4MVBC 3THML 1I1CA 4PR5B 2NLJA 3BH8A 1UJ3C 1A02N 5FKAA 3NFNB 4J12A 1UZ8B 4GUPB 3MJ7A 1QRNB 4XMKL 3QYCA 5ESQA 1EHLL 3MMEA 3MC0A 3SN6N 4Z76B 2YMXH 2B5IB 3VI4F 4W81A 4KK5D 3IFOA 3HTLX 3PWJA 4LCYB 2G2RA 5FOJA 1YECL 3ZHDA 4KQ3L 1SVZA 1CFTB 5BVPH 4LLDB 4QO1A 1NDGA 1E6JL 3H8NA 4WCYH 2AK1H 2B0SL 5GS0L 4R6UA 1XR8B 1G9MC 1NGZA 2AXGB 3KLDA 2PO6C 3D3VE 5FGSA 4PTTA 2Q8BH 2VH5H 4Z8FH 3OKKB 3GHEH 1MOEA 2OMNA 2CO7B 3ARGB 3WFHB 2PYED 3UJIL 2VUOA 2ZCKL 3TPUB 3H2WA 1NCWH 2BVOB 2PCPB 2D0FA 4HUKB 3GJFH 5DFVC 1ZVHA 1IAIH 4LU5H 3QJHA 5C0CB 5D7JA 3P30H 4RRPA 1KLUB 3WUWB 1CFVH 4HS8L 3QDJA 4ELMA 4RGOL 4NM8H 5CWSB 3QG7H 3TCXA 2I9TA 1A7OL 3RIFK 5F97E 4GAFB 4B0MM 3EW3B 2NY5L 4P5KB 5EN2B 1YN7A 4D9LH 2OM5A 4LKXB 3CFBA 3HNSL 3QUYA 2C5DC 1DJSA 3P9WB 4YK4B 4BM7A 1JTPA 4KRNA 1MCHA 2OSLB 3FB5B 4YGAB 1MWAB 5SWZA 5IMLA 5I8KH 1LDPH 1NGYB 1K9TA 3OR6B 4JJHA 5T3XL 4XP9H 4XNXH 5H35B 4CVXA 3HS0B 3NCEB 5ISZA 5DRXB 3KYOB 4JHWH 3KDMA 1FL5A 2FX8L 3WHE1 1CFQB 3V7AG 3OKMA 2C1OB 4WI7A 1KLGA 3QNZB 1U95A 3UBXA 1U8LB 3SE8L 3CH8A 4PJBB 4TTGA 3GGWA 4KJPC 4J3WA 4J1UB 3GJFA 1HXYA 4LCUA 3V95A 1HHHB 1QLFA 1TVDA 1OAQH 5JOPE 3CZFB 1DN0A 3WXVL 2A0LC 4XMLH 5D8JH 4HFUH 1KEGH 3BRGC 2GJ6E 4XBGA 1I85A 4H1LB 1IEBB 4BQCA 5D7LE 5C1MB 1P7KA 4DZBA 1YC7A 2XV6B 5JIIA 3D5OF 2BSSA 4XNUL 1R6VA 1X6NA 1ZT7A 1WWWX 4X6CA 2DQFB 4Y1AD 1YUHB 1OAYH 3D2UB 1GZPB 2DBJA 1JZ7A 4I3RL 4U6TA 5DJAA 5SWZD 3NTCL 3MGAA 3VI4E 4PRNB 2AJSH 4G9FB 4RIRA 1S7SB 4MQ7A 1A6TA 4MAYC 3QWOB 1H0DA 1RFDH 3WS6A 5B3NA 1WZ1L 1A7QL 2VLME 5ISZD 4YHKL 2EIZB 1FZOA 5GRUL 5IR1B 1BOYA 4PJEB 1OGAE 2I25N 2DRUA 3O3AB 3N0PB 3LEVL 1UJ3B 2A1WH 2PXYB 3TBYA 1IL1B 4U1MA 1HKLH 4EUPB 4OLXH 1WEJL 3T0XA 2GEEA 1JI1A 5DC4B 5T1KB 5CJXC 4ONOA 4MXQD 5DHVB 1UZ8A 1D6VL 3GMNB 5F96H 1QRNA 1U3HC 4WU5B 5F3HB 4MZ2A 4PREB 2W60B 4F80A 2FB4L 4ZO7A 2DBLH 3TCLB 4Z76A 2P5ED 2NPLX 3DTXA 3LEXB 4LCYA 5F1OB 5TQ2H 4PLOB 2PO6B 4LLDA 4G6JH 5LXGL 2ITDB 4I3GA 2LV4A 2GTWB 3B9AA 1QBML 4N5ED 2AXGA 3ZKMC 3DXAB 2JIXD 1YEJL 3E6HB 5MHSE 4P2QE 5E1AB 4YFDB 3DROB 3OKKA 2ZUTA 1XGTA 3WFHA 1T89A 2CQVA 2W65B 3TPUA 2IFGA 2E6PA 3KGRA 3MCG1 3CU1A 1B4RA 5GJSH 3QHFL 4EQ3A 5C9JA 1WSST 4FQHA 2H2SC 1VEPA 1KLUA 3EFDL 3LKSB 5DI8B 3IU3B 5CWSA 4PBVC 3KYMA 5J7CC 5DJ0A 1X4YA 1HINH 4XPHL 1AP2A 3H3BC 3C6SA 3B9DA 4W70A 5DHYB 1GH7A 5ETUB 4FG6D 4XHJD 3DYMA 4XVTL 3N1FC 2CRIA 4M3JA 3REWB 3FB5A 1MWAA 1PEZA 5EOCL 1NGYA 2EYSB 2VR9A 3HA0A 5I1HH 3IXTB 2NXYC 5H35A 3OV6A 5DRXA 5LVEA 3KYOA 1IM9D 4TOYL 2WW8A 4RISH 2AP2A 1CFQA 2C1OA 1KB5B 1FDLH 4MJ6B 1U8LA 1T1ZB 3O2DA 5JHDE 5CEYA 4PJBA 5FCUL 4I3SL 1YDPA 1AO7D 3RTQD 1FG2A 3RAJH 3SCMC 1R3JB 1IMHC 3MPCA 3GSXB 1B2WL 5D9SB 5C09A 1XF4B 3LD8C 4N9GA 2JB5L 4H1LA 1IEBA 1YQVH 4Z78A 4R3SB 2MQ3A 2DI7A 3SDXB 1BBDH 1AHWC 4P3WA 2UWEA 3T04D 3O3DA 5C0BE 3B3IB 3S35H 5GGQL 4ACPA 3ULVC 4K3EH 1YUHA 5IW6B 3D2UA 1UM6H 4HUWA 4MAYB 1FAIL 4NO0B 2OTUB 3BW9A 4PRNA 5F7HA 1CI5A 2QQQA 3JV6B 5ECJE 4FN0A 4R0LA 1S7SA 5DJCA 3QWOA 3FFCA 1MFCL 3VG9B 3HG1B 4PRHB 3RVWD 5IR1A 4DFHA 1TCMA 4OCLC 4JDTH 4D8PB 1IGJB 1UJ3A 3TV3H 3IKCB 3RNQB 2Y25A 3V0VB 2VDRL 4PRAB 1RZFH 1W72B 1NAML 2FATL 1Q1JH 1U3HB 4TUJB 5T1KA 4N8CH 1JPFB 5CZVH 2R0KH 2YPKB 4LCCB 2A9MH 1QG3A 4O2CA 1XGQB 4WU5A 5DF0A 2XYCA 5F3HA 3QCVH 2W60A 3LPFA 5C09D 3QDAA 4OZIB 5EOQL 2HJKB 2YC1B 4QHKJ 1RUKL 4ODBD 1NCNA 3LEXA 1MF2H 1WT5C 5E5UB 2PO6A 5FECB 3ORJA 1AKJA 4OCRH 2EDYA 2OZ4L 2ITDA 1DE4B 5D4QA 2LU7A 4OB5H 4OFKA 2R1WB 1KTLB 1CR9H 2EO9A 3O9WA 3DXAA 1V3KA 3OSKA 4TQEH 2WIMA 3E8UL 5E1AA 1JUFB 4ODHL 1DUYA 3DROA 4HPOL 4FQJL 4K7PH 4O2EB 2FHFA 3FFCD 1EAJA 1JMXA 1EGJL 5IB4B 2YZ8A 5IEKB 1XGRA 1CGXA 4C4KO 2ICWJ 4YZFF 4OV6F 3NABH 4BUGA 3D48R 4G9DB 2VDLL 3OAUH 2Y06L 2XTJC 3GKWH 3LKSA 2X4OB 3NCYP 2AJXH 1U3ZA 4JM2D 3MRDB 3VFRB 5I66A 3C8DA 1J12A 2I5YL 4FP8L 2X05A 1KLFA 3RZWA 3VRLF 5HI3C 1GGIH 3VCLA 3UJTH 1TTUA 4KK9C 3JUYA 4HWUA 4GRLD 2NXYB 1TZHA 3OKDB 4K9EC 4U0RC 3IGAB 2VERN 4P2RD 3RIAK 1PX3A 4ELMF 1I8MB 2EYSA 1AKJD 1T21B 5IVXB 2QKIB 5AUMB 3R0MA 2K7QA 4OJFL 1U8HB 3VWJA 3O9WD 4DZ8B 4U1HB 3ZT5A 3ZE1F 5FGBC 5KG9B 5ADOL 4RMSA 4APQC 5JIKA 4C56A 1HDMA 1ZEAH 4Q0XL 3SCMB 2P8LB 4ODVH 3MNWA 2JK5B 1CDBA 4XXCC 1R3JA 1PFCA 4MNQD 3GSXA 1AHWB 5C7XL 1XF4A 1WUNT 1A6UL 3STBA 4XC1L 5HYJA 5IGXH 3QDME 4R3SA 2IBBA 1RV6X 2VQTA 2EH8H 2BX5A 4PJHA 2X4NB 3B3IA 4U0QB 2G75B 3VG0H 1HHKA 1S78D 3EYQC 4X4YB 4W4OC 1P7QD 1RUPH 4ZUTA 3QNXA 4NO0A 2WINA 4AG4H 4HPYH 3DO7B 2VDKL 5EFIB 4GFTB 3W11C 1HH9B 4E0RB 3P3YA 1DCLA 4PRHA 3BGMB 4EI6B 5F9OL 2J4WH 3MBEB 3VWJD 4X6CF 4KC3B 2YHGA 5KSBB 1S5IH 4JFPB 4JO3L 1IGJA 4BZ1L 3DARA 3B9KB 4C56D 3IKCA 3RNQA 3X14B 1RIHH 1W72A 4HCRL 2Y07H 3ZTNL 3L7EB 2DMKA 2HFFB 4HAFA 5D1XC 4NUGL 4Z5RB 2R2HB 1JPFA 3C09C 2A0LD 1CFBA 3A6OA 2DQHH 4M1DL 3V4VH 2BVUA 5TQ0L 3MLVL 4K3JL 4YZFE 3KJ4C 3V5DA 2KDGA 2HJKA 1NCBL 5HYJD 2FGWL 3QG6B 3L95B 1M1SA 2P8MB 5C0EB 4OF3A 5FECA 3QEHA 2Y5EA 4UTAH 4EI5D 1DE4A 5FYKL 2Y4SA 1GGBL 4L1DA 3VRLE 3VFOB 2R1WA 1RJCA 1E4KA 1EVTC 5GJTL 5C2BH 5EU6E 4ENEC 4OSUL 3QDJE 4IOSD 5GS3A 3GI8L 2KH2B 1LD9B 3SEPA 1MFBH 5CKGA 5IB4A 4NHUA 2XTJB 3QHTC 2CGRH 4KRMB 5F7EL 5IEKA 5IROA 5LAXA 3TC9A 2LABA 3IXAB 2ICEA 3LZFL 3PNWB 3I84A 3MRIA 1SM3L 4UDUB 3WLWD 4M1CC 4OFPA 1QBLH 1U92A 1Y18B 3UBXI 3HKFA 1NH6A 3T08A 3AFLA 3MRDA 1WWBX 5SX5K 4JPIB 4RAHA 4U0RB 4GMTH 3T2QA 2IPTH 3MV7B 4I77L 4MWFB 2QQLH 1PD6A 3BIBX 3ZDZF 3OKDA 4WO4C 3ZDYF 3B5TA 4NN5C 2Q20A 1J8HB 4ZXBC 1I8MA 1DQQB 3CAFA 3GKZA 3Q6GL 2GJZA 4S1QL 4UOJA 3FONB 5BS0B 3MV9B 3TFKD 1T21A 5IVXA 5LBSL 3SGDH 3WHXB 4APQB 1QD0A 1U8OA 2WUCH 1F02I 5SWQB 4R26H 1U8HA 5CLTA 1CFSB 1ACYL 1KTRL 4NYLA 4DZ8A 4FXGB 4UT7L 1BX2A 1PKQE 5KG9A 3FCTA 4LSUL 3SCMA 3KPLA 1FFQA 2P8LA 4XAKD 3T0ED 4HW6A 1B0GB 2JK5A 1TJIH 4Y4FA 1DVFC 3BO8B 4M6NL 2ZJSL 4HH9B 2AJUL 3WNOA 1AHWA 5JW4M 4NZDA 3MOAL 1IQDB 4U1SA 3SJVE 3F5WB 3PDDA 4PJBF 3KS0H 3X3FL 3FHQA 3L3OB 3IU4L 5F7KC 2F8VA 1SJEB 4KTEH 5I75C 15C8H 4JGMA 4JQIL 5IW1B 4JQVC 2G75A 1DSFH 3TT3H 4WTWA 2NXYD 1S3KL 4NQDB 5DRZA 3MJ9H 4L8CB 3HPLA 1CE6A 1IC5L 1MH5B 2VQUA 3DO7A 2XWTB 1MCRA 5GGSY 3BQUA 4JLRA 2NY4B 3K4ZA 1HH9A 1FJ1A 3F7YB 5HI5C 1KELL 5H37H 3CDGB 5C0GB 4KDVA 1QRNE 1U8QB 4JFPA 1DBAH 1MAMH 5FDYA 4WTXA 4NM4L 4XCYB 2HFFA 1J1OL 3L7EA 5T33H 2DOCA 1JHKH 2R2HA 3KJ4B 4Y4FD 2MPAL 1QOKA 4NC2B 5JDJA 1MHHB 4QEGA 3ARXA 1U3YA 4NQEB 1QKZH 1UB6B 5E2WL 2DDQH 1JP5A 1FVCB 4DKEL 2O93L 2IBZY 5I16B 3O8XC 1RZ7H 5TE6H 3FTGB 1C7SA 4XP5H 1BZ9B 3QG6A 1MJUH 1RI8A 3L95A 4HK0B 1A5FL 2R2BB 2BXYA 4RA0C 1AE6H 1WBYB 2AEQH 3HPJA 1MCQA 4PUBH 3P77A 1WJ3A 4IRZL 4JKKA 4IDJH 5DURD 3BISA 3MJ9A 3CPLB 2DICA 4GKNB 5J9PA 4JFDB 5C0CE 3I3DA 3ZDYE 2EEBA 3FZUD 1T04A 3ALWA 4WUUB 1OARL 5ITFB 4FQCL 1LD9A 3BQUD 3ARBA 4LLMB 1UYWH 2YXMA 2DLFL 5F1KC 5C08B 1BFVL 4UDUA 2EZ0D 5ESAB 1NC2B 2WP3T 1Z9SA 2D03L 1Y18A 1WIOA 5ESVB 3O11B 1V7NL 3RVTC 1FVEB 1Q0XL 2BY0A 3EYFA 4LPVA 4ZXBB 5DD0L 3SGJC 4MWFA 3MV7A 1OY3B 3IJHA 2QSVA 1EJOL 1JGDA 3HC3L 1MFDH 2F5AH 1J8HA 1DQQA 3QCUL 4JRYB 4P46C 3FONA 3HB3D 1FFRA 4O9HH 5BS0A 5FFLA 3DSFH 4U6XB 4APQA 4F15C 4M6OL 5SWQA 3OMZA 1CDHA 4OFIA 1SBBA 4J6RL 4FXGA 5F1IB 3KPNB 5DEFB 2CUMA 1IZJA 1J1XL 4U6YB 3I85A 4XXCA 3T8XB 5CUSH 4XBPB 3O2WL 2GITB 4EJ1C 1MCKA 3ARBD 3MLUH 1I8IA 2BSTB 4LCIL 2B4CH 1PJ9A 4U3CA 1G6VK 1G9NH 1I9RH 5EZIH 5BMFH 2AJZA 5I75B 2GCYB 3ZE2F 1IQDA 1GGYA 3SE9H 3FT3A 4KK9D 3L3OA 4W4OA 1PLGL 1AXTL 35C8H 1SJEA 3ALXA 2MWCA 4G9FE 1LEIB 2L0DA 3I2CH 4GXUM 5IW1A 5A2FA 1AFVL 5E6IA 1IAKB 4PJEE 3LVEA 4QGYA 4LASL 3CH1B 4PY8I 1GZQB 4L8CA 4PY7B 1J8HD 5JTWA 5GGTH 5JNYB 1OM3L 1XT5A 4MD4B 1MH5A 1HXMA 1KCUH 1UVQA 5F88B 5C9KA 3SDXF 2XWTA 4MQSB 2XA8L 1I1AD 1GHFH 3IDNB 4PJHF 4APQD 3RUGA 4XPTH 3STLA 5C0GA 1LQSR 1QFOA 5D1XA 4NCC2 4LSRL 2W0PA 4HWNA 3VFVB 4HXAH 4OBSA 4YBQC 4XCYA 4S1SL 1I7UA 2VABB 4YBLC 1KN2H 3O8XB 4LSPL 1TMCB 3VWKD 4QRSA 1QPXA 3BPLC 3IVKB 1NDMB 1UB6A 4HQQL 4FNLH 4LPUA 4QXTB 4K7PY 1FVCA 3VFUB 1NCUA 4PTUA 3WDHA 5I16A 3DXAE 5C6PB 1ZA6B 1FQ9C 5AZ2L 1BZ9A 4LSSH 2ZUUA 4MNHB 5TE4L 4I9WE 2J7LA 2Z35A 4HK0A 2DYPA 1MAKA 5ID0B 5EORH 1JZ8A 1WBYA 4D9RE 43C9B 1NMBH 5C6TL 5E6ID 3RA7L 4HFWA 4KKCC 1FFPA 3OAYK 2ENSA 5E6ZA 3CPLA 3ARFC 3W11D 4YHPB 4Y2OA 4JFDA 3GMQB 3W82A 3VFWB 4UQ2B 4YNYB 5T3ZH 4YHZL 3GMMB 1BFTA 3EYSL 3UTQB 3AS2A 2C3XA 4LLMA 5MEQA 2Y7QA 1NEZA 1IGIH 5D1XD 4N90E 2F58L 4PJ8D 4RDQF 3TIDA 2DJSA 1TIUA 3M1BB 4LEXL 3AB0C 3HNTH 3MLWH 3MRKB 5ESAA 1JCKA 3SDYL 4LLVA 4YFLI 3I6LD 4YE4L 2NY3D 3MYZA 1HN1A 4B5EA 2BVEA 1FFNB 3Q6FB 5ESVA 4WO4A 3V6ZB 1KJVB 4TNVF 4ZXBA 1JV5A 1ZAGA 1V8HA 4HUNB 1F4WH 4P46B 5B38A 3RVXC 5AG8A 2HT2C 1P6FA 4X7FC 4F15B 4JO2H 4IIQC 1Z0NA 2DYPD 4G5ZH 4DKAA 2H9GA 4XMPL 1TTGA 2KZ1B 5INCB 2NMSA 4F7CB 4U6XA 4ENED 3ZTJH 4LPWA 1EA9C 1ZE3C 4F57L 2R1YA 2YK1L 1T3FA 4ONGL 5GRJL 3KPNA 4UIKH 1DVFA 1MCPH 2NW2B 5DEFA 5I8EB 5IMKB 2O5XH 3JWDH 4XBPA 5BVJA 2HT4D 3SDXE 2JJTC 2Q7NA 5IVXF 4PFEA 4R2GC 4M1CD 4EOWL 2EIEA 1E6OL 4KJWD 4KZDL 3B2UC 1I9IH 5F6HI 4R8WH 2VDNL 1YEEH 4JQVA 5IESL 2P5WD 2I9LB 1A3LH 1MREL 3ROOA 4KMTH 5DVMA 1BZQK 1FAKT 5KVGH 4WO4D 5TPWL 5E08L 4FQPA 1AR2A 4ZXBD 3HG1E 4PRHE 5JLZA 2BY1A 3QRGH 1IAKA 5DVNA 1E4WL 1DANU 4XC3H 1Q72H 1GZQA 1U6AH 4PY7A 5JNYA 4MD4A 5F88A 4YUEH 1S9WA 3ULVF 2IANE 1EMTH 4AEIL 4F8TA 3IDNA 5K9JL 5LWYL 4TUOA 3JXAA 4JE4B 1QR1B 4A2MA 1PZ5A 3HMXL 3ARQA 1A2YA 4YBLB 1DVFD 5IW3A 4IOFC 4OZIE 5T3ZD 3VFVA 2X89A 3HCVB 3BPLB 1BGXH 1Z6JT 4O5LH 4PJGB 3BZEA 1U41A 3O8XA 3VU2A 4WY7L 2DI8A 1E4XH 1HOCB 3H0TA 3IVKA 5KSBF 5ICXA 1U0QA 5C0FB 4M4PA 4X98A 5IMMB 5DMGC 1QYGH 3H9SA 1IEHA 2BC4A 2XWJA 1UH2A 1E4JA 2DM4A 3CFCL 5J6GB 3CK0L 1NMAH 2OR9H 3PGDA 4OD3H 5KAQG 3ARFB 43C9A 5HDQL 1SVCP 3NIGF 2FEDD 3QCTH 4ZFOB 2X4TB 3DSNA 3E3QC 4UI2A 1YY9C 4Y2DC 4CNIB 3Q3GA 4FFZL 4FQXC 4YHPA 4OLZH 5HI5D 2HLFD 2V9QA 3VFWA 4UQ2A 4NBZB 1BBJB 2A9NH 4KZEH 1RK0B 3I9GL 4JPKH 3AB0B 3AC0A 2DLEA 5AYQA 1D5ZB 5I1GL 4PGBB 3CMOH 3RNKB 3VXUD 1EFXD 4P9MH 5A43C 2O5YL 1X44A 4JAMB 4JFHE 4RMUA 2X89D 4JY5L 1KB9J 3MRKA 1WFUA 3KYKH 1IJ9A 1X7QB 3LKRB 1T83C 1WZKA 1CDUA 3DVIA 3SGJA 4MB3A 1Z5LB 3ISWA 1GSMA 2WUBH 1OWRM 1FFNA 5E8PA 3V6ZA 5IVXE 2IFFH 4IIQB 1GOFA 3KPRB 1QSFA 3F12B 1OCWH 5CJ5A 3H9SD 4Y4HC 4HWBH 2VE6B 2A74B 1F8TH 4X6FB 3DUSA 5J12C 4G8GA 2J1KA 1MIMH 3D0VA 2BNQD 2OX5A 1VFAB 4F7CA 2X1OA 5I1CL 1OTUD 1YJDH 4LARH 2VXSL 3PHOB 3UC0L 2C3GA 2WBJC 2ZNXA 2A6JB 2NW2A 4R2GB 5I8EA 5KJRL 5IMKA 4CU8A 4KK8C 2BVQA 3OZ9L 2OQJA 2DTMH 5F93C 3ULVE 5JUEH 2RBLA 1B4JH 2XOTA 2YZ1A 4JFYA 1MQKL 5C0RL 2Y9RT 2DTSA 3N06B 4GH7B 5I18H 1O7VA 5IFAH 5L88L 4LQFL 5MEOB 1L0YA 1PSKH 1MI5B 2WZPD 1QSFD 4F7PB 5DD5H 5F1NA 1IGCL 5KSBE 1J0YA 3VRJA 4DGVL 1CLOH 5EG6C 1A1OB 3HI6L 4ETQA 3VFTB 3IAPA 3MLXH 4G6KL 4NNPL 4G8GD 5MEND 4NQUA 1UWGH 4Z77A 2FBJH 3H3PH 5FKPA 3ABZA 3MROB 4OZGA 4Q9RH 3MA9H 2G60H 3NIGE 3EDJA 4GT7A 1F97A 3RWHB 5I1LA 3IDIA 1BZ7B 4XNQA 5EPMA 2FX7H 2B39A 2ZOKB 4DJMA 4OCSH 1N0XH 3UTTE 1QR4A 4PJGA 5CFHA 4DN3H 1T1WB 1T2QH 2WLZA 4N9OB 1HOCA 1N6UA 2BJMH 1INQB 3WKNA 5GGSB 5EO0B 4WNQA 4QRRB 3V52L 2A6IA 3KPOB 3P2TA 1FZJB 3RGHA 3TIEB 2IGFL 4ZS6C 4Y2DB 5CP3H 2VZVA 5J6GA 1VFBA 3OTTA 1NCTA 3T2OA 2IF7A 4ZFOA 3DUUB 2X4TA 5EBGA 3OXRB 4XCEA 4PJFB 1JNNL 3P9LB 4WEBH 1S9YB 1MCSA 3TEUA 5CJQL 5FUZL 3U7YH 3MRNB 3FOLB 4YC2C 1RK0A 3N9GL 1BFSA 3O81A 4ZUSB 1D5ZA 1MRCH 3CUPB 4PGBA 2VYRE 4YBQD 3RNKA 3SQOH 1FO0B 4XAWL 1T7XA 3DMMA 5F7DB 5J11C 4JAMA 3BDYL 4PGJA 3V7AE 5EUKA 1X7QA 4P3DB 1HSBB 3GEWB 3B9EA 5BS0E 5GGUA 3MV9E 5JDSA 4S10A 4Y4HB 4IIQA 2IWGA 3CVHB 4MJ4A 3BP7B 5J12B 3F12A 2VDPL 3LH2H 5DEGA 5HTSA 1MFAH 4LMQE 3QXUA 4IMKC 3GNMH 5CP3A 2VDOL 2A74A 5ACLA 4J8RB 4L8DB 3T0WA 3CX5K 1NC4B 2XTLA 3NCJL 1PVHA 2WBJB 1ZKAA 4YDKL 3DYOA 1VFAA 2Z8SA 3DGCR 3QDGB 2DLHA 4KK6C 3LIZL 4GKZA 3NA9H 4CDGC 4K2UH 3PHOA 1IGFL 4XCNB 3ARZA 3T0BA 4M7LH 2JJTA 3O6FC 3D9AL 3NIDF 3QXDA 4RSVA 4EDWH 3VXNA 4NZRL 4P23C 4TVPE 3TBTB 4DOHB 1HYSD 4N8VA 4JGUA 1ORQB 3DMMD 3JV0A 3MUY1 4WIQA 3FRPA 3MGTA 2NR6D 2Q8BL 1LO2L 4NQDE 1NGWB 4MJ5B 1W2KT 2D7OA 5MEOA 4NFCA 1INEH 2NZ9C 1MI5A 1NCWL 1QNZH 1U2HA 4OCWH 1RMFH 2XACC 3CLEL 4HXBH 5F89A 3AVEA 3EHBC 2CDEA 4R7NB 1FORH 1AD0A 1QEWB 2ATKB 3C6LA 3VFTA 3RVUC 5JHLH 3D39A 1WICA 1HHJB 1KBGL 5DR5L 3AMLA 3OR7B 3QG7L 5C0NC 1FL3B 2J6EA 4KI5C 5IB5B 5IHUH 3ULUH 2MCPH 3FFDB 3QI9A 3WHE0 4NQEE 2FCBA 5DJZA 5A40E 5HSFA 2J88L 3RWHA 4MJIA 3NFPB 1BZ7A 3KPQB 4HUXB 5FM4A 3MRJB 3F62A 5D5MB 3DETC 5I8KL 3TGXA 4YX2H 2QQNH 2A73B 3WUZA 2CK0L 4F58H 1T1WA 3WKMH 1A9BB 2VJXA 4JHWL 2CJUH 3BP4A 4Y16B 3O3EB 5EO0A 3PV6A 4QRRA 1V3LA 2QSCL 3HZKB 3MLSL 3MO1A 4J3UA 1CVSC 4NNXB 3KPOA 4JFDE 4M43L 1FZJA 2VLJB 4WUUE 4Y2DA 5FDWB 2DQUH 1INDH 1K8IA 4FQXA 4JDVB 1MI5D 4HLZG 5HI4C 3SY0B 5C2UB 5JQ6L 1G7LA 2PF6A 4D2NA 3OXRA 4ZG1A 1OAQL 4ZQKA 5EUOA 4PJFA 4YC2B 4KVCH 3P9LA 4HFUL 3C6LD 2Y5TB 5C08E 2H1PH 3RHWK 4GG6B 3D39D 4WTZG 1SEBB 3DBXB 2MNUA 3RVVC 5IEHA 3CCHA 1CFNB 1KIUA 4ZUSA 5CBAA 3QI9D 2BNUB 5GS1B 5DZLA 3CNKA 4KJQD 5DGRA 1FO0A 5AAMA 1WVZA 2XZAH 5F7DA 4MJID 1P4BL 1NUDA 3LPGA 3K74B 1SY6A 1OAZL 3NIDE 4X6EA 1T0NB 5FO7B 1MCDA 4KI1A 4JRYE 1HSBA 2HWZH 1FNSL 4Z0BL 5DMGD 2R0LL 2EYTB 1TVBA 3CVHA 4X6BA 3BP7A 1CICD 3IFNL 5I1JL 3X13B 3M17B 4K94L 1YEGL 1NLBH 2BCKB 4LHUB 3FRUA 1NC4A 3RIFF 1EX0A 2WBJA 4FQXD 4N0FB 3O6FB 1U2CA 3T3MF 3OHXB 1HHGB 4P23B 1C8PA 2DM7A 3BKML 2EDRA 1S5HA 4EEEA 1U8PB 5L2JB 4JG0H 2W0FB 3L3KB 3VGFA 5DTFB 2AK4E 4FQ1H 3BKJH 4JEGB 5KVDL 4PRID 1MWAL 3ULUD 2DWDB 1BIIB 3OJ2C 1ORQA 3WLBA 4Z18A 3QIWB 4WUKH 4LNRA 3U4EB 2Q6WB 3P4OA 3ARED 1F00I 3P11L 5J1SC 4DGYH 1UCBH 3KG5A 3QSKB 4MJ5A 2F19L 4JN2B 3U9UB 3O2DL 1ADQH 3HI1B 2YPLA 1HSAB 3GMLB 3OX8B 4G7YL 1K5NA 1ES0B 3JTTB 3QA3B 2X70A 4S1DD 4XT1C 2HYMA 3EOTH 4B41A 3BT2L 5DO2C 2V5TA 1PZUB 4OLYL 1AQDA 1UM5H 2ATKA 2NW3B 2FJHA 4L4JA 1HHJA 1T7YA 3B9VA 3OR7A 3UCRA 4HULB 3NFSH 2FO1A 2BFVL 1WISA 5IB5A 3CDYA 5IQ7H 3BZFB 2Y23A 2ESVB 2V17L 1QFUL 1MFNA 5ACZB 1ETZB 1J05B 4WI4A 3T4YB 3KPQA 4HUXA 2DQJH 3V9FA 2W91A 4CJ1A 5D5MA 3HLAB 3L3IA 3DV6A 4FQ2H 1NGXB 5I1HL 4L3EB 1UA6L 3CC5A 5EZOH 2XPGB 1S7RB 1A9BA 3T3PF 5DVOA 3O3EA 4LOUD 4G6AC 3WNMA 3DO3A 4F2MA 1BD2B 1ADQA 2VLJA 2ORBL 1GIGL 4PJGF 2YPLD 1S7TB 1Q9LB 5CBEA 3KVQA 3SY0A 1R3LB 2VN4A 2D7TL 3KLHD 1FGNH 3VMOA 1MLBB 1BQHA 5IOPA 3CGTA 4X8JB 1JGVH 3MLPA 3V0AC 3O4LB 4NQXB 1T1XA 1YQVL 3QBTB 1FYTE 3S4SG 4Y8DC 2FECI 3DBXA 4PRBB 1UXSB 3NZ8B 2XY2A 1G9ML 1CFNA 2VNCA 3O6LL 3T3ME 3QUXC 1JGLL 3RZCC 3ZSTA 2CKBH 4LAQH 4K3EL 4D0DA 1LO0L 2VL4A 3CFDB 4GAYA 1SYVB 4ZFFA 1J8KA 3THMH 4PJXB 4Q97A 2BVTA 4ZPTB 3ILPA 4JKWA 5IK3A 4XMKH 3W2DL 2UUDH 1EHLH 4IMKA 2ADJA 4ZS6D 1T4KA 2F74B 5TFSL 4FS0A 2V2WA 4KJYB 3X13A 3MBXL 3M17A 1YECH 4KQ3H 3FJTA 1OT2A 4KMLB 2BCKA 4LHUA 1E6JH 4N8CL 4HJJL 2B0SH 5GS0H 1I9EA 2D4FA 5CZVL 4N0FA 4BZ2L 4BQ6A 4GKSB 1BREA 1DUZB 3OHXA 3VE0B 3NCCB 3NZHL 4QHMB 3QCVL 4MDJB 4P23A 5L2JA 5FAAA 2QHRL 3L3KA 4M4RA 3IAQA 3QFJB 5DTFA 3MRRA 3UJIH 2ZCKH 5DT1L 3EDFA 4OCRL 2X1PA 1KPVA 2CKBA 2DWDA 4J3TA 3BXNA 2HTKC 5TF0A 4GW1B 3UAJD 3U4EA 4C54A 4HS8H 2BNRB 2HJLB 4WVRA 4M7KH 1HIML 1A7OH 1KB5L 1JTOA 5EU5B 4JN2A 5F7FA 3U9UA 3ZL4L 1DL7L 3IDJB 4LSTL 1U9KA 1HSAA 3GMLA 3RWJB 3OX8A 5IB2B 1ES0A 3JTTA 3WYRA 3HNSH 2DD8L 1H15B 4JANB 5EZLA 5GHWL 3QIBD 3VI3F 1UQSB 2DM3A 3NABL 3Q5TA 4GRWH 2CXKA 1AGEB 2PTUA 2FIKB 4HV8B 4OF0A 5HD8D 4PJGE 2FX8H 4H25B 1CDCA 4I5BB 4MD0B 2ESVA 3T1FB 1GGIL 2DKSA 1A6ZB 4Z95L 3S5LG 5ACZA 4LGSB 5JPNB 3SE8H 1NMCC 1UFUA 2X4PB 4X9GA 4K3DL 2Q87A 2HH0L 4CMHC 1FVDB 3HLAA 5C07B 1NGXA 4L3EA 1YEDB 4P2CG 4GLRH 2ZSVB 4LVNB 4K3HA 4U2ZA 3WXVH 4I2XB 1MCNA 1C08A 1CWVA 1NBYA 4L8BB 4Y4KB 4P4KC 5D2LE 4Q2ZB 1SBSL 2WWKO 2Z92B 3ETBF 1W72L 4KUCF 4P5TA 1PX4A 1S7TA 4XNUH 3BPNC 5IHBA 1R3LA 3EHBD 5BJTB 4PRDA 4X99B 1LK2A 4PV8B 4I3RH 1UH3A 3D69B 3NTCH 3HAEG 4KI5D 1BJMA 4X8JA 1JYXA 4P9HH 2B1HL 5GS0D 3O4LA 4M5YL 4NQXA 2WSKA 4IRJD 3QUXB 1WZ1H 3C5JB 1A7QH 4YHKH 5HYEA 1UXSA 4XWOC 3KR3L 5CEZE 4U7SA 1KJ2B 3LEVH 3P0GB 3HC4L 4GXUN 3KPRE 4PJFF 1WEJH 1NGQH 4HSQA 4QRPB 4MJ2A 4WFHD 4P3CL 3L1OL 3G6AB 1SYVA 2F54B 2ARJB 4PJXA 1OQXA 4AG4L 4HPYL 2NY0D 1PW3A 3TYGL 1FNHA 1CL7I 4X5XB 2JTDA 2FB4H 3MNVB 1EEYB 4NNYA 2J3SA 3O3BB 3ILQC 4JFZL 1YQ2A 3AAZB 2HKFL 2DN7A 2Y07L 5LXGH 4P5TD 2HJFB 3VFNA 3QEQA 4MNGB 1QBMH 5MEPB 1ND0B 1T66D 2G5BB 3VE0A 4XP6L 4QHMA 1YEJH 2FX9L 2VN7A 3RVVD 4G42A 5FV2A 3VI3E 2HFTA 3RIAF 3DHJA 3QFJA 1EVUA 1R5VB 1UXWB 4YLQT 1F58H 1ZLUK 2J8OA 3G5YB 4GJTB 4UDTB 4EVNB 3PABA 4QXWA 4OGAD 1YZZA 2NY6B 2NY2D 1N6VA 1XGUB 3QHFH 1UKSA 4GW1A 1J88A 5A2IH 4L29B 2HJLA 5C2BL 1TDQA 1FLTX 2C4XA 2VAAB 4IBLT 4OD1L 2HLAB 2EE3A 5INDB 4XPHH 5EU5A 1LEKB 3QZWB 2AV7A 3L3DB 1LVEA 3IDJA 4UUJB 5IMOA 3RWJA 1EAPB 3G9AB 2FEEI 5IB2A 1RAMA 4MXWL 5DK3A 1N7ML 1IC4L 3LQZB 4XVTH 3VXMB 1UQSA 5GRWA 1N4XL 3RX8A 1AGEA 5EOCH 4FHBD 4ALAH 4U1KB 1K4CB 1QSVA 3LS4L 2FIKA 3QEQD 4TOYH 2MQ0A 4HV8A 1FG9C 1CTNA 3FQWA 1YMHB 3ULVL 3EJYD 4I5BA 4MD0A 5J3HD 4CMHB 3T1FA 1GC1C 1A6ZA 4PV9B 1RJYA 5C3TA 1H8SA 3QR2A 2QQLL 4LEOB 4QRRE 3QFJD 1FH5L 4E42B 5FCUH 4I3SH 5HHQB 2X4PA 3JV4B 1FVDA 2VSCA 2RB8A 5GSRA 3S36L 3SDAC 3VXSB 5C07A 3E3QE 3RL1B 5IBTH 4NKDA 3TN0C 1T7ZA 43CAA 1J5OL 5EIIB 1UKQA 1B2WH 4I2XA 1A1MB 2WUCL 2DQTL 4UTBH 3FO1B 1BF8A 2JB5H 3BPNB 1U91B 3MNZB 5CIPH 4PJIB 2Q76B 4YJZL 3N50A 5FO8B 1QO3B 5D5MF 2BSRB 3PWPA 4Q2ZA 2Z92A 2X4SB 1MUJB 5GGQH 5BJTA 1DQDL 5ACMA 4DK3A 2G9HB 1FAIH 1JL8A 4BFEA 4PV8A 3RY5A 5I17B 3D69A 2H26A 2NQCA 1KTDB 4JRXB 3CFJB 5L8KB 1DN2A 3H42L 2O5ZL 1MFCH 3RZCA 3C5JA 2GTZB 4HS6B 2Y72A 1SMOA 4LFHD 5E94B 15C8L 1KJ2A 2CH8A 2VDRH 1NAMH 2FATH 5D70H 3OPZL 1KN4L 4JHAL 4OLUL 3MJ9L 2F54A 2ARJA 4GG6F 4LDLB 2Z9TA 5C07D 4HLJA 2EECA 1KXTB 5IM7A 4ZFGL 4C59B 1GYAA 1XF2B 2XIDA 3QDGE 3OKEB 2E7LA 5CIPA 4R97C 4HMDA 1RZKC 3PL6C 4KUZH 3OF6D 4LSVL 1ITBB 3VGDA 5F7MC 4YHMH 2EDNA 2EXYC 4KROC 3PWPD 2YS4A 3BSZL 5L2KD 4DOHE 2ZSWA 1BVLA 4J2XA 4MNGA 2QADC 2VLRD 3SDDB 1ZT4A 1ND0A 3OB8A 5DUBB 2DDQL 3TVMD 1OF2A 4K9EL 4PS4H 3E8UH 3QRFM 4H8WC 4ODHH 1ZGLB 1S7VB 4HPOH 2C7UA 4FQJH 3K1KC 1R5VA 1EGJH 3RZCD 4G43B 5TDPA 4UDTA 4EVNA 3GMPB 1P1ZB 5DVKA 1V3JA 4PLNC 1F3JB 1CXLA 2VDLH 1NAMA 2HTLD 1XF5B 2Y06H 4FQIL 3R8QA 3PQYD 4D94A 4L29A 3OGCA 4PGZA 5T1MB 4TPRH 2P24A 1BMGA 4ESKA 2NY7L 2HLAA 5GRZA 4HC1A 2DMBA 6FABL 1LEKA 2I5YH 3QZWA 4FP8H 4Y19B 1MY5A 4UUJA 4HUUA 1ZGLP 3BYYA 5FHBL 5B4MC 1LK3L 1OD7A 3QXWA 3MSPA 3PF2A 3K8MA 4KKNA 3LQZA 3JV5A 3VXMA 3QQ9D 5D1ZD 3S36X 1EXUA 1LO4L 2FL5A 2FSEB 1YEFL 1CDYA 1M6OB 1K4CA 2QSQA 2EEAA 4WENB 3OAZH 2CDGB 3NMEA 1I7TB 1KPUA 4OJFH 1OLZA 3EIFA 1C5DA 3SOBH 2D31B 2ZG1A 4UMGA 1XIWA 3VW3L 2OP4L 3SDAB 2R9HC 4C83B 5EA0L 5IB1B 3TN0B 3CLFL 4Q0XH 2VKWA 1NJ9A 4KI5F 2LU3A 4LAJH 5HHQA 2F5AL 4QTIL 1QP1A 3JV4A 4L4VB 1JN6B 3MXVL 3VXSA 4JY6B 2VLJE 2QQKL 5HBBA 4O9HL 3QT2A 3DSFL 5D2NA 5DEZA 4E41A 5EIIA 4XNMB 5E5MB 5C7XH 3N1MC 1A6UH 4P4KA 4XC1H 4DCQB 3FO1A 2YN3A 1OVZA 1DR9A 1U91A 4HT1L 1F4XL 4PJIA 5FO8A 5HDBE 5EBLA 4GG6E 1MUJA 5KAQF 3RWGB 1WFNA 3HZVB 5JW4Q 2B4CL 3WXWL 2Q1EA 2NY1D 1JZ3A 4XGZA 3FQRB 1KTDA 3CXDL 2VDKH 4JRXA 1FL6A 5B39G 2P48B 3V7MA 1ZMYA 4HS6A 5F9OH 4WJ5B 5E94A 4JO3H 1XIWD 4BZ1H 3ARDA 3MLYL 3HE6A 1GGCL 3ZTNH 3WIIL 4L9LC 2ADFL 3T2NL 1KUMA 4NUGH 3GSUB 2QR0A 1RURL 3GO1L 4R97B 4M1DH 3BP6A 3PL6B 4U6HB 4FXKB 4E41D 4PJDB 5TQ0H 3MLVH 4JFXB 5I19L 4ELKA 4P4KD 3OKEA 3MR9A 4KROB 3TA3C 1NCBH 3LQMA 2FGWH 4UNTA 2CRMA 1OAUL 2QADB 4PJXF 4ZUVB 1LO3L 3S34L 2EKJA 1C5CL 1NANH 4WW1A 1QSZA 5FYKH 5KZCD 1GGBH 2DS4A 1IGYB 3LAFA 4M1GL 5DUBA 5GJTH 4FNLL 5IBUG 1SJVA 4OSUH 4R7DB 4HS3A 2VB5A 1ZGLA 4PJCB 4LSSL 4YDIL 2OL3H 4G43A 3DV4A 5F7EH 3BHBA 4WI5A 1RUML 4TTDD 2IMNA 4M7LT 4G7VH 1F3JA 3W39A 4G6FD 3BMWA 3ARDD 3LZFH 3HZMB 1SM3H 3HE6D 3T09A 5GZND 1RIUL 1AGFB 4JB9L 4JFEB 3GSVA 5T1MA 4FQLL 1C16B 3RFZC 4MS8D 5DK2B 1LNUB 2ED8A 4Z7UA 4F37K 5T3ZL 4Y19A 1T20B 3ZLQC 4F33B 4I77H 1A6PA 3T0AA 3L5WB 4LPXA 5IVOA 4ZUWA 5LGKA 2ESVE 1IGIL 3S5LB 4RBPH 2Z31D 4G80B 3MLWL 3AS1A 1M6OA 3Q0HA 5LBSH 4BH8B 1DBML 5IUSA 2CDGA 4L3EE 1I7TA 2DLGA 2D31A 5JOFB 2HKHL 4KKAD 1CQYA 1F4WL 4RMQA 2Y6SC 5IB1A 2APTA 4C83A 3TN0A 2JB6A 4LSUH 1T5WA 1FP5A 2OL3A 4Q6IC 2GSGB 4JO2L 3BJLA 1PYWA 3T65B 1XF1A 2BOBB 2DQIL 1JN6A 3K2UL 1BD2E 4JY6A 3QPXL 4DVBB 5SWSB 3U1SL 1U8NB 1B9ZA 2ZJSH 3MYJB 4H0HB 2AJUH 5LJYH 4X7SH 4XNMA 2P42B 3MOAH 5E9DA 4XP4H 4DCQA 3LSOA 1PG7W 1KGCD 2BHUA 1K85A 3HAEB 3X3FH 5JQHC 2O5XL 3FMGL 3IU4H 4K23L 4RGNC 3O4LE 5D7KE 1VESA 4OV5A 1KULA 4JQIH 4YHNB 3VMPA 2R1XB 3KPSD 2NCMA 4XI5D 4PG9B 1I9IL 1A7NL 4XNZC 1IC5H 2CLRB 4X9IA 1Z9LA 2YR3A 3FN3A 5FYKD 2VLLA 1YEEL 4PJXE 1EUTA 4P57B 2D7QA 4KXZI 4PJAB 5BRZE 5HHMB 4QYOB 3WFBL 4WJ5A 1KELH 1HH6B 2JJWA 5KVGL 3S88H 2W07A 4L9LB 5KVMC 4UT6L 4NWUH 4Z7NE 3SPVA 3PHSA 3QO1B 3TN0D 3FB6A 4XPBL 1J1OH 3RWFB 5GXBB 2GI7A 4X7CC 1U6AL 4A2LA 2FYYB 1K3ZA 3GSUA 3PV7A 2MPAH 3O6KH 3L5HA 4NRYB 4UAOC 3PL6A 4ISVA 3KAAA 4JFXA 4DKEH 1QFHA 5E9DD 3DX8B 4DAGL 2WWMD 3MLRH 1A5FH 1BGXL 3WS3B 4QHUB 4D9QE 4IRZH 3UTSD 3UYRL 3LKQB 3IKKA 3RI5K 4JO1L 2OJZL 1JK8A 2CMRL 3TO2A 5KSVA 4X6DA 4R7DA 2GUOA 2BNRE 3C60B 1T80A 5FYJU 2PR4L 1CGUA 2FECL 3NPSC 1X5KA 3OXSB 3JWOC 4M8QB 2NNAB 2EEDA 3EOBB 3LKPA 5JA9A 5EU4B 3QCTL 2DLFH 4UQ3B 1L6ZA 4JG1L 3MLTA 3BEVB 5J1TC 1BFVH 1ZVSA 4LF3B 4XP1L 5DUML 1AGFA 2JELL 4NQCA 5HY9A 5D7LB 1BP3B 1WBZB 3V4UL 3IRZA 1QPPA 3F7VB 3SHSA 2D03H 5DK2A 1LNUA 2HN7B 4LSQL 3M8OL 4WFED 2A9NL 3V0WL 1V7NH 1M71B 3EYVB 1Q0XH 1T20A 4JPKL 4F33A 5DD0H 4I0PB 1ZK9A 1Y6NR 1I1FB 5D6CA 1EJOH 3HC3H 3L5WA 4KROD 3QHZL 5CSGA 5D1QC 1TJGL 2A6KB 1P84J 3S5LA 4RBPK 4DKDC 3UYPA 1QA9A 3OG4B 1MHEA 1G7HB 5E00A 1CXHA 5ALBL 4GS7C 4LBEB 4BH8A 4M6OH 5B22A 2W59A 2WUBL 4Q6IB 4J6RH 3FKUS 5J13C 4I2XE 3KXFB 4O58L 5JOFA 1RZGB 1B0WA 1HYRC 1KIRA 1J1XH 3RDTD 3FT2A 3QWRD 3O2WH 4DW2L 2GSGA 3T65A 1F8TL 5DQJB 4Y5XB 1CGYA 1WZMA 1Z3GH 2BP3A 5D71L 5KW9L 4GQ9L 2P44B 4LCIH 1N5YL 4JPVL 5DJDB 4AL8L 4J3SA 3F7QA 4LLWA 3AGVA 5MP6L 4RGNB 1MHCB 4NQCD 3HAEA 5B4MD 2ICCA 1AXTH 4CN6A 3BJ91 4X4MA 2AGJL 4J4PC 4XNZB 4V2BA 1XAUA 3F7RA 1AFVH 1A7PL 2XQBL 2YBRB 3D3VA 2FH6A 4LASH 1A21A 4PG9A 4ZODA 3DURA 4HAGA 1OM3H 1AXIB 1CYGA 1D9KD 2CLRA 4QRPE 4PJIF 4G8EA 3ZT6A 1FIEA 2F54E 5I1AA 3ZHLA 2XA8H 4P57A 3P0YL 1EERB 3FQNB 4MAUL 4PJAA 2FHCA 4NHCL 4QYOA 4MSWB 1HH6A 4QRTB 2UZYB 4LSRH 1S7QB 4ZFOL 3MRGB 1AR1D 4UAOB 2X1XR 4S1SH 3RWFA 4OFYD 2FYYA 4HJGB 3DVFA 4LSPH 2AEWA 2BOCB 3FQXB 3GRWA 3TA3A 2H6PB 4JY4A 4NRYA 4HQQH 4M93C 1PAMA 5I71C 4YDLC 3EGSB 3DX8A 3QH3B 5AZ2H 4F7TA 5DJYB 5TE4H 4ODWB 1S9XA 3HNVL 1FNFA 3QUKA 4OCSL 8CGTA 2CRZA 3WS3A 4XB8A 1Q0YL 4ZTOL 5JMRA 3I6LE 2VC2L 3D3VD 3LKQA 1BOGB 5FYKU 2E7HA 2V9RA 3CFEA 3NPSB 1ZANH 4PRPB 3RGVC 5JHDB 3MODL 3N1GC 5JOEA 2MJWA 1JPTH 1BQLH 3EYSH 1TTFA 3E1F1 5JXED 4OI9A 2NNAA 4OKVB 1EUUA 5IWLA 2A6DB 2F58H 5CSZB 4P4RA 4DQOL 3FO2A 4LEXH 4J3VA 3UTOA 2J12B 2VOTA 4ZSOB 4DEPC 1MJ7H 3KWWA 5D7LA 1WBZA 3F7VA 3BZ4B 4YE4H 1ZXQA 4OD2B 5IF0A 4YH6A 3TA3D 2HN7A 1YNTB 4XX1G 3EYVA 4ERSL 1CL7L 4OZ4B 5FYJE 4GS7B 2NY5C 3ZYZA 2A6KA 4EXKA 5HVHC 1UCTA 5JORA 4XZUB 5J13B 1MRDL 4XMPH 1CF8L 1TLKA 4LBEA 2WP3O 5L0QB 5FOBA 3VXSE 2G5RA 1G7MA 1RU9L 1K2DB 4F57H 1FNGA 4ONGH 5GRJH 1VACB 3KXFA 5I8CA 3I02B 1OGTB 2ZZUT 4M62L 5AYUH 3QUMB 1CTOA 4OZFG 1R3IL 1KYOK 3EAKA 1IBGH 1ZHNA 3GNML 3C08L 4Y89A 1LO5B 3HR5B 1CN4A 4EOWH 2X5PA 5JOPD 3C2AL 5C3LD 3SBWC 1E6OH 2IQAB 4IHOB 4U4BA 4KZDH 1BECA 5DRNB 2WANA 1ZLVH 1H3GA 1B0RA 4U3HA 2J6EL 1OTSC 2GJ6D 2VDNH 1MHCA 1HNGA 2N56A 3A6BH 3BWAB 1OP3K 5IESH 1MREH 5BOPA 5B39B 5TPWH 1WBXB 3AY4A 5E08H 5CD5C 5DD1L 1MVFA 2FEEL 5F21B 2YBRA 1NCDL 4JVWA 3OGOE 4X9HA 2XZCH 3QO0A 3BE1H 2DJUA 4KHXL 2X4QA 3MJ6A 2VZ1A 1EHAA 4PG2C 2VLMD 5K9JH 4AEIH 2FH8A 5LWYH 1YPZB 3OJVC 1JZ2A 1ODAA 4G8IB 4D0BB 2HT3C 1OGAD 2Q7YA 3QPQC 4QRTA 2QSTA 3G04B 1QNZL 4OCWL 5BXFB 4WDIB 1S7QA 2GKIA 1OD9A 3BOVA 3MRGA 5LG1A 5M95B 4MQXD 2LAGB 3ZKNC 3EO9L 4HX1B 4KQ4L 3ARPA 4ZYKB 4M93B 1VCAA 1FORL 4HJGA 5I71B 4U1GC 1G6RB 2BOCA 4EN3D 4WY7H 4YDLB 3C5SB 3CVIL 3FQXA 5KSAC 3TBWA 4GW4A 5EZJB 1HCFX 4KGJA 4NWTL 2MCPL 3EGSA 3QH3A 5IBUB 1ROWA 5J8OA 5DJYA 4ODWA 1FO0L 5ANMB 3CFCH 1GPOL 2GYSA 3CK0H 3KYNB 5HDQH 1SY6L 3QJFA 3RGVB 1HQ4B 2RFXA 5HYSG 4PJDF 1NAKL 1YY8B 3C5ZD 5D72L 1BOGA 1YN6A 4FFZH 1JWMB 5MHSD 4P2QD 5BV7C 3V8OA 5DQ9A 1WIUA 2ICWA 5JHDA 1AIFB 3CVHL 4G6ML 4LLQA 1TITA 3I9GH 3L3JB 1XGYL 3PWLA 4FTVB 2VWEC 5I1GH 1NANI 5TDOB 1VA9A 3PP4H 4DEPB 4GOSA 4Y19E 2GQHA 1VEOA 4QRUB 4JFFB 3MACL 4B7IA 4JY5H 5CZXD 2YA2A 3MV8B 4PJCF 4MDIB 4YIQA 3BZ4A 3QQ4B 4W6YB 4YR6B 4L9DA 1V7ML 1AGBB 1YNTA 1BIHA 5D1QA 4MCYA 3ZKQD 5HVHB 4PJ7B 4M8VA 2Z8WC 2WM0A 5A3ID 3RWEB 4GRWB 5L6YL 1VADA 1HEZA 4KRPC 4NSKA 4XZUA 5CMAB 4N0UB 3NH7L 3IFLL 4PLKD 1V3MA 3QAZC 4L4VE 1K8DB 2EKSB 5I1CH 2HWZL 4WV1C 2FBOJ 3UC0H 4HIEB 2DQDL 3QISA 5I15L 2HFEB 4MMXC 1D5IL 4WHYG 1OGTA 5KJRH 2HG5A 3QUMA 4AYFA 2J8HA 2VXUH 3OZ9H 8FABA 2CD0A 2GT9B 2H8PA 5F3BB 3C9NB 3HR5A 1VFUA 1F4YL 1MQKH 4ZAKC 5C0RH 5IKCA 1FNEB 5DRNA 1ZLVK 5HHVL 3CSYA 3U4BL 5EO9B 3K80A 3IETB 3BWAA 4J4PA 4FFVC 5F72S 4JG0L 5L88H 1X3DA 4LQFH 3K8KA 4FQ1L 5D1QD 1I3VA 5C0BD 2EC9U 2XRAL 1IGCH 1W0VB 5KN5A 4DGVH 5EU6B 4FOMA 4NO5B 3OKYA 1F6AB 3HI6H 3ESUF 4G6KH 1WTGT 5DD3L 2IAMD 4LLYB 1UCBL 1TZGL 1IT9L 3BN3B 1P4IL 4D0BA 5ID1B 1ADQL 5C0AB 2QJDA 2PNDA 5CCKH 4P2OB 1FHGA 4PJDE 1IC1A 4TSBL 4U1GB 1A4JB 1LDSA 4WDIA 2WQRA 5KSAB 4PGDB 4M61B 3RHWF 4HIIA 2Q3ZA 4YK4C 3DRTB 1CD1B 4UBDC 5IFJB 1OTTC 1G6RA 4PJAF 3C5SA 1OB1B 2JKXA 5EZJA 1S8DB 1TFHA 1JWSB 4K71C 4YO0B 3V52H 2NXZD 2HAZA 4JZJC 3GUTB 2IGFH 5AD0A 3GI9L 4QHLB 4PJCE 3KYNA 5I1DB 2AXFB 3ES6B 2EDHA 2LTQC 2O26U 1G7QB 3RGVA 4DVRL 5DDHA 4MA3B 2A77L 4TSCL 1JNNH 1FCCA 2NTSP 5AEAA 2O61B 1JWMA 3EBAA 5CJQH 5KVFL 1AIFA 2FIRT 2IADB 4JFEE 4ODXA 2M8XA 2AERT 3N9GH 1VPOL 4FTVA 4RAUA 3QIUD 5I1IH 1MRFL 5DXWA 4XAWH 4PLJC 1ZA3B 2B2XL 3RL2B 1QFWI 1FGNL 2APBA 1QLRB 2LQRA 3VXPA 3X3GL 5KS9E 1AQKL 1XFPA 1A6AB 4POUB 2IALB 1JGVL 1OL0A 3ROLB 1IFHL 4NRZB 5E2VH 2PW1A 4KRPB 4PJ7A 4MXVF 4U6VL 4C55A 1ZVYA 2RQ8A 2CKBL 1BVKA 4LAQL 3M45A 2WK2A 3PG2A 2VDOH 1M7XA 4WV1B 2XT1B 1C1EL 4AEEA 3HI5L 5H8DA 3NCJH 1U58B 4N0UA 4YDKH 4LLAA 2PXYC 1K8DA 3LEYL 2EKSA 3LIZH 1A1NB 5SWSE 1IGFH 4HIEA 2HFEA 2UYLB 1W0WB 1CGVA 3D9AH 3BGFC 4ZAKB 4KKLD 3QULA 4NZRH 4IRSC 3C9NA 5EC1B 4NFDA 3R4DA 2VL5A 4X4ME 5HPMB 3D0LA 1LWRA 5D7IB 2V7HB 3QDMD 4PJ5B 1LO2H 3IETA 5E8NA 4XVUC 1SYSB 1JZ6A 3QUZA 3ECBB 4FFYL 4M6MH 4UILL 1JPST 4G8FB 4OBRA 2H3NB 4PJAE 5HHME 1KPRB 4AM0B 4LP5A 1ZHKA 3CLEH 1W0VA 5AG9A 4PG2A 5EU6A 4NO5A 1F6AA 3EO1B 3MCKA 2RAMA 1CD9B 1KBGH 4LLYA 5DR5H 4M7KL 1C5BL 4M48L 1WTLA 5ID1A 3JBG7 5C0AA 1VDGA 3NOIA 3BGAA 3SDCC 5GZOD 1P4LA 2J88H 5SV3A 4YHLL 3L3HB 5KSAA 3TO4C 3CXHJ 3BPCB 4A6YB 1UEMA 1NUNB 3EYOB 4K71B 3HC0B 2GY7B 1X5XA 1MY7A 3DRTA 1CD1A 2CK0H 3QFDA 4JZJB 5TH2B 2K9UA 1OW0C 1OB1A 3PHQB 1S8DA 1WITA 5T1DL 2HVJB 1JWSA 5CGTA 2LU4A 2QSCH 3MLSH 2YN5A 3MZGB 4ZOAA 1KCSL 2IPKB 2LTQB 1U8IA 4M43H 4OUUA 3GUTA 3QUZD 5FM8A 3V5KB 4KRLB 5FB8A 5F9JA 4QHLA 2AXFA 3ES6A 5JQ6H 2YSSB 3D25B 2D2OA 1MJ8L 4MA3A 1PKQA 4MXVE 5D7JD 5JZ7C 2O61A 5EU6D 4X8XA 4CU7A 5J57B 1B90A 3O2VL 3QDJD 1Y6MR 5FGRA 4ZNCD 5J4MA 3U79A 4NOFA 4MHHI 4YHOH 4KKBC 3UX9B 4OFVA 3STZA 2UZIL 1ZA3A 3DX7B 3I3BA 3QUYD 5F9DC 1J0HA 3ZMRA 1P4BH 1QLRA 3IT8D 4F7EB 2MKLC 1A6AA 2Z4QB 3P73A 3SJVA 1OAZH 3OKNB 5TJWK 4ZUUB 2IALA 4YDVB 4P9HL 4X4XB 4OZHB 1FNSH 3ROLA 3PGCB 1JNLL 4Z0BH 4E5XA 2ZUSA 3UTPE 4HJ0D 2R0LH 1K4DB 4AT6B 1IGML 4JDZA 3IFNH 4UOW1 4EKXA 5I1JH 5H94B 3VG9C 4OCXL 1SJXA 1FBIL 1UACL 3KXFE 4K94H 4POZC 5IG7B 3DVNB 1NGQL 1YEGH 2BVPB 4OZFB 3ZDXF 3LQAC 4PR5A 1U58A 3NFNA 3ZT7A 1WK0A 5EH1A 1DQML 4GUPA 5GIRB 4HDIB 3BGFB 1A1NA 3D85B 3Q2CA 3BKMH 2UYLA 4IRSB 1W0WA 4RGNE 3LRSB 4LCCC 1T2JA 3GIVB 1EBPA 5KVDH 1MWAH 1CFTA 2CRYA 3UYOD 1NPUA 5CGYC 1XR8A 2BRRL 3ZE0F 4NQSB 2FJFB 4DUVA 3RWDB 5D7IA 3P11H 3SJVD 3WIHH 4PJ5A 1FPTL 4LL9A 5H2BB 1SYSA 1PG7L 1EEZB 2F19H 3O2DH 3ECBA 4WI8A 1F58L 3ARGA 1QSEB 1WF5A 1QVOB 4G7YH 1U8JB 4G8FA 1UH4A 1N59B 2BVOA 2E9IA 1NBVL 2PCPA 3GJFK 3MA7B 4BA8A 4LCWB 4QHKI 4WFGE 3BT2H 4PP1D 5C0CA 5EWIH 4YPJA 3EO1A 2X4UB 4OLYH 4QLRA 3WUWA 2IC2A 1I1YB 4MB4A 3SDCB 2BFVH 2MMXA 4H1LH 4WW2C 3U6RB 1NSNL 4GBXC 3TO4B 1QRND 2V17H 1FV1B 1QFUH 1QLEL 4P5KA 5EN2A 3BAEL 4LKXA 1A6VH 1CD8A 1N26A 3L3HA 3T1WA 1T6WA 3E6FB 2OSLA 4GXVL 3LB6C 1P9MC 3DRQB 5DMKB 1YMMB 3OR6A 3UEZA 4ALAL 1UA6H 3HC0A 2ICWI 5KSUB 1YPZF 1HCVA 1FRGL 4MCZB 3HS0A 1M4KA 5HYSB 3CDFA 3PHQA 2X42A 3BKYL 5EIVA 3WIHA 1ULVA 2PW2B 3MUHL 5GGRB 5E99L 3QNZA 1Q38A 4BJLA 3V6OC 1QBBA 1KJ2L 3MOQA 3MZTA 2FD6L 4PRPE 5CJOL 4K07A 2ORBH 3LRGA 1GIGH 4NO2B 3ARGD 4J1UA 2CR3A 3MX0A 2D7TH 5IBTL 1URLA 5DHVH 1HHHA 3D25A 3GMRB 3CZFA 4V1DB 5C0CD 2BSED 5I30L 4PJ9C 5KVEL 4UTBL 1PY4A 3MRLB 4ZSOE 3CZJA 1MCEA 2HVKB 4ZO8A 2NTFB 3IDXL 4GMSH 3ZDXE 2R56L 5GISL 1G9MH 3O6LH 5LGJB 1JGLH 4I1NB 5CAYB 2DQFA 1JRHL 1GZPA 1LO0H 3VFPB 1AH1A 2Z4QA 2EH7L 3OKNA 4ZUUA 2DI9A 2ZG3A 4OT1L 4YDVA 5A2LH 4FQQB 1I7ZB 4G9FA 4X4XA 4BSWB 5J0BA 3PGCA 5HYQB 3W2DH 2EIZA 2IG2L 2H45A 3L5XH 1RD6A 4ONFL 4PJEA 5TFSH 3O3AA 5C0JB 3ZE0E 4LHJB 2ATPB 5DJXB 5H94A 3GSQB 2PXYA 3MBXH 1IL1A 4BZYA 4EUPA 5IG7A 4OI8A 5D70L 3MBEC 4NKIH 3U36B 1BWMA 2IANB 4HJJH 5DHVA 4BZ2H 3B9KC 1NCAL 4HWZB 5GIRA 3GMNA 3D85A 4HC1L 3NZHH 1Q9KB 4PJ7F 4PREA 1MIEL 2VMFA 1PG7X 2QHRH 4IRSA 3TCLA 4GRWF 3FT4B 3LRSA 3GIVA 4KUZL 5SV4A 5DT1H 4K8RC 4YHML 4S2SB 1NL0L 3TWCH 1HWHB 2GTWA 2YD8A 4HKBB 1R0AL 1GAFL 3D2UD 1TZIB 4PBWD 4LDEB 3E6HA 3QQ3B 4PS4L 5FYJL 1HIMH 1YC8A 2DLIA 1KB5H 1QHOA 4U31A 3SE4C 5C92A 4G9FD 3ZL4H 1DL7H 4XH2B 2GK0B 4LSTH 3B8SA 5LQBL 1F3DJ 1FNAA 1QVOA 4MD5B 2W65A 1U8JA 2YD2A 1YPZE 2DD8H 4UT9L 2X2YA 5AAWA 5GHWH 5HJ3B 4MVBD 1I3UA 2APVA 3MA7A 4HEME 4LCWA 5C6WH 2PXYD 1MCCA 4WW2B 2ITCB 2X4UA 4GBXB 2XXMB 5DI8A 3IU3A 5T1KD 2EDBA 4TPRL 2YD6A 5FHAL 3FOMB 1DLFL 3U6RA 2MFNA 3RPKA 3TO4A 1A7RL 1UM4L 5DHYA 4NN7C 3SKOB 4Z95H 2VAJA 5ETUA 4IRSD 1KNOB 3WEXB 2D9CA 1Y0LB 2B20A 3REWA 4K3DH 1OW0A 2HH0H 4NKMB 4U7MA 3EJZC 1MCWM 5ANME 2PO6D 3IXTA 1B6UA 4YHIB 4IOIB 5I0ZA 1VSCA 3IAGC 3SOBL 3DXAD 1J18A 2PW2A 4WGWB 5GGRA 1KB5A 5J1AB 4MJ6A 4I9WD 3S97C 4RAVB 1T1ZA 2Q3AA 5DFVD 4QOKB 1SBSH 1W72H 4D9RD 4Z7VB 2VSDA 4PJ9B 2VZ3A 1CDGA 4LRNL 4FTVE 2P45B 3GMRA 3U9PH 3UJJH 4X9BA 2XXCB 4QF1B 5D9SA 1JPSL 3AS0A 1KENL 2AEPL 3UO1L 3GJEB 4JFFE 1BQSA 2B1HH 4M5YH 4L3CB 3MV8E 2NTFA 1UWEH 2EDKA 3SDXA 5JR1L 3KR3H 4N90D 4HBCL 4CMMB 3HC4H 1P6AB 1BVZA 2C3VB 4PJ7E 5IW6A 2A38A 4MAYA 4P3CH 3VFPA 3L1OH 5K9QI 4GRWE 2OTUA 3B2VL 4W6WB 1KV3A 1KFAL 3CSGA 4U1LB 2XQYK 4CW1B 4GKOA 5T3XE 4FQQA 1I7ZA 2LVCA 3JV6A 3U0PB 4BSWA 4KFZC 3TYGH 3HUJB 1L0XA 4N0UE 3HG1A 3HFMH 2VZTA 1XH3B 4KJPD 4WHDA 5CJXA 4D8PA 3TBSB 5DJXA 4CGTA 2NY4C 3GSQA 3V2AR 4JFZH 1JJUA 2ZWLT 4PRAA 3V0VA 2HKFH 1OAKH 4QCIB 1U3HA 4TUJA 3U36A 2IANA 4M9PA 1KACB 2AVGA 4RZCB 4OKDA 2YPKA 4FMFA 1X6LA 2H41A 4LCCA 1XGQA 1HI6B 4XP6H 4NZUH 1TJHL 2FX9H 5DHXB 2F53B 4OZIA 4RRPG 4R4NC 4F9LC 1WCQA 2YC1A 2HMIC 1DLHB 3UTTB 1CE1L 1RZJC 5FA4B 1YA5A 1Z9OA 4F9PC 2KKQA 4JR9L 2LVEA 1GC1L 1KTLA 4MAYD 1U8MB 1S9KC 3BD4A 4NO0D 3QQ3A 1OP5H 3JUZA 4OD1H 1JUFA 2XN9E 4GAGL 1MPAL 3I3EA 3T4AB 4NKOB 4O2EA 4XH2A 2GK0A 2OL3L 2OBGA 3HG1D 4MD5A 4PRHD 4MXWH 1FNLA 1N7MH 2VISB 3VXRB 5HJ3A 1IC4H 2VLKE 5C0AE 4G7VL 4G9DA 5D7IF 1N4XH 4MA8L 3WE6B 5CD3B 4WW2A 4GBXA 3UBXG 2X4OA 2Z8RA 4M7JL 1U3HD 3VXTB 2JJSC 3LS4H 4NN7B 2WQ8A 5HGHB 3FOMA 1M7DB 4UB0H 4L4TB 5GSVB 3VFRA 2H32B 1H5BC 3ULVH 3AXLB 4XHQA 2NYYC 1P9MA 4KMQA 1B88A 3SKOA 1JZ5A 3HRPA 1KNOA 4KV5F 3W5MA 3U2SB 1FH5H 3G5ZB 5DJ8B 1JNHB 1KC5H 1MFEL 3IGAA 5JIPA 4NKMA 3S36H 3ZKMD 2ZUYA 1FZMB 3P4MB 1M05B 4YXLL 5HPOA 4ZO6A 1J5OH 2QKIA 1ZOXA 4IOIA 4KVNL 4NO3B 5DK0B 5DD6B 5AUMA 3V6OA 4TSAL 2V5MA 2DQTH 5C0DB 4FA8A 4U1HA 5FO9B 4NZJA 2C1PB 3S9DB 4RAVA 2VWEE 5HVGB 4XVSH 5I1EL 1KT2B 5IHZB 4OIAA 1D5MB 3TH3T 2H2SD 1DQDH 3DGGB 3MREB 1RZKL 2IH3B 2R2EB 4X7SL 2HA1A 3GJEA 3OKLB 4XP4L 4G3YL 3H42H 5GRXG 2VXTL 2O5ZH 4QT5B 2XKNB 4DKFL 4L3CA 2OTPA 2A83B 3LN4B 4N1EA 2X4NA 5HDLA 5IIEB 4JFHD 3BYTA 1AD9B 2AV1B 1CCZA 4X4YA 1N3NB 4OF6A 4H8WL 3OPZH 1KN4H 4JHAH 4OLUH 1NKRA 1W0YT 4JZOB 2IMMA 5HDOA 4CW1A 3KLSA 1FE8L 2FO4B 3RP1A 5EFIA 2R39A 4ZFGH 3HUJA 4E0RA 1D5BB 2EDTA 4IJ3C 5E56A 3BGMA 4HKXB 4EI6A 4W6XB 3MBEA 3S88L 5KSBA 3WO4C 1XH3A 5T1LB 5HYFA 4TNVK