4I5DA

Crystal structure of ralstonia sp. alcohol dehydrogenase in its apo form
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
249
structure length
233
Chain Sequence
AYRLLNKTAVITGGNSGIGLATAKRFVAEGAYVFIVGRRRKELEQAAAEIGRNVTAVKADVTKLEDLDRLYAIVREQRGSIDVLFANSGAIEQKTLEEITPEHYDRTFDVNVRGLIFTVQKALPLLRDGGSVILTSSVAGVLGLQAHDTYSAAKAAVRSLARTWTTELKGRSIRVNAVSPGAIDTPAKFAAATPLGRVGRPEELAAAVLFLASDDSSYVAGIELFVDGGLTQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic analysis and structure-guided engineering of NADPH-dependent Ralstonia sp. Alcohol dehydrogenase toward NADH cosubstrate specificity.
pubmed doi rcsb
source organism Ralstonia sp.
molecule tags Oxidoreductase
molecule keywords Alclohol dehydrogenase/short-chain dehydrogenase
total genus 90
structure length 233
sequence length 249
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2012-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4i5dA00
3ICPA 4J4TA 4BO5A 4F6LA 5DCUA 3WSWA 2ILTA 4CMAA 3VPHA 4RLSA 4FJ2A 1T4DA 4IS3A 4WLNA 2JL1A 2RHRA 4PLHA 4J43A 1GL3A 3ICCA 3NT5A 3GGOA 4TZTA 3GN1A 3O03A 2ZQZA 4JX8A 4KUEA 4OOEA 4L75A 1VC2A 1QKIA 2BFAA 4IM7A 3E48A 4WKGA 1KVRA 1GZ3A 3OP4A 1P1JA 3TRIA 2DUWA 2YHIA 4FD3A 5L9AA 2X0RA 3JQ9A 2DTXA 5EJ2A 2OORA 1ML3A 4GX2A 1PIWA 4N7RA 2YYYA 4IINA 5JE8A 5BSGA 3DBRA 5JFOA 3HDHA 1Z7BA 4CR6A 4D46A 3EGOA 2WD7B 4AJJA 4NZ9A 3LT0A 3AU8A 3OF2A 5A9RA 3JD2A 1QRRA 3N7UA 2WTBA 4JJIA 3FCOA 3VH2A 3WJ7A 2X58A 1N7HA 1GCOA 2NU8A 2VYVD 3PHHA 5DCYA 3QVOA 3K73O 2IODA 3E5MA 4IIVA 3CIFA 1WAMA 3BA1A 3OH8A 4ESOA 1U7HA 4IGFA 3OQ1A 3WGYA 1X15A 3WGQA 4E3ZA 1GV0A 1PQWA 3F4LA 2OFPA 1YRLA 3AFNA 4CLRA 1X0VA 4D79A 4CMBA 3JQDA 4P4GA 5B4UA 1XLTA 3HDJA 3WWZA 2ZB8A 3C24A 4B8WA 3ANMA 4Q3AA 4HXYA 5JDIA 1LLDA 2Q45A 3TDKA 4CV2A 1NTOA 4KUGA 1BVRA 3RFVA 2GDZA 4MJLA 3GH3A 3DO5A 4AJOA 5THKA 3PDJA 5TC4A 5A03A 1DO8A 1WVGA 3UAGA 1NVTA 4KWHA 2FP4A 4CLDA 3FPCA 4O1MA 1TT7A 2GLXA 4RF2A 3RAJA 3RUIA 3GNQA 1F17A 4R5MA 1V9LA 1M75A 4CLRB 4W82A 3MWEB 4Z0TA 1LX6A 2PY6A 5T6BA 4R1SA 5CDYA 4FC7A 1JW9B 3CTMA 1PJTA 2GZ3A 3F1KA 4J1SA 3W6ZA 4EITA 2G76A 1E7WA 2VOEA 1JU9A 1EFKA 3WYCA 4E2ZA 3AJRA 3ON5A 4WUVA 4NIMA 3RASA 4GWGA 4ZN6A 1YOVB 2AXQA 1E92A 2IEBA 4YA6A 4NBVA 1H5QA 5I7EA 2PZJA 1PGJA 1HDCA 1E1MA 2HRZA 2NADA 4MVJI 4BO8A 1GAEO 1E3WA 4OH1A 4M49A 4E5MA 2Y93A 3GVHA 3UFXA 3COSA 3ZH2A 2HMWA 3GVXA 4OQYA 1X14A 3I9JA 1NM5A 4YT5A 3WGIA 1PTJA 1EFLA 5JDCA 1PGQA 4ID9A 1RYEA 3PQEA 3TJRA 2EW2A 1HF3A 3DTTA 3TQHA 3WTCA 4WLFA 3HFGA 1V0JA 3G17A 4X54A 4P8RA 1Y8QB 3JTMA 4BNYA 4B3IA 3JCZA 4WECA 3VTFA 3UCEA 1GADO 1H0KA 4Z3DA 1NP3A 1ZK1A 1QYDA 1EBUA 1IHYA 5TJ9A 4RVFA 1YL7A 3DC2A 3BMQB 1R4NB 2JCYA 1AXGA 3A9WA 3PWKA 1BHSA 2O4UX 1ZEJA 2VUSA 4HFRA 4CODB 1JA9A 4M89A 4OGWA 4BNTA 4YJHA 4GKBA 3L4SO 4JQCA 3ZNOA 1Q0HA 3VPFA 4DYDA 1IPFA 2GASA 3ZHYA 4EZBA 3DHEA 1R4NA 1ZH8A 1Y5MA 5JMPA 1NHGA 3DOOA 4BQRA 1PS9A 3VVBA 3HDYA 1TT5B 3H5RA 3QVXA 3D7LA 1GYPA 1U3WA 5A5EA 4OQZA 1PJ2A 2E37A 4OSOA 2B69A 2UAGA 1HE3A 1WDMA 1K3TA 2CF5A 1MA0A 4DLBA 5ILOA 3GEDA 4YRAA 1ENOA 2YQ5A 3ONEA 3ZGYA 5CDGA 3WQQA 5ENDA 5JYEA 3ZN2A 2PA3A 4XIYA 2CVQA 4EUHA 3PWZA 1BW9A 3P2OA 4R69A 3ASUA 2CVOA 3E03A 1T24A 4RF4A 1QYXA 4BNHA 3EK2A 4ILKA 1EVIA 2EW8A 3GEGA 3LDHA 1J5PA 2BI7A 2D4AA 4QTZA 5G0WA 1W8DA 3I5MA 2EP5A 5JBIA 3VTZA 3HHPA 3CINA 3BIOA 3QHAA 4R01A 3ZCXA 5JC8A 3JYOA 1K5HA 1VSUA 2AQ8A 3QIVA 1ZSYA 2VHZA 5DZSA 5BSEA 1XA0A 4IQ0A 5L51A 4D43A 1WMBA 4LSWA 4ZU3A 5JDIC 4B4UA 4BNGA 3EAGA 2B83A 3WLFA 4OAQA 3U0BA 2J3IA 1U3VA 5IDQA 4WLEA 3O4RA 3DB2A 2VZ0A 5COQA 1C0KA 3JQAB 4KQXA 4W4TA 3TZQA 1YS4A 1I30A 3KVOA 1WMAA 1DSSG 2H5LA 1MG0A 3FD8A 3L9XA 3NJ8A 3VDQA 3VKUA 3BTVA 1LSJA 3BMQA 1N2SA 3WGTA 3NYWA 3U5TA 3LC1O 1A5ZA 1ZIDA 3ONDA 2HJRA 1J49A 3C85A 3DBHA 4A27A 4G65A 2HK7A 1U4OA 3H2SA 3S2EA 3HWRA 1B14A 4J16A 1XU7A 4XYBA 1HWYA 3LU1A 4IMRA 4BNMA 5G0VA 1DC4A 1U28A 4FFRA 1LQTA 2XXBA 2Q1WA 2F1KA 2NV6A 3GT0A 3U3XA 4RJTA 1E3WB 1T2FA 5FF9A 3F1LA 1PJ3A 2GYYA 2P91A 2H6EA 4QX6A 2V7PA 5DULA 2EJWA 2FSSA 4Z0HO 3MEQA 3PHJA 2VOJA 1PR3A 3ENNA 3H4VA 1QYWA 3RBZA 2Z5LA 3ENKA 2C07A 5COAA 4XYLA 1V3TA 1DDOA 1EUZA 2AE2A 2C59A 3QVSA 1I2ZA 2J5RA 2B37A 4HV4A 3Q0EA 4XYMA 4AJ4A 4AJPA 4YAIA 2X1HA 4NI5A 3VHRA 4F46A 1SZJG 1Z74A 4DLAA 3IJRA 3GNSA 3W8FA 1PJLA 1VL0A 4DGSA 3AUTA 1C1DB 4IUYA 5JCXA 1N9GA 4GVXA 5F5NA 3OJOA 3PK0A 3NJ4A 2D1YA 4YACA 4CM7A 5L7WA 5DF1A 3TN7A 4XB2A 4IS2A 4PG6A 5AOVA 1ID1A 1U4SA 3LVFO 4JBIA 3DBLB 1LC3A 1SC6A 1I32A 1RM3A 2HMTA 2W2LA 3QW2A 4TQGA 3FHLA 3WBFA 4PN3A 3OFSA 3KV3O 3DMTA 1DIBA 2Y99A 5GZ6A 3WIDA 3IMFA 4JJFA 3RBXA 3RKUA 3WB9A 1CRWG 3CSDA 1N9GB 2X23A 4H7PA 4QQRA 4A0SA 1Q0QA 3TFQA 3DONA 1W0CA 3H5AA 3PTZA 2YV2A 1NPTO 5A9TA 5BQFA 2Y1CA 4CPDA 1GEGA 3VZPA 4Y67A 1YDWA 3ZZNA 1HLDA 1SOVA 4PGFA 3I9LA 3R3JA 4WASA 3DZJA 2A4KA 4HFNA 2AG8A 4XA8A 2VRCA 3K6JA 1KIFA 4NBWA 1X13A 4KZPA 1XKQA 1D3AA 4XJTA 2R6JA 2JJYA 1ISHA 2RBEA 3VKVA 2VCYA 1P0FA 5I9NA 2NNLD 3L4BC 4J6FA 1SEVA 3RKRA 4M86A 1B15A 4R51A 2H63A 2W2LD 3GZNB 1Q7CA 3GFBA 3RUHA 1WWKA 1F0YA 5L3ZA 3F6YA 4ZRNA 1LNQA 3QQPA 3U4IA 5I7VA 1B8VA 3V2UA 3ORFA 3IAHA 1Y6JA 1NPYA 3G49A 3G3EA 1JN0A 1DPGA 5KVQA 5TIIA 2RHCA 4ZQEA 3PHGA 1TT5A 1XEAA 3RROA 1ISIA 1UP6A 4J7CA 4MVJA 3SLKA 5IN5A 1RYDA 4XGKA 1Y81A 1NFFA 3HUDA 2YJZA 3U4HA 4K9DA 1ZK2A 3QE3A 3QY9A 5L40A 4WLVA 1CF2O 4XB1A 1JAXA 4BO9A 2QRLA 3GNTA 5CG2A 3I9KA 3UW3A 1H2HA 9LDBA 5I8WA 4A26A 3U49A 1KEPA 3KBOA 2GGSA 2BFMA 4PLWA 4NU6A 4CMCA 4E0BA 1GPJA 3OSUA 1E1NA 2OUIA 1LJ8A 5A1TA 3KEQA 4BIIA 5DDIP 3KRTA 4N18A 1QV7A 3X2FA 3MJTA 5CDUA 5IFLA 5T5QA 5C7OO 3AM5A 4NFHA 2PNFA 1IHXA 2O7SA 4FSHA 2HK9A 4ZRMA 3W1VA 4MKRA 4XGNA 2YFHA 3PJDA 4DMMA 2Q1SA 8LDHA 5KJ1A 4MKZA 3U9LA 3WOHA 5JAZA 2QZZA 2TMDA 4LVCA 1GUZA 2B5WA 4TRJA 2RIRA 2WYVA 4I8XA 4EEXA 1B26A 4O0LA 4NMHA 1EE2A 3GUCA 1HT0A 3KHUA 5K0ZA 1CDOA 4G2NA 3ZU4A 3I9MA 3OJFA 2VWQA 1EK5A 2IYPA 1AUPA 1SB8A 5BNTA 1B3BA 5IZCC 5JXWA 1NPDA 3KYDA 5TJHA 3WGGA 2IXAA 4IDGA 3NTQA 2VT3A 4BNLA 2WE7A 3DAPA 3VPGA 3INTA 4TZKA 3W4IA 4RPKA 3MWDB 3G79A 3D5QA 1WDLA 2W4QA 2C5EA 3DL2A 1HE4A 4AL4A 3KSUA 1I2BA 4U0KA 1UDAA 4UVGA 1IZ0A 5G4KB 3D64A 2YQ4A 3PYXA 3ZU2A 3QWFA 4CJXA 1Z6ZA 4NU5A 4N5NA 2BFPA 1IPEA 2AQHA 1AE1A 4WNIA 1HRDA 4A03A 1E77A 1HDRA 2CNBA 2DBZA 3H5NA 3FNEA 2QHXA 1I3NA 1I3KA 3BXXA 3I4FA 1HZJA 4L4RA 3FNHA 3ZNNA 1PGNA 3WIEA 4BB5A 1O0SA 1B8UA 1K6XA 5K6AA 3GF4A 3QV1A 4QUKA 2GUGA 3GRKA 1OMOA 3JQAA 3V2GA 1R0LA 3NTOA 4FPXA 1HYEA 1BSVA 3OIGA 3Q6IA 3P5SA 2O3RA 4PG7A 4FIZA 1FF9A 3G1UA 4FS3A 4N54A 1JQBA 4CMGA 4M1QA 1ZVMA 3HFSA 4QFDA 1W6UA 2WE8A 5B4TA 3LK7A 3JQ8A 4RO0A 4Z9XA 3MJCA 2FPGA 4FFLA 4ITUA 4E32A 5T67A 4YAEA 1EEHA 3UCFA 3U4CA 3O8QB 4XR4A 4YXFA 2SCUA 2PKQO 4XIJA 1HDYA 4YT4A 1FJHA 2BGLA 2D5CA 2GF2A 4HY3A 4EJ0A 4L4SA 4D3DA 1Q7BA 1A4IA 3RQSA 1PJ4A 5CG1A 1ISGA 1LDEA 2QRKA 1NQAO 3LLVA 1EE9A 3WG9A 1RM5A 3GR6A 3IQDB 2HDHA 2XF8A 4CM9A 1ZSNA 4EGFA 2BELA 4MVJP 2BRUA 1D1SA 1XDWA 3GDFA 3B70A 3VH4A 1MGOA 4GLOA 1Q7GA 4MVJH 4CUJA 3I23A 2NTNA 3SC6A 1E6EA 4FFOA 3R0IA 1LDMA 3PJEA 4W99A 1ONOA 5TNXA 4YB8A 2YW9A 2DPGA 5EN4A 2P4QA 4CQLA 1P1RA 3DAFA 3WTBA 5JLAA 1DIRA 1LUAA 1BDBA 1V3UA 5MDHA 4ALMA 4ZQGA 4E12A 2D8AA 3S2GA 4P38A 1R66A 4NG5A 2ZTUA 2WM3A 4J2OA 1R12A 2PZLA 1IUKA 3TWOA 3ZWPA 3IL2A 3GK3A 3F47A 2OL4A 2NVWA 4PLGA 4UVEA 3UICA 4BNKA 4HWKA 1GCUA 1F12A 3JQ7B 3KUXA 1KVQA 2X86A 3F5QA 5L7TA 3TFOA 3ULKA 3ST7A 2P4HX 2W2KA 4PRLA 2HQ1A 2EP7A 1MG5A 4AICA 5B1YA 1KS9A 3QSGA 3FPLA 2HMVA 3NTRA 2YUTA 3WWYA 5IDXA 2HUNA 1M2WA 4J0EA 1DFGA 4FC6A 1A7AA 3VPXA 3ZU5A 4BGEA 1ONNA 4H15A 3JYLA 3M2PA 3QVTA 4HNGA 5BNIA 1DIGA 1RPNA 1RWBA 1I5RA 1W73A 2HRBA 3GEMA 2J5QA 3CZMA 1ZMTA 1OZAA 4HNHA 4D3SA 3PIDA 2BHLA 1GZ6A 4R5HA 3DTYA 1H6CA 5F3RA 1EMDA 2FR8A 4YR9A 1J4AA 1ONPA 1PL8A 1NR7A 3PHLA 5A3VA 3S1LA 4KQWA 4BO3A 2Q99A 2V65A 4R1UA 3DZBA 2EGGA 3TL3A 2IZZA 2JD2A 2I99A 4DIOA 4DLLA 1T26A 5JC1A 5L95A 2R00A 3DFUA 1E3IA 4E13A 3DXFA 1PWZA 3TZKA 2GZ1A 2EKPA 4RORA 4E5NA 4O6VA 3NDRA 2PKQP 2XOXA 3KZVA 3PP8A 3MJSA 3ZWWA 2Z95A 4RPJA 3LQFA 2J6IA 1SOWA 1YJQA 2PLAA 4JIGA 3C1TA 1ZUD1 3Q3CA 3QA9A 3SLGA 1JWAB 1Z7EA 4BO0A 4WLOA 4YJGA 3ZWOA 4OIMA 3O9ZA 1YDEA 1DHRA 4BNWA 1HSOA 4C7KA 4J4HA 4MVJD 3DBLA 3IKTA 1YXMA 1A7KA 4PZDA 3N74A 2QIOA 1XQ6A 2AG5A 3X2EA 1IL0A 4XQ9A 1BXZA 1ZBQA 2Q50A 1GYRA 2GNAA 1C3VA 1E7YA 1YKFA 2DTEA 3IIEA 3HQ4O 1HYGA 1IYZA 1HETA 3EVTA 1KY5A 1NAIA 2RAFA 4JGBA 2B35A 2JFHA 4Z9FA 1P77A 1M6WA 1WP4A 1LRLA 3H9UA 3NAQA 2C0CA 4NBTA 1BMDA 1R6DA 3ZWMA 5J23A 3JQ9C 4J0FA 4QFCA 3V1YA 2E48A 2HK8A 1KVUA 1WDKA 4UEKA 4F6CA 2CVZA 2CDAA 1Z45A 1EVJA 5JAQA 4R3NA 4BO6A 5KJFA 2VYNA 3WGOA 3B6ZA 2A35A 4GX1A 4H16A 5TSDA 1BW9B 3UN1A 3T7EA 4LRTB 4FCCA 3ZWYA 3ZW9A 2ET6A 4Y8VA 3L6EA 1F8FA 3ROPA 3MCVA 1U2DA 3CPSA 4XX0A 2YHIB 4QXMA 2NSDA 3PVZA 5HBRA 4J7XA 3GHHA 3DZKA 5CDSA 2D5AA 4PLPA 5FFFA 4J49A 1H6DA 3FBGA 3RC2A 4MVJE 2QX7A 5KVSA 5JAMA 4L8VA 1UAGA 1UZNA 4GVLA 3JQBC 1CQJA 1Y8RA 4RPHA 2B4TO 4LGVA 4RPGA 1YBAA 3AY7A 2CSUA 3WNVA 1Z82A 2VZ9A 5CPFA 1EUDA 3RSHA 4R16A 5JO9A 3BYZA 3EC7A 4E5PA 5IF3A 2VQ3A 3FTPA 1EBFA 1PL6A 2J5KA 5L4NA 4M55A 3ZHZA 2C2YA 2HU2A 2ZTMA 4MDHA 3A28A 1KETA 5EQFA 3TPCA 3V5NA 2Z1NA 1PS8A 3WGHA 4DC0A 4BNNA 1GV1A 1MV8A 4RDHA 1SNYA 4ONEA 1GEEA 2NVUA 1BWSA 2NU9A 1DOHA 3JQFC 4LW8A 4LCJA 1GQYA 1GU7A 4AJHA 3DBVO 1GDHA 3WYBA 3ZWNA 2D3TA 4D44A 2YV3A 4AJ2A 5BNFA 1T2AA 4E5YA 3E18A 1PGPA 3NGXA 3ZHBA 2ZTLA 3PLNA 4NJMA 3AM3A 4J3FA 1UZLA 4K6CA 3FF4A 5HTOA 1P33A 5FI5A 1LRKA 4YVFA 3RFTA 5BSFA 1XIVA 1Y9EA 2G5CA 2O2SA 5L45A 1ENPA 3OEYA 5IZCA 1PQPA 5A05A 4UVIA 4RVDA 3ITDA 1YWGO 1JKFA 1LSOA 4MP8A 4TKLA 4UVDA 2HMSA 1PU2A 2X0NA 5B12A 2J3HA 4BGIA 4IJWA 3IOYA 1XHLA 5F1KA 3LC7O 2QQ5A 1DJNA 4ALNA 2C29D 4W7IA 4B7CA 3GZ4A 2JFFA 3NDIA 4DRYA 5A4DA 4HKTA 4TRNA 4FN4A 5JY6A 2AE1A 3QWIA 2DC1A 4BVAA 4NDNE 5TGDA 1GR0A 5T8KC 3O8QA 4LMPA 2PH5A 3LF2A 4L0QA 4R9RA 4AVYA 4CMKA 1LEHA 1SCUA 3VAZA 4E5KA 4CUZA 1KVTA 1U3TA 1L7DA 4GGPA 1ZK4A 3OA0A 1G6KA 5K6AC 3E9QA 3WYEA 2OBYA 4RZIA 1K0UA 4M54A 4LSMA 1IULA 1YQXA 3S2IA 4EUEA 1PR9A 3UXYA 4KUHA 3WICA 4ND1A 5HRUA 4NBUA 2WMDA 4DREA 4J4BA 1Y8QA 3DBRB 3OJEA 4FBGA 4IJKA 4CM3A 3GUYA 3AM4A 4IDCA 3ANLA 1YB4A 1KC1A 2Y67A 5THQA 5IDWA 4EI2A 5G4LA 4YCAA 2X22A 1D7OA 4INAA 2PD4A 4BNVA 5KJCA 4XQEA 3GAFA 1G0NA 1R15A 3JQGA 3U62A 4GQAA 5JO0A 3GGPA 2NWQA 4BNUA 2WDZA 4A7PA 3ROMA 1OFGA 2Y1FA 3DHYA 5GY7A 4KP7A 3DZHA 4IXTA 4GSKA 1RJWA 1ZNQO 4JP2A 1YOVA 4R41A 3QVWA 4LMRA 3W8EA 4O63O 4RGBA 2AA3A 2PV7A 3RC9A 3WLEA 3F46A 1XU9A 3M6IA 4MKXA 3QP9A 3ETGA 1VL6A 2I67A 4R4JA 3NGLA 5AXBA 1BRMA 4GAEA 3OHSX 4OXYA 4IPTA 2O3JA 1NQOA 1PJQA 1U1IA 4IY1A 1E7QA 5EMHA 1TLTA 2OO5A 5H82A 4BKUA 2O23A 3H9GA 3PWSA 3NX4A 4BB6A 4I5DA 3CEAA 4BNZA 2EKQA 4GKVA 1UXGA 4II3A 4BKOA 3E5RA 5EIOA 3A06A 1LBEA 2FSVA 4Z9YA 5A3JA 1PWXA 5EL0A 3CH6A 2RH8A 3GRPA 4Y6PA 3OECA 4HFMA 3PGJA 4JROA 1KEVA 3GPIA 3DZGA 4XRRA 5G0UA 3V1UA 4MOWA 5KKAA 1FDUA 1TI7A 3AUAA 3E82A 1T2CA 3AI1A 2P9GA 4YQYA 4YJDA 3K30A 1LSUA 1NHWA 3C8MA 4U0JA 1LSSA 1RM0A 1WPQA 2Y1DA 4YTEA 3H8VA 5DBIA 3VH1A 4YWJA 2DBVO 1DIHA 4IQGA 4J2HA 1DAOA 3DDNA 3FRJA 4FDAA 2WJPA 4CV1A 5C5IA 1ADGA 1D4FA 2W2KB 4NK5A 4ZA2A 3GAZA 2VHXA 3OJ0A 1EVYA 3RCBA 1CERA 2J8ZA 5ADHA 1YVEI 2PK3A 2PGDA 1NVGA 5COBA 3TOXA 5JMWA 3A4VA 1U3UA 2P9EA 3OA2A 4IZIA 4II2A 4K26A 1XELA 2OZPA 4TRMA 1AHIA 3FWNA 3NT4A 2VN8A 4DIBA 4PZEA 5FI3A 3Q2KA 3VC7A 1Q0LA 4B3HA 4MO2A 4YRBA 3BMOB 4XQCA 3CUKA 3MZ0A 2EKLA 4R68A 1HSZA 3HADA 3Q1LA 1ARZA 7MDHA 1JVBA 2NTVA 3I9OA 1HZZA 2Y0EA 1Y5RA 2O2YA 2HJSA 2DAPA 2HMUA 1GYQA 1FXSA 1LI4A 4OM8A 3SC4A 2DM6A 3AW9A 2HKIA 1KYQA 3BHIA 5FEUA 1AXEA 2Q49A 1PQUA 1C0LA 1A27A 1GQ2A 4K6FA 4CLOB 4D0SA 3HE3A 1YE3A 3WS7A 1UUFA 2DQ4A 4LK3A 4WOJA 3AI2A 4BNFA 4D3FA 3AOEA 2VNSA 3PYLA 3PPIA 4RVUA 1E3EA 1E3JA 1LA2A 1R0SA 3L4BA 1C1XB 4DWVA 3TZCA 4FB5A 3ONFA 2QZ9A 4R1TA 5IXSA 3DFZA 4EBFA 3D0OA 1A71A 3Q2IA 1BVUA 3NKLA 4DA9A 4F45A 1H9BA 8ADHA 3ABIA 1QORA 4FJ0A 1ZMOA 1EQUA 4PG5A 1I33A 1O6ZA 4FJ1A 5IDYA 2NVUB 4CMIA 4UUPA 1T1SA 1R0KA 1WXDA 3ASVA 3H9JA 1LU9A 2RH4A 3W4JA 1H6BA 1T4BA 1ZZEA 3AUUA 2P68A 3ZWVA 4MPDA 1AGNA 3JQGB 4D42A 2E82A 2OGUA 3GVIA 3QJ5A 3UOGA 2YDYA 1YO6A 1HLPA 2EG9A 7ADHA 1WW8A 3OQBA 2OHXA 3C1OA 1Q1NA 2GN9A 5T57A 3B20A 1ZXLA 1DRWA 2B5VA 3EW7A 2BKAA 1NQ5A 4CQLB 5I8ZA 3SJUA 4Z6KA 3PI7A 2X4GA 3OIFA 4UEOA 2VRBA 2B36A 2DFDA 3KB6A 3CKYA 2DLDA 5DT9A 4MIOA 1P1HA 2IXBA 4IJUA 4JCOA 1DC6A 4LVUA 5U1PA 1ZFNA 1UAYA 4WOKA 4IDEA 1QV6A 2FZEA 2WSBA 1ZEMA 2VYND 1RKXA 3HJAA 3F4BA 2UDPA 3H2ZA 1P45A 4K1LA 2ZCUA 3WQSB 1MXHA 4BMSA 1O94A 4A2CA 4B7UA 3RUEA 3STHA 5JAIA 3T7CA 3LF1A 2V6FA 1VKNA 3UKOA 1QP8A 1EZ4A 3QWBA 1NVMB 1ZK0A 1HDOA 4DPLA 3E6AA 3AK4A 5KNLA 1LRJA 2AQIA 3N58A 3JD4A 2DT5A 3NT2A 4RDIA 5DP2A 3SX2A 3WGZA 4OKNA 2EXXA 4YQZA 4CM8B 3I83A 4L76A 4JNKA 4Y6SA 4A5OA 1LDBA 3K31A 4ZQBA 3QRWA 3IC5A 1FK8A 2JCXA 1E6UA 4BGUA 3OICA 2LDBA 1UXIA 1UP7A 2NM0A 4BKPA 2Y66A 5ER9A 4LISA 1XR3A 1BXGA 4UEJA 3WJAA 3P2YA 3VOSA 1E7RA 3TF5A 2PD6A 1P74A 1IOLA 2QG4A 1P1IA 3E1KA 1YB5A 1GY8A 1N7GA 4KMSA 4JJGA 4HP8A 1ZXBA 3RU9A 3S8MA 4WPGA 4ND2A 1Y1PA 3OMLA 3TZ6A 3ZU3A 1BXGB 2OP1A 2X5KO 1T1RA 1ADBA 1GFSA 3BHMA 5CP8A 4E2YA 4BO7A 2FPPA 3PZBA 1VKOA 2X0IA 1NR1A 1VLLA 2OMEA 4IDFA 3PJGA 4DTIA 2YFQA 2GN8A 4ND3A 3I9NA 4BO4A 2AHRA 5H81A 2YV1A 4W9NC 1KBZA 3W6UA 1MXFA 3GHYA 4WEQA 1I2CA 1ZCJA 3FBTA 4WLUA 2ZB7A 1S7CA 3IJPA 4Q3EA 2EGHA 1YGYA 1M76A 4TSKA 1JVSA 2FY8A 1I3MA 5F21A 4ZVVA 3QWHA 2EIHA 4J1NA 4R9SA 2X8LA 3Q9NA 1T2EA 2I3GA 3GY0A 4UREA 2EHDA 4OXNA 1HXHA 1MP0A 1SO8A 4E31A 2GPTA 5ES3A 4D7AA 1XWFA 1U5AA 2R00C 4FR5A 1QYCA 1NQTA 2IDZA 1HE5A 4U5QA 4E6PA 2DUUA 1SB9A 4W7HA 1KEUA 3L6DA 5JCJA 2DU8A 2LDXA 3KO8A 3GOHA 4IDAA 4E21A 3H3FA 4IDBA 1YJ8A 3MOGA 2G82A 3KSDO 1BGVA 2BLLA 1AHHA 3ZDFA 1LTHR 2IE0A 3OM9A 1PJCA 3EZLA 3BMNB 3VZQA 5JCJD 4QECA 3VH3A 1Z73A 2QRJA 3AY3A 3C7DB 4ZGWA 1EK6A 3DR3A 1NNUA 4GMGA 3DHNA 1VSVA 5JPIA 1U8FO 4CM8A 2YZ7A 4N5MA 1P9LA 2PZKA 4XGIA 3V2HA 1J6UA 2X5JO 1GUYA 3HSKA 1O8CA 3F9IA 4PLVA 3L6OO 4CV0A 5I9MA 4QO7A 2G17A 2I65A 3RU7A 5JS6A 5TS3A 2EF1A 4AJEA 5I7FA 4HUJA 2UV8A 4YDRA 3EZYA 3EUWA 1VI2A 2E49A 3IKVA 2PD3A 4YJHB 1ISFA 2V6BA 4URFA 5CPBA 4XDZA 5EQDA 4BL5A 1TVEA 1MC4A 1QG6A 5FWNA 2XAAA 2AEJA 3KOUA 1FMCA 2VUTA 2FR1A 2GN4A 4BO1A 5CHEA 4NK4A 2I9PA 1P31A 2Y1GA 4J9UE 4MVJF 2ZCVA 2NU6A 1R16A 2VUUA 2GRAA 2DPHA 4I1IA 4ND4A 2BD0A 4CV3A 2X7HA 4AJ1A 1B8PA 1UXJA 4DQVA 1A72A 3JD3A 5CFZA 1BXKA 3DZIA 5ITWA 4JN6B 4A73A 5KJ6A 1ADCA 2JD0A 5I9LA 1ORRA 1UZMA 1QYVA 2GN6A 2Q2VA 1E7MA 4UULA 4D45A 1H93A 4IBOA 3VZRA 4UVHA 4YRDA 4J1TA 1IE3A 2CZCA 3BMOA 3NV9A 2C20A 1U5CA 1P44A 1U8XX 5F1PA 3AU9A 3TNLA 2FR0A 1CWUA 4E2XA 3NUGA 2PFGA 1V35A 1Y7TA 4WCFA 3ANNA 3DZFA 3RUDA 1DC5A 3BMCB 4U7WA 5DOVA 4BV9A 3GLQA 2V6GA 4TKMA 3PGXA 1ZW1A 2CUKA 3H9QA 3KYCB 4KOAA 3WX0A 4CM4A 1DBVO 2PWZA 1NWCA 4XQGA 4C7JA 2PZMA 1DC3A 4PG4A 4L74A 1QXSA 9LDTA 3UUWA 2Q1UA 4PLTA 1OBFO 5H83A 3BAZA 3GZNA 3UHAA 4JLWA 2C7GA 4YT8A 5EINA 4R1NA 1NXQA 3S2FA 1ISJA 2NUAA 4K28A 3F5SA 2D59A 3KM0A 4WGGA 3H6KA 1N8KA 3SVTA 4NR0A 4NH4A 4G5HA 1P0CA 4XEHA 2X5OA 3TSCA 5G4KA 4BMNA 2O4CA 3I6IA 1VM6A 4E30A 5CEEA 2IYOA 4LCEA 4KTTE 4DQUA 4QEDA 4Y9DA 1EUCA 5T64A 1YB1A 1LLUA 3R1IA 1KVSA 1NBOA 5KVVA 5G0TA 1TB4A 1Z75A 1VJ0A 4Y6RA 3HNPA 1HDXA 1DAPA 3C7CB 3VVCA 5KVCA 2UYYA 4GH5A 1HTBA 1HE2A 5DP1A 1BG6A 3AOEC 4CR8A 3DMTC 2I3AA 2VYVA 4J91A 3JD0A 2I6TA 3K2BA 3U09A 4YPOA 3O26A 5GZ3A 1EDOA 1PJSA 5AXAA 1H94A 1B3RA 4RF3A 3PEFA 4ZD6A 4TRRA 1VJ1A 3JQBA 3ZV4A 3RWBA 3BZUA 4P22A 3RVDA 4O59O 4Q3NA 1IY8A 1UXKA 2E6UX 2O7QA 3UGKA 4CR7A 5C7LO 1C1DA 5T8KA 1ZJZA 1PX0A 4MIYA 2QYSA 3H9EO 3P19A 4Q3CA 3D4OA 4GL4A 3EY4A 1N92A 1DFHA 1G1AA 4OHUA 2D2IA 1MB4A 3LYLA 1K89A 3RUAA 3DEYX 2WD8A 1LDGA 3PXXA 1PZGA 3JQ8B 3K5PA 3RC7A 2JCVA 4I5GA 4YJGB 5TX7A 1B2LA 4EJ6A 2C5AA 3AOGA 2PGJA 2XXJA 5DN9A 1ENYA 5DBFA 4AJNA 3JQ7A 1ZKMA 4CMHA 5L7YA 4I9UA 1U2GA 4OKIA 2O50A 4KDFA 2CDBA 4AJIA 3BTOA 5TF4A 4ALLA 1C0IA 1NYTA 1XGKA 4PVCA 1GPDG 1T2DA 4XJSA 3FR8A 1YBMA 4YAKA 3ZV5A 4EJMA 3CE6A 4DBZA 1E7SA 1XSEA 2UUPA 1E1LA 3ZV6A 3GDGA 4FGWA 3O38A 3ZW8A 4P4NA 1DRUA 2WEKA 3C3XA 2P5YA 1ULSA 4YAJA 3DBHB 1LLQA 1F8GA 3LLSA 4RL6A 2D0IA 3RI3A 1YH3A 4BHTA 2JAHA 1E3SA 1M6HA 1KC3A 4MP3A 2NQ8A 5KWEA 4ROSA 1DJQA 5TT1A 3KSZO 6LDHA 3FTNA 2ZQYA 3F3SA 1QMGA 2RCYA 5BSHA 1O89A 3H65A 2O3QA 4OO3A 3OQ6A 4MVJG 4XDYA 2ZIZA 2BFOA 1L1FA 1JKIA 3ETEA 4ZQHA 2CY0A 2NTJA 3E9NA 2Y05A 2ZKLA 4RZHA 2YDXA 4BKRA 4CM6A 3D1LA 2P9CA 4TVBA 2VNAA 1ZSVA 3KETA 4NHEA 1UR5A 5B37A 1VL8A 4PLYA 1I0ZA 1LC0A 1UJMA 4CM5A 4XZ3A 1UDCA 3GQVA 4WEOA 1MLDA 4Z3KA 3OEWA 4Y98A 5ICSA 3KEOA 4ALJA 1OC2A 1ISMA 1V3VA 1D8AA 2BF7A 5ER6A 4DYVA 1JDJA 3CMMA 5HA5A 3T4XA 1I3LA 3GMDA 5IZ4A 4CLHA 4MIEA 2A92A 2AQKA 1XCBA 2JD1A 4OSPA 5TT0A 5JDCC 4E33A 3SBOA 4RQTA 2FWMX 5GZ1A 4XCVA 1DRVA 1UXHA 2DBQA 1J0XO 1PEDA 1N5DA 1DHTA 2ZJ0A 2BMAA 3G0OA 2CD9A 2TMGA 1CIVA 2JFGA 1Y8RB 3GG9A 3HG7A 3QLJA 4BNJA 4BNXA 5U9CA 2PR2A 1GD1O 3P7MA 4RPLA 1K6IA 1QLJA 2I76A 3PFWO 5ENVA 4TWRA 3Q9UA 2FRDA 1ENZA 1LLCA 4PIVA 1DIAA 3JV7A 2Y68A 3Q11A 1BTOA 5A02A 1V6AA 3W4KA 4U8GA 2A94A 4DBVO 3B1FA 3D3EA 4GMFA 5JW6A 3IS3A 4IIUA 3I4CA 5FYDA 1SMKA 4Z0PA 1HEUA 2O3TA 1A9YA 4NBRA 4YBZA 3WNQA 4BKQA 1D1TA 5AVOA 4WCFB 5EPOA 2AEMA 2E4AA 3IUPA 1E5QA 1SEPA 4QSMA 4YT2A 4ZHSA 5CDTA 3RJ9A 4YYZA 3I1JA 3G1TA 2HCTA 4Q39A 4QO8A 5BR7A 4GPD1 5I7SA 5L4LA 1HDGO 4RLHA 4NFSA 1HYHA 4CM1A 4ZICA 3WQRA 3ETDA 2ZYGA 4W6ZA 1BDMA 2JKVA 4KTVE 1R4MA 4CQMB 3LZ6A 4FOOA 3ITKA 4WCDA 1TEHA 5BT9A 2GR9A 4FFMA 3UVEA 4BS9A 2X9GA 1EDZA 4TMFA 1JAYA 1M67A 3UH1A 4EW6A 2GD1O 3W8DA 3EHEA 3ADPA 3C1AA 3D5TA 4B3JA 2AMFA 5LCXA 4J7UA 5EESA 4B79A 3UCXA 3PRJA 2HSDA 3ZWXA 4QT0A 5HWSA 1SAYA 2O3SA 4YJFA 4BNIA 1NX6A 4DIFA 3KLMX 5JNLA 4XRGA 1PZEA 1PGOA 1DXYA 4U6QA 1EVZA 3WR5A 5DNAA 1QR6A 4CQMA 5KCZA 1I8TA 1FDVA 2H1SA 3D3WB 1KOLA 4DC1A 4OL9A 2JHFA 3GN2A 3EMKA 2A9FA 2PTGA 2DVMA 3L77A 5JSFA 4HBGA 3JD1A 3HB5X 4I9HA 2ZB4A 5MGBA 3K9QO 3TOZA 1B0AA 3JSAA 4HFJA 4YAGA 1O9BA 1C14A 3DAGA 3K92A 5KTKA 4XD2A 4BMVA 5A9SB 1GUFA 3FWZA 1T25A 5IG2A 3B1JA 3BMNA 3FSRA 3LT1A 2DTDA 2Q3EA 4Q3DA 4XWYA 4CMEC 2C54A 4DVJA 5C37A 1XQ1A 1UDBA 3DQPA 4CUKA 1KEWA 2C2XA 2EV9A 3EYWA 4OMUA 4JXKA 1E3LA 4DPMA 5DBGA 3KXDA 1VPDA 4PZCA 4XKJA 1TXGA 1YQGA 2F00A 2FZWA 4BOYA 4EDFA 3RJ5A 2H9IA 1P1FA 2VWHA 1H9AA 4Q3BA 2GCGA 4S3MA 1EQ2A 2IZ0A 2IZ1A 2O3UA 2Q4BA 4B4OA 5AYVA 3GDOA 3MJEA 2X0JA 1RM4A 4PLZA 1A4UA 1OI7A 1PZFA 2QW8A 2G1UA 1WZEA 3FN4A 4GGOA 4E2WA 5U4QA 1I24A 2QYTA 1TA4A 3RUFA 2G0TA 3RUCA 1JKJA 1A9ZA 5K9ZA 1MC5A 1PJBA 3MJ4A 2VTDA 5CAEA 2POQX 1WLYA 3RBVA 3HN7A 4KWIA 3WFJA 4KDEA 3M1LA 2BGMA 3ROKA 1OC4A 3JQEA 3TL2A 3AY6A 2AEFA 3RD5A 1DLIA 3HZZA 3OIDA 3I52A 3JYQA 3UF0A 3TZHA 3NDJA 1NFQA 2VT2A 4ZJUA 4MP6A 1CJCA 4W9NA 2C7VA 3M2TA 4PVDA 4B4VA 1SBYA 3BTSA 1JWBB 4CLOA 3PIIA 3HN2A 3L07A 4IJVA 1UH5A 3OETA 5AQ1A 3ZNQA 4CQMD 2JHGA 2B0JA 3FNGA 6ADHA 2B4RO 2P2SA 1WNTA 4GWKA 4TROA 2FOIA 3LT4A 4O5OA 1JLLA 3ZWBA 4I9NA 2GZ2A 3RC1A 5C7IO 4BGVA 1Q2XA 3K8ZA 2EWMA 3FNFA 4GSLA 3DOJA 3D4NA 3BHJA 3GC6A 2CDCA 3GA0A 3QWAA 2XPCA 1IZ9A 4WCFC 1R4MB 1CYDA 4WJZA 2BH9A 1LQUA 4LN1A 2Q4EA 4CM4B 2O48X 4RVHA 3H7AA 2P5UA 3L9WA 3DWFA 3KTDA 1VRWA 4JP3A 4PRKA 1CETA 4WNCA 4GBJA 1LXCA 1P3DA 5A5FA 3SXPA 4IZHA 1DFIA 4RVGA 2FN7A 5HS6A 1W4ZA 3MOIA 2Q2WA 1N1GA 5A04A 4CMIB 1HL3A 2DKNA 2VRCD 2Y0DA 5TRTA 2CMDA 3WMXA 5ITVA 1FDTA 4NQZA 3WXBA 5F1OA 3GVPA 3VPSA 3FR7A 4NPCA 5KKCA 5KJEA 2DBRA 1NWHA 3HB4X 3MTJA 1WZIA 4G81A 4YJFB 5LDGA 3IP1A 2NLOA 1NAHA 2X6TA 2HAEA 1E0DA 1I36A 2EERA 1CEQA 1MUUA 5EERA 4AJKA 1F14A 3HDQA 1IB6A 1OAAA 4XYGA 1DB3A 2I5PO 3GPDG 4FQ8A 4J90A 4EUFA 4F3YA 2Q46A 3I3OA 1F06A 2W8ZA 1E1KA 3PHIA 4M8SA 3JYPA 4D0RA 4CLXA 4DL9A 1B16A 1ZJYA 4RVSA 5L4SA 2VHVA 4S1VA 1PS0A 2OOSA 1U9JA 2FHSA 2OBNA 4BUCA 4R3WA 2V6MA 4EYEA 1X7DA 2DFVA 3RFXA 4FFNA 4YEDA 2PGLA 4D41A 3NRCA 1YL5A 2VHYA 2IRWA 3R6DA 3S55A 4JBGA 3WMWA 4DQXA 1E6WA 3LT2A 5A9SA 4B8ZA 3PYMA 1X7GA 3INRA 1R37A 2I66A 3B1KA 1QLHA 4H3VA 2X9VA 2HLPA 1I01A 3ZNPA 4RV9A 3ZI0A 4PLFA 3IP3A 5IJZA 3PZRA 4N5LA 4HADA 2AW5A 2GERA 1VE9A 3AUSA 4CL3A 3OJLA 5DOZA 3KLPX 1C1XA 3CMCO 1YONA 1K2WA 1GTMA 5AXCA 3H3JA 3NEPX 4AFNA 4IQ8A 3L0DA 3T4EA 3R3SA 2VHWA 5TLSA 5JY1A 3SJ7A 2ZYDA 1NFRA 5IAAA 1LDNA 3MTGA 2ZJ1A 3ADOA 4PFJA 2YHUA 1GZ4A 2C82A 4WK6A 4OXKA 4DXHA 1P1KA 2Z1MA 4R54A 3A14A 3WBBA 2VZ8A 4BV8A 3INGA 5LC1A 2ZTVA 1NASA 5L53A 2IEDA 3VDRA 4HX5A 3D3WA 1XYGA 3PQDA 3PLRA 4TVOA 3GGGA 4GLLA 4J1QA 3PQFA 1H6AA 3K2EA 2ZYAA 1KERA 2CF6A 2NQTA 3D4PA 3MJVA 4IMPA 4PLCA 4A10A 2BGKA 4M87A 1V8BA 3KYCA 3AFMA 1HKUA 3DOCA 5KOIA 1H2BA 2UVDA 4OOFA 3ZV3A 1X0XA 3U4DA 5AXDA 2ZB3A 3ROQA 4P4LA 3AWDA 2NU7A 3E8XA 5C3MA 4XYEA 4L73A 3PFFA 2W98A 4PG8A 4GX5A 4I5EA 5LDHA 2FPIA 2Y0CA 5ICMA 1FDWA 1N1EA 4UUNA 3V1TC 2CFCA 2WD7A 2B4QA 2X9NA 2PH3A 4FGSA 4FFPA 4ALIA 1PSDA 1Y9AA 1O5IA 4RQUA 1JTVA 4NNJA 4NJMB 4IDDA 3AI3A 1X1TA 3E9MA 1YL6A 1XG5A 3A1NA 4C4OA 3IDSA 3BTUA 4IGEA 1DEHA 3CXRA 1YQDA 4AG3A 2OP0A 3FI9A 4UUMA 3LC2O 4AJLA 2Q2QA 4CLEA 2GO1A 4L9RA 3WFIA 4FOSA 1B7GO 1ZO8A 2OXIA 4L4XA 1MFPA 4CM9D 1YBVA 1KY4A 5CEFA 4NJOA 4UUOA 5TQVA 3V8BA 2Y1OA 1GQQA 1U7TA 4ALKA 2EJVA 4BQPA 5CEJA 1UP4A 5HS4A 3JQAD 3LSYA 4OYRA 1E5LA 4CMJA 5G0SA 3PJFA 3EVNA 4E4YA 4DUPA 2UUOA 4MINA 4I08A 1FDSA 4Q9NA 1PL7A 5GMOA 2VWPA 2FMUA 1M66A 4DPKA 4XR9A 4J9VA 1C0PA 2WYWA 3RIHA 1LDYA 2PKRA 4WE3A 3KYDB 3M1AA 4MVJM 3JQCA 4B4WA 4GX0A 2EEZA 1O95A 1ADFA 1K6JA 4GI2A 5F5LA 5A06A 3GVCA 1PZHA 5B4VA 4FW8A 4ZQFA 1DLJA 2Q1TA 2Y1EA 2ZATA 4B7XA 1ZK3A 1X7HA 5JYDA 2BI8A 2VWGA 4JBHA 1OOEA 3SEFA 3WDSA 4ND5A 5DCWA 4OJNA 5G2OA 3C7AA 3PDUA 3GG2A 4IXWA 3IUSA 2JAPA 1G0OA 3I6QA 3GMSA 3VZSA 3ZHXA 3EDMA 3GFGA 1MX3A 3JQ6A 4I5FA 1AN9A 2NVBA 4DMLA 1S6YA 3DMYA 1QSGA 3JYNA 3CZRA 1SPXA 2WWRA 2VTEA 3WSVA 4CL8A 2WYUA 4UAGA 3ZWCA 3ZWAA 3JQFA 2ZK7A 1CQIA 1I10A 1MFZA 3K96A 1HDZA 2J3KA 4LRSB 1ULUA 4EEZA 4NFYA 1VJTA 5ILGA 4JK3A 1L7EA 3KYBA 4CMEA 2R2GA 5IN4A 2GSDA 2HO5A 3BMCA 4RCVA 4BO2A 3OBBA 2NACA 5KIAA 4RF5A 5IXYA 2W90A 2J3JA 2YY7A 1X1EA 4U6SA 4PCVA 5HM8A
chains in the Genus database with same CATH superfamily
2IY9A 1AXRA 2YWGA 3A11A 3KWFA 4J4TA 5E1MA 1R8QA 2WMNB 4JIMA 3WSWA 3V8MA 1MQ9A 1V3QE 1G8KA 5JYCA 3FB1A 2DMRA 3Q98A 3QMMA 2P62A 5B6PA 1TZMA 1J2RA 2RKBA 4FJ2A 4IS3A 1VP9A 2MMCA 3Q85A 4WLNA 5I01A 3K70C 5FR2A 1P4AA 2RHRA 4UCFA 4Z86A 2NPOA 2NXJA 3TEMA 3ICCA 5CJJA 3NT5A 3UJCA 1DMSA 3UV6A 4CI9A 4TZTA 5B3KA 2GILA 3GN1A 1KYZA 3IMGA 1OWPA 1Z34A 3O03A 4JX8A 3RS0A 5B7PA 3KQOA 2LNDA 3IXQA 1G20A 4L75A 2BFAA 1BEZA 1XP8A 4R0NA 2FFAA 4D9HA 3DDHA 3FKSD 3OP4A 3W5AA 1U8AA 2OTCA 3BE6A 1P7PA 2DHEA 5HF8A 3G0DA 5J2UA 2YHIA 3JRXA 4TYQA 2Z4TA 1AO3A 2X0RA 3EW9A 1ZVVA 2J9RA 2PWPA 3JQ9A 4Z7QB 5HJ7A 2HEGA 3IAM1 4MPPA 4X60A 2OHOA 3HRIA 3SR4A 1E4EB 4N7RA 3CCFA 3M9WA 2YYYA 4IINA 5JE8A 3DBRA 3HDHA 1Z7BA 2RHDA 1H1LA 1HUQA 1ZM2A 4S0ZA 3LFUA 4AJJA 3WLHA 4CEHB 3IQZA 2ZGVA 1L5YA 1Y37A 4M0KA 3AU8A 4NV3A 1GUAA 2R48A 4KQGA 1CQXA 1NU8A 4IIJB 5DO9A 2IIBA 2I71A 3IPCA 4JJIA 3FOAA 5DYTA 3K9CA 2HSJA 4GGMX 4IVPA 4FCVA 5C35A 1TM2A 2X58A 1ORHA 4QXQA 5JIBA 4MROA 4JITA 4RHFA 4RTKA 2WD9A 4QU5A 3UK7A 1YRAA 1Z4LA 2VYVD 2A9PA 3PHHA 4PX5A 1MX1A 5JLJA 3EAQA 1S2OA 1WIWA 2V4ZA 3K73O 3NXSA 4NCIA 4PM4A 2IODA 3UWPA 4MQBA 4RA9A 3AEKB 1K92A 2C4NA 1QVRA 2Z8YA 1PFWA 4ESOA 3RVNA 4UEWA 3EXFB 4ZMRA 1MQAA 5EZ6B 3WGYA 5E1BA 4E3ZA 2I3BA 3F4LA 3TKAA 3P96A 1WM1A 1KZHA 1UKVY 2IQ5A 4MVWA 3MUOA 1X0VA 3GLHE 4X97A 4P33A 3PNOA 1BHJA 4I99A 1KHTA 1PKXA 1RKUA 3WWZA 2I1LA 2GN0A 2C03A 2IVFA 2W0MA 3OKAA 4Q9IA 1XZMA 1EG7A 1QHYA 4L2IB 2HT6A 4NOLA 1T9GS 4ZKEA 4KR0A 4L27A 4Q7EA 2BE7A 1LLDA 1WX1A 5BSWA 1NTOA 1V1RB 4AD8A 4KQKA 1BVRA 3CLUD 3G9QA 4LGYA 5IEBA 3RFVA 1D4ZA 2EDCA 3L06A 621PA 4B87A 5KYKA 1QP7A 1X1DA 2FVXA 3HCOA 2CK3D 1QHIA 5KNCH 4KWHA 4MDFA 4C3VA 5C9ZA 1ZI9A 5FA6A 4A8PA 1X19A 1P19A 2QLNA 3ORQA 5KO2A 4RF2A 3RUIA 1L7NA 1MU0A 3BGOS 3NHWA 5SV2A 1PW5A 2BBSA 2ZROA 4H18A 5ED4A 4ARZA 4JQZA 1F17A 1ZJ5A 5HF6A 3Q2OA 4R5MA 5JAOA 1M75A 4HTAA 3WL8A 1JV2B 1BN6A 3O7WA 4Z0TA 4R1SA 3CM0A 4DWOA 4B35A 4FC7A 1GP2A 1JW9B 3LY8A 3CTMA 4OB8A 4UU7A 1RRCA 1ZJJA 1SELA 2VOEA 2B61A 3WYCA 1ZM7A 1G8GA 3ANXA 1RJDA 2A0KA 3H1PA 3NKFA 1QHHA 1QPBA 3G88A 3CZAA 3W2IA 1YOVB 2AXQA 3C6QA 2PT6A 4NBVA 2PSHA 1H5QA 2JLSA 1E9CA 2XCQA 4F1KA 1G8FA 1Y8AA 4MW9A 5I7UA 1ZICA 3SZRA 4I3HA 3TD6A 2VBFA 1CU1A 1HDCA 5K51A 4CF6A 1AQNA 2ZM5A 3EHDA 2HRZA 3W9UA 2NADA 4MVJI 1E2GA 1YOBA 4Z8YA 1E3WA 1H1LB 4RZXA 5JXGA 2FR8C 4DRXA 1Z7WA 3QE4A 2WT4A 2VYFA 1X14A 3K1ZA 3OFND 3SHTA 4M9RA 5G41A 3OLYA 2DR3A 4X5OA 2COUA 1RYEA 1PTKA 4GP6A 2UZ1A 1RWOA 2EW2A 1HF3A 1QIDA 1OY1A 2QWXA 2R6AA 3HFGA 4G0UA 1XTBA 3QE0A 2CLOB 1BA2A 4LJYA 4U2FA 3U7EB 4B3IA 4WESA 1CRQA 4RU1A 5FAKA 1Y6GA 4WECA 3A1CA 1GADO 3MTEA 3UCEA 3DCJA 1BHO1 4BWFB 3R20A 3WB0A 1GL9B 1ZK1A 2I2FA 1EBUA 1IHYA 2DWPA 3FCCA 3K1YA 4D02A 1YL7A 4A8JA 1O6CA 3PU6A 2CHQA 1M74A 2GD6A 3PWKA 4F11A 4RD6A 2HCFA 3K0CC 3W3AH 3FOZA 1XAHA 1PFUA 2VUSA 1JA9A 4M89A 1R50A 4PTYA 3AG6A 1QIIA 3A58B 3G2QA 3HFRA 4GKBA 4EJ2A 4A0RA 5EGSA 4C2BA 1VLZA 3OCWA 1BXRA 1GKLA 4V3BA 3CX4A 4DYDA 1CKEA 4NYMQ 3WGNA 1L5HA 3ZHYA 1NM5C 3L40A 4OQDA 1CZUA 3T3MB 1GITA 5IYZB 2CNDA 1O54A 4BQRA 5CCDA 3EXIB 5KWSA 5FUXA 3VVBA 4I6GA 1NG1A 1DTWB 1WXXA 3R75A 4HDMB 3H42B 3OVMA 1I4WA 3AERB 3SJCA 3K35A 4F72A 2OFOA 4WOPA 2ZYRA 4RJ2A 4NU0A 4QDZA 1Y7LA 3RGWS 1ND5A 3JWHA 1MA0A 5ILOA 3IDQA 3EG5A 3EE6A 3GEDA 1OGJA 2O5EA 3GGJA 5F5XA 1IDOA 3OZIA 3E9YA 5EE0A 2ATCA 4COKA 1TJ4A 2G70A 2I6FA 3KD3A 4OJMX 5T4EA 3ZN2A 3LCJA 3AMVA 4KE8A 1HNXB 5ALPA 4ZTBA 2XDQA 2HX1A 5IHXA 1NW3A 3X43A 3E03A 4MI3A 1Y1RA 2ODNA 4BNHA 1QYXA 3EC2A 1IWBB 3ID6C 5I47A 4JI8B 4ILKA 3AHIA 4BFXA 1J5PA 3IV7A 2D4AA 1AQ6A 5G0WA 3L8ZA 1W8DA 2BAGA 4UDXX 5ELXA 1VJDA 2GWHA 1LBSA 1ZIYA 3BICA 4M7PA 5ALZA 2CB9A 2F3PA 2IC5A 4LJ9A 4R8KA 3JYOA 4EPWA 5B5SA 3AR2A 1K5HA 2QQEA 2AQ8A 3K5HA 1ESZA 4IQ0A 3DMGA 5AI9A 1WMBA 1BAPA 4CTKA 5DM70 1QUEA 1Q11A 3I6YA 4OBWA 4B4UA 2AW3A 2EJCA 4KQIA 3TRHA 4ZYVA 4DZRA 2ZBUA 5JZ9A 5K0FA 2D7DA 3KBBA 4I4TB 5KDDA 3VHLB 5BW5A 3THWA 2ZWIA 6Q21A 3AVTA 4WLEA 5DLPA 1MZPA 3PI6A 4I1RA 2VZ0A 1DEAA 2VK1A 3IPXA 1W36C 4L0CA 3D1JA 2AJCA 1R9MA 2JBHA 1IIBA 2FQ1A 2WSIA 5FOVA 2WABA 4PNPA 3O31A 4ZARA 3ZLBA 3TTYA 2B1RA 4BX2A 3Q3EA 2IPXA 3TZQA 1V48A 2O2XA 1GO2A 3KVOA 5BN3A 1DSSG 3L9XA 3DXXA 4K87A 2JLWA 2REXB 4K9RA 4A6EA 3QX3A 1JEDA 3A8TA 1YZTA 3BMQA 4GIBA 4LY3A 1KFEB 4L5YA 4Q9JA 3GP3A 2IUEA 5ULLA 3ONDA 2HJRA 1JJVA 5IWCA 2P3QA 4FSDA 4LSGA 2FWRA 3C85A 3DBHA 2R79A 2HRDA 2HK7A 1SCJA 3W6NA 1U4OA 2NO7A 3QTLA 4F8EA 2G63A 1QX4A 3SBXA 3VSDA 2JEYA 1P18A 3OCVA 1XMOB 4GOOD 4H7IA 5ALSA 5JAHA 1K7CA 1OR8A 3UATA 4QKQA 4J0CA 5FJJA 1LQTA 5LP6A 1G2PA 2G1KA 1EAYA 1FW8A 1LCIA 2H7YA 1FU7A 4RJTA 1T2FA 5FF9A 3F1LA 2FX5A 1J9GA 1G2OA 3N7AA 2P91A 3HKBA 4QX6A 2V7PA 4Z0HO 2FSSA 2HN9A 1P2GA 3MEQA 2ORWA 5EY5B 1RHQA 3PHJA 1NW5A 1XZFA 4DN6A 5JZBA 2EYQA 3ZK9A 4JCCA 1FLNA 1VMIA 4BQIA 4Q15A 1G5PA 1XXHB 3RBZA 5DNDA 4ETIA 5E2BA 3TFWA 2ZOSA 2WUFA 4ZEXA 4X71A 1A2QA 4NONA 2CGEA 1XA4A 3QVSA 2J5RA 5M29A 1Z9BA 3OIVA 4AJ4A 3I73A 4HV4A 1GNLA 2QJOA 4NI5A 4DG8A 4F46A 3OMWA 4K9PA 3BJEA 4KAFA 4O25A 1CVLA 3O3NB 4K88A 4TWBA 3SF8A 3F73A 4G56A 5KZMB 5FTJA 4GVXA 3LX6A 5F5NA 2F48A 3CNHA 3O75A 3PK0A 1QRAA 2Q3BA 3I39X 4QYXA 3SIRA 1FQJA 4HLCA 2Z9DA 4RD1A 5DF1A 3WL4A 4BFZA 1T2NA 1B43A 3TN7A 3EWSA 3ZY4A 4EHLA 4PG6A 3WMEA 3KVVA 2JAUA 1ID1A 4YALA 1RRFA 1U4SA 4V0RA 3RRMA 5KYYA 1RAAA 1SC6A 1QQ7A 3M4JA 4TQGA 4WXYB 4PN3A 2JI9A 2EL9A 1NI4B 3PFGA 4JU8A 4PAOA 1PYDA 3RV3A 1YU9A 2Y99A 2OZKA 5GZ6A 3RBXA 2JRLA 1EPUA 2A0XA 2DLNA 1GRQA 1N9GB 3ZZ1A 1RHUA 1NMXA 3TFQA 3G0HA 1N5MA 1KNXA 5KSOA 2YV2A 5A9TA 2YYZA 2XKAA 4HZIA 4OQLA 1GEGA 1B93A 3G9XA 3R7WB 4DLNA 3LPMA 5JI3E 4Y67A 1E3TA 1UF9A 3ZWDA 4G07A 1CUFA 1SOVA 1UPUA 2RHOA 1AY0A 3I9LA 3Q7RA 4G84A 1UKYA 4PGFA 3LHSA 5J5VA 4CHGA 2RGWA 1Z15A 2QR3A 3IUYA 2AG8A 2FFHA 4G89A 3AONB 2BR5A 2WFLA 5FD8A 5C3UA 4M0PA 1F0PA 3N0RA 2G3YA 4BMXA 1U9IA 3BF8A 1ISHA 2FUEA 2RBEA 1F3LA 2VCYA 3H18A 3L0SA 3KKPA 3LUJA 1JI0A 3KJIA 1WR8A 3TZLA 5K3FB 4MMXB 5I9NA 4NARA 4C0WA 1SEVA 4B31A 1B15A 3K09A 1G21E 2ZDHA 5AICA 2B20A 2H63A 2W2LD 2WF7A 3EXHC 4IEIA 4E5VA 4ZKDA 5CBKA 1KTIA 4ZC8A 1L7RA 1GDDA 2HNAA 2WDPA 5G3ZA 5GWXA 5K0ZA 1F0YA 2BGGA 3INNA 2NQ2C 2XMRA 1LK5A 4EK9A 5I7VA 3MD0A 2V5AA 1B8VA 3CNBA 1P17A 3V2UA 4DNXA 5AUOB 1ULHA 2Q0QA 3ORFA 2YXNA 3K53A 4RA9B 3B3GA 3AX6A 5KTSA 3B12A 5B64A 1NPYA 2DFTA 4MJXA 4QHSA 5SY9A 1XDBA 1XLTC 9MHTA 2KYRA 3U9SA 1U7PA 3P71T 3WMRA 2ORIA 3RROA 1ISIA 1UP6A 5LFAA 5DTEA 2VI5A 3DEZA 3PGA1 3GCZA 5IN5A 4CCWA 4OG2A 2OXTA 4XGKA 2HJVA 3UJ7A 4HDNB 2MCFA 3SYMA 3U4HA 4K9DA 1ZK2A 3QE3A 4WLVA 1NMZA 3JR3A 2DE0X 4O5AA 2UUBB 2J08A 4XB1A 4PYLA 2QRLA 2YVQA 3I28A 4JELA 1UFKA 2PTHA 5I8WA 2G88A 1NGSA 2BZ0A 1KEPA 2I2XB 2XHEA 3ZZTA 3KBOA 4EKYA 2GGSA 1NF8A 3E3LA 4PLWA 2OC4A 2ON6A 4M0UA 2XYHA 3HPQA 1LJ8A 2C95A 4BC1A 2XW6A 2FWAA 3ICVA 5I9BA 2BMDA 1WHSA 3K94A 4D9GA 5DDIP 2JJ8A 3KRTA 4FYHA 3SSAA 1X3LA 2ZRDA 3AB7A 3E2PA 3RAPR 1YDHA 3MJTA 3U7RA 1GPH1 1JQDA 5T5QA 1F5NA 2XGGA 2XOKD 3M6AA 4BDSA 1F51E 4QPPA 4YV0A 1SWVA 1MAUA 1XEXB 4JLJA 4MQLA 3ZJUA 1C3OB 4ZRMA 2JFXA 2WZDA 4JODA 4MKRA 4XGNA 4LS3A 1ZH6A 4ZCRA 4D9NA 3RYTC 3CW9A 4DMMA 4OFBA 5FO1A 2QZZA 3KUCA 3LXMA 5FH9A 1G4HA 3KU1A 4JUAA 4RIFA 3TX2A 3CVUA 2O06A 4GU5A 1W46A 1FBNA 1LD3A 3A37A 1YA8A 4F3RA 3KQYA 3MXOA 4HGPA 4JA0A 4NMHA 4O0LA 3A1VA 5D1HA 3LUHA 4G2NA 1I4LD 4RW0A 3OJFA 2YWDA 4RKEA 3ZDAA 2F4VB 5BNTA 2IYVA 4GMHA 1RCUA 3IGFA 1DPFA 3WKEA 1CYEA 4KAXA 4Q48A 3V9PA 1TF7A 4HVLA 4BBJA 4WN9B 3HVUA 1D6MA 3WGGA 3G2OA 4BFTA 2AZMA 2OD7A 2W2TA 3WKBA 4M0CA 5JOQA 1V47A 2A7QA 3NTQA 4BNLA 3RIYA 3DAPA 2OVBA 4QEZA 3WK8A 2ONKA 4ITRC 1UM9A 2VEDA 1QU3A 2CZQA 1UADA 2O0KA 3GH1A 1RQNA 3G79A 3D5QA 3K9LA 1WDLA 3LECA 3MQ2A 1Y3BE 3LWBA 2VXBA 2GEUA 2OOKA 1NN0A 3DL2A 3KSUA 1M1NA 5A2GA 1VB5A 4MV3A 3TAHA 3M82A 3WADA 4EQ6B 2QN7A 3D64A 3D6VA 5EZ5A 3WC4A 3NIDB 3PYXA 4UM8B 1RXIA 1VG0B 3QWFA 3ILVA 2BHTA 4N5NA 1Z0SA 1A04A 1EXMA 5FWYA 4BFUA 4WNIA 1YAHA 4UMVA 2W6ID 4LFCB 1V8DA 1HRDA 2GX6A 4MGYR 4QJ4A 4CDMA 4XUEA 3C5EA 4A03A 5K0TA 1KOGA 2VK4A 4HQFA 1U80A 4HWGA 2BBWA 4OHYA 4J3NA 4Y1GA 3GELA 1JHYA 4CKEA 1I3KA 3BXXA 4A15A 4ZOQI 1LPSA 4BB5A 1Y89A 2AVDA 1B8UA 3A4TA 1S4QA 2BGNA 3TO5A 4GD3Q 3D4LA 3GF4A 4KVFA 3VU8A 5MF6A 1U0BB 3F6BX 4KSCA 1OMOA 1SU7A 5DGHA 1R0LA 3V2GA 4V0LA 1BKYA 1DT5A 3WA6A 5I5EA 2XWQA 1FA9A 5GVSA 4FX2A 2O3RA 3RDPA 4FIZA 2XZTA 1Q44A 2HXGA 3G1UA 3OCUA 1YR1A 4N54A 5AOCA 5B1EA 1KDZA 1CHNA 3BQMB 1MJGM 3TI9A 2ZUWA 3HFSA 4FGUA 4OP1A 5B1HA 5B4TA 3BSSA 1Q1QA 3LK7A 2RHBA 3LBAA 4BRSA 2PIDA 3MJCA 3NKVA 4CYMA 5CFQA 5T67A 4YAEA 4BIMA 4LPKA 1UBFA 4RNDB 2H06A 1EEHA 5ERXA 5JRZA 5JPCA 4YXFA 2O8BB 2SCUA 4ZT7A 5LOVA 4XIJA 2HHJA 3QKTA 5KQGA 3U7QB 5JFGA 2C88A 2C8VA 2QX4A 2VBCA 3NNNA 4HY3A 4L4SA 5JNSA 3RLFA 2RSLA 1UPTA 3QVVA 4MWDA 3RQSA 1PJ4A 1SR8A 2QL6A 1LDEA 2R751 3RWOA 1SXHA 3WQHA 2EFGA 4UKDA 1P80A 4LA4A 3L93A 2HDHA 5AW9A 4WX2B 1NLZA 5GTDA 2F8SA 2WIAA 4GT1A 2BRUA 4UNNA 3KOYA 5CNIA 1N4DA 5CA1B 5HQ3B 1OFUX 3GDFA 4CFYA 3CVYA 2XUZA 5DWDA 1Z8NA 3BUSA 3OZRA 4GLOA 3V00A 2GVNA 3F3KA 1Q7GA 4U1RA 3O1LA 2QAGA 2NW6A 2FWJA 2NTNA 3TW8A 4B6GA 5JHHB 4WJKB 2AFHB 3VI4B 2FDXA 3PR3A 1LDMA 4W99A 1ONOA 4O8ZA 2B34A 4FFBA 1G6OA 4YB8A 3AXSA 5EN4A 3BSYA 4RZ2A 4CQLA 3DAFA 4IV5A 1RJ9A 3VX4A 5CIWA 1IBCA 2PX2A 5E3IA 4F2HA 4KHPB 4WXRA 2JS7A 2JLVA 5AM5A 4K2HA 1CUEA 1O4WA 4RY2A 5HGXA 2D8AA 5KHLB 1Z47A 1XALA 3T3PB 1X2EA 4J2OA 3JZFA 1R12A 1Y98A 4IHJB 3ZWPA 3U3OA 4PCAA 1SHKA 1XZHA 4UTZA 4MRMB 5KYYB 1N3BA 3IURA 3RJMA 5L3RA 5LQUA 2GJAA 2BUCA 4E46A 4C04A 2K87A 4OK5A 3F5QA 2JIZD 2ZT6A 3LXXA 4MKFA 1MB2A 2I8LA 3ULKA 2BFCA 1RZUA 2FW8A 4QYTA 1V1RA 3ST7A 3AVWA 1REQA 1MDBA 3C41J 1U1GA 2OV3A 1Y3IA 1MG5A 4AICA 4KJZA 4GI1A 2QRHA 4AN1A 2FTKE 1YZHA 2HMVA 2PXXA 1H2XA 5HK8A 2HUNA 1K8ZB 2I0FA 4OGGA 4V0QA 5HMLA 3R8FA 1VE7A 5BN1A 1LGYA 1DFGA 4FTWA 1R0CA 4WNYA 3ZCSA 3ETJA 3ZU5A 1N2BA 5CFLA 2UUAB 3STWA 3W7AA 3M2PA 4GEGA 4J0DA 2C5BA 3UTDA 2L69A 3A6LA 5IJ0A 2QRUA 1SVWA 3NHPA 3L8YA 3GEMA 4YJ3B 3VNVA 1CUWA 2A57A 4HNHA 3UYLA 4IGIA 5T7BA 1CUHA 2DFKB 1GZ6A 4YP9A 4G01B 4NY1A 1P4HA 1H6CA 1EMDA 2FEAA 1NURA 2FR8A 5KOYA 1H4QA 3FPHA 4L1KA 4OAPA 1ZY2A 2CBZA 1PL8A 1NR7A 3QKUA 2TMYA 2ZYVX 4KQWA 2Q99A 2W2MA 4IIJA 1MAAA 2EGGA 4UHFA 4YS6A 5IUKC 4PZAA 4K9KA 2CCJA 1KEEA 2JD2A 3E0XA 2X2PA 4DYHA 2LVBA 5L95A 2R00A 3WKDA 3ZIAD 3DFUA 1E3IA 4OB7A 1MOQA 4E13A 2QN9A 2EKPA 1INLA 1PJRA 3T5TA 4CNBA 4R0MA 5ALRA 2IQIA 4WL0A 3OEHA 3ZWWA 1EWQA 1XD8A 2FLKA 4I66A 2PLAA 1GTJ1 3GUZA 3C1TA 1UQRA 2HBRA 3E2IA 5ALOA 1LZKA 5JJKA 1JFFA 4YJGA 1GIAA 3YASA 5EZYA 3KAJA 4A1OA 1DHRA 1HSOA 1S8OA 1JSXA 2V0CA 4JVSB 2QKYA 4MKGA 1PV2A 4RE5A 5DMXA 2BFEB 2QTAA 2W2VA 2B0CA 1YXMA 4JJ8A 4BFYA 1A7KA 3NRBA 2CNWA 4ZDWA 3ZDZB 5KQPA 2WKQA 1RYZA 2QIOA 1XQ6A 2N46A 3HJRA 3UGTA 2AG5A 2Y3IA 3X2EA 3CW8X 1JI3A 1FSZA 1SXJC 2JJ1D 2HV8A 3HDGA 1FFSA 2HHAA 3LHFA 3N8GA 1UEXC 5D00A 3I4LA 1ZBQA 4JOBA 1JR4A 1ZH4A 2VYCA 2R1VA 2GNAA 4LF9B 1VXRA 1E7YA 1YKFA 4JYCA 2XTMA 1E8NA 5CX1B 1OB5A 1HYGA 1Y5LA 1UMCA 5JD5A 1IYZA 4EDHA 1CUAA 3CX6A 1EWYA 2QJFA 4MVXA 2XMZA 2PU5A 3GJ0A 1LS1A 1VSQA 4QBKA 1YJCA 1EVEA 1G66A 1EIWA 2VVTA 2IOQA 5DIFA 1S3IA 3TIIA 1R6DA 4W5HA 3VR2D 3PBKA 1FNDA 3VR0A 1Z25A 2BSAA 1BE1A 1VE1A 3CUEF 4ON9A 2NG1A 3V1YA 1E4OA 2HK8A 1XRNA 3F2VA 4JB2A 4FCWA 1XI2A 1QGAA 4YCNA 3D1VA 3TQSA 4RTJA 1SXQA 1L5HB 1PKEA 3G8CA 3AHHA 3N28A 2CDAA 1O95D 2XMDA 3N53A 4KZKA 4QD3A 4QICA 4WQMA 4WZBA 3R8CA 3ZD7A 2VYNA 2DBYA 3GL9A 2A35A 4OX9Y 1V2HE 4LCBA 5REQB 1UWKA 2YIDA 3MWGA 1GU0A 3T7EA 3ZWYA 3HYTA 4GXTA 5EZQA 2ET6A 2PKXA 2DOKA 3BZWA 3ZXSA 4DXDA 4JT8A 6CHYA 1HOXA 1KAMA 2PUVA 4WSOA 1W30A 2C5LA 1QRUA 2OORC 1V7CA 5EWLB 3ZUGA 8ABPA 2NSDA 3L0PA 1NULA 3H6HA 4J7XA 5HBRA 3DZKA 2IV2X 3TGLA 5FFFA 5DFAA 2QXYA 5LN1A 3K0FA 3RC2A 5K20A 5KVSA 5JAMA 1UAGA 4G5FA 3SHOA 3KKOA 3UJHA 2GFQA 5KNBH 3U56A 1EJBA 5D85A 4BKUA 3IERA 3BILA 1W75A 2B4TO 4JDPA 3AY7A 1B76A 2F4NA 3GD7A 4LZWA 4MEAA 3HCBA 4RPGA 3H2YA 5DSZA 4ZI7F 1EUDA 4KPUA 3MAJA 5BSMA 3RT1A 4E5PA 2P6UA 4UBKA 1K8RA 1E20A 2VQ3A 3DUFB 4FHDA 4JBXA 5IF3A 5HF9A 4DA0A 3WK7A 2WTXA 5HQTA 3KALA 1K7YA 3NG1A 2JFWA 5MGNA 3ZHZA 1JDNA 2ZTMA 5KBYA 1QHNA 2X6QA 3X1JA 3FHTA 4TTTS 2XUHA 2ZU6A 3IXMA 2ZAGA 1BFKA 2Z1NA 3V5NA 1M7HA 1PS8A 3T5AA 3K6SA 1KMMA 2AZXA 1GV1A 2FRDC 3CEPB 4Y2XA 2GA9A 5JYBA 1Z5WA 4BRZA 5AR1A 5AJZA 4LFAB 1BWSA 3GJXC 4FINA 1IN7A 1DOHA 4LCJA 1GQYA 2GDJA 4A16A 4AJHA 4F1WA 2E0IA 1EWRA 1W52X 1IXYA 2VPZA 2VJNA 4WHMA 1NQWA 2Z2XA 3KJXA 3HEAA 1V1MB 2TRSB 1T9KA 3GLIB 4MUHA 4AJ2A 4Q1AA 2FMTA 1MKYA 1U2EA 1OXTA 3B1ZA 1P7ZA 3PPWA 2PVCA 3PLNA 1JT9A 1CRZA 1G9SA 1MB0A 2JBAB 3CIOA 4FWBA 1UZLA 2XYVA 3FF4A 2D2EA 4Q1DA 3VMMA 2Z6QA 5CFOA 3PDIA 1SU4A 1Z3CA 3RFTA 2KM1A 1WBJB 4AY2A 1KI7A 2ZI9A 5L45A 3JAKA 2H8KA 4W5WA 2MTBA 1Q0RA 8GPBA 1QK3A 1XCOA 1BJTA 2ZSJA 4RVDA 2FQQA 1E9RA 1T5BA 3AFHA 4L3OA 5K3AA 4NATA 1JKFA 3VISA 3ZZMA 4XCQA 3UK6A 2HMSA 5B12A 4FLEA 2IOFA 1P2SA 3K09C 3IOYA 3BHNA 2I1QA 1FJGB 4LJ4A 5TXGA 2J5XA 2J9FB 2IEGA 2ESRA 2HU5A 2V7WA 2ERYA 4XE5A 2C29D 3UB2A 1T8PA 1AM4D 4P92A 2XJ4A 3GZ4A 3LQ1A 3N0VA 3TM4A 3F96A 4L5IA 1U02A 3ETCA 5JMOA 3MBIA 4E15A 4F96A 4RTOA 4BVAA 2HA7A 3EOZA 2YWEA 2ZRCA 4LXQA 2IH5A 3Q3IA 4G86A 1TNDA 4U2CA 1DMRA 3O8QA 5T8KC 1THMA 4LMPA 2PH5A 1AKTA 4HPWA 4L0QA 1W35A 3EH1A 5A6SB 1VKZA 4AVYA 7AT1A 3NASA 1NV9A 5CITA 1D0VA 3RIEA 4BBAA 2AMLA 2MU1A 1F6BA 1XHEA 2V7QA 2IUYA 2VC2B 3OZFA 2EDAA 5K6AC 2A4MA 1WKVA 2GZRA 1YS1X 1ZUIA 1Z0JA 5DHUA 3INYA 1HFEL 2RC5A 2ZBFA 3CZPA 3ISJA 4JWTA 2JGMA 1PR9A 3G2LA 1Q0PA 16PKA 4KUHA 3ZH9B 5HRUA 3QVJA 1K5GA 1P7WA 1JEYB 1OXBB 4A3SA 1XB2A 3HY4A 4AY5A 4DREA 4P0QB 3H87A 4LDRA 5DI3B 3HCEA 3U3KA 1PP4A 1YDFA 4GXRA 1W88A 3GUYA 2V9ZA 2A1UA 3AM4A 2P4EA 3B1XA 2P90A 2D1SA 2R9VA 4EY8A 3HXQA 4Y1RB 2Y67A 5IDWA 2BONA 2I2DA 4C43A 3EVCA 4BN4A 4B3BA 2VO1A 4EZEA 5LJIA 3H13A 1IXSB 5B1DA 1JYSA 1ZC4A 4MCAA 4OXQA 1VL1A 3BF7A 5KJCA 3JQGA 4B3GA 2CYAA 3GGPA 3QELB 1F8YA 1Z39A 4EG4A 2C84A 4EEKA 2VF7A 3KHKA 2WDZA 4A7PA 3OTQA 1NUHA 3T1VA 4BFCA 2Y1FA 3ZPXA 1TOAA 3IAM6 4KP7A 5HMMA 4R8SA 4GSKA 1HFWA 1RJWA 3LG2A 4I6JA 4ZAZA 4ER7A 1EHCA 1QO9A 1XZKA 4LMRA 2VT6A 3T38A 1JHPA 1T4CB 3W8EA 2AA3A 2FWPA 2H4ZA 3PX7A 1ZHHA 3RC9A 3E81A 1V4BA 2ZJ4A 2HEIA 2Z9CA 4PYJA 2WWFA 3I2KA 5AXBA 1CJBA 3OHSX 4C0QC 4OXYA 3AT1A 4HAYA 1KJNA 3KQKA 1UCFA 1KI2A 4IQFA 4Q12A 1CZKA 1O6FA 1CJKC 2ENUA 3BL6A 1SBCA 2O23A 3DE3X 3H9GA 3NX4A 3WRWA 1UBNA 4HC4A 5KKNB 4BMPB 3W5CA 4I5DA 2EKQA 4GKVA 1A8UA 3A06A 1LBEA 1XL1A 2FSVA 3KUDA 3TJZA 4HLQB 5A3JA 2H2WA 1MH1A 3KB1A 3REGA 5B6JA 3NIBA 3LW7A 5G0UA 1VJRA 5TGZA 2JLYA 4BPBA 5KMGB 5KB3A 1TRKA 4GWLA 3AUAA 3E82A 3EVDA 1BWQA 2P9GA 3ED5A 4LIPD 2HLDA 1DJMA 4FM9A 3WDLA 1T3ZA 4NYIQ 4U0JA 3U61B 2GYWA 2OAEA 2R1VB 1KYXA 2GYVA 3MTBA 3H8VA 4YRCA 2ZBRA 5DBIA 4L2IA 4IUCS 4N0DA 3TVYA 4J2HA 2OLKA 3Q9SA 1NG9A 1SCAA 2RJ3A 3I01M 3WIBA 2NSYA 4LV6A 1L5VA 5JJ5A 3IEIA 2HQOA 1BMQA 3OD1A 4FYJA 1IMJA 2I6XA 1E5XA 4I4IA 2KPOA 2CXQA 2VHXA 3GAZA 1Z37A 2JIPA 4O4IB 4CU2A 3PEUA 3B6EA 5TGTA 5FV4A 5ADWA 1JR6A 1WXIA 1T9ZA 5DBHX 3UG7A 2PGDA 5IJAA 1TVKB 3L3BA 1M0WA 5JMWA 5CBPA 4GFDA 2QN2A 2O2GA 4L28A 1NMQA 3Q8WA 1ABBA 4XPIB 4TRMA 1AHIA 3FWNA 4EMUA 4DIBA 4AZSA 5JCOC 4HS4A 5FI3A 3Q2KA 4F8YA 3FKJA 2G6BA 3ILXA 2E4ZA 4O3FA 3EDRA 4Y9TA 3JASA 1K66A 5CB8A 5E8JA 4LMAA 2XQJA 4MYSA 2VDVE 5HBGA 5DVZA 1ZISA 2NTVA 1HZZA 1U2SA 1XEXA 4KX5A 5J63A 2O2YA 3UANA 1R5JA 4DNFA 1GYQA 1PZXA 2P9YA 3FZNA 3IHWA 3L7OA 3OKPA 4KPUB 4OP3A 3AW9A 4X20B 2HKIA 3E3NA 3H8WA 4YMIA 1IEQA 1KYQA 4TLEA 4LNUA 5IM4A 4B6RA 1R10A 2Q49A 1AKYA 3NIGB 2HF7A 1N0HA 2QU8A 3H1BA 1GQ2A 4JR0A 3VTAA 1GZSA 2BGIA 4ZYZA 4ZEMA 2SECE 2Z98A 3ZQJA 4CLOB 5DM0A 5E7IA 5ALFA 1UUFA 2DQ4A 4LK3A 1D1QA 1G20B 3EDQA 4EW3A 3AI2A 4D3FA 5KYUB 2R6HA 2VKTA 4TXMA 1VSBA 3OAAD 3PPIA 5KOHA 3GJRA 1HQYE 1ELOA 3ZDYB 2WJYA 1LA2A 3L4BA 3FPBA 1C1XB 4YRRA 2AKAB 1GNQA 3D8SA 5LQJA 4R1TA 1HV8A 4BZWA 5CDFE 4M0EA 5IXSA 3DFZA 3PICA 3OUTA 2XSZD 1L4BA 4W5JA 2EZUA 1BVUA 1MBZA 2E4YA 2QGZA 5JG7A 3GLIA 8ADHA 2H7VA 1XWIA 3P4XA 1TAQA 3VNUA 4IIJF 3ZYZA 3O21A 1OH7A 1ES9A 1PFGA 2C3OA 4PG5A 1WSDA 2DEUA 3O8OB 2N42A 3QVUA 5LQKA 1REQB 3CT6A 2ZBEA 1IK4A 1UBRS 2ZT5A 3GUVA 1OLSA 4UUPA 5JBQA 1T1SA 1WXDA 1ZNZA 3ASVA 4KO8A 3H9JA 4BX0A 4E88A 1N2OA 1LU9A 2FEKA 1RWMA 3R0JA 3W4JA 3JWJA 2P68A 1XVVA 1TA0A 2VUIB 4MRMA 4XVRA 1AGNA 1E2IA 3BGVA 3JQGB 4LAFA 3IR5A 4D42A 4PWYA 4Q1EA 3DLHA 5U4XA 2R8XA 2JLCA 2YDYA 4RY0A 1YO6A 2W4IA 2XVXA 3WLAA 2XUFA 2OHXA 5A5DA 2P65A 3DJYA 4EHIA 4Y1RA 4LWPA 1Q1NA 2HF2A 2H1CA 1ZD8A 1CIPA 4IOLA 3SN6A 3C0KA 4K86A 1VRVA 2B5VA 3EW7A 3QZUA 2BKAA 1NBEA 2ZM6B 4CQLB 3FZGA 3PI7A 5HG0A 1MJ5A 3OIFA 2VRBA 1U6JA 2FJ0A 3U1VA 2DLDA 2Z2YA 1AQUA 5D87A 3Q9LA 5JNVA 4UTXA 1DC6A 1AKWA 4PWZA 4YPVA 3SEQA 2G5PA 3CEMA 3FYDA 1UOEA 4KH0A 2OBFA 1ZEMA 4P34A 2VYND 5KYXB 2EL7A 3GP8A 3KKKA 3M1IA 4FS8A 4MUJA 1RQ2A 5FEMA 5REQA 3F4BA 1PBTA 4I50B 4O4LF 1G5HA 2F1RA 3IELA 4FMDF 5BSTA 1MXHA 3EIQA 3TMAA 3AR5A 3WQSB 1ZR2A 1C81A 3EA0A 4A2CA 4B7UA 3U4AA 1KQOA 1QF9A 3VSBA 1PNTA 2EKDA 1GCIA 1LNSA 1VKNA 5K1ZA 4ARVA 1THZA 5K4GA 5LOVB 1KMHA 4EENA 3E6AA 4KQFA 1SD1A 3JRNA 4GNKA 1OT3A 4ZV7A 5I7WA 3UMGA 1WF3A 4OKNA 3ABOB 1ILEA 4CM8B 3P97A 3RF7A 3EIOA 3ZDRA 5KTPA 1LDBA 5FTLA 3K31A 4MITA 3QRWA 3NHUA 3PXUA 4UJ5A 3IC5A 5BYBA 2JCXA 3TIVA 4BGUA 4AKIA 2LDBA 1ZA1A 2WQ7A 1L4YA 4L85A 4QYIA 5ALNA 1URPA 4BKPA 1ECLA 4GP7A 5LUAA 1Q19A 5ER9A 1XR3A 4GPTA 1BXGA 1FMLA 4ODIA 4UPEA 4UEJA 3VGPA 2H17A 4O1IA 4DY4A 2NV2B 1DE0A 5B53A 2PD6A 2I7XA 1P74A 3HMQA 1IOLA 2REOA 3ABSB 3ITNA 4AMZA 4JI4B 1OZ0A 2ZRHA 1GY8A 2OZVA 4JJGA 4AZWA 4EHNA 3RU9A 3P9QA 4XI9A 2IHUA 3T15A 4C06A 3IBSA 3A4LA 3SJZA 3TZ6A 1Z12A 4PS1A 1CT9A 1RAIA 3DOUA 1T1RA 1GFSA 1HM5A 3E7PA 3HBFA 1T9BA 4BO7A 4DV1B 3OG9A 5GP1A 2BP7B 1C8VB 1JP7A 2D00A 4RV5A 4YCSA 3OPXA 2EFDB 2X0IA 4A8TA 1A9QA 1NR1A 1TZKA 4KQCA 3N5CA 4FZRA 3RTDA 3G1WA 2GN8A 2R8YA 3GU3A 4ND3A 3W9BA 4RJKA 1I6KA 4OL0A 3QOYA 5HKOA 4G37A 5EZSA 3M6VA 1TTHA 3G9ZA 3TL6A 5I8PA 3C74A 1N0VC 3EXAA 4RFSA 1ZCJA 3FBTA 4OF4A 2ZB7A 4PBRA 4CIBA 3RYFA 1R00A 4EIWA 2EGHA 4Q4JB 4AU1A 1M76A 1JVSA 2X42A 3NP7A 2ZR0A 4OQ4A 1I3MA 4BFLA 3R9XA 1I4OA 3RSSA 5EP2A 3NU1A 2I3GA 1Z5NA 4NBKA 2PRJA 4EKNB 3BFVA 3T41A 5KPDA 2GHIA 4ZEOA 1ABFA 4NS4A 5M34A 1AGPA 3VUFA 5TPWB 2J30A 4E31A 1TM3E 2XUGA 1OLXB 3DO8A 2B1IA 4RXMA 4D7AA 2HJWA 4Z4QA 2F8TA 1XWFA 5T4FA 2A7XA 1RC0A 1KK3A 3OD5A 5I3ZA 2LPMA 2B9VA 3L7YA 4G0QA 1GARA 3U13A 1RLJA 5EMKA 4C5AA 1Z2PX 1SB9A 3HP4A 1KEUA 1NJ2A 2FB9A 1E0JA 1ODIA 3M3HA 4X41A 3GOHA 3O2JA 1XA3A 3OJXA 4W5RA 1G63A 4ISBA 1DAFA 4KITB 2FVYA 1ECJA 5ITSA 1UINA 2IE0A 4M76B 2Q4DA 3BGIA 3EZLA 4XQ0A 4WN3A 4Y2PA 3BMNB 1VBKA 3ZI7A 2C2ZA 2FPIB 2JI6A 5JCJD 4LRXA 3VH3A 1GT6A 1XRRA 4KMOA 3TW6A 3KE8A 3C7DB 2XE8A 5CK4A 3ZS9A 4C4YA 1TUGA 1R5NA 3ZCTA 3KPUA 2OCDA 1WE2A 2ZR8A 1POWA 1VLQA 4N48A 1PJAA 1FU4A 2J33A 3RARA 2HPVA 5JPIA 1XNRB 1ECFA 2ONYA 4W8HA 2FUNB 4N5MA 3OQJA 1Q14A 2RONA 2VA9A 1KZ6A 2JAOA 2DLCX 3Q1KA 3BM5A 3AIKA 4BN5A 1J6UA 3AIIA 1EGMB 5CCXA 2GHRA 4ND8B 3F9IA 1ZN9A 4PLVA 3OQNA 4RZ3A 2G17A 4TS3A 1CDEA 1GZDA 5FAXA 3RU7A 2JIOA 2XUPA 4IO0A 1NXOA 1U0NA 1KIMA 1NDQA 2UV8A 2ASEA 1J5XA 3ZGOA 2NUBA 3ZGVA 5BRAA 3AEUB 4NMWA 3UHOA 1K75A 2VDWA 3IKVA 4YJHB 5IBCA 1ATZA 3D3QA 3ETLA 4URFA 4ER6A 3HY6A 1HY3A 5EMNA 4XDZA 4AO7A 3L0CA 4DV3B 3AI7A 4BL5A 1TVEA 4TUYA 4LOHA 1MC4A 5E3HA 2EARA 2XAAA 5LU9A 2H4FA 2V3CC 1FMCA 1NL3A 2FR1A 5KAPA 3CX8A 5CHEA 1NXSA 3ZZ0A 2VAWA 1JEQA 5TQVA 4J9UE 3LZCA 4B3CA 4TVSA 2NU6A 4LMBA 3WLIA 3I1IA 3DF9A 3THRA 4Q3KA 2FPOA 4MGEA