4I5DA

Crystal structure of ralstonia sp. alcohol dehydrogenase in its apo form
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
249
structure length
233
Chain Sequence
AYRLLNKTAVITGGNSGIGLATAKRFVAEGAYVFIVGRRRKELEQAAAEIGRNVTAVKADVTKLEDLDRLYAIVREQRGSIDVLFANSGAIEQKTLEEITPEHYDRTFDVNVRGLIFTVQKALPLLRDGGSVILTSSVAGVLGLQAHDTYSAAKAAVRSLARTWTTELKGRSIRVNAVSPGAIDTPAKFAAATPLGRVGRPEELAAAVLFLASDDSSYVAGIELFVDGGLTQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic analysis and structure-guided engineering of NADPH-dependent Ralstonia sp. Alcohol dehydrogenase toward NADH cosubstrate specificity.
pubmed doi rcsb
source organism Ralstonia sp.
molecule tags Oxidoreductase
molecule keywords Alclohol dehydrogenase/short-chain dehydrogenase
total genus 90
structure length 233
sequence length 249
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2012-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4i5dA00
1U3TA 2ZQZA 3F4BA 3WFIA 3AI1A 3QVOA 1HZZA 4D42A 4DUPA 1K6XA 2QQ5A 2VNSA 1B2LA 4GX2A 4Q3AA 5CFZA 3QP9A 4N5NA 3KHUA 4W6ZA 2PH5A 1PS9A 1XWFA 4YAIA 3DB2A 4WCDA 2VUTA 2OUIA 4OOEA 4IDCA 3D4NA 3H6KA 1UP7A 3D3WB 2VZ0A 4J1SA 4OL9A 3E5MA 4D43A 4E30A 5JXWA 2NSDA 3D5QA 4AJIA 1E3JA 4DBVO 3MJSA 4ZU3A 2A9FA 1GV1A 4DTIA 1EVIA 1KY5A 2JFGA 4KDFA 1IL0A 4D44A 2VRBA 1NVMB 1W73A 3BMOB 1NFQA 2X1HA 3C1TA 4WOKA 4OMUA 1DIRA 3L4SO 3H7AA 1JDJA 1E3WA 5F3RA 3EAGA 3NT4A 4TVOA 1MLDA 3L4BC 3AFMA 5COBA 2OHXA 4WECA 1PJTA 2BFMA 3JQFC 2R6JA 4I08A 5FI3A 5TJHA 1M67A 2YW9A 5KCZA 4E5KA 1CEQA 1PTJA 1FDWA 3X2EA 4A5OA 3H5NA 4EJMA 4WK6A 3A06A 1LDBA 5DOVA 1C0LA 3OQBA 5L51A 4KMSA 3JQ9C 1W8DA 1I3KA 4M1QA 4ND3A 5GMOA 4FDAA 1ULSA 3PQDA 1E1KA 4BB6A 1HRDA 1H6AA 4EUEA 1FF9A 2PZMA 4MOWA 4BGIA 1MB4A 3KYCA 4ZQGA 2QRLA 2GD1O 3PWKA 4R41A 1HDYA 3CUKA 1SOVA 5DOZA 4II2A 3UN1A 4ZJUA 2XPCA 1DAOA 2NVWA 3LF1A 1HLDA 1B16A 1N8KA 4JJIA 3LLSA 1YBMA 1NM5A 3E9QA 3QLJA 3UKOA 5HM8A 2JCYA 2ZK7A 2BFAA 3DOOA 4BMSA 2DBVO 1MG5A 2PD4A 2P9EA 5AOVA 1GAEO 3P2YA 4NH4A 3PIDA 4YXFA 2G0TA 1PJSA 1YGYA 7MDHA 3U4IA 3KYDA 5ITWA 1U8FO 3IAHA 3KYBA 1Y8QB 1AN9A 2B0JA 4O0LA 1P3DA 3V1TC 4BNWA 5ENVA 4R3WA 4RDIA 2PA3A 4CQMA 2DBQA 3AM4A 1MUUA 1UP6A 3PHHA 3U4CA 5IN4A 2Q50A 2Y1FA 1ZKMA 4PLGA 2OBYA 3WNVA 4YT8A 3TZCA 5A04A 1ZK0A 4L4XA 4AICA 1E0DA 1Y8RA 5JDCA 4AJ2A 4E5YA 1PQPA 1GZ6A 2JHFA 1LRLA 4FN4A 3HWRA 4OXNA 1PGNA 5FF9A 3C3XA 1AUPA 1QYVA 3GN1A 3IKTA 2X9GA 1BVUA 3HHPA 4FJ1A 4PVCA 1WW8A 1NHWA 2YJZA 4U6QA 4CMAA 5A4DA 3EGOA 4YJDA 2JJYA 3F1KA 5L4SA 3H9UA 3PFFA 1K0UA 1PJ2A 5JO9A 3WS7A 1FDTA 1P74A 4HNGA 4LVUA 4CM5A 4KWHA 3ZU3A 2GO1A 4L76A 4FIZA 4CM6A 2I65A 1KYQA 4HUJA 5LC1A 1PJBA 2NWQA 2IEDA 1HDOA 1IULA 1NTOA 2I67A 3H5AA 3WGOA 3ANLA 2PKQP 1YDEA 1ZIDA 3ENKA 1DSSG 4RQTA 3FPLA 2BH9A 2BI7A 3K2EA 1QV6A 4QFDA 3ZHYA 4D0SA 3LT4A 5A5FA 5L9AA 3GK3A 3SJ7A 2J5RA 3BMOA 3I3OA 4FSHA 5B37A 4C4OA 1H9AA 2D8AA 1PSDA 1FXSA 3D0OA 1CIVA 3UVEA 5IZCC 3JQ8B 2CVZA 1KIFA 5BSEA 3GRPA 1VKOA 3H8VA 3WDSA 5KJFA 4JK3A 5C37A 1RYEA 2EW8A 4OYRA 1GZ4A 2GN4A 1SAYA 4HNHA 1DDOA 4TZTA 5T67A 4DIOA 5JDIC 3VHRA 4U7WA 1PWZA 3AY6A 3K9QO 2NTVA 3WNQA 5BNFA 1SB8A 5J23A 1XLTA 3DZBA 4OQYA 2AXQA 2D5CA 1YJQA 4C7KA 5G4KA 3U0BA 3I9MA 2CDCA 1HE5A 3JD3A 1ZK1A 3TN7A 2AG5A 4MPDA 3V5NA 2VYVD 4XYBA 5KJEA 5LDHA 2GERA 4HY3A 2ZTVA 3HG7A 2EGHA 4FW8A 3LF2A 1O6ZA 3JD0A 4LCEA 3FR8A 3T4EA 2JAPA 4B4WA 3BHMA 4CM8A 1E92A 1WDKA 3WQQA 1BW9B 2EP5A 1JWAB 5KKCA 3OA2A 2Y99A 4RVDA 4DRYA 5FI5A 4EDFA 5KJ6A 4YVFA 3OJOA 4NIMA 4TRRA 1WZIA 4CV3A 2CDBA 4IJWA 1BXZA 4CM9A 4DC1A 2OO5A 5CEJA 1KY4A 4YJGB 1DPGA 3IP3A 2HK8A 3JQBA 3QW2A 4JJGA 4IXWA 1BXGB 5FEUA 4IM7A 4PCVA 4CLRA 2HMWA 3ABIA 2Q49A 1D8AA 2O2YA 2Q4BA 4R16A 4TRMA 4XGIA 2VZ9A 2W98A 2POQX 3WIEA 2JKVA 4P4LA 1VE9A 2G76A 3FRJA 1XDWA 4JLWA 3QA9A 2Y1OA 1V9LA 3JQGB 4XGKA 3LLVA 3KBOA 4IGEA 4BO4A 5JBIA 4PLYA 2WYUA 1J0XO 1HL3A 4XQ9A 1SNYA 1GL3A 2O2SA 3AU9A 1H6CA 1UR5A 1BWSA 1ZUD1 3DOCA 2NV6A 3BMQB 4CLXA 4H15A 4XRGA 1YKFA 1VM6A 4MVJE 5JDIA 3WYCA 1T4DA 5TRTA 5CDUA 4QQRA 4ZQHA 1V6AA 1BXKA 5TSDA 4A0SA 4BB5A 2E82A 4N54A 3AI2A 5I9MA 2HMUA 4DQXA 4WE3A 3K31A 3O26A 1HYHA 1T2FA 4O59O 4ZVVA 4IJUA 1FMCA 5KWEA 1I36A 1ZZEA 1KVTA 2DT5A 1UH5A 1B3RA 4A10A 1Q1NA 4CMIB 1IZ0A 1LSUA 5LCXA 1PGPA 2P9CA 5T5QA 3ZV4A 4AJ4A 1X1TA 1GPDG 3B70A 3JTMA 4GMFA 4HP8A 4AJNA 1XELA 3AUUA 3OIGA 4LSWA 1NQTA 1PZFA 5U4QA 4ND1A 3W6ZA 1B3BA 3M1AA 4XR4A 2ZQYA 3OQ1A 3GMDA 4DYVA 3TQHA 5GZ1A 3QWIA 1M76A 1ZXBA 4L0QA 1GQQA 4E0BA 2WD7A 4J7UA 3MTJA 3NUGA 5C7IO 3D3EA 2GN6A 3GVCA 4CMEA 5BSHA 1XG5A 3DFUA 4KUGA 3GQVA 1T24A 5ILOA 3WOHA 4AJEA 5JY6A 4FFLA 4GMGA 4UAGA 1Y81A 4FB5A 1L1FA 1NFRA 2ZB3A 4Z9FA 2ZCUA 5EMHA 3E1KA 3H5RA 3EK2A 5COAA 4RZHA 5U1PA 2W2KB 1MXHA 3KEOA 1CYDA 3GT0A 3VH4A 4BKOA 4BO0A 1GY8A 4KZPA 3FTNA 4J6FA 4ITUA 1LX6A 4LRTB 4AJHA 2OZPA 1I0ZA 1NP3A 1T4BA 3FN4A 2DPGA 3IDSA 4H16A 4TKLA 3S2IA 4RDHA 3D1LA 3R1IA 3ANNA 5L53A 3WQRA 2PV7A 3W8FA 2A92A 3AJRA 3NEPX 1PZHA 2WE8A 1DFHA 3I9OA 1MP0A 3MJVA 4E5NA 3F47A 1TVEA 4B3HA 3HN7A 3RFXA 2H5LA 3ICPA 3FI9A 4YRBA 4OO3A 1QKIA 2W8ZA 1CQIA 1LSJA 1R12A 3NJ4A 2E49A 3WSVA 4EITA 1CJCA 1ZJZA 3DBHB 4JP3A 1KBZA 5F1KA 1PS0A 5DULA 4BO2A 3ZWBA 3TWOA 4IS3A 4DXHA 2QHXA 4MVJP 1Y9EA 4D3FA 1X1EA 2X0IA 2DFVA 4R51A 3P19A 3GH3A 3ORFA 2DVMA 4IMPA 4E13A 1PJ4A 2R2GA 2ZYGA 3P5SA 1O8CA 4MVJF 3BTOA 3H2SA 4XR9A 3PIIA 1R0KA 2PZKA 3P7MA 2B37A 4QFCA 3VPGA 4BKUA 3Q9UA 4J3FA 3INRA 1UDCA 1Q7CA 4KQWA 3HDHA 1BG6A 1K6IA 1ZK4A 4CLRB 4RF2A 1PL7A 2YV1A 5I8ZA 2FWMX 2BELA 2DU8A 2FP4A 2O23A 3K73O 1DAPA 1E5QA 1QLHA 1Z82A 4GX0A 4J90A 5T57A 2CF5A 5EPOA 3DFZA 3ZU2A 5IXSA 4PLWA 4NJMB 2O48X 2Q1TA 3ZWMA 3ROQA 2EWMA 3F1LA 1DC5A 2JD2A 2Q3EA 5DBGA 2ZATA 2X0JA 5AVOA 3I9JA 3JQFA 4IXTA 3WMWA 2HKIA 2PKQO 2RH8A 2OFPA 2Y0CA 3VZQA 5L45A 3PZRA 3AY7A 4HBGA 1IB6A 1HTBA 4EBFA 4ALMA 4UVIA 3DHEA 1HE4A 3BTSA 4NBUA 1ZSNA 5JDCC 4BIIA 1N1EA 2AQ8A 1MC5A 1HKUA 4E2YA 4BO5A 1LSSA 4AL4A 1UDAA 3MJCA 1T2AA 3MJEA 1EVZA 4PLFA 3H9GA 3NKLA 4BHTA 2EJWA 3ZNPA 5TNXA 5F5NA 3X2FA 4AJ1A 3N7UA 5L3ZA 1CWUA 2SCUA 3TZHA 3DQPA 3GFBA 1HWYA 2EGGA 4E31A 4AJJA 4IQGA 2FOIA 4BO8A 4FFOA 2VN8A 3O9ZA 1LSOA 4IDEA 3TJRA 2HK9A 3B1KA 2QRJA 4F6LA 1A9ZA 4XKJA 4ID9A 3BHIA 5JAQA 1E6WA 1NWHA 2VNAA 2XAAA 4A03A 1IYZA 1HEUA 3I5MA 3FD8A 5AYVA 5DCUA 3ZNQA 3ZWWA 1PU2A 5AXCA 3U62A 4YAGA 1G1AA 4ZA2A 1OAAA 4DMMA 4BNYA 2B4TO 3OA0A 1KERA 3HDYA 4ND2A 1ZK2A 5G0UA 2HJRA 4WPGA 4DBZA 3GEMA 4BNLA 5FWNA 3TOZA 5IF3A 3G3EA 3CMMA 5JMWA 4Q39A 2GNAA 3F5QA 5C7OO 2HUNA 5TJ9A 2JCXA 5JFOA 1AHIA 4I9NA 4EEXA 2Q1UA 1X0VA 3GHYA 2R00C 3O38A 3DBLB 4OIMA 3GG2A 2BRUA 5A3JA 3GVHA 3ZWAA 1I10A 1PJ3A 3RC7A 3VC7A 3OJEA 3GAFA 3F3SA 2ZJ1A 4PZCA 3QHAA 3DEYX 2ZTUA 2Q1SA 3BMNB 2O50A 3QVXA 4KWIA 3S2EA 4IY1A 2QYTA 1LLUA 1U5CA 4MKXA 4PLPA 5B12A 3JYQA 3G1UA 2AA3A 4IQ8A 3NTRA 4B4VA 4MP8A 2NACA 2EKLA 1GADO 2CF6A 5F1OA 2A35A 3FNGA 4BNNA 2Z1MA 3PHGA 5L7YA 4N7RA 3GDGA 2VRCD 5ICMA 3ITKA 3I9NA 1CF2O 3OJ0A 1R0SA 3VH3A 1E1MA 1ZEJA 3IMFA 3OEYA 4J1QA 4HFJA 4OH1A 2BGMA 4CM7A 5CAEA 2DAPA 3FBGA 1ONNA 1DJQA 3GZNA 1GUFA 5C5IA 4OQZA 1DO8A 3HSKA 4IJVA 4OM8A 4XJSA 3WGGA 3GGGA 4P22A 4DA9A 1E7MA 4EUHA 1LU9A 1RPNA 5IDQA 1LLQA 1LC0A 1O9BA 4NJMA 1ISHA 2RAFA 5ILGA 4OSPA 4WKGA 3S2FA 2H1SA 2BD0A 3C85A 1PS8A 2AEJA 1Q2XA 3AK4A 3O03A 3EHEA 3RC9A 3RUCA 1PR9A 1HT0A 2VHVA 2ZKLA 2Y1EA 2UYYA 3SEFA 2BGKA 2OOSA 3NDJA 4Z3KA 3JQAA 5TIIA 5DF1A 1DRWA 1SO8A 1P1RA 2PZJA 4UUOA 4CR7A 1A71A 4ALIA 2DKNA 1NQOA 2O3TA 5FYDA 3VZPA 4I8XA 2EEZA 4M54A 3CZRA 4QT0A 2OBNA 2BGLA 4FGSA 4WGGA 4R5HA 4WLOA 1PR3A 3Q1LA 4WNCA 5IN5A 2V6BA 3F9IA 4J1NA 3PVZA 4JNKA 5DBFA 3TZQA 1D3AA 1F12A 2JFHA 3CKYA 3DO5A 1Y9AA 2YV2A 4R01A 5TGDA 2EXXA 2V6MA 2I9PA 1OBFO 3JYOA 5H81A 1HE3A 4FS3A 4R1UA 1QYDA 4Q3CA 3WB9A 2RHCA 1RWBA 2Y1CA 2VUSA 4NPCA 3PI7A 4B3IA 3TSCA 4BQPA 3GDOA 3DC2A 3L9WA 3INGA 1U3VA 2ZIZA 4MKZA 4BGVA 4EYEA 3ZHBA 4J0EA 3UUWA 3R3SA 2A94A 2JCVA 4LRSB 1P0FA 1EUZA 1EFLA 4YQYA 1IZ9A 4BV8A 3DHYA 3VOSA 5JW6A 1ARZA 4FQ8A 3GC6A 4XQGA 1LNQA 4O6VA 2ZB8A 2QW8A 4XGNA 4Z0PA 3A4VA 4CM3A 5B4UA 3VPFA 5HA5A 4J7CA 1E7RA 1P9LA 2TMGA 4E5PA 5LDGA 4CQLA 2DPHA 2GN9A 3AU8A 5GZ3A 4NBWA 2Y1DA 3H2ZA 4KQXA 4PG5A 1A72A 4YJHA 4ZQBA 3C7CB 4X54A 3M2TA 3TL3A 3PGJA 1Q7GA 4P38A 3UICA 4XX0A 2YHUA 1NNUA 2I3AA 4QSMA 2X9NA 3MWEB 2W2LA 1X7GA 2PD6A 3A28A 4KTVE 4CMCA 3CH6A 1X7HA 2B35A 1ISJA 4II3A 4BMNA 4CLEA 3WGQA 3GVPA 4U0JA 3PTZA 1H2HA 1SPXA 1TLTA 1LEHA 1X7DA 2IZ0A 1I5RA 2F1KA 3WQSB 2JFFA 4QO8A 4R9RA 1KEUA 1ZSVA 4DL9A 4MVJG 3DL2A 2YV3A 1XR3A 5A1TA 4JN6B 1Y7TA 4FBGA 3RD5A 5G4LA 1ZW1A 1NVTA 2VCYA 3ZWVA 2AEFA 4E21A 1EUCA 4J9VA 4B8WA 3JYLA 3K96A 3SX2A 2WMDA 5I7FA 3F6YA 1N1GA 3GG9A 4NFYA 2WE7A 2X58A 5ES3A 5ICSA 4UVDA 5DT9A 4L73A 4FJ2A 3KSDO 3LT2A 3PHJA 4JBHA 2P4HX 1JVBA 3L6EA 4L74A 4FOOA 4GAEA 3RIHA 3CINA 1WDLA 2JAHA 2C5EA 2I6TA 1Q0LA 2AE1A 4Z6KA 3MJ4A 4JBIA 3E82A 3UHAA 1JU9A 4XWYA 3OETA 2J3JA 1ENYA 5CDYA 4EUFA 2PWZA 1R37A 3KB6A 4GKBA 3RWBA 4JX8A 5HWSA 1QV7A 1V0JA 1C3VA 1LJ8A 1BTOA 1E1NA 1YO6A 4E2XA 3GY0A 2BF7A 3I4FA 1ISGA 2HRBA 1BXGA 1FDUA 4ZQEA 2H6EA 4R9SA 2VTEA 3UCEA 4FPXA 1ADBA 3WBBA 3FWNA 1NVGA 4ZN6A 4BO9A 4AFNA 4RPGA 2YHIA 2X0NA 3E8XA 4NFSA 4M89A 2EKPA 3W1VA 4MVJI 3U4HA 1YL5A 2NUAA 3TZKA 1AHHA 3HUDA 3DWFA 4BOYA 2Q2WA 1ENZA 1ZXLA 4N5LA 5BNTA 4CLOB 1LBEA 2HJSA 4J4HA 5EL0A 3I52A 2BFOA 4XJTA 2GSDA 1I2ZA 4E12A 4LSMA 4F3YA 3DAFA 3EZYA 1R4NB 2YYYA 3GNQA 2Q1WA 5JYDA 1B0AA 2H63A 3C24A 4D45A 1X0XA 2O3QA 1JLLA 4RVHA 4CL3A 3GUCA 4EEZA 1ISMA 1EE9A 3I9KA 5F1PA 3ZWOA 4M87A 2FR0A 1ADGA 1JN0A 2CY0A 3G0OA 1UJMA 3JYNA 5B4TA 1LQTA 5CDGA 4FC6A 1WAMA 2CSUA 3HB4X 1H94A 2FPIA 3BXXA 3RUAA 4QTZA 3BAZA 3WGZA 3KLPX 5C3MA 1PJLA 2ZYAA 1NBOA 1BDBA 1RM5A 1EEHA 3ULKA 3T7EA 2VHZA 1P33A 5JAMA 3Q3CA 2VTDA 4B7CA 3CMCO 1WMAA 3ANMA 1AXGA 2WWRA 3KOUA 3W4KA 2NVBA 1NPTO 2NM0A 3FNEA 4J7XA 4GWKA 2RIRA 4ZGWA 1HLPA 1LI4A 1R16A 2OP0A 3DMYA 3WBFA 5BNIA 1JTVA 1AGNA 4IINA 1WDMA 4J49A 4ND5A 1EQUA 1OOEA 2P2SA 3U09A 3JD2A 1ID1A 2G5CA 1U3WA 4UUPA 1DHTA 4TSKA 2VZ8A 3QRWA 1P1IA 2XF8A 1F17A 2IZZA 3JQDA 4MO2A 1K5HA 1LRKA 4BO3A 3S1LA 1C1XA 1TT5B 5DCYA 3OHSX 4XB1A 3WGYA 3JV7A 5K6AA 4MINA 1BGVA 3LSYA 1TA4A 4CM4A 4WLUA 3PJGA 2W4QA 3RQSA 1YONA 4INAA 3NJ8A 4AJOA 3DZGA 3O4RA 4OGWA 2YQ4A 2VWHA 3H9JA 1HF3A 3K92A 1XGKA 3UFXA 5A5EA 3RROA 3CSDA 3Q6IA 4B4UA 3OICA 2WYVA 3ZDFA 1E3LA 2AMFA 3FNFA 2J5KA 4BVAA 4TRNA 4LMPA 2B4QA 2O7QA 3KM0A 3PFWO 1LTHR 4XEHA 4YJGA 2FMUA 3HZZA 4PG7A 1DC3A 1F06A 4Z9XA 1B14A 1C0KA 1XKQA 3M6IA 2RH4A 3EC7A 1N2SA 2WSBA 1U9JA 5TLSA 1IHYA 1UAGA 4DVJA 3OP4A 3AM5A 5THQA 1QYWA 2NU6A 5I7EA 3Q11A 1UP4A 1BRMA 5DCWA 2EW2A 4GL4A 5I7SA 1PEDA 1VC2A 1F8FA 1A7AA 1M6HA 3HDQA 4GGOA 4DQUA 2RHRA 3NDRA 4WLFA 4NJOA 2JL1A 1BDMA 3ZWPA 2GZ1A 3QWAA 4UREA 2UAGA 3GVXA 3UOGA 1EFKA 4RPHA 1NPYA 2FPGA 1K89A 4RVSA 2VHWA 5GY7A 5ER9A 2PH3A 2O3JA 3GVIA 2WTBA 4GBJA 5CG2A 1KVUA 1T2EA 5HS6A 4NK5A 3ADOA 2PGLA 2BHLA 1Y5MA 5CEFA 2G17A 2GPTA 4TZKA 5CG1A 5KIAA 2GZ2A 5FFFA 1LLCA 1EDZA 4WNIA 1C0PA 3BMQA 4ZD6A 5IDXA 3VDQA 2AQKA 2C5AA 3D3WA 4BO1A 1JQBA 2Y68A 2CVOA 2VOEA 4CJXA 4ZRMA 3DMTC 3SBOA 5L7TA 1Z7EA 1DRVA 3DZFA 3S55A 5HTOA 1PGOA 5CDSA 4R1NA 3INTA 3WSWA 1XHLA 1NWCA 3FF4A 3ZN2A 2VQ3A 3VPXA 3NV9A 2HMSA 2NQ8A 4UVEA 3FTPA 1X14A 3KSUA 4JCOA 4MKRA 1ZSYA 4PG4A 4Z0HO 5A9SA 3IKVA 3A9WA 1YOVA 1KS9A 4Z0TA 3W4JA 4Z3DA 3LQFA 4NBVA 1OI7A 4RF5A 5A02A 5GZ6A 3Q0EA 3RI3A 3W6UA 1PJCA 2CDAA 3OMLA 1DC6A 2FY8A 3E18A 1Q7BA 3I4CA 1ZCJA 2IEBA 2AE2A 4CM8B 3LYLA 4PG8A 2VWQA 1EK5A 5BT9A 2WDZA 1GTMA 1U4OA 1MG0A 2B5VA 1M6WA 4K9DA 1GZ3A 4NZ9A 3GGOA 1ENPA 3V2HA 2NLOA 5DZSA 1FJHA 3TRIA 4MVJM 1C1XB 4RF4A 5L95A 4OHUA 2D5AA 4L4RA 1PQUA 1KETA 2C0CA 5COQA 2YQ5A 5JCJA 1I33A 4GX1A 3GUYA 4CM4B 1YVEI 1B26A 3GNSA 3RUEA 1OFGA 3HN2A 2ZTLA 4G65A 3KYCB 4P8RA 3K8ZA 2Z5LA 1DJNA 2UV8A 5G0WA 2FSVA 2A4KA 2XOXA 1N7GA 3CPSA 3HE3A 4B7XA 4YRAA 1U8XX 2GASA 1NAHA 3OH8A 3BA1A 2GN8A 3PJFA 3NYWA 3K30A 4I9UA 2HRZA 3EYWA 3DTYA 2P4QA 4NFHA 2J8ZA 3KYDB 5JC8A 2J6IA 2NU9A 1R0LA 1LXCA 3RUHA 3KEQA 4K26A 4RO0A 1Z7BA 1HYGA 1SBYA 2BKAA 2ZTMA 4IIUA 4PIVA 4PZEA 4YBZA 1QSGA 1J4AA 4J2OA 5EESA 3TZ6A 2CUKA 1O94A 3OJFA 4OKIA 1PGQA 3KLMX 1JA9A 2DC1A 1M2WA 2PGDA 1H6BA 3QWHA 5EQFA 3BYZA 3V2UA 1YL7A 2DLDA 5I9NA 4M55A 4TRJA 1VKNA 4BO7A 3MEQA 4QX6A 1RYDA 4ESOA 4BNHA 1ONOA 4GPD1 2O3SA 1ISIA 3PDUA 1VJ0A 4JQCA 4TROA 3DBLA 1NR7A 1IY8A 3Q2KA 1YQDA 3AWDA 4HX5A 1WZEA 3GAZA 4R5MA 1E3SA 5EN4A 5IJZA 1LA2A 4ZHSA 2XXBA 3NAQA 1H2BA 5JYEA 1QYCA 2E37A 3L77A 3ZCXA 3M1LA 3OJLA 3SLGA 4PFJA 4RPLA 3A1NA 1NHGA 1GUYA 4B4OA 4PLZA 3QVSA 1RJWA 2FRDA 3FR7A 3WGTA 5CEEA 1WXDA 3JQ7B 1U2GA 1KC1A 1BVRA 3FNHA 3G49A 3GPDG 4Q3EA 4R69A 4YTEA 3WG9A 3GFGA 1ZVMA 3ZGYA 1IE3A 1E3WB 2ZJ0A 1ISFA 1E1LA 3JQ7A 4Y6SA 2B83A 4DPLA 1TT7A 3HFSA 4IDGA 2VYVA 4TQGA 5CPFA 1U3UA 1ZH8A 3IUSA 1ZEMA 2D4AA 5HRUA 3IP1A 2EV9A 2CD9A 3WYEA 4BNIA 2HMTA 1EVJA 2J3HA 3ASVA 3OSUA 5L4NA 1C1DB 2DM6A 1P1JA 5AXDA 3UXYA 5L40A 1ENOA 4NBTA 5DDIP 4FFPA 1HDXA 4CL8A 4W7IA 3WTCA 3PLRA 2WYWA 3B20A 3C1AA 4WUVA 3RUIA 3WWYA 4AVYA 3JQBC 2HAEA 5A9RA 5H83A 4D3DA 2FR8A 2NU8A 3OEWA 2FN7A 4XRRA 1VL8A 1N5DA 1VJ1A 3PP8A 4BKRA 1DFIA 1U2DA 4FGWA 3RUDA 3TPCA 2EP7A 2DUWA 1DIHA 2O3UA 1EE2A 5BSFA 1LLDA 2GGSA 3T7CA 4J2HA 3BTUA 1LRJA 1B8VA 3CEAA 1JKJA 1L7DA 1NR1A 2CFCA 4FD3A 4RQUA 3K5PA 1A4IA 2NNLD 5G0SA 3HADA 1UUFA 1ZK3A 4GSLA 4D0RA 1HDCA 5IXYA 2EF1A 1H6DA 1BHSA 1W6UA 1AXEA 3G1TA 3IC5A 3ONEA 1YWGO 1I30A 4B3JA 4MP3A 3KRTA 2Y93A 3JQCA 4KDEA 3EW7A 3ZH2A 2GF2A 3C7AA 2D1YA 3TDKA 3GZNB 4BNUA 3WICA 4YPOA 3IL2A 4CUJA 2VHXA 1P1FA 4ROSA 4ZQFA 3FWZA 1PL8A 3FSRA 4GLOA 1HE2A 4DLBA 4URFA 3HJAA 3KV3O 1CETA 1EUDA 2EIHA 3U3XA 1Y8QA 5DP2A 5KJCA 4CLOA 1QXSA 2HO5A 3RUFA 3WX0A 4RL6A 1T1SA 2O4UX 1SOWA 3BTVA 4YJFA 6ADHA 3BMCB 1YXMA 1UAYA 4IZIA 1E7WA 2UUPA 3PPIA 1IUKA 1ONPA 1PL6A 2BLLA 4N18A 4BKPA 4FJ0A 5JCXA 1GQYA 1A7KA 3D64A 1P44A 3L6DA 4FC7A 2VT3A 2F00A 5I9LA 1J6UA 3NT5A 2D59A 1QG6A 2GLXA 3A14A 3RU9A 3AUSA 4AG3A 4DPMA 5JLAA 4FFNA 4XIJA 4KP7A 4YDRA 3ROKA 5MDHA 4D46A 2IDZA 3SC6A 4EW6A 2Q99A 4Q9NA 4D41A 1JAYA 4NU5A 4WCFB 2NVUA 3K6JA 1F0YA 1EVYA 1DB3A 4FCCA 2WD7B 5TT0A 3WMXA 4L9RA 3WJ7A 2B5WA 4I5DA 2PKRA 4DQVA 2DTEA 1U7HA 4QECA 2V65A 2E6UX 2P91A 1Z74A 4O63O 5EQDA 2BFPA 3FCOA 2X5KO 2BMAA 1RM3A 3L07A 1I3NA 3T4XA 1VL0A 4E5MA 3LK7A 5ITVA 4XA8A 2IODA 4E3ZA 2V6GA 2NTJA 4YYZA 2X7HA 5IG2A 3GOHA 4P4NA 1XYGA 3BIOA 2WD8A 3V1YA 3I9LA 1XSEA 2X6TA 3EDMA 3TFOA 1T2CA 4HKTA 1TI7A 3SLKA 1DIBA 3GN2A 4CM1A 4IQ0A 2FHSA 3L0DA 2G82A 1PZGA 1N92A 3DTTA 2HU2A 3RJ5A 1DBVO 4DC0A 2YDXA 1G6KA 3QE3A 1XQ6A 1FDSA 3DZJA 3PYXA 2E48A 1SC6A 5AXBA 1JVSA 4Q3BA 3FHLA 5JMPA 5JC1A 3LT1A 4BNZA 3ICCA 5JCJD 4NQZA 1YB5A 3VTZA 4IPTA 3PHLA 1HYEA 1XQ1A 4BNKA 3LC2O 3QIVA 3COSA 5G4KB 3DBRB 4O5OA 3KXDA 1GYRA 2NADA 4TMFA 4WLEA 4G2NA 3GLQA 2UVDA 1YQGA 4GH5A 1Q0HA 2B69A 3E5RA 5JE8A 2VYNA 4QEDA 3H3JA 5IAAA 1MFPA 4DMLA 1G0NA 2UUOA 1U5AA 3H3FA 1XEAA 2OL4A 1J49A 2C54A 1OMOA 3QQPA 3PQFA 4ALKA 3D4PA 4LK3A 2OP1A 5T6BA 2YDYA 3STHA 4Y6PA 4YR9A 5ER6A 4RLSA 2Q2VA 4LVCA 3BMCA 4PLHA 1KC3A 3NT2A 4FR5A 1F8GA 5IDYA 3NTQA 3IJRA 1E7YA 1OZAA 1UXHA 4RVGA 4H7PA 1SMKA 2G1UA 1ORRA 3DZKA 4ALLA 3IJPA 3PYLA 3WR5A 5K9ZA 1UZNA 3DONA 4K6CA 2X5JO 3L4BA 1G0OA 4EGFA 1T26A 1CDOA 3DDNA 4S3MA 1HDGO 1TB4A 4QO7A 2D0IA 3OQ6A 1UXIA 3AY3A 3QWBA 4NK4A 5T8KA 2PD3A 4BNMA 4CV2A 2OXIA 2NVUB 1ULUA 1D1TA 2J5QA 1PIWA 4YEDA 2HCTA 1U7TA 1HDZA 1A4UA 3HB5X 4NNJA 5TC4A 1LC3A 1TEHA 3RASA 1HSZA 1JWBB 3JQAD 5K6AC 4YJFB 3LT0A 2PGJA 3OF2A 4BNVA 3NGLA 1AE1A 5EERA 3N58A 3NRCA 4J4BA 5JSFA 2D2IA 1QYXA 1SEVA 1I3MA 3LC7O 1WP4A 4YT4A 2EERA 3E48A 1P1KA 2BI8A 2X9VA 3ITDA 3H4VA 1KEWA 5CHEA 5ADHA 2I99A 2YZ7A 1L7EA 2PFGA 4IJKA 3ONDA 4JROA 4JJFA 3LZ6A 3AI3A 1ZMOA 4BS9A 1EBFA 1D7OA 4UEJA 3RAJA 1NQAO 4XCVA 1N7HA 4CQMB 4RZIA 4RGBA 3WLFA 4A2CA 3PLNA 1B8PA 2NTNA 4I5EA 1M66A 1A9YA 1YOVB 3PJDA 3O8QA 4WEOA 1R15A 4IBOA 1SB9A 3DZHA 5JY1A 4EJ6A 4CV0A 3EZLA 2CVQA 1B15A 2HMVA 3R0IA 4F46A 3JQEA 3H9EO 2IYOA 1PJQA 3W8DA 5KTKA 4BGUA 1A5ZA 4GVLA 3IS3A 2C82A 4R54A 4XDYA 1FK8A 4HWKA 3ONFA 4DREA 5A9SB 1ZO8A 3WJAA 4UEKA 1IHXA 4E32A 4ZRNA 3AUTA 4DLLA 4KUEA 2HQ1A 4I5GA 4W7HA 1O95A 8LDHA 1GR0A 2Q2QA 5CDTA 1OC2A 1C14A 2QIOA 1LDEA 4XD2A 3M2PA 4QXMA 1JW9B 1R4NA 3ASUA 3W4IA 1P31A 1KVQA 2AQHA 3BMNA 2WJPA 3D7LA 3GRKA 3MWDB 4XDZA 3ZU5A 4ND4A 3DBRA 2Y0DA 4NMHA 4EZBA 1IPFA 1YJ8A 3BHJA 2DBRA 2OORA 4LISA 4E4YA 2QYSA 3E9MA 3ZWCA 2YFHA 4J4TA 1YB4A 3ZNOA 5MGBA 2W2LD 3PEFA 4CV1A 1Q0QA 2X0RA 3ADPA 3WIDA 2QZ9A 5EJ2A 3RSHA 1BW9A 4XYMA 3IIEA 5KNLA 3P2OA 3SJUA 4XB2A 4LGVA 5KVSA 4BNXA 4IDFA 2IRWA 3ZWXA 3AOEC 4D7AA 4CMGA 5DP1A 4K1LA 4EJ0A 1W0CA 3Q9NA 1W4ZA 3IUPA 3OBBA 1GD1O 4W4TA 4Y8VA 1PWXA 5H82A 5A9TA 1FDVA 3AW9A 4GSKA 3QVWA 3V8BA 1S6YA 3WGIA 4Y98A 1WNTA 1X13A 1DFGA 3PWZA 1XU9A 2IXBA 3UF0A 4BL5A 2PK3A 3PYMA 4Y9DA 1E7QA 3KTDA 3GEDA 2QG4A 4E2WA 5U9CA 5L7WA 4OJNA 2D3TA 1U1IA 4RORA 1MFZA 1JKFA 4MIYA 2I76A 3PRJA 3DAGA 3GZ4A 3ROPA 1X15A 2Z1NA 4QUKA 3QVTA 4HV4A 1Y1PA 4G81A 4YT5A 4J43A 4UVHA 2DUUA 5G0VA 1NFFA 1Y5RA 4CQMD 1N9GA 4CR8A 4GKVA 4OXKA 5F21A 4D3SA 3ZWNA 4JP2A 5F5LA 3HFGA 2ILTA 4ONEA 4F45A 4GWGA 4MP6A 1ADCA 3QSGA 4YWJA 3ST7A 4E2ZA 2RCYA 2ZB4A 4PGFA 3CE6A 1EZ4A 5ENDA 4IDDA 5T64A 2PNFA 2X8LA 1ADFA 3OECA 2VWPA 1I01A 3I83A 4NDNE 4TWRA 3AOEA 4BNJA 1YRLA 3JCZA 2GR9A 3JQ9A 1K6JA 3I1JA 4XQEA 4GQAA 3PXXA 4OSOA 4RPJA 4A26A 4NR0A 3O8QB 1KVRA 3V1UA 4IDAA 1R6DA 1GUZA 3JQAB 4M86A 4W99A 5I7VA 1BMDA 1E5LA 1GCUA 1DLIA 3LC1O 4W82A 2YFQA 3DXFA 4R68A 2ZCVA 1XCBA 2PTGA 4RVFA 3JYPA 1HSOA 1E3EA 4TKMA 3E6AA 2GYYA 4U0KA 1HDRA 4FOSA 4Z9YA 2C07A 2EG9A 4WLNA 4G5HA 4UUMA 5TS3A 1RM4A 4J16A 3UW3A 2W2KA 3OIFA 1RM0A 4P4GA 3B6ZA 1I24A 1V35A 2AHRA 4HADA 4CODB 5EINA 4RJTA 2DFDA 2HLPA 5IZ4A 1CQJA 1ML3A 1T2DA 1GFSA 3HDJA 3F5SA 2R00A 1C1DA 1H5QA 2GZ3A 2EKQA 4LCJA 2XXJA 5AQ1A 3NX4A 3QV1A 4XYGA 3KVOA 4KOAA 4HFMA 2VWGA 2TMDA 2GCGA 4BNGA 3ETDA 4PRLA 3CIFA 1Y6JA 3HQ4O 3IQDB 4UUNA 5L4LA 1V3UA 4YA6A 7ADHA 3GGPA 1MC4A 4IGFA 4ALNA 4B79A 3RKUA 3EUWA 3K2BA 4MVJD 4YB8A 2C29D 3AFNA 4IS2A 4GVXA 1LDMA 4PRKA 1C0IA 3MOGA 4J0FA 5JAIA 1TXGA 2Z95A 3H9QA 5KKAA 2C2XA 3JQ6A 4NU6A 4A7PA 3QJ5A 4CQLB 1GEEA 4AJPA 4PLTA 4YACA 1YB1A 3JSAA 4RPKA 3U9LA 4YAEA 4HFRA 4YAJA 1NXQA 2V6FA 3NGXA 4CM9D 1SZJG 3S2GA 5THKA 3DR3A 1U4SA 4WLVA 3VPSA 4CMHA 3ON5A 1CERA 4R4JA 2YY7A 1A27A 3GA0A 4CMIA 2NQTA 9LDTA 2E4AA 3DAPA 1Z75A 3WFJA 1GQ2A 1I8TA 4H3VA 2I66A 4MIOA 3PGXA 1QRRA 3PZBA 5KVQA 2X86A 2DQ4A 2AW5A 2X5OA 4BV9A 4ILKA 1VJTA 1PZEA 1N9GB 4Y67A 4UULA 1DRUA 1DIAA 1LDYA 2Y67A 3PHIA 3VTFA 3CXRA 3PJEA 3MOIA 2NU7A 2I3GA 3VAZA 4J91A 3D4OA 3CZMA 3GHHA 4R3NA 3SXPA 4OAQA 2H9IA 4LW8A 4TVBA 2JHGA 1EK6A 3ZZNA 4WCFA 5IDWA 2CNBA 2Q4EA 1E77A 1PGJA 1BSVA 3RCBA 5CP8A 2LDBA 3LVFO 3NTOA 5HS4A 4MJLA 4AJKA 4M49A 1LDGA 2W90A 3NDIA 2WEKA 5KJ1A 1YH3A 4PLVA 2X4GA 3W8EA 4Q3DA 3I6QA 3WXBA 1VPDA 3PWSA 1GDHA 1UDBA 3ENNA 4JIGA 4RLHA 4E33A 3TF5A 4WCFC 3B1JA 5JO0A 3ZWYA 1QORA 2EJVA 4PN3A 2FPPA 4CMJA 4NG5A 5C7LO 1NYTA 1VRWA 4XIYA 3AOGA 1GU7A 1H93A 1QLJA 5TF4A 3C8MA 1O0SA 2C59A 4PG6A 3VZSA 4YQZA 3DBHA 2ZB7A 1J5PA 2DTXA 1WWKA 3VH2A 4GI2A 2IE0A 3D5TA 2P9GA 3I23A 4I1IA 4HFNA 5T8KC 4C7JA 3DOJA 2AG8A 1H9BA 3IOYA 3ZHXA 5K0ZA 1DLJA 1O5IA 4IDBA 2JD0A 2VOJA 1UXGA 2HK7A 1OC4A 1YS4A 2LDXA 2OMEA 3ETGA 3MTGA 3Q2IA 1M75A 4D79A 3TNLA 1GV0A 4MIEA 5A05A 1QR6A 4M8SA 3E9NA 2P68A 2Q45A 3KO8A 4XYEA 3RBXA 3RFVA 3KZVA 3MCVA 1F14A 3OFSA 1Z73A 2FSSA 1VL6A 2P5UA 3UH1A 3WWZA 4UEOA 1B8UA 1UZLA 2Y0EA 3HNPA 4BO6A 4K6FA 4L4SA 3VZRA 3GPIA 3JQ8A 5JNLA 1VI2A 2OGUA 3GR6A 3AM3A 1E6UA 4W9NC 3ZW9A 3RBVA 1P0CA 3PQEA 4AJLA 3RJ9A 3L6OO 3DBVO 3RVDA 4YAKA 2I5PO 1EMDA 1K3TA 2IZ1A 1WMBA 3KETA 1K2WA 4RVUA 2C7VA 4KUHA 4RV9A 2J3IA 4U8GA 4DPKA 1Y8RB 1YE3A 3CTMA 4I9HA 3WLEA 1O89A 4F6CA 3MJTA 4K28A 2GDZA 3UAGA 3ZNNA 4EI2A 1YDWA 3U5TA 4YCAA 1LQUA 1R66A 3H65A 4DGSA 4NBRA 4A73A 1H0KA 1R4MB 1HXHA 3JD4A 3QY9A 2B4RO 3VVBA 2HDHA 3TL2A 3U49A 4GGPA 3UGKA 3WGHA 3FPCA 4FFMA 2Y05A 3F4LA 1DC4A 4NI5A 3RKRA 4XYLA 5A3VA 4LMRA 3TFQA 1MX3A 3C1OA 2JD1A 2O7SA 4OOFA 4CLDA 5B1YA 4CLHA 3GEGA 4BGEA 5G2OA 5CPBA 1Z6ZA 3VVCA 2AEMA 5BSGA 1P77A 1MV8A 4BKQA 1KEPA 4DYDA 3R6DA 2VUUA 3I6IA 4GLLA 1NQ5A 1DIGA 3C7DB 3G79A 3N74A 4YRDA 4OXYA 2HSDA 5TT1A 3DZIA 3BZUA 4Q3NA 1V3VA 1WPQA 3VPHA 5IFLA 3ZI0A 4O1MA 2VT2A 3GF4A 1S7CA 1JAXA 8ADHA 2V7PA 5EIOA 4L8VA 1DHRA 5KOIA 1VSUA 2FZEA 1GPJA 5JPIA 1D1SA 5BR7A 4WASA 1LDNA 1XIVA 2C7GA 4XQCA 5DNAA 1VSVA 1WVGA 3GMSA 4RF3A 1EQ2A 2GUGA 4JXKA 3S8MA 4CMEC 6LDHA 5JAZA 1I2CA 1MA0A 3QWFA 1QP8A 3ZV3A 1DOHA 3EY4A 3VKUA 5A06A 2FZWA 2IYPA 3U4DA 4B8ZA 2RBEA 4DWVA 3F46A 1P45A 2O4CA 1ZJYA 4WJZA 4CUKA 4PZDA 2B36A 3PK0A 4U5QA 2ZYDA 3VKVA 1VLLA 3OM9A 4OKNA 2FR1A 2J3KA 4U6SA 3RFTA 3ZV5A 4WOJA 5DN9A 1E3IA 3EVTA 3LDHA 4PLCA 5I8WA 5BQFA 4A27A 1XA0A 2X22A 3B1FA 4FFRA 4MDHA 1MXFA 3WTBA 2IXAA 1E6EA 2P5YA 1KEVA 1D4FA 4JGBA 1V8BA 3DHNA 2PZLA 3G17A 1NX6A 3E03A 5HBRA 3LU1A 2CZCA 3TOXA 3UCFA 2C2YA 3RU7A 1KVSA 3KSZO 4IZHA 3ZW8A 3ETEA 5TX7A 5AXAA 1ZFNA 1ZBQA 3GDFA 4S1VA 1TT5A 2GRAA 3MZ0A 5KVCA 4PVDA 3ZU4A 1NAIA 4YJHB 2Y66A 1YBAA 5A03A 1PX0A 1I3LA 1Z45A 2CMDA 1ZMTA 3WYBA 4CUZA 4W9NA 1NPDA 2VYND 4N5MA 4RCVA 4DIFA 1DEHA 1DXYA 4BNFA 1YL6A 3EVNA 2EHDA 1MGOA 2QX7A 3VH1A 4R1SA 1B7GO 1I32A 4ALJA 4ZICA 1V3TA 1HZJA 3ZHZA 4HXYA 4IIVA 1SCUA 4KTTE 1T25A 4CMKA 9LDBA 4BNTA 2AQIA 3EMKA 1ZNQO 2WM3A 3RC2A 1PQWA 4WEQA 4CMBA 3VDRA 3DMTA 2ET6A 2VRCA 4UVGA 2X23A 1SEPA 1R4MA 3ROMA 5DBIA 2QZZA 3JQGA 4I5FA 4YT2A 1GCOA 3JD1A 4J9UE 4MVJA 4Y6RA 3RC1A 3R3JA 1UZMA 2VHYA 4L75A 4B7UA 3FBTA 3AUAA 1GEGA 3L9XA 3SVTA 4JBGA 1HETA 2PLAA 2UDPA 4CR6A 1WLYA 1GYPA 4MVJH 4R1TA 4IMRA 2PR2A 1P1HA 5KVVA 4DLAA 3SC4A 4CPDA 4J1TA 1IPEA 3PDJA 3V2GA 1U28A 1UXJA 1RKXA 5TQVA 3ZV6A 3KUXA 3GNTA 5G0TA 5JS6A 1UXKA 2DTDA 2PY6A 4GX5A 1EBUA 2Q46A 1KOLA 1YBVA 3RBZA 1IOLA 4DIBA 4E6PA 5IZCA 1I2BA 1XU7A 4LN1A 2O3RA 2YHIB 2DBZA 3UCXA 4BMVA 1JKIA 1QMGA 4NHEA 1GYQA 1NASA 4XZ3A 2YUTA 2QRKA 5B4VA 4IUYA 4BUCA 1YQXA 1E7SA 1LUAA 2C20A 1CRWG 1EDOA 2Y1GA 4BQRA 3OIDA 1T1RA
chains in the Genus database with same CATH superfamily
3G1WA 1JHUA 1XZGA 2OHGA 3F4BA 3WFIA 3QVOA 4D42A 4DUPA 4L9SA 1AM4D 5LQRA 1XD9A 1YZYA 2HPAA 4PAGA 4YHBA 4NNOA 2HTEA 2P2ZA 2VDJA 2YIDA 4JUBA 5CFZA 2OLJA 2ZBUA 3EWAA 4YAWA 1PS9A 1XWFA 3PITA 3ZXYA 4M9SA 4F4FA 3B52X 2P6NA 3UY4A 3G59A 5B3AA 3FB1A 5K2MA 5JHGB 1S3FA 3H6KA 5C8XA 1NVFA 3D3WB 4OL9A 4JLJA 1W96A 2REQB 1PZMA 5JXWA 2NSDA 3AILA 1Q16A 2PMWB 1NDQA 3L7MA 3ADCA 2A9FA 1GV1A 3EODA 4LGMA 4ER0A 1IL0A 2WV7A 1SXGA 3GCWA 4AQDA 1T8PA 3BQ9A 5C5CA 2X1HA 2NO7A 3JASA 2PUCA 1ELOA 3OQVA 4HGZA 1TFRA 3HMKA 2Y1XA 4OMCA 3ZCPA 3BJMA 1XPOA 1EE1A 1E3WA 1JECA 3V8VA 4MARA 4UD6A 2C3UA 3L4BC 3AFMA 1BWQA 2GBLC 5COBA 2JDIA 1J9GA 2C3PA 1PJTA 2CJWB 3SIXA 4EA7A 2PZ8A 5FI3A 4B7ZA 3CXUA 1J22A 4M0DA 2FX3A 1QOQB 3PD0A 3UWMA 4D0NA 5KCZA 2CLFB 3BF7A 5GJWC 1E4EB 2H31A 4ZAXA 1AA6A 4EJMA 5CA1B 5HOQA 5CVCA 16PKA 1LDBA 3JALA 3BRCA 3CF0A 1A5TA 4EMUA 2QSUA 4C0SA 3K0EA 2LUOA 1IB0A 1XMSA 4TPKA 5EP3A 1TEZA 4M1QA 4MQFA 3EWSA 3NBUA 3KKLA 3NVAA 1ULSA 1N2BA 3BWYA 4ETMA 4X1KB 2UUAB 2IOFA 4BRZA 2V7WA 3I01M 1V5FA 4U9HS 4H6XA 1FF9A 4JLAA 4X20B 2XKKA 4MOWA 1IN7A 1PWYE 4PYJA 4JQOA 4Z7OB 2BFDB 2DKFA 3IAUA 2AZMA 4R41A 4II2A 4DW8A 4ZJUA 4CI9A 2GCIA 4JJIA 1N8KA 1B16A 5A1TA 2WHPB 3LLSA 1RXVA 1NM5A 3E9QA 1U8TA 1XFAA 1DKOA 1TJ5A 4O4IA 5M29A 1O0CA 1YI8A 4BMSA 1FQOA 1SHLA 1VCIA 1YGPA 2PD4A 2V6JA 2P9EA 2QTGA 3FHCB 4HDMB 5JG7A 4BATA 4DB4A 1HNWB 4C0WA 2ZIFA 4NH4A 3VSAA 1LK0A 2H2HA 3V97A 4HYYA 4U02A 3QHPA 3KYDA 5ITWA 3X1DA 3IAHA 1AN9A 1BFUA 2B0JA 3BGWA 3NOOA 1YZFA 4BNWA 1G9SA 1OCEA 2R1TB 2XT6A 4CG2A 4ZI5A 4KO1S 4R7TA 3GUZA 3CCFA 1P8AA 4WESB 3QU5A 5FUYA 1FYEA 3PQ3A 2GZDA 2Y1FA 2QQEA 4JEHA 3DNFA 5D3MA 2FEXA 1VKRA 3PC3A 4K0RA 1Z0DA 4WH0A 4YT8A 3G2HA 3ZHQA 4E08A 1PZNA 5DN6A 1W9MA 2YR0A 1E0DA 5F77A 3AH8A 1CY6A 4JSRA 4AJ2A 3O9MA 2OZEA 2EKZA 3PPWA 3MLEA 1PQPA 2NX2A 2VK8A 4MH0R 4O4LF 5E4YA 4PQEA 3HWRA 3ROGA 5I9IA 3RADC 1OE0A 4DM4A 2JLVA 2IUFA 3KOXA 1CEYA 2FWNA 2WM8A 1ZNXA 3L6BA 2LIPA 1NRJB 2GK4A 2YRXA 5EHXA 1E98A 1ZD5A 2X9GA 1EJ6A 1BVUA 3FUXA 4FJ1A 3DYIA 4N6NA 1NHWA 1GKYA 4PVCA 1ABFA 2FPIB 3SJZA 3AF5A 2FEKA 5KNCH 1P19A 2ZWOA 3TTTA 5L4SA 5EG5A 1D6NA 2OBXA 5TQ2A 1W85A 1GKUB 1K0UA 4QUHA 1OIXA 2XUOA 3I2YX 4GW3A 4TTJA 2DR2A 5JQGB 3ORYA 2WU0A 4LYHA 3ZBTA 1OXBB 1OXTA 4CM5A 4TLAA 1OXVA 2XYRA 5KWSA 4C4RA 4MCAA 3UWDA 5AW8A 1KYQA 3PC7A 4POOA 3MIIA 2NWQA 3JVDA 1V8PA 2IEDA 1K8RA 2GD6A 3MELA 4HRAA 1JJFA 1NTOA 2FHPA 2I67A 3AZQA 5ALIA 3U80A 1E2KA 3ANLA 5JV5A 3A6LA 1L7NA 2AMJA 3ENKA 3I42A 3WLSA 2D13A 2IYAA 3ILYA 2WSSD 3HXQA 5ALZA 2BH9A 2BI7A 4YV7A 4D0SA 2AN4A 3LT4A 5A5FA 2XMQA 2IUTA 4LZWA 3SJ7A 2R6DA 2XR1A 2PQMA 4KYIB 2YX1A 1IIBA 3P2IA 4ZQIA 2FDCA 2OKCA 1RADA 3ELYA 4ODIA 3D0OA 1GTZA 3O8CA 1XZNA 3RGGA 2WTXA 3FPGA 1JSCA 3WWPA 3MSCA 1KIFA 1V8FA 3H8VA 1UFQA 5J4KA 3HJFA 1I3CA 1NXXA 3K9LA 4R8LA 3OY7A 1RYEA 2GEDA 3NAMA 4J03A 4X94A 4L8GA 4MV1A 1SQGA 2GN4A 1SAYA 5JQGF 2WU4A 1QDUA 1UJ5A 3C3WA 3IMKA 5T67A 5BUSA 1RHMA 3OIWA 5TS2A 5BNFA 4X20A 3ESRA 2C8KA 3QF4A 4ZOBA 4CF7A 1XJWA 4C0HA 2N46A 2D5CA 2GMWA 4RKFA 4X00A 5DI3A 1WD7A 1WSDA 1YJQA 2ODAA 3CO5A 3HLYA 4M9XA 1LVUA 1F51E 1U8CB 1ZMXA 2BP7A 2VJAA 3IESA 2IQIA 6GPBA 4C76A 3TG8A 3S28A 3L0ZA 5ADUS 1ECBA 4Y1RB 5KJEA 2RKOA 3KJEA 3CVVA 2GERA 2RI1A 3A4MA 2ZTVA 4HY3A 4Q7EA 3HG7A 2QSZA 2GBPA 3LF2A 4B4WA 4UDNA 4BRSA 2VP5A 3FR8A 4MW6A 4KREA 1AX9A 1SD5A 1E92A 1T1IA 1WDKA 3DM5A 5KHLB 3CX8A 3USZA 4G26A 2FFQA 4RD4A 2VNKA 4RUKA 3UZUA 4DRYA 5ERXA 4J2TA 5A4KA 1BU8A 5JD4A 1Q77A 4OF4A 4HH0A 4QYIA 1T3SA 1LNZA 1VGQA 1NQXA 2RJNA 4IJWA 3I6ZA 2Q5HA 1SURA 4CM9A 4DC1A 3U1BA 4FGLA 1THGA 1MCZA 5KUTA 1G7RA 3AR5A 3IP3A 2NZ2A 4DJDC 1E3DA 4MV8A 5FT9A 2B78A 3JQBA 1QHYA 2VBFA 4UTPA 4MQFB 4IM7A 4KAXA 4NARA 2VDNB 1U5BB 4FYXA 4OQLA 2Q49A 4P31A 3TLGB 2HSZA 3AL3A 3DCJA 3BZBA 3G2NA 3LT5A 4H31A 4R16A 4D9FA 2A9KA 5BWNA 1JIQA 2POQX 4OA8A 4XVQA 3IERA 4MW9A 2PSJA 4M21A 2Y1OA 4I55A 2OQ2A 3I39X 4KC0A 1VPLA 5ELLA 3KBOA 4IGEA 3AESA 4YP7A 3V6LA 3ZE0B 4LHYA 1UBRS 1FZTA 1SNYA 1I3OA 1GL3A 2O2SA 3EUAA 3IUYA 1BWSA 1RQNA 2J3EA 4CLXA 1R8YA 3CPHA 3HXPA 4H15A 3N59A 2A5GA 1Q5PA 2DSNA 4GOLD 4MVJE 4UDXX 1WKBA 3EVGA 5HMLA 5JDIA 3AKZA 1CZHA 5JR3A 1M6YA 5FYQA 1V6AA 2V4ZA 1BXKA 3NPAA 3V9AA 2ID7A 3KKZA 3SSAA 4BB5A 4F8YA 1M1XB 4TN5A 3G68A 3K31A 5LPNA 3HP7A 4Q16A 1T2FA 2R4TA 1JPNA 3LI2A 4ZOQI 3SKYA 2QRPA 1KWGA 3LRPA 2CMHA 4FEYA 5JXHA 1KOJA 1ZZEA 3MMNA 4KHPB 3DVAB 1XVIA 2DT5A 2GJAA 4RC9A 2WQ6A 1KAMA 4CMIB 2LGJA 2JHPA 3ZE9A 2QN2A 3B5EA 2P9CA 5T5QA 3W5HA 4PR0A 3ZV4A 5FWXB 1B0ZA 1Q7RA 2HF7A 1UBFA 4NS4A 4QDOA 5H7XA 2Q0XA 1ACLA 1BVYF 2WR8A 3JTMA 3NHUA 1KBQA 1EP2B 4HP8A 3RVNA 4GMDA 3RSGA 4LSWA 1AF7A 4PX2A 1NQTA 1OFIA 2IZ5A 4KX3A 4WN9B 4ND1A 3D8NA 3W6ZA 4N48A 1G3RA 1V7PC 2H7CA 1GPBA 2VTKA 3G23A 3M1AA 4WY5A 4DJJA 5GZ1A 1L5HA 5A5GA 4P92A 1KK1A 2CZGA 3NUGA 4CT5A 2P2YA 5ALLA 4XVRA 3ILSA 1WOYA 3W3AA 1T24A 4HN4B 4H3SA 1EFRA 2ZBRA 4XCQA 3FSJX 1HT2E 3NKVA 5AHRA 2XUPA 1PI3A 1EU1A 1Y81A 4GMGA 2CNWA 1L1FA 4OFXA 1NMSA 1SOMA 1V2GA 1U0GA 3FAZA 3O8BA 3E5NA 4ZOLB 3EK2A 3ZGNA 1XZEA 1V1JA 5COAA 4KQIA 2W2KB 3L41A 4IIJB 4NCKA 1CRLA 1CYDA 2FKAA 4PYRA 3OZUA 3RF6A 1Z0JA 1WF6A 2CDNA 4BKOA 2E4UA 1RWWA 1IBCA 1GY8A 1IC6A 3BC1A 4LYAA 1LNSA 3OKPA 3BK2A 3L06A 4LRTB 5IYZA 1AN0A 5FCDA 3BXZA 3IDSA 1QH1B 3BAFA 3DS8A 2CUZA 3S2IA 1P73A 3OMWA 3QMWA 3D1LA 3R1IA 3ANNA 5EUQB 5F64A 2PV7A 2JA1A 3WO0A 1VXOA 2E4ZA 2YXNA 4CKEA 4MMYB 2J9FA 1PZHA 1DFHA 1IBLB 1MP0A 1F5NA 1MRNA 4E5NA 3WV5A 3OIYA 5H59A 3VDNB 3BIFA 4IG4A 2OFXA 2P9YA 2WHRA 2YW2A 1R6TA 3S6JA 4DV1B 3ER8A 1R5BA 2VK2A 1I4DD 3AYZB 1X6VA 5DNCA 4EKGA 3LQ2A 4YAFA 4CFYA 2KJQA 3VR4D 1VBNA 2W6IA 1XEXA 4CKYA 4ETNA 1IATA 1CJCA 1TUGA 1GCAA 1ZJZA 1KBZA 1KTVA 1SKQA 1XMJA 3N0TA 3P27A 2VJMA 1K98A 4O0MA 2CLSA 5DULA 1JHAA 3DUFB 3GIDA 3TWOA 4DXHA 2PUGA 3REOA 2X0IA 1GSAA 2DFVA 3FPSA 4R51A 1DRKA 4KPUA 4X8OA 1Q3HA 3ZZUA 3AHJA 3GH3A 4KYTA 3RVJA 3FYCA 3TYXA 3X1ZA 1YC2A 4BFWA 2I2WA 4P7GA 1SUSA 3DVRX 1Y6RA 1O03A 3FCAA 1GQRA 3B13B 4XR9A 1TTQB 5REQA 1R74A 3T12A 2AUMA 3MAAC 1R0KA 2PZKA 4L5JA 2NXWA 3LGXA 3W5IA 3WLOA 4B6QA 4YRIA 3UTDA 2I2DA 3VPGA 1S4MA 3G2KA 5LQAA 3INRA 2OECA 3VFDA 1RE1A 1ZY2A 4KQWA 3HDHA 5TB5A 3TLMA 1XP8A 3JARB 3PGA1 1ZK4A 1HMPA 2MOKA 4QATA 4RF2A 4CLRB 3LOPA 3ZKAA 1JQLB 4QULA 2YV1A 3SEQA 5I8ZA 1TYZA 2O23A 5T57A 3EGXB 4GX0A 4MRNA 1EINA 3H19A 5AKEA 3Q6MA 4CW7A 3BE5A 1Z26A 3B9RA 3FWHA 1Y1QA 5ALGA 2J4CA 3GLHE 5AKJA 1YFLA 1WD5A 5EEHA 1XA3A 3AR3A 4QUDA 3VTKA 5IXSA 4A6XA 5JZOA 5KWJA 2IY8A 2GD0A 3ZWMA 1I9CA 3ROQA 4GC9A 1RRKA 2JD2A 1D2HA 5TF0A 3VVMA 3W90A 4MW2A 4ZCLA 1ZA2A 2A7QA 1M3SA 2ZE5A 4LC9A 2H3HA 5CVUA 5AVOA 3I9JA 5E95A 5HQ3B 4LXXA 3O75A 2PKQO 2OA0A 2XB9A 2ZM6B 3AV3A 1ISSA 1DAIA 3IR7A 1M2FA 3VI4B 6REQA 2BWJA 1JHXA 2ES4A 4XGQA 1M0EA 5FH9A 1PVOA 2QX4A 3ERCA 1YACA 4UVIA 1HE4A 4TSRA 4ME6A 1D8TA 3IBGA 4GNRA 2AW3A 4MV6A 4G0VA 1N6NA 2QW1A 4BIIA 1N1EA 1V43A 4XASA 1SXJD 1CFJA 2PM8A 2YV5A 3PNOA 4E2YA 3O95A 4BO5A 1OFUA 4KFUA 1LSSA 2O7NA 5KTPA 2VRNA 1N57A 4QGBA 4AL4A 4F11A 1UDAA 3INNA 5BSVA 5LXTA 1SD2A 3AQIA 1NYQA 1QTQA 5FR1A 3MUOA 1A4XA 2YY5A 1EVZA 1WUIS 1DAMA 1IQRA 2EJWA 2XBUA 3L0PA 3N8IA 2KHZA 2YWCA 3LPDA 5HK8A 1G5RA 2QLFA 3X2FA 3N2IA 3O3NB 4B6GA 2HY7A 1NSYA 1T1GA 3GWZA 4TKVB 1SIOA 3DQPA 2BFEA 2EGGA 4US0R 4XOIA 3ZE1B 4BFCA 2KE5A 2FOIA 2J9GA 4FFOA 2VN8A 1Q95A 3RAPR 1ZICA 3HFJA 1Y63A 5ALEA 4F38A 1QIGA 3CFYA 4ZVUA 3Q15C 3PV0A 4X44A 4XKJA 4DADA 2C4VA 3OZSA 5JAQA 3K9CA 3WWOA 2G6BA 3L43A 3RREA 1I4TD 1XMVA 5DSXA 5B2ZA 3FD8A 3ZWWA 1PU2A 2XQFA 5F23A 2A8YA 2FAXA 3OHMA 4CVNA 1OAAA 1TCBA 2FPGB 3QV2A 3HDYA 1ZK2A 3CUTA 2HJRA 1WBBA 3AR2A 4DBZA 2XSZD 5CDFA 4X84A 4BNLA 4V1CI 4ZVTA 1FFXB 4WCVA 1Y7IA 2BRUC 5JMWA 1LH0A 3INYA 2WJVA 3ZPXA 4L6AA 5C7OO 2XV1A 3NNSA 1F2DA 1P9NA 2Q6VA 3H1PA 1AV6A 2Q3DA 2JCXA 5A4MS 1JJAA 3CJTA 3KVVA 4I9NA 1X0VA 3D59A 3ID6C 8GPBA 3O38A 2PX3A 3OPYI 2HW8A 4OIMA 1XAJA 4AS2A 2QY6A 4QAQA 5A3JA 3BFJA 3VYUB 4UEQA 2L2QA 5ULLA 1JH9A 1OHHA 3EVEA 3GAFA 4GXTA 1X9GA 1DOZA 4I9FA 4YGYA 4E88A 1GO2A 1GGHA 2WWXA 4MIKA 4QODA 1ZWLA 3QHAA 3W5UA 4CG1A 3HHEA 5M34A 4OQFA 3BMNB 5FO1A 2ZS7A 2Z4SA 5DMXA 3WXMA 1X8XA 4KWIA 1MAUA 3S2EA 1S7GA 3K70B 4IY1A 4YMTA 4HDOB 1U5CA 3UAZA 4LKRA 4O08A 1QRUA 2VNHA 4PLPA 1L5GB 3JYQA 1FVHA 3G1UA 1IRXA 4IQ8A 1Z29A 3ZDBA 2WA1A 3I2KA 4MP8A 4ZC1A 4OLBA 4QAJA 1XUOA 1RRCA 3FNGA 1JHYA 2Z1MA 3PHGA 1MC1A 3JYHA 3BL6A 4WXEA 5LLDA 2I2AA 5JZMA 3HC7A 2KS6A 2VRCD 3B3QA 4LHEA 5ICMA 3I9NA 3OJ0A 3R74A 1NXOA 4RTKA 3VH3A 1D2MA 4QYSA 5AHOA 1BEUB 1JGTA 2PZFA 3OEYA 2BGMA 4OH1A 2PHZA 1J99A 4CM7A 2DAPA 2QMEA 3QK7A 2IPAB 3GZNA 4ZEVA 3KT6A 4PZLA 4IUCS 1P0IA 1JTFA 3L1HA 3GCDA 3CA8A 3QOWA 3GGGA 3MCTA 3WGGA 4TQUS 1G4HA 4QNRA 1CBUA 1E7MA 2PT9A 1CLEA 1LU9A 2RGCA 3OZEA 4GPTA 4N1AA 4EUHA 1LLQA 2AD1A 1OILA 1O9BA 2WAXA 3KXLA 1IEQA 4POAA 1QO7A 3UYKA 4KITB 1WZNA 1NBME 5IT0A 3DB1A 4WKGA 1GU1A 3B1WA 4HGNA 1U0RA 1W85B 1APBA 4MUAA 2IA5A 2BZSA 2PIDA 4PANA 1GTRA 5CDFE 2AEJA 2WVHA 1W46A 1ZAKA 3C6BA 3EQ8A 1H65A 5B1IA 4F1JA 3CZ4A 2CK3D 2VHVA 2ZIXB 5KSOA 2BGKA 1Y3AA 4PAWA 4YDHB 1AZWA 5DX8A 4Z3KA 5HMMA 4UU0A 1CE8B 4XD7D 3DE4X 1OX5A 3UXMA 5DF1A 1QOZA 5K0SA 4G5RA 1A71A 3LV8A 4P53A 1E9VA 1AS3A 2H2DA 3SEZA 3VZPA 4ETIA 1VIDA 2NUTA 3BDVA 3FOWA 2E5WA 1UPXA 1JILA 4P80A 4PW0A 5E7JA 3CZRA 3PNMA 4YRJA 1TGVA 4MR9A 1QK3A 4QT0A 5CCBA 3VOAA 1BE8A 5LMUB 4WGGA 2QT9A 3WKAA 1CUAA 1I1HA 3A1DA 2XOEA 1UEJA 1KIAA 2DUJA 4EABA 3F9IA 1WY7A 4F2WA 5KOJA 2IBSA 2VBGA 2QJFA 3F5MA 2ECQA 3AKCA 3PUWA 4Q21A 3BDIA 5AVSA 3F2VA 3DO5A 4Q4AB 1U9CA 2XCQA 2YV2A 1TMOA 2XKJE 4GSYA 1KDVA 2I78A 2C7OA 3LUCA 3DE3X 2HUPA 1O94C 2D2XA 3OQIB 4L8YA 1QYDA 1SC3A 1K7XB 3OE5A 1WQ3A 1RWBA 2ZSKA 3UQZA 3W04A 4JI5B 4BQPA 3BFPA 3WHLA 3THRA 2ZIZA 2Q28A 3M9LA 4H3KB 3CZ9A 1SU7A 2P6PA 4FTWA 5JCOA 3NEAA 3RIEA 2BEUB 3WLKX 4EYEA 3HR8A 4C01A 1IY1A 1K08A 3JXEA 3SXJA 1T3GA 10MHA 2JCVA 4OMFG 5BUZA 5H9WA 5CLIA 1C7EA 1GSIA 3GT4A 1TYDE 2QN7A 3OQJA 2CT8A 1OW3B 3OUUA 1Z2AA 1EHCA 2UVQA 4A6EA 3ABSB 4PF1A 4Q7KA 1JB9A 4JLPA 1YIOA 1LNQA 3KXPA 1SKMA 3DFFA 1CY8A 1RJFA 3R5JA 1IK4A 2QW8A 1VJCA 2R1VA 2OB1A 1E8MA 4GLJA 1D09A 2FJ0A 5E2IA 1A9XB 5J2TA 3VPFA 1CR4A 3MWKA 1OFUX 4J7CA 2VT7A 4YMIA 4ZI2A 2NVOA 4K0KB 2TMGA 4E5PA 4CQLA 4EELA 2O20A 2GBLA 4PX5A 4NBWA 3Q7QA 2I1QA 2PWAA 2E5LB 3NWEA 1TU0A 4LS3A 3PGJA 4N5DA 1TAHA 4W63A 6YASA 4ND6A 1QE5A 4ER3A 3Q85A 3HCCA 1SKUA 1VYHA 3BA6A 2BMWA 2X8AA 3OKCA 5EGSA 4EVIA 1VBMA 2VDWB 4UW9A 1CDEA 3PEEA 1BKSB 3RRJA 4D82A 3WLIA 1MIOA 1X7HA 4FUQA 3MT8A 4RA9A 1ISJA 1XQYA 4X6XA 2QBYB 1VPTA 1F48A 4BMNA 4CIDA 1SWVA 3WGQA 3QNMA 3PTZA 4Y30A 5JJBA 2A9RA 1SPXA 3WWEA 1OBHA 1TLTA 2QM3A 2QRHA 5HZMA 1I5RA 2NSHA 2ZRBA 1N8SA 1UFVA 1KEUA 2LCQA 1ZSVA 3OPMA 2QMHA 3DL2A 2Q4RA 3IOMA 1EIZA 3C4QA 3C45A 1XR3A 4HTFB 1EB9A 2IV2X 5IK2A 1ZW1A 1NVTA 2DH6A 2VCYA 4PV7A 3ZV7A 3RM3A 4J9VA 2XH8A 4B8WA 4Z2AA 1W0KA 1XRRA 3OZDA 2DMRA 2WU1A 3SX2A 4D9GA 1MTOA 1U5BA 1RSZA 2UZ0A 2H4JA 3F6YA 4NFYA 4YJ2B 1IXSB 2WE7A 2X58A 3KQYA 4UVDA 1JDZA 2RK6A 4L73A 2B9VA 3KCQA 1KO1A 3FJOA 3L6EA 4JJ6A 5DIZA 1QWOA 4UTRA 3DAYA 3L84A 2JAHA 3DA8A 2I6TA 1Q0LA 2AE1A 3E9CA 1L5KA 4EPVA 3B1VA 3D31A 3MJ4A 4Z86A 1DTEA 3NALA 3E82A 1Z6AA 3DKRA 1QGED 1P80A 2O5EA 1CZUA 4NZMA 1ENYA 3LUFA 1YA4A 2F3SA 3G7SA 4Q1DA 4ZEXA 5CDYA 3SAJA 3KAKA 1A4RA 1JBEA 4GKBA 2DQYA 4I4TF 4IF4A 4IV5A 1V0JA 4OYHA 4KQJA 3EX7C 1E1NA 2GZAA 2BF7A 4WW0A 1AKUA 4QPDA 3CRMA 5LKAA 4EY8A 2HRBA 3F6CA 1GNRA 4ZQEA 4GMHA 4EIWA 1KO5A 3BGOS 3JU3A 2WY2D 2Z9DA 1RT9A 5HYVA 4FPXA 1R6UA 4GUDA 4AZ3A 2PXHA 3PUKA 2V7TA 3WMEA 2SKDA 3C6QA 4W1QA 3DZ8A 3FX2A 4MVJI 2FXIA 1F0NA 3IX7A 1YL5A 4B2IA 4DLSA 4IHJA 4C7XA 1AHHA 1ND5A 3HUDA 4BOYA 3HVIA 5JECA 4B3GA 3OKFA 4OHXA 3PNKA 4E1BA 4HTAA 5HUHA 1Y7HA 2R44A 3OQIA 4N5LA 1ZC4A 1JB1A 3KK0A 1LBEA 3IUEA 2Y2VA 4LJ7A 2FWBA 4P1ZA 4XJTA 3V8MA 4PX3A 1JVNA 1JSRA 2PT7A 4EFDA 1DMSA 1ZDMA 4LSMA 4F3YA 2GTPA 4RXTA 1UXOA 1ZM9A 5AK0A 4RTSA 3KQUA 2ZFUA 1L9XA 4ZYUA 5CK5A 1GGMA 4CL2A 4CL3A 2WB4A 4HEJA 3HXLA 1F6BA 2OCXA 3HNOA 4EEZA 1EE9A 1V3QE 3CF6R 2ZR0A 1A5BB 1DUVG 1TUBB 1UBUS 2BTQB 3I9KA 2BFWA 3KQPA 3M9WA 3PX3A 4N65A 6Q21A 4EB3A 1JN0A 2CY0A 4O1HA 2V7XA 4MUMA 3EYAA 5CDGA 5IJ9A 1WAMA 3MB5A 2GUWA 2FPIA 3BXXA 2HF9A 3WL8A 1NYLA 3KLPX 3WGZA 4HNQA 1PJLA 1KP2A 3CUYA 3FB4A 2EVWX 1FFSA 5D87A 5ALMA 4BX3A 3PNYA 3IKJA 5AVUA 3U0BA 1S9DA 2HJGA 1N2JA 2VSXA 3L05A 3Q3CA 1EUQA 2D2VA 2I0FA 3QIAA 4WN3A 4DDWA 5KX5F 3CMCO 2KLBA 3BRSA 1G6OA 3RTGA 1RDFA 3KOUA 5BSUA 3AR4A 4ANFA 3UT5B 1NPTO 1II9A 5HIIA 2NM0A 3FNEA 1M1UA 2RIRA 2H65A 1LI4A 1R16A 4ZGWA 4F4CA 3WBFA 2ZREA 1QRDA 2AI1A 3ROTA 4F96A 1AGNA 4IINA 4J49A 4HDNB 1P7VA 4Q1VA 5GIPE 3ZY2A 2G80A 3FWYA 3QPUA 3MJFA 1QHHB 3GQBB 2DEUA 3L1KA 3JD2A 3LE8A 2G5CA 2J5BA 4A5SA 1OB5A 1U3WA 4UUPA 2QE6A 2VZ8A 3QRWA 2XZLA 1BH2A 1FU7A 1P1BA 1C5KA 3R3ZA 4YIHA 5TVGA 5K3CA 2I6QA 5DCYA 1BMFD 1N2EA 4KI7A 3WRYC 4GE3A 4MINA 5EIAA 4KXUA 2EDAA 3MYYA 3LSYA 2F17A 1TA4A 3ZZ1A 1S96A 4URZR 4EZEA 2OENG 4CM4A 4WLUA 2GPYA 4H7HA 3PJGA 4G1FA 1SXJC 2J7PD 2W4QA 4YLEA 5KC8A 5EFOA 4BBJA 3FKQA 1XNGA 2GOYA 5JAUA 2VWHA 3GXBA 1SUBA 3H9JA 3WYDA 4F5YA 1N2CE 5IDVA 3K70D 5JT1A 3AVQA 3WRVA 3ZDFA 3C5HA 1JHQA 2VRWA 5EWLA 2J5KA 1YRHA 4BFVA 4LPKA 4DA6A 5L3QB 3EE6A 4O2BB 3HB0A 3GUUA 4P4TA 3V4PB 3PFWO 4FFBB 3TQCA 3V4ZA 3T5GA 4OY3A 3A0UA 1VMAA 4HDNA 3X2SA 3S70A 1KZ9A 1CJSA 5AW7A 1L3BA 1B14A 1I1OA 3BDAA 3C3YA 3W5CA 5A6SA 3DLHA 3I5XA 5HKLA 2HYDA 3OP4A 4RACA 4MRMB 2Q6LA 3E8SA 1M2VB 1QOPB 3CF2A 2OD2A 3BK7A 3Q11A 3VNRA 4BQOA 1Z0SA 2BH2A 1V96A 2VDMB 5DCWA 2BCGY 4M9RA 3I04M 4LQDA 4EY3A 3MERA 5IEBA 1G5TA 5K8UA 1I94B 3QBDA 3N8DA 1W1WA 4P54A 3CB2A 3ZY5A 5KB3A 2WNIA 2OBMA 5HOEA 1QX4A 4L0DA 1AKTA 2UYOA 2RHRA 3E7PA 4WLFA 4WOCA 1MZPA 3ZWPA 1E61A 2DG2A 5ILQA 4HNTA 1LBIA 4IVRA 4BVKA 5K20A 3ZWQA 5FLKA 2BFFA 2NV0A 3CTPA 2O0MA 2ODEA 2R47A 4FXPA 4BLWA 5AW1A 3QG1A 1Y6GA 1YB7A 4MTCA 1K89A 3DP9A 3SNHA 5SYAA 2PH3A 5JSHA 1DEOA 1K06A 4N12A 1I5OA 2HB6A 3P2MA 4OLJA 1CQZA 4GBJA 5CRIA 4W5QA 2QNBA 3O4VA 1OQAA 4XJXA 2YV4A 2PVPA 1Z9BA 4AO6A 2IUSA 1JPJA 2XMPA 2AS0A 5EUCA 3TSWA 2BHLA 5KU1A 5LJIA 1Y5MA 1WXFA 2GPTA 3HGQA 1QP0A 5A7HA 4DDVA 4UM9D 2Q41A 5KQMA 4F1WA 4FCTA 1ATIA 3OCYA 3USCS 1GL7A 1JNXX 2GQ0A 2JLAA 3BMQA 2BY4A 1VXRA 3FYUC 3R41A 2JIRA 3VDQA 2AQKA 3AEZA 4ZZIA 3D3WA 2GRJA 1JQBA 2MSDB 3FMFA 4XI9A 5TEWA 1LWOA 4PAMA 3SG0A 1YT5A 1T5LA 4EFKA 2VOEA 4ZRMA 3DMTC 4JB8A 1Z7EA 4XAQA 3E3NA 5EJGA 1XZBA 2HIGA 4QDZA 1PGOA 4BJHB 1BVHA 2H4XA 4AQ7A 4LNAA 4AZ0A 5BN5A 4R1NA 5K3OA 3INTA 3LD9A 2H4FA 3WSWA 1NWCA 2XVAA 1Z8DA 4CCYB 3OIUA 4RNDB 3VPXA 1K0FA 2HMSA 2NQ8A 2Y1LA 3QE0A 4RANA 1JSLA 4DIKA 4JCOA 3SM3A 3WO1A 4R1OA 3U19A 1ZH2A 4KQHA 2V9CA 4PG4A 5A9SA 3IKVA 4P33A 1LJUA 3RG8A 3VHLB 5BV1A 1UKCA 1WZCA 3A1UA 4WD3A 3HJCA 4Z3DA 3LQFA 4CDNA 4OHRA 1NJ6A 2BTOA 3OLZA 5GZ6A 3Q0EA 4B3BA 1MNQA 3Q3GE 3RI3A 3EULA 3FJYA 3QEOA 4C4TA 1FQWA 1JFLA 1M8KA 2CDAA 1ETHA 1YRWA 3PNBA 5AI9A 3KZOA 1CKEA 1MU0A 1SC1A 4DXDA 4AYWA 2JIOA 2XT0A 2B6NA 3E18A 3H9BA 3I4CA 4WFKA 4ED9A 3T7TA 3VNUA 2AE2A 3AJ9A 4Q05A 3TLJA 3ZKWB 4CDGA 5BT9A 3P0JA 4OGLA 5DISB 1EWYA 1GTJ1 3AJAA 4JC5A 4WZAB 4Z8XA 3UMJA 3GELA 2GLUA 4AU1A 2M2IA 1PYDA 1T0JB 4YRCA 3RYFA 3V2HA 4J94A 5CK4A 3W2TA 3C48A 4JLMA 2JLBA 1M8PA 2D5AA 1JG3A 1XEFA 3HCRA 1CP2A 2QZJA 1XEXB 4FINA 3KWMA 1I33A 4IILA 1DJMA 4GMXA 2EFYA 4IXNA 1YVEI 1B26A 2CWDA 4AKGA 3RUEA 2V97A 2BDEA 1GAQA 2Z56A 4US1R 3F6PA 1MVLA 4G1UC 5SV2A 1XZFA 3VSBA 4IV0A 1EZ1A 2CV1A 1VCMA 3LUGA 1VFPA 3KYCB 4BYGA 2NOAA 4UTVA 1KORA 3UMSA 3G9UA 1NMZA 2QENA 2XUZA 4HAYA 4PC3A 3ZLTA 2CHEA 4JI7B 3SICE 1RXIA 1T5TA 1RJGA 1MAVA 1ODKA 2GS9A 3CPSA 4B7XA 4YRAA 2RGNA 4PHCA 2C00A 2CD7A 2C5HA 1UBKS 2GASA 3T7SA 3IHKA 1BX0A 1GVNB 1WEKA 3OH8A 1ODCA 4MGEA 1NNSA 3UUGA 4UU7A 1KDYA 4BPBA 3KFLA 3CLVA 3PJFA 4HCJA 2D1QA 4AECA 4OK6A 1E2QA 2HRZA 4RMNA 3EYWA 3V00A 3OWOA 3H5IA 2A0FA 4A15A 2P4QA 1FYFA 3IQGX 4MV5A 2B3TA 3QPDA 1VIVA 5JC8A 4QFBA 3T9EA 1ABEA 3FDZB 3I0ZA 2EHJA 3UATA 2Y4NA 4O2AB 4XIFA 2YBEA 2G9UA 5JUWA 2PYZA 4F6RA 1SG0A 1J1IA 3LMKA 1BFKA 4PIVA 2ZTMA 4GKAA 4NX2A 4PZEA 4COOA 1J4AA 1JKMA 1P2UA 4G25A 1KK3A 3TI7A 4PQYA 1O94A 3OJFA 4UOEA 3ABZA 1IXKA 3GT3A 4ETWA 2D7DA 3R9XA 2G1JA 3BYZA 3V1KA 1YL7A 1VG0B 5CNKA 2BEUA 1VKNA 3ZQ4A 3MEQA 3KQKA 1VL2A 4JYMA 1QIFA 1UM9B 4BNHA 5EWMB 4PFQA 2D4HA 2ID4A 2O3SA 1FU8A 3DEJA 4A82A 1YCHA 2PO5A 4DRXB 2BT4A 2H54A 1J0AA 3IXMA 1Q0UA 3ILXA 3JW8A 3W77A 1O87A 5AUNB 1ZGZA 2GJ4A 4TTAA 3IVRA 3AWDA 4HX5A 1JR3E 2RJ3A 4R5MA 1E3SA 2WWYA 1LA2A 1JG4A 1RQXA 4N01A 2IIBA 3LQRA 3DEZA 3NAQA 4L4UA 4Q9KA 3RQIA 2YWBA 1QYCA 2E37A 3UMRA 2GYWA 4OREX 1XRJA 3NBMA 4GM4A 4I1PA 1Y1LA 4RSRA 1YRQA 2KM1A 3LY9A 1MOQA 3BWCA 1YAJA 3ESBA 4G0ZA 3DSRA 3TPZA 1Y3BE 4L4ZA 4PLZA 1O95D 3DHVA 4W5HA 5CEEA 1VI6A 2BGGA 2F7SA 1NJ8A 5HCUA 4BU0A 1O0BA 1BVRA 3GPDG 2FI1A 3ZBPA 1BHO1 3GFGA 1Z0ZA 3F4KA 4PBSA 3ZGYA 5E2AA 4G24A 1QUEA 2ZJ0A 3V3TA 1L8XA 2CYAA 4ECAA 4QGSA 2J46A 2YBDA 1ISFA 3JQ7A 4IIGA 3W6NA 2VJNA 3KJQA 1SK9A 2D1RA 4ROTA 3UFBA 3HA2A 3ZKWA 4TTIA 5CPFA 3NNDA 2IYFA 2JFPA 2Q3HA 3A6HA 3KZCA 3QELB 1MX9A 2JJ1A 5HRUA 3M3PA 3SHQA 2D4AA 3GLFE 1PR0A 3MVEA 2J9XB 3TOVA 2IS6A 3O83A 3P4YA 1G2IA 3WYEA 5K4GA 1EVJA 3OCCA 4LF4B 4UAUA 3ASVA 1XJQA 1NZDA 3OZ7A 1C1DB 4FYVA 4DZTA 1P1JA 5C4GB 4EY5A 3DWEX 1SOAA 5DDIP 1KMHB 3CEMA 3MOSA 3PPVA 1H5NA 1VRVA 1W47A 1EUCB 2EX4A 3C1AA 5IVDA 3R7DA 4BVGA 3WWYA 4AVYA 3RW9A 3WP0A 4YLYA 5H83A 5A9RA 1EGAA 3BBLA 3HNRA 3VOTA 4JLVA 4W5RA 2NU8A 3SZLA 3V32A 3HI4A 2FN7A 4XRRA 3TTWA 3ZCUA 1N5DA 3R7SA 4HLNA 4C88A 5DGTA 5ITZB 1U2DA 4FGWA 2RARA 2QB5A 3TPCA 2GCNA 3BWVA 2DUWA 1W36D 4ITVA 5LUAA 2E18A 1QHIA 5DTIA 4UASA 1LLDA 3T7CA 3RU3A 1R4AA 1WJGA 3CEAA 1JG6A 3Q3EA 3P9RA 1H1LB 2R8BA 1JMYA 3W5JA 1JQJC 1Z0KA 4MDFA 4QHSA 4H0FA 3QPVA 5CW1A 1Z4KA 3AEUA 1IJKA 1AQJA 2AB0A 3OZGA 5C0OE 3QUSA 2J30A 4K5QA 2VXBA 4X6UA 3E9EA 1H6DA 3PSHA 5JCOC 5KZMB 1ZG3A 3A4LA 3UT5A 2ARKA 1RZUA 2VCHA 3IUMA 5C1OA 1YWGO 2C99A 4K3VA 3KRTA 1RXCA 2OWDA 5FOUA 4JH0A 4H7DA 1K5GA 2HSGA 1FCJA 3KQVA 3MCWA 1TYAE 2CJXA 1K3UB 5MFZA 3WICA 4YPOA 2JZOA 2HRRA 1FFCA 4MUGA 4KXXA 1Y4AE 4AIRA 4D9IA 2Q8QA 5AVXA 3QPAA 3HJAA 3UAXA 3KV3O 3U3XA 1QF7A 2WV9A 1YJBA 2W71A 3E70C 2QRUA 3AVXA 1YJXA 1DELA 1F38A 1HNZB 4NEGA 5E6SA 1QXSA 2HO5A 4CLOA 5J5VA 3RUFA 3R0ZA 3TVTA 4DGQA 4P4SA 2W2QA 3SSMA 4HUTA 3EFBA 5FPQA 3SYNA 3JZFA 4MROA 3S7TA 4H60A 4YJFA 4Q1BA 1Q6ZA 4QOEA 3QUAA 6ADHA 4QUJA 2OILA 3PPIA 2BLLA 4X0EA 1RP7A 5B2EA 1GQYA 1C8KA 1K7SN 4FC7A 2Q6OA 4HOYA 4REOA 5C8ZA 2VT3A 4B40A 1FX1A 5D84A 3RVBA 2F00A 5I9LA 3KQWA 4RKEA 1M0WA 3RU9A 2EFEB 3W3AD 1F6DA 3D3JA 2PL9A 3AIKA 1R9NA 4Q00A 1TECE 2HQBA 3G02A 3HR7A 2CBXA 4UHJA 1YS9A 3WIVA 4ACBA 2E1RA 4D46A 3V7YA 3NCHA 4A2WA 4DLVA 2XZPA 4ZODA 5C81A 4QQFA 2YWJA 2FFAA 2PN1A 1Y5IA 3K6JA 1EJBA 1F0YA 4G89A 2WD7B 5TMDA 4CNBA 1KYIA 4N8SA 3ZD9A 1K9SA 3WJ7A 3D7NA 3TEJA 2V58A 3O2QB 4I5DA 4K2HA 3AUFA 5CFLA 4RQBA 1XLWA 4LJLA 3ZK9A 1T1EA 1Z74A 2AT1A 4O63O 4BMZA 5ARCA 2XCIA 1W44A 4EVRA 1IN4A 1NQVA 4IRUB 4IIXA 4XUDA 3T9AA 3T4XA 1AURA 2J0VA 3P9SA 2XMRA 2J32A 4E5MA 3F6RA 2XYVA 3RPEA 2IODA 3MWJA 4DBLE 4ZDJA 3O8OA 3CWQA 4E3ZA 2V6GA 2Z2KA 3DLPX 4UC0A 4NKRA 5IG2A 3R6LA 2PPVA 1XYGA 3TINA 1ZIXA 3SF8B 2JIMA 2WD8A 3V1YA 2CCGA 5JYCA 1RWVA 2X6TA 4G9GA 1SIBE 1T2CA 1F9AA 3FPBA 3SLRA 2IGBA 4L5BA 2PRYA 2AK3A 1ZW6A 4M0KA 5FOTA 1A1VA 3X1YA 3BSSA 3I2GA 3VKWA 5H5JA 1OH6A 4JI6B 1U80A 4CGYA 4URWR 2QJOA 2B94A 3ZJVA 1ZNWA 3VR4A 4DC0A 2YDXA 4G1MB 2V55B 3STYA 1XQ6A 4RX1A 1O95C 4C21A 2E48A 2IK8A 5LQSA 2ZITA 5EJEA 1G6Q1 2FWRA 2I2FA 1PNRA 1JVSA 1FJXA 4GKJB