4I5LC

Structural mechanism of trimeric pp2a holoenzyme involving pr70: insight for cdc6 dephosphorylation
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
295
structure length
295
Chain Sequence
DEKVFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Ca(2+)-dependent PP2A heterotrimer and insights into Cdc6 dephosphorylation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/toxin
molecule keywords Serine/threonine-protein phosphatase 2A 65 kDa regulatory su
total genus 111
structure length 295
sequence length 295
chains with identical sequence F
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2012-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 4i5lC00
1II7A 5HPEA 2NYLC 4G9JA 1HP1A 1IT6A 4LU9A 1UTEA 3E7AA 3H62B 4DHLA 4V0XA 1S3MA 2QJCA 2WDDA 4TUGA 1V73A 3EGHA 3QFNA 4UWQA 2IE3C 3H61A 1OIDA 1XM7A 3H69A 1W24A 4H2FA 4I5LC 2Z72A 3C9FA 4FBKA 1Z2XA 4O4KA 2BQ8X 3AUZA 3P71C 4F0ZA 2DFJA 3N5UA 4ORCA 1OIEA 5INBA 3KBPA 2NYMC 2P6BA 2O8AA 3TGHA 2XMOA 3JYFA 2ZBMA 4H1SA 4ZVZA 2IAEC 4HD0A 4V0VA 4TUIA 4MOYA 3QFKA 4O24A 1KBPA 1Z2WA 3E7BA 4Q7FA 3HVQA 1U32A 5EQVA 4DSYA 5F3WA 2BDXA 2HY1A 3RL4A 4I5NC 1SU1A 3DW8C 1NNWA 3H63A 1XZWA 3ZU0A 1FJMA 4OR9A 4IL1A 4KKZA 4NZVA 1T70A 4XPNA 3GVEA 2YVTA 4KBPA 3QG5C 4J6OA 4UT2A 3THOB 2Q8UA 1HPUA 5DNYA 2IE4C 3QFMA 2O8GA 3CK2A 3IB7A 5C1VA 4ORBA 2JOGA 3QFOA 2NXFA 1UF3A 5JJTA 3ICFA 4IYPC 4UT3B 3T1IA 4B2OA 1TCOA 4M0VA 1WAO1 3PSOA 3H66A 4UT3A 1S3NA 1S8EA 2QFPA 4H1YP 3ZTVA 1AUIA 3FGAC 2WDCA 1OI8A 2CV9A 2KKNA 2Z1AA 3IVDA 2AHDA 2HYPA 4LACC 4JA7A 3C5WC 1HO5A 4O5GA 3DSDA 3H67A 4FBWA 2Z06A 2WDFA 4V0WA 4H2BA 3PSNA 3RL3A 2BCDA 2QFRA 5GTUA 1S3LA 2HYOA 4ORAA 3DSCA 4MOVA 3RQZA 4LTYA 5B8IA 1MF8A 4WWLA 3EGGA 2GJUA 5J28A 1USHA 4O43A 3H60A 5JPFA 5JPEA 3IVEA 4H2IA 3THNA 1JK7A 1S95A 1QFCA 3AV0A 3RL5A 1M63A 4H2GA 2WDEA 2A22A 4MP0A 1G5BA 3H68A 2NPPC 3K7WC 4ZX2A 3V4YA 4FBQA 4DT2A 1WARA 3K7VC 3IB8A 4JA9A 4FCXA 3LL8A 2R17A 5IOHA 3H64A 1T71A 4YKEA 1QHWA 2USHA 1S70A
chains in the Genus database with same CATH superfamily
1II7A 5HPEA 2NYLC 4G9JA 1HP1A 1IT6A 4LU9A 1UTEA 3E7AA 3H62B 4DHLA 4V0XA 1S3MA 2QJCA 2WDDA 4TUGA 1V73A 3EGHA 3QFNA 3FLOA 4UWQA 2IE3C 3H61A 1OIDA 1XM7A 3H69A 1W24A 4H2FA 4I5LC 2Z72A 3C9FA 4FBKA 1Z2XA 4O4KA 2BQ8X 3AUZA 3P71C 4F0ZA 2DFJA 3N5UA 4ORCA 1OIEA 5INBA 3KBPA 2NYMC 2P6BA 2O8AA 3TGHA 2XMOA 3JYFA 2ZBMA 4H1SA 4ZVZA 2IAEC 4HD0A 4V0VA 4TUIA 4MOYA 3QFKA 4O24A 1KBPA 1Z2WA 3E7BA 4Q7FA 3HVQA 1U32A 5EQVA 4DSYA 5F3WA 2BDXA 2HY1A 3RL4A 4I5NC 1SU1A 3DW8C 1NNWA 3H63A 1XZWA 3ZU0A 1FJMA 4OR9A 2YEQA 4IL1A 4NZVA 4KKZA 1T70A 4XPNA 3GVEA 2YVTA 4KBPA 3QG5C 4J6OA 4UT2A 3THOB 2Q8UA 1HPUA 5DNYA 2IE4C 3QFMA 2O8GA 3CK2A 3IB7A 5C1VA 4ORBA 2JOGA 3QFOA 2NXFA 1UF3A 5JJTA 3ICFA 4IYPC 4UT3B 3T1IA 4B2OA 1TCOA 4M0VA 1WAO1 3PSOA 3H66A 4UT3A 1S3NA 1S8EA 2QFPA 4H1YP 3ZTVA 1AUIA 3FGAC 2WDCA 1OI8A 2CV9A 2KKNA 2Z1AA 2ZO9B 2AHDA 2HYPA 3IVDA 4LACC 4JA7A 3C5WC 1HO5A 4O5GA 3DSDA 3H67A 4FBWA 3D03A 2Z06A 2WDFA 4V0WA 4H2BA 3PSNA 3RL3A 2BCDA 2QFRA 5GTUA 1S3LA 2HYOA 3E0JA 4ORAA 3DSCA 4MOVA 2DXNA 4LTYA 3RQZA 5B8IA 1MF8A 4WWLA 3EGGA 2GJUA 5J28A 1USHA 4O43A 3H60A 5JPFA 5JPEA 2DXLA 3IVEA 4H2IA 3THNA 2ZOAA 1JK7A 1S95A 1QFCA 3AV0A 3RL5A 1M63A 4H2GA 2WDEA 2A22A 4MP0A 1G5BA 3H68A 2NPPC 3K7WC 4ZX2A 3V4YA 4FBQA 4DT2A 1WARA 3K7VC 3IB8A 4JA9A 4FCXA 3LL8A 2R17A 5IOHA 3H64A 1T71A 4YKEA 1QHWA 2USHA 1S70A
chains in the Genus database with same CATH topology
1II7A 5HPEA 2NYLC 4G9JA 1HP1A 1IT6A 4LU9A 1UTEA 3E7AA 3H62B 4DHLA 4V0XA 1S3MA 2QJCA 2WDDA 4TUGA 1V73A 3EGHA 3QFNA 3FLOA 4UWQA 2IE3C 3H61A 1OIDA 1XM7A 3H69A 1W24A 4H2FA 4I5LC 2Z72A 3C9FA 4FBKA 1Z2XA 4O4KA 2BQ8X 3AUZA 3P71C 4F0ZA 2DFJA 3N5UA 4ORCA 1OIEA 5INBA 3KBPA 2NYMC 2P6BA 2O8AA 3TGHA 2XMOA 3JYFA 2ZBMA 4H1SA 4ZVZA 2IAEC 4HD0A 4V0VA 4TUIA 4MOYA 3QFKA 4O24A 1KBPA 1Z2WA 3E7BA 4Q7FA 3HVQA 1U32A 5EQVA 4DSYA 5F3WA 2BDXA 2HY1A 3RL4A 4I5NC 1SU1A 3DW8C 1NNWA 3H63A 1XZWA 3ZU0A 1FJMA 4OR9A 2YEQA 4IL1A 4NZVA 4KKZA 1T70A 4XPNA 3GVEA 2YVTA 4KBPA 3QG5C 4J6OA 4UT2A 3THOB 2Q8UA 1HPUA 5DNYA 2IE4C 3QFMA 2O8GA 3CK2A 3IB7A 5C1VA 4ORBA 2JOGA 3QFOA 2NXFA 1UF3A 5JJTA 3ICFA 4IYPC 4UT3B 3T1IA 4B2OA 1TCOA 4M0VA 1WAO1 3PSOA 3H66A 4UT3A 1S3NA 1S8EA 2QFPA 4H1YP 3ZTVA 1AUIA 3FGAC 2WDCA 1OI8A 2CV9A 2KKNA 2Z1AA 2ZO9B 2AHDA 2HYPA 3IVDA 4LACC 4JA7A 3C5WC 1HO5A 4O5GA 3DSDA 3H67A 4FBWA 3D03A 2Z06A 2WDFA 4V0WA 4H2BA 3PSNA 3RL3A 2BCDA 2QFRA 5GTUA 1S3LA 2HYOA 3E0JA 4ORAA 3DSCA 4MOVA 2DXNA 4LTYA 3RQZA 5B8IA 1MF8A 4WWLA 3EGGA 2GJUA 5J28A 1USHA 4O43A 3H60A 5JPFA 5JPEA 2DXLA 3IVEA 4H2IA 3THNA 2ZOAA 1JK7A 1S95A 1QFCA 3AV0A 3RL5A 1M63A 4H2GA 2WDEA 2A22A 4MP0A 1G5BA 3H68A 2NPPC 3K7WC 4ZX2A 3V4YA 4FBQA 4DT2A 1WARA 3K7VC 3IB8A 4JA9A 4FCXA 3LL8A 2R17A 5IOHA 3H64A 1T71A 4YKEA 1QHWA 2USHA 1S70A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1II7 A;  5HPE A;  2NYL C;  4G9J A;  1HP1 A;  1IT6 A;  4LU9 A;  1UTE A;  3E7A A;  3H62 B;  4DHL A;  4V0X A;  1S3M A;  2QJC A;  2WDD A;  4TUG A;  1V73 A;  3EGH A;  3QFN A;  4UWQ A;  2IE3 C;  3H61 A;  1OID A;  1XM7 A;  3H69 A;  1W24 A;  4H2F A;  4I5L C;  2Z72 A;  3C9F A;  4FBK A;  1Z2X A;  4O4K A;  2BQ8 X;  3AUZ A;  3P71 C;  4F0Z A;  2DFJ A;  3N5U A;  4ORC A;  1OIE A;  5INB A;  3KBP A;  2NYM C;  2P6B A;  2O8A A;  3TGH A;  2XMO A;  3JYF A;  2ZBM A;  4H1S A;  4ZVZ A;  2IAE C;  4HD0 A;  4V0V A;  4TUI A;  4MOY A;  3QFK A;  4O24 A;  1KBP A;  1Z2W A;  3E7B A;  4Q7F A;  3HVQ A;  1U32 A;  5EQV A;  4DSY A;  5F3W A;  2BDX A;  2HY1 A;  3RL4 A;  4I5N C;  1SU1 A;  3DW8 C;  1NNW A;  3H63 A;  1XZW A;  3ZU0 A;  1FJM A;  4OR9 A;  4IL1 A;  4KKZ A;  4NZV A;  1T70 A;  4XPN A;  3GVE A;  2YVT A;  4KBP A;  3QG5 C;  4J6O A;  4UT2 A;  3THO B;  2Q8U A;  1HPU A;  5DNY A;  2IE4 C;  3QFM A;  2O8G A;  3CK2 A;  3IB7 A;  5C1V A;  4ORB A;  2JOG A;  3QFO A;  2NXF A;  1UF3 A;  5JJT A;  3ICF A;  4IYP C;  4UT3 B;  3T1I A;  4B2O A;  1TCO A;  4M0V A;  1WAO 1;  3PSO A;  3H66 A;  4UT3 A;  1S3N A;  1S8E A;  2QFP A;  4H1Y P;  3ZTV A;  1AUI A;  3FGA C;  2WDC A;  1OI8 A;  2CV9 A;  2KKN A;  2Z1A A;  3IVD A;  2AHD A;  2HYP A;  4LAC C;  4JA7 A;  3C5W C;  1HO5 A;  4O5G A;  3DSD A;  3H67 A;  4FBW A;  2Z06 A;  2WDF A;  4V0W A;  4H2B A;  3PSN A;  3RL3 A;  2BCD A;  2QFR A;  5GTU A;  1S3L A;  2HYO A;  4ORA A;  3DSC A;  4MOV A;  3RQZ A;  4LTY A;  5B8I A;  1MF8 A;  4WWL A;  3EGG A;  2GJU A;  5J28 A;  1USH A;  4O43 A;  3H60 A;  5JPF A;  5JPE A;  3IVE A;  4H2I A;  3THN A;  1JK7 A;  1S95 A;  1QFC A;  3AV0 A;  3RL5 A;  1M63 A;  4H2G A;  2WDE A;  2A22 A;  4MP0 A;  1G5B A;  3H68 A;  2NPP C;  3K7W C;  4ZX2 A;  3V4Y A;  4FBQ A;  4DT2 A;  1WAR A;  3K7V C;  3IB8 A;  4JA9 A;  4FCX A;  3LL8 A;  2R17 A;  5IOH A;  3H64 A;  1T71 A;  4YKE A;  1QHW A;  2USH A;  1S70 A; 
#chains in the Genus database with same CATH topology
 1II7 A;  5HPE A;  2NYL C;  4G9J A;  1HP1 A;  1IT6 A;  4LU9 A;  1UTE A;  3E7A A;  3H62 B;  4DHL A;  4V0X A;  1S3M A;  2QJC A;  2WDD A;  4TUG A;  1V73 A;  3EGH A;  3QFN A;  3FLO A;  4UWQ A;  2IE3 C;  3H61 A;  1OID A;  1XM7 A;  3H69 A;  1W24 A;  4H2F A;  4I5L C;  2Z72 A;  3C9F A;  4FBK A;  1Z2X A;  4O4K A;  2BQ8 X;  3AUZ A;  3P71 C;  4F0Z A;  2DFJ A;  3N5U A;  4ORC A;  1OIE A;  5INB A;  3KBP A;  2NYM C;  2P6B A;  2O8A A;  3TGH A;  2XMO A;  3JYF A;  2ZBM A;  4H1S A;  4ZVZ A;  2IAE C;  4HD0 A;  4V0V A;  4TUI A;  4MOY A;  3QFK A;  4O24 A;  1KBP A;  1Z2W A;  3E7B A;  4Q7F A;  3HVQ A;  1U32 A;  5EQV A;  4DSY A;  5F3W A;  2BDX A;  2HY1 A;  3RL4 A;  4I5N C;  1SU1 A;  3DW8 C;  1NNW A;  3H63 A;  1XZW A;  3ZU0 A;  1FJM A;  4OR9 A;  2YEQ A;  4IL1 A;  4NZV A;  4KKZ A;  1T70 A;  4XPN A;  3GVE A;  2YVT A;  4KBP A;  3QG5 C;  4J6O A;  4UT2 A;  3THO B;  2Q8U A;  1HPU A;  5DNY A;  2IE4 C;  3QFM A;  2O8G A;  3CK2 A;  3IB7 A;  5C1V A;  4ORB A;  2JOG A;  3QFO A;  2NXF A;  1UF3 A;  5JJT A;  3ICF A;  4IYP C;  4UT3 B;  3T1I A;  4B2O A;  1TCO A;  4M0V A;  1WAO 1;  3PSO A;  3H66 A;  4UT3 A;  1S3N A;  1S8E A;  2QFP A;  4H1Y P;  3ZTV A;  1AUI A;  3FGA C;  2WDC A;  1OI8 A;  2CV9 A;  2KKN A;  2Z1A A;  2ZO9 B;  2AHD A;  2HYP A;  3IVD A;  4LAC C;  4JA7 A;  3C5W C;  1HO5 A;  4O5G A;  3DSD A;  3H67 A;  4FBW A;  3D03 A;  2Z06 A;  2WDF A;  4V0W A;  4H2B A;  3PSN A;  3RL3 A;  2BCD A;  2QFR A;  5GTU A;  1S3L A;  2HYO A;  3E0J A;  4ORA A;  3DSC A;  4MOV A;  2DXN A;  4LTY A;  3RQZ A;  5B8I A;  1MF8 A;  4WWL A;  3EGG A;  2GJU A;  5J28 A;  1USH A;  4O43 A;  3H60 A;  5JPF A;  5JPE A;  2DXL A;  3IVE A;  4H2I A;  3THN A;  2ZOA A;  1JK7 A;  1S95 A;  1QFC A;  3AV0 A;  3RL5 A;  1M63 A;  4H2G A;  2WDE A;  2A22 A;  4MP0 A;  1G5B A;  3H68 A;  2NPP C;  3K7W C;  4ZX2 A;  3V4Y A;  4FBQ A;  4DT2 A;  1WAR A;  3K7V C;  3IB8 A;  4JA9 A;  4FCX A;  3LL8 A;  2R17 A;  5IOH A;  3H64 A;  1T71 A;  4YKE A;  1QHW A;  2USH A;  1S70 A; 
#chains in the Genus database with same CATH homology
 1II7 A;  5HPE A;  2NYL C;  4G9J A;  1HP1 A;  1IT6 A;  4LU9 A;  1UTE A;  3E7A A;  3H62 B;  4DHL A;  4V0X A;  1S3M A;  2QJC A;  2WDD A;  4TUG A;  1V73 A;  3EGH A;  3QFN A;  3FLO A;  4UWQ A;  2IE3 C;  3H61 A;  1OID A;  1XM7 A;  3H69 A;  1W24 A;  4H2F A;  4I5L C;  2Z72 A;  3C9F A;  4FBK A;  1Z2X A;  4O4K A;  2BQ8 X;  3AUZ A;  3P71 C;  4F0Z A;  2DFJ A;  3N5U A;  4ORC A;  1OIE A;  5INB A;  3KBP A;  2NYM C;  2P6B A;  2O8A A;  3TGH A;  2XMO A;  3JYF A;  2ZBM A;  4H1S A;  4ZVZ A;  2IAE C;  4HD0 A;  4V0V A;  4TUI A;  4MOY A;  3QFK A;  4O24 A;  1KBP A;  1Z2W A;  3E7B A;  4Q7F A;  3HVQ A;  1U32 A;  5EQV A;  4DSY A;  5F3W A;  2BDX A;  2HY1 A;  3RL4 A;  4I5N C;  1SU1 A;  3DW8 C;  1NNW A;  3H63 A;  1XZW A;  3ZU0 A;  1FJM A;  4OR9 A;  2YEQ A;  4IL1 A;  4NZV A;  4KKZ A;  1T70 A;  4XPN A;  3GVE A;  2YVT A;  4KBP A;  3QG5 C;  4J6O A;  4UT2 A;  3THO B;  2Q8U A;  1HPU A;  5DNY A;  2IE4 C;  3QFM A;  2O8G A;  3CK2 A;  3IB7 A;  5C1V A;  4ORB A;  2JOG A;  3QFO A;  2NXF A;  1UF3 A;  5JJT A;  3ICF A;  4IYP C;  4UT3 B;  3T1I A;  4B2O A;  1TCO A;  4M0V A;  1WAO 1;  3PSO A;  3H66 A;  4UT3 A;  1S3N A;  1S8E A;  2QFP A;  4H1Y P;  3ZTV A;  1AUI A;  3FGA C;  2WDC A;  1OI8 A;  2CV9 A;  2KKN A;  2Z1A A;  2ZO9 B;  2AHD A;  2HYP A;  3IVD A;  4LAC C;  4JA7 A;  3C5W C;  1HO5 A;  4O5G A;  3DSD A;  3H67 A;  4FBW A;  3D03 A;  2Z06 A;  2WDF A;  4V0W A;  4H2B A;  3PSN A;  3RL3 A;  2BCD A;  2QFR A;  5GTU A;  1S3L A;  2HYO A;  3E0J A;  4ORA A;  3DSC A;  4MOV A;  2DXN A;  4LTY A;  3RQZ A;  5B8I A;  1MF8 A;  4WWL A;  3EGG A;  2GJU A;  5J28 A;  1USH A;  4O43 A;  3H60 A;  5JPF A;  5JPE A;  2DXL A;  3IVE A;  4H2I A;  3THN A;  2ZOA A;  1JK7 A;  1S95 A;  1QFC A;  3AV0 A;  3RL5 A;  1M63 A;  4H2G A;  2WDE A;  2A22 A;  4MP0 A;  1G5B A;  3H68 A;  2NPP C;  3K7W C;  4ZX2 A;  3V4Y A;  4FBQ A;  4DT2 A;  1WAR A;  3K7V C;  3IB8 A;  4JA9 A;  4FCX A;  3LL8 A;  2R17 A;  5IOH A;  3H64 A;  1T71 A;  4YKE A;  1QHW A;  2USH A;  1S70 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...