4I5NC

Structural mechanism of trimeric pp2a holoenzyme involving pr70: insight for cdc6 dephosphorylation
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
293
structure length
293
Chain Sequence
DEKVFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Ca(2+)-dependent PP2A heterotrimer and insights into Cdc6 dephosphorylation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/toxin
molecule keywords Serine/threonine-protein phosphatase 2A 65 kDa regulatory su
total genus 104
structure length 293
sequence length 293
chains with identical sequence F
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2012-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 4i5nC00
3H67A 3DSDA 4O5GA 4H1YP 4ZX2A 4NZVA 3K7VC 4M0VA 3ZU0A 4IYPC 3DW8C 4UWQA 3THOB 4MOVA 3CK2A 3RQZA 1G5BA 3PSOA 4UT3A 4KBPA 4OR9A 1IT6A 3T1IA 1HPUA 2NYLC 1S70A 5IOHA 4TUIA 1W24A 2USHA 2NPPC 1NNWA 3AUZA 2BDXA 2IE4C 1WARA 3H63A 4MP0A 4V0WA 2DFJA 2WDCA 3EGGA 3ICFA 4ZVZA 4G9JA 1OI8A 2QFRA 1M63A 1S3NA 3C5WC 3H60A 3TGHA 4FBWA 1S8EA 1S3MA 4B2OA 3H68A 3N5UA 4FCXA 4O4KA 4HD0A 3RL5A 2HY1A 4H2FA 2WDFA 5B8IA 3FGAC 4JA9A 5J28A 4H2GA 3IVEA 4FBQA 2QFPA 5DNYA 4I5LC 5EQVA 5INBA 4WWLA 3QG5C 3K7WC 1U32A 2NYMC 3ZTVA 3JYFA 4ORBA 4V0VA 3H61A 2JOGA 3IVDA 2O8AA 2HYOA 2AHDA 4DHLA 2Z1AA 3H66A 1T70A 3H64A 3E7BA 4H2IA 4LACC 3IB7A 4H1SA 4DT2A 1OIEA 4LU9A 3RL4A 1XZWA 3THNA 3QFNA 3RL3A 1OIDA 3LL8A 2NXFA 1S95A 4O24A 2YVTA 1MF8A 4J6OA 3QFOA 3KBPA 1AUIA 1USHA 4H2BA 3QFMA 4ORAA 4V0XA 1Z2XA 2Q8UA 4O43A 1Z2WA 4JA7A 4MOYA 5F3WA 1HO5A 2P6BA 1TCOA 2HYPA 3P71C 1T71A 1V73A 1WAO1 2IAEC 3V4YA 5JJTA 2WDEA 2XMOA 3C9FA 2CV9A 2A22A 2IE3C 3H69A 1UTEA 2Z72A 4ORCA 4XPNA 3DSCA 4FBKA 3QFKA 2WDDA 4IL1A 5C1VA 2Z06A 3EGHA 2KKNA 2BCDA 2QJCA 1QHWA 2BQ8X 1FJMA 3GVEA 2GJUA 4Q7FA 3PSNA 4F0ZA 4LTYA 3AV0A 4UT2A 2R17A 1SU1A 4UT3B 1UF3A 1JK7A 4KKZA 1XM7A 1S3LA 1II7A 3IB8A 4DSYA 5GTUA 1QFCA 3E7AA 4YKEA 5JPFA 3HVQA 4I5NC 5JPEA 2ZBMA 4TUGA 1KBPA 2O8GA 5HPEA 1HP1A 3H62B
chains in the Genus database with same CATH superfamily
3H67A 3DSDA 4O5GA 4H1YP 4ZX2A 4NZVA 3K7VC 4M0VA 3ZU0A 4IYPC 3DW8C 4UWQA 3THOB 4MOVA 3CK2A 3RQZA 1G5BA 3PSOA 4UT3A 4KBPA 4OR9A 1IT6A 3FLOA 3T1IA 1HPUA 2NYLC 1S70A 5IOHA 4TUIA 1W24A 2USHA 2NPPC 1NNWA 3AUZA 2BDXA 2IE4C 1WARA 3H63A 4MP0A 4V0WA 2DFJA 2WDCA 3EGGA 3ICFA 4ZVZA 4G9JA 1OI8A 2QFRA 1M63A 1S3NA 3C5WC 3H60A 3TGHA 4FBWA 1S8EA 1S3MA 2ZOAA 4B2OA 3H68A 3N5UA 4FCXA 4O4KA 4HD0A 3RL5A 2HY1A 4H2FA 2ZO9B 2DXNA 2WDFA 5B8IA 3FGAC 4JA9A 5J28A 4H2GA 3IVEA 4FBQA 2QFPA 3D03A 5DNYA 4I5LC 5EQVA 5INBA 4WWLA 3QG5C 3K7WC 1U32A 2NYMC 3ZTVA 3JYFA 4ORBA 4V0VA 3H61A 2JOGA 3IVDA 2O8AA 2HYOA 2AHDA 4DHLA 2Z1AA 3H66A 1T70A 3H64A 3E7BA 4H2IA 4LACC 3IB7A 4H1SA 4DT2A 1OIEA 4LU9A 3RL4A 1XZWA 3THNA 3QFNA 3RL3A 1OIDA 3LL8A 2NXFA 1S95A 4O24A 2YVTA 1MF8A 4J6OA 3QFOA 3KBPA 1AUIA 1USHA 4H2BA 3E0JA 3QFMA 4ORAA 4V0XA 1Z2XA 2Q8UA 4O43A 1Z2WA 4JA7A 4MOYA 5F3WA 1HO5A 2P6BA 1TCOA 2HYPA 3P71C 1T71A 1V73A 1WAO1 2IAEC 3V4YA 5JJTA 2WDEA 2XMOA 3C9FA 2CV9A 2A22A 2IE3C 3H69A 1UTEA 2Z72A 4ORCA 4XPNA 3DSCA 4FBKA 3QFKA 2WDDA 4IL1A 5C1VA 2Z06A 3EGHA 2KKNA 2BCDA 2DXLA 1QHWA 2QJCA 2BQ8X 1FJMA 3GVEA 2GJUA 4Q7FA 3PSNA 4F0ZA 4LTYA 3AV0A 4UT2A 2R17A 1SU1A 4UT3B 1UF3A 1JK7A 4KKZA 1XM7A 1S3LA 1II7A 3IB8A 4DSYA 5GTUA 1QFCA 3E7AA 4YKEA 5JPFA 3HVQA 4I5NC 5JPEA 2ZBMA 4TUGA 1KBPA 2O8GA 2YEQA 5HPEA 1HP1A 3H62B
chains in the Genus database with same CATH topology
3H67A 3DSDA 4O5GA 4H1YP 4ZX2A 4NZVA 3K7VC 4M0VA 3ZU0A 4IYPC 3DW8C 4UWQA 3THOB 4MOVA 3CK2A 3RQZA 1G5BA 3PSOA 4UT3A 4KBPA 4OR9A 1IT6A 3FLOA 3T1IA 1HPUA 2NYLC 1S70A 5IOHA 4TUIA 1W24A 2USHA 2NPPC 1NNWA 3AUZA 2BDXA 2IE4C 1WARA 3H63A 4MP0A 4V0WA 2DFJA 2WDCA 3EGGA 3ICFA 4ZVZA 4G9JA 1OI8A 2QFRA 1M63A 1S3NA 3C5WC 3H60A 3TGHA 4FBWA 1S8EA 1S3MA 2ZOAA 4B2OA 3H68A 3N5UA 4FCXA 4O4KA 4HD0A 3RL5A 2HY1A 4H2FA 2ZO9B 2DXNA 2WDFA 5B8IA 3FGAC 4JA9A 5J28A 4H2GA 3IVEA 4FBQA 2QFPA 3D03A 5DNYA 4I5LC 5EQVA 5INBA 4WWLA 3QG5C 3K7WC 1U32A 2NYMC 3ZTVA 3JYFA 4ORBA 4V0VA 3H61A 2JOGA 3IVDA 2O8AA 2HYOA 2AHDA 4DHLA 2Z1AA 3H66A 1T70A 3H64A 3E7BA 4H2IA 4LACC 3IB7A 4H1SA 4DT2A 1OIEA 4LU9A 3RL4A 1XZWA 3THNA 3QFNA 3RL3A 1OIDA 3LL8A 2NXFA 1S95A 4O24A 2YVTA 1MF8A 4J6OA 3QFOA 3KBPA 1AUIA 1USHA 4H2BA 3E0JA 3QFMA 4ORAA 4V0XA 1Z2XA 2Q8UA 4O43A 1Z2WA 4JA7A 4MOYA 5F3WA 1HO5A 2P6BA 1TCOA 2HYPA 3P71C 1T71A 1V73A 1WAO1 2IAEC 3V4YA 5JJTA 2WDEA 2XMOA 3C9FA 2CV9A 2A22A 2IE3C 3H69A 1UTEA 2Z72A 4ORCA 4XPNA 3DSCA 4FBKA 3QFKA 2WDDA 4IL1A 5C1VA 2Z06A 3EGHA 2KKNA 2BCDA 2DXLA 1QHWA 2QJCA 2BQ8X 1FJMA 3GVEA 2GJUA 4Q7FA 3PSNA 4F0ZA 4LTYA 3AV0A 4UT2A 2R17A 1SU1A 4UT3B 1UF3A 1JK7A 4KKZA 1XM7A 1S3LA 1II7A 3IB8A 4DSYA 5GTUA 1QFCA 3E7AA 4YKEA 5JPFA 3HVQA 4I5NC 5JPEA 2ZBMA 4TUGA 1KBPA 2O8GA 2YEQA 5HPEA 1HP1A 3H62B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H67 A;  3DSD A;  4O5G A;  4H1Y P;  4ZX2 A;  4NZV A;  3K7V C;  4M0V A;  3ZU0 A;  4IYP C;  3DW8 C;  4UWQ A;  3THO B;  4MOV A;  3CK2 A;  3RQZ A;  1G5B A;  3PSO A;  4UT3 A;  4KBP A;  4OR9 A;  1IT6 A;  3T1I A;  1HPU A;  2NYL C;  1S70 A;  5IOH A;  4TUI A;  1W24 A;  2USH A;  2NPP C;  1NNW A;  3AUZ A;  2BDX A;  2IE4 C;  1WAR A;  3H63 A;  4MP0 A;  4V0W A;  2DFJ A;  2WDC A;  3EGG A;  3ICF A;  4ZVZ A;  4G9J A;  1OI8 A;  2QFR A;  1M63 A;  1S3N A;  3C5W C;  3H60 A;  3TGH A;  4FBW A;  1S8E A;  1S3M A;  4B2O A;  3H68 A;  3N5U A;  4FCX A;  4O4K A;  4HD0 A;  3RL5 A;  2HY1 A;  4H2F A;  2WDF A;  5B8I A;  3FGA C;  4JA9 A;  5J28 A;  4H2G A;  3IVE A;  4FBQ A;  2QFP A;  5DNY A;  4I5L C;  5EQV A;  5INB A;  4WWL A;  3QG5 C;  3K7W C;  1U32 A;  2NYM C;  3ZTV A;  3JYF A;  4ORB A;  4V0V A;  3H61 A;  2JOG A;  3IVD A;  2O8A A;  2HYO A;  2AHD A;  4DHL A;  2Z1A A;  3H66 A;  1T70 A;  3H64 A;  3E7B A;  4H2I A;  4LAC C;  3IB7 A;  4H1S A;  4DT2 A;  1OIE A;  4LU9 A;  3RL4 A;  1XZW A;  3THN A;  3QFN A;  3RL3 A;  1OID A;  3LL8 A;  2NXF A;  1S95 A;  4O24 A;  2YVT A;  1MF8 A;  4J6O A;  3QFO A;  3KBP A;  1AUI A;  1USH A;  4H2B A;  3QFM A;  4ORA A;  4V0X A;  1Z2X A;  2Q8U A;  4O43 A;  1Z2W A;  4JA7 A;  4MOY A;  5F3W A;  1HO5 A;  2P6B A;  1TCO A;  2HYP A;  3P71 C;  1T71 A;  1V73 A;  1WAO 1;  2IAE C;  3V4Y A;  5JJT A;  2WDE A;  2XMO A;  3C9F A;  2CV9 A;  2A22 A;  2IE3 C;  3H69 A;  1UTE A;  2Z72 A;  4ORC A;  4XPN A;  3DSC A;  4FBK A;  3QFK A;  2WDD A;  4IL1 A;  5C1V A;  2Z06 A;  3EGH A;  2KKN A;  2BCD A;  2QJC A;  1QHW A;  2BQ8 X;  1FJM A;  3GVE A;  2GJU A;  4Q7F A;  3PSN A;  4F0Z A;  4LTY A;  3AV0 A;  4UT2 A;  2R17 A;  1SU1 A;  4UT3 B;  1UF3 A;  1JK7 A;  4KKZ A;  1XM7 A;  1S3L A;  1II7 A;  3IB8 A;  4DSY A;  5GTU A;  1QFC A;  3E7A A;  4YKE A;  5JPF A;  3HVQ A;  4I5N C;  5JPE A;  2ZBM A;  4TUG A;  1KBP A;  2O8G A;  5HPE A;  1HP1 A;  3H62 B; 
#chains in the Genus database with same CATH topology
 3H67 A;  3DSD A;  4O5G A;  4H1Y P;  4ZX2 A;  4NZV A;  3K7V C;  4M0V A;  3ZU0 A;  4IYP C;  3DW8 C;  4UWQ A;  3THO B;  4MOV A;  3CK2 A;  3RQZ A;  1G5B A;  3PSO A;  4UT3 A;  4KBP A;  4OR9 A;  1IT6 A;  3FLO A;  3T1I A;  1HPU A;  2NYL C;  1S70 A;  5IOH A;  4TUI A;  1W24 A;  2USH A;  2NPP C;  1NNW A;  3AUZ A;  2BDX A;  2IE4 C;  1WAR A;  3H63 A;  4MP0 A;  4V0W A;  2DFJ A;  2WDC A;  3EGG A;  3ICF A;  4ZVZ A;  4G9J A;  1OI8 A;  2QFR A;  1M63 A;  1S3N A;  3C5W C;  3H60 A;  3TGH A;  4FBW A;  1S8E A;  1S3M A;  2ZOA A;  4B2O A;  3H68 A;  3N5U A;  4FCX A;  4O4K A;  4HD0 A;  3RL5 A;  2HY1 A;  4H2F A;  2ZO9 B;  2DXN A;  2WDF A;  5B8I A;  3FGA C;  4JA9 A;  5J28 A;  4H2G A;  3IVE A;  4FBQ A;  2QFP A;  3D03 A;  5DNY A;  4I5L C;  5EQV A;  5INB A;  4WWL A;  3QG5 C;  3K7W C;  1U32 A;  2NYM C;  3ZTV A;  3JYF A;  4ORB A;  4V0V A;  3H61 A;  2JOG A;  3IVD A;  2O8A A;  2HYO A;  2AHD A;  4DHL A;  2Z1A A;  3H66 A;  1T70 A;  3H64 A;  3E7B A;  4H2I A;  4LAC C;  3IB7 A;  4H1S A;  4DT2 A;  1OIE A;  4LU9 A;  3RL4 A;  1XZW A;  3THN A;  3QFN A;  3RL3 A;  1OID A;  3LL8 A;  2NXF A;  1S95 A;  4O24 A;  2YVT A;  1MF8 A;  4J6O A;  3QFO A;  3KBP A;  1AUI A;  1USH A;  4H2B A;  3E0J A;  3QFM A;  4ORA A;  4V0X A;  1Z2X A;  2Q8U A;  4O43 A;  1Z2W A;  4JA7 A;  4MOY A;  5F3W A;  1HO5 A;  2P6B A;  1TCO A;  2HYP A;  3P71 C;  1T71 A;  1V73 A;  1WAO 1;  2IAE C;  3V4Y A;  5JJT A;  2WDE A;  2XMO A;  3C9F A;  2CV9 A;  2A22 A;  2IE3 C;  3H69 A;  1UTE A;  2Z72 A;  4ORC A;  4XPN A;  3DSC A;  4FBK A;  3QFK A;  2WDD A;  4IL1 A;  5C1V A;  2Z06 A;  3EGH A;  2KKN A;  2BCD A;  2DXL A;  1QHW A;  2QJC A;  2BQ8 X;  1FJM A;  3GVE A;  2GJU A;  4Q7F A;  3PSN A;  4F0Z A;  4LTY A;  3AV0 A;  4UT2 A;  2R17 A;  1SU1 A;  4UT3 B;  1UF3 A;  1JK7 A;  4KKZ A;  1XM7 A;  1S3L A;  1II7 A;  3IB8 A;  4DSY A;  5GTU A;  1QFC A;  3E7A A;  4YKE A;  5JPF A;  3HVQ A;  4I5N C;  5JPE A;  2ZBM A;  4TUG A;  1KBP A;  2O8G A;  2YEQ A;  5HPE A;  1HP1 A;  3H62 B; 
#chains in the Genus database with same CATH homology
 3H67 A;  3DSD A;  4O5G A;  4H1Y P;  4ZX2 A;  4NZV A;  3K7V C;  4M0V A;  3ZU0 A;  4IYP C;  3DW8 C;  4UWQ A;  3THO B;  4MOV A;  3CK2 A;  3RQZ A;  1G5B A;  3PSO A;  4UT3 A;  4KBP A;  4OR9 A;  1IT6 A;  3FLO A;  3T1I A;  1HPU A;  2NYL C;  1S70 A;  5IOH A;  4TUI A;  1W24 A;  2USH A;  2NPP C;  1NNW A;  3AUZ A;  2BDX A;  2IE4 C;  1WAR A;  3H63 A;  4MP0 A;  4V0W A;  2DFJ A;  2WDC A;  3EGG A;  3ICF A;  4ZVZ A;  4G9J A;  1OI8 A;  2QFR A;  1M63 A;  1S3N A;  3C5W C;  3H60 A;  3TGH A;  4FBW A;  1S8E A;  1S3M A;  2ZOA A;  4B2O A;  3H68 A;  3N5U A;  4FCX A;  4O4K A;  4HD0 A;  3RL5 A;  2HY1 A;  4H2F A;  2ZO9 B;  2DXN A;  2WDF A;  5B8I A;  3FGA C;  4JA9 A;  5J28 A;  4H2G A;  3IVE A;  4FBQ A;  2QFP A;  3D03 A;  5DNY A;  4I5L C;  5EQV A;  5INB A;  4WWL A;  3QG5 C;  3K7W C;  1U32 A;  2NYM C;  3ZTV A;  3JYF A;  4ORB A;  4V0V A;  3H61 A;  2JOG A;  3IVD A;  2O8A A;  2HYO A;  2AHD A;  4DHL A;  2Z1A A;  3H66 A;  1T70 A;  3H64 A;  3E7B A;  4H2I A;  4LAC C;  3IB7 A;  4H1S A;  4DT2 A;  1OIE A;  4LU9 A;  3RL4 A;  1XZW A;  3THN A;  3QFN A;  3RL3 A;  1OID A;  3LL8 A;  2NXF A;  1S95 A;  4O24 A;  2YVT A;  1MF8 A;  4J6O A;  3QFO A;  3KBP A;  1AUI A;  1USH A;  4H2B A;  3E0J A;  3QFM A;  4ORA A;  4V0X A;  1Z2X A;  2Q8U A;  4O43 A;  1Z2W A;  4JA7 A;  4MOY A;  5F3W A;  1HO5 A;  2P6B A;  1TCO A;  2HYP A;  3P71 C;  1T71 A;  1V73 A;  1WAO 1;  2IAE C;  3V4Y A;  5JJT A;  2WDE A;  2XMO A;  3C9F A;  2CV9 A;  2A22 A;  2IE3 C;  3H69 A;  1UTE A;  2Z72 A;  4ORC A;  4XPN A;  3DSC A;  4FBK A;  3QFK A;  2WDD A;  4IL1 A;  5C1V A;  2Z06 A;  3EGH A;  2KKN A;  2BCD A;  2DXL A;  1QHW A;  2QJC A;  2BQ8 X;  1FJM A;  3GVE A;  2GJU A;  4Q7F A;  3PSN A;  4F0Z A;  4LTY A;  3AV0 A;  4UT2 A;  2R17 A;  1SU1 A;  4UT3 B;  1UF3 A;  1JK7 A;  4KKZ A;  1XM7 A;  1S3L A;  1II7 A;  3IB8 A;  4DSY A;  5GTU A;  1QFC A;  3E7A A;  4YKE A;  5JPF A;  3HVQ A;  4I5N C;  5JPE A;  2ZBM A;  4TUG A;  1KBP A;  2O8G A;  2YEQ A;  5HPE A;  1HP1 A;  3H62 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...