4I5NC

Structural mechanism of trimeric pp2a holoenzyme involving pr70: insight for cdc6 dephosphorylation
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
293
structure length
293
Chain Sequence
DEKVFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Ca(2+)-dependent PP2A heterotrimer and insights into Cdc6 dephosphorylation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/toxin
molecule keywords Serine/threonine-protein phosphatase 2A 65 kDa regulatory su
total genus 104
structure length 293
sequence length 293
chains with identical sequence F
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2012-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 4i5nC00
1XM7A 4V0XA 3E7AA 3PSNA 3IB8A 2IE4C 3H69A 4H2BA 3CK2A 2USHA 2HY1A 1V73A 3IB7A 3IVEA 3H64A 4O24A 4ORAA 3JYFA 3E7BA 4IYPC 4NZVA 1II7A 3T1IA 1T71A 2AHDA 3RQZA 4XPNA 2JOGA 4F0ZA 2R17A 3QFKA 2HYOA 1Z2WA 3C9FA 4MP0A 4FBWA 4M0VA 5J28A 4FBQA 5INBA 4O4KA 3DSDA 1AUIA 4DHLA 4J6OA 3LL8A 1S95A 1HO5A 4B2OA 3QFNA 3THNA 3ZU0A 1OI8A 1IT6A 3HVQA 1QHWA 1TCOA 4MOVA 2BDXA 2HYPA 4LU9A 4UT3B 5JJTA 1USHA 3P71C 3AUZA 1T70A 4HD0A 3RL5A 3DW8C 3EGGA 3RL4A 2IAEC 1HP1A 3QG5C 1W24A 4H2FA 4LACC 1G5BA 5HPEA 1UTEA 5IOHA 3H63A 2BQ8X 2Z1AA 3K7VC 4ZX2A 4OR9A 1WAO1 4TUGA 2QFPA 4ORCA 4MOYA 3DSCA 4FBKA 1XZWA 3H67A 3H68A 4G9JA 1Z2XA 1KBPA 3K7WC 2DFJA 1MF8A 1S3MA 1HPUA 4UT2A 2KKNA 5DNYA 1WARA 2Z72A 4DT2A 3EGHA 3N5UA 1NNWA 3ICFA 2NYLC 2QFRA 3H66A 1UF3A 4V0WA 4H1YP 3FGAC 3PSOA 3QFMA 4FCXA 1U32A 2Q8UA 3C5WC 4I5NC 3V4YA 4UT3A 4H2IA 1S70A 2NPPC 3H60A 1S8EA 3H62B 1JK7A 4V0VA 2WDDA 5GTUA 2O8AA 1S3LA 3TGHA 2WDEA 3GVEA 5C1VA 2P6BA 4YKEA 1OIEA 2O8GA 1S3NA 3QFOA 4JA9A 5EQVA 2IE3C 3THOB 1FJMA 2CV9A 5JPEA 2GJUA 4LTYA 4DSYA 4H2GA 2QJCA 2BCDA 4WWLA 4ZVZA 4O5GA 1SU1A 2Z06A 4Q7FA 5B8IA 2NYMC 3KBPA 2ZBMA 2XMOA 4O43A 3IVDA 4ORBA 2A22A 3AV0A 3ZTVA 4I5LC 4UWQA 3RL3A 1OIDA 5JPFA 1M63A 2YVTA 2WDCA 4IL1A 1QFCA 4TUIA 4KBPA 4JA7A 2WDFA 3H61A 2NXFA 4H1SA 4KKZA 5F3WA
chains in the Genus database with same CATH superfamily
1XM7A 4V0XA 3E7AA 3PSNA 3IB8A 2IE4C 3H69A 4H2BA 3CK2A 2USHA 2HY1A 1V73A 3IB7A 3IVEA 3H64A 4O24A 4ORAA 3JYFA 3E7BA 4IYPC 4NZVA 1II7A 3T1IA 1T71A 2AHDA 3RQZA 4XPNA 2JOGA 4F0ZA 2R17A 3QFKA 2HYOA 1Z2WA 3C9FA 4MP0A 4FBWA 4M0VA 5J28A 4FBQA 5INBA 4O4KA 3DSDA 1AUIA 4DHLA 4J6OA 3LL8A 1S95A 1HO5A 4B2OA 3QFNA 3THNA 3ZU0A 1OI8A 1IT6A 2YEQA 3HVQA 1QHWA 1TCOA 4MOVA 2BDXA 2HYPA 4LU9A 4UT3B 5JJTA 1USHA 3P71C 3AUZA 1T70A 4HD0A 3RL5A 3DW8C 3EGGA 3RL4A 2IAEC 1HP1A 2DXNA 3QG5C 1W24A 4H2FA 4LACC 3E0JA 1G5BA 5HPEA 1UTEA 5IOHA 3H63A 2BQ8X 2Z1AA 3K7VC 4ZX2A 4OR9A 1WAO1 4TUGA 2QFPA 4ORCA 4MOYA 3DSCA 4FBKA 1XZWA 3H67A 3H68A 3D03A 4G9JA 2ZO9B 1Z2XA 1KBPA 3FLOA 2DFJA 3K7WC 1MF8A 1S3MA 1HPUA 4UT2A 2KKNA 5DNYA 1WARA 2Z72A 4DT2A 3EGHA 3N5UA 1NNWA 3ICFA 2NYLC 2QFRA 3H66A 1UF3A 4V0WA 4H1YP 3FGAC 3PSOA 3QFMA 4FCXA 1U32A 2Q8UA 3C5WC 4I5NC 3V4YA 4UT3A 4H2IA 1S70A 2NPPC 3H60A 1S8EA 2ZOAA 3H62B 1JK7A 4V0VA 2WDDA 5GTUA 2O8AA 1S3LA 3TGHA 2WDEA 3GVEA 5C1VA 2P6BA 4YKEA 1OIEA 2O8GA 1S3NA 3QFOA 4JA9A 5EQVA 2IE3C 3THOB 1FJMA 2CV9A 5JPEA 2GJUA 4LTYA 4DSYA 4H2GA 2QJCA 2BCDA 4WWLA 4ZVZA 4O5GA 1SU1A 2Z06A 4Q7FA 2DXLA 5B8IA 2NYMC 3KBPA 2ZBMA 2XMOA 4O43A 3IVDA 4ORBA 2A22A 3AV0A 3ZTVA 4I5LC 4UWQA 3RL3A 1OIDA 5JPFA 1M63A 2YVTA 2WDCA 4IL1A 1QFCA 4TUIA 4KBPA 4JA7A 2WDFA 3H61A 2NXFA 4H1SA 4KKZA 5F3WA
chains in the Genus database with same CATH topology
1XM7A 4V0XA 3E7AA 3PSNA 3IB8A 2IE4C 3H69A 4H2BA 3CK2A 2USHA 2HY1A 1V73A 3IB7A 3IVEA 3H64A 4O24A 4ORAA 3JYFA 3E7BA 4IYPC 4NZVA 1II7A 3T1IA 1T71A 2AHDA 3RQZA 4XPNA 2JOGA 4F0ZA 2R17A 3QFKA 2HYOA 1Z2WA 3C9FA 4MP0A 4FBWA 4M0VA 5J28A 4FBQA 5INBA 4O4KA 3DSDA 1AUIA 4DHLA 4J6OA 3LL8A 1S95A 1HO5A 4B2OA 3QFNA 3THNA 3ZU0A 1OI8A 1IT6A 2YEQA 3HVQA 1QHWA 1TCOA 4MOVA 2BDXA 2HYPA 4LU9A 4UT3B 5JJTA 1USHA 3P71C 3AUZA 1T70A 4HD0A 3RL5A 3DW8C 3EGGA 3RL4A 2IAEC 1HP1A 2DXNA 3QG5C 1W24A 4H2FA 4LACC 3E0JA 1G5BA 5HPEA 1UTEA 5IOHA 3H63A 2BQ8X 2Z1AA 3K7VC 4ZX2A 4OR9A 1WAO1 4TUGA 2QFPA 4ORCA 4MOYA 3DSCA 4FBKA 1XZWA 3H67A 3H68A 3D03A 4G9JA 2ZO9B 1Z2XA 1KBPA 3FLOA 2DFJA 3K7WC 1MF8A 1S3MA 1HPUA 4UT2A 2KKNA 5DNYA 1WARA 2Z72A 4DT2A 3EGHA 3N5UA 1NNWA 3ICFA 2NYLC 2QFRA 3H66A 1UF3A 4V0WA 4H1YP 3FGAC 3PSOA 3QFMA 4FCXA 1U32A 2Q8UA 3C5WC 4I5NC 3V4YA 4UT3A 4H2IA 1S70A 2NPPC 3H60A 1S8EA 2ZOAA 3H62B 1JK7A 4V0VA 2WDDA 5GTUA 2O8AA 1S3LA 3TGHA 2WDEA 3GVEA 5C1VA 2P6BA 4YKEA 1OIEA 2O8GA 1S3NA 3QFOA 4JA9A 5EQVA 2IE3C 3THOB 1FJMA 2CV9A 5JPEA 2GJUA 4LTYA 4DSYA 4H2GA 2QJCA 2BCDA 4WWLA 4ZVZA 4O5GA 1SU1A 2Z06A 4Q7FA 2DXLA 5B8IA 2NYMC 3KBPA 2ZBMA 2XMOA 4O43A 3IVDA 4ORBA 2A22A 3AV0A 3ZTVA 4I5LC 4UWQA 3RL3A 1OIDA 5JPFA 1M63A 2YVTA 2WDCA 4IL1A 1QFCA 4TUIA 4KBPA 4JA7A 2WDFA 3H61A 2NXFA 4H1SA 4KKZA 5F3WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XM7 A;  4V0X A;  3E7A A;  3PSN A;  3IB8 A;  2IE4 C;  3H69 A;  4H2B A;  3CK2 A;  2USH A;  2HY1 A;  1V73 A;  3IB7 A;  3IVE A;  3H64 A;  4O24 A;  4ORA A;  3JYF A;  3E7B A;  4IYP C;  4NZV A;  1II7 A;  3T1I A;  1T71 A;  2AHD A;  3RQZ A;  4XPN A;  2JOG A;  4F0Z A;  2R17 A;  3QFK A;  2HYO A;  1Z2W A;  3C9F A;  4MP0 A;  4FBW A;  4M0V A;  5J28 A;  4FBQ A;  5INB A;  4O4K A;  3DSD A;  1AUI A;  4DHL A;  4J6O A;  3LL8 A;  1S95 A;  1HO5 A;  4B2O A;  3QFN A;  3THN A;  3ZU0 A;  1OI8 A;  1IT6 A;  3HVQ A;  1QHW A;  1TCO A;  4MOV A;  2BDX A;  2HYP A;  4LU9 A;  4UT3 B;  5JJT A;  1USH A;  3P71 C;  3AUZ A;  1T70 A;  4HD0 A;  3RL5 A;  3DW8 C;  3EGG A;  3RL4 A;  2IAE C;  1HP1 A;  3QG5 C;  1W24 A;  4H2F A;  4LAC C;  1G5B A;  5HPE A;  1UTE A;  5IOH A;  3H63 A;  2BQ8 X;  2Z1A A;  3K7V C;  4ZX2 A;  4OR9 A;  1WAO 1;  4TUG A;  2QFP A;  4ORC A;  4MOY A;  3DSC A;  4FBK A;  1XZW A;  3H67 A;  3H68 A;  4G9J A;  1Z2X A;  1KBP A;  3K7W C;  2DFJ A;  1MF8 A;  1S3M A;  1HPU A;  4UT2 A;  2KKN A;  5DNY A;  1WAR A;  2Z72 A;  4DT2 A;  3EGH A;  3N5U A;  1NNW A;  3ICF A;  2NYL C;  2QFR A;  3H66 A;  1UF3 A;  4V0W A;  4H1Y P;  3FGA C;  3PSO A;  3QFM A;  4FCX A;  1U32 A;  2Q8U A;  3C5W C;  4I5N C;  3V4Y A;  4UT3 A;  4H2I A;  1S70 A;  2NPP C;  3H60 A;  1S8E A;  3H62 B;  1JK7 A;  4V0V A;  2WDD A;  5GTU A;  2O8A A;  1S3L A;  3TGH A;  2WDE A;  3GVE A;  5C1V A;  2P6B A;  4YKE A;  1OIE A;  2O8G A;  1S3N A;  3QFO A;  4JA9 A;  5EQV A;  2IE3 C;  3THO B;  1FJM A;  2CV9 A;  5JPE A;  2GJU A;  4LTY A;  4DSY A;  4H2G A;  2QJC A;  2BCD A;  4WWL A;  4ZVZ A;  4O5G A;  1SU1 A;  2Z06 A;  4Q7F A;  5B8I A;  2NYM C;  3KBP A;  2ZBM A;  2XMO A;  4O43 A;  3IVD A;  4ORB A;  2A22 A;  3AV0 A;  3ZTV A;  4I5L C;  4UWQ A;  3RL3 A;  1OID A;  5JPF A;  1M63 A;  2YVT A;  2WDC A;  4IL1 A;  1QFC A;  4TUI A;  4KBP A;  4JA7 A;  2WDF A;  3H61 A;  2NXF A;  4H1S A;  4KKZ A;  5F3W A; 
#chains in the Genus database with same CATH topology
 1XM7 A;  4V0X A;  3E7A A;  3PSN A;  3IB8 A;  2IE4 C;  3H69 A;  4H2B A;  3CK2 A;  2USH A;  2HY1 A;  1V73 A;  3IB7 A;  3IVE A;  3H64 A;  4O24 A;  4ORA A;  3JYF A;  3E7B A;  4IYP C;  4NZV A;  1II7 A;  3T1I A;  1T71 A;  2AHD A;  3RQZ A;  4XPN A;  2JOG A;  4F0Z A;  2R17 A;  3QFK A;  2HYO A;  1Z2W A;  3C9F A;  4MP0 A;  4FBW A;  4M0V A;  5J28 A;  4FBQ A;  5INB A;  4O4K A;  3DSD A;  1AUI A;  4DHL A;  4J6O A;  3LL8 A;  1S95 A;  1HO5 A;  4B2O A;  3QFN A;  3THN A;  3ZU0 A;  1OI8 A;  1IT6 A;  2YEQ A;  3HVQ A;  1QHW A;  1TCO A;  4MOV A;  2BDX A;  2HYP A;  4LU9 A;  4UT3 B;  5JJT A;  1USH A;  3P71 C;  3AUZ A;  1T70 A;  4HD0 A;  3RL5 A;  3DW8 C;  3EGG A;  3RL4 A;  2IAE C;  1HP1 A;  2DXN A;  3QG5 C;  1W24 A;  4H2F A;  4LAC C;  3E0J A;  1G5B A;  5HPE A;  1UTE A;  5IOH A;  3H63 A;  2BQ8 X;  2Z1A A;  3K7V C;  4ZX2 A;  4OR9 A;  1WAO 1;  4TUG A;  2QFP A;  4ORC A;  4MOY A;  3DSC A;  4FBK A;  1XZW A;  3H67 A;  3H68 A;  3D03 A;  4G9J A;  2ZO9 B;  1Z2X A;  1KBP A;  3FLO A;  2DFJ A;  3K7W C;  1MF8 A;  1S3M A;  1HPU A;  4UT2 A;  2KKN A;  5DNY A;  1WAR A;  2Z72 A;  4DT2 A;  3EGH A;  3N5U A;  1NNW A;  3ICF A;  2NYL C;  2QFR A;  3H66 A;  1UF3 A;  4V0W A;  4H1Y P;  3FGA C;  3PSO A;  3QFM A;  4FCX A;  1U32 A;  2Q8U A;  3C5W C;  4I5N C;  3V4Y A;  4UT3 A;  4H2I A;  1S70 A;  2NPP C;  3H60 A;  1S8E A;  2ZOA A;  3H62 B;  1JK7 A;  4V0V A;  2WDD A;  5GTU A;  2O8A A;  1S3L A;  3TGH A;  2WDE A;  3GVE A;  5C1V A;  2P6B A;  4YKE A;  1OIE A;  2O8G A;  1S3N A;  3QFO A;  4JA9 A;  5EQV A;  2IE3 C;  3THO B;  1FJM A;  2CV9 A;  5JPE A;  2GJU A;  4LTY A;  4DSY A;  4H2G A;  2QJC A;  2BCD A;  4WWL A;  4ZVZ A;  4O5G A;  1SU1 A;  2Z06 A;  4Q7F A;  2DXL A;  5B8I A;  2NYM C;  3KBP A;  2ZBM A;  2XMO A;  4O43 A;  3IVD A;  4ORB A;  2A22 A;  3AV0 A;  3ZTV A;  4I5L C;  4UWQ A;  3RL3 A;  1OID A;  5JPF A;  1M63 A;  2YVT A;  2WDC A;  4IL1 A;  1QFC A;  4TUI A;  4KBP A;  4JA7 A;  2WDF A;  3H61 A;  2NXF A;  4H1S A;  4KKZ A;  5F3W A; 
#chains in the Genus database with same CATH homology
 1XM7 A;  4V0X A;  3E7A A;  3PSN A;  3IB8 A;  2IE4 C;  3H69 A;  4H2B A;  3CK2 A;  2USH A;  2HY1 A;  1V73 A;  3IB7 A;  3IVE A;  3H64 A;  4O24 A;  4ORA A;  3JYF A;  3E7B A;  4IYP C;  4NZV A;  1II7 A;  3T1I A;  1T71 A;  2AHD A;  3RQZ A;  4XPN A;  2JOG A;  4F0Z A;  2R17 A;  3QFK A;  2HYO A;  1Z2W A;  3C9F A;  4MP0 A;  4FBW A;  4M0V A;  5J28 A;  4FBQ A;  5INB A;  4O4K A;  3DSD A;  1AUI A;  4DHL A;  4J6O A;  3LL8 A;  1S95 A;  1HO5 A;  4B2O A;  3QFN A;  3THN A;  3ZU0 A;  1OI8 A;  1IT6 A;  2YEQ A;  3HVQ A;  1QHW A;  1TCO A;  4MOV A;  2BDX A;  2HYP A;  4LU9 A;  4UT3 B;  5JJT A;  1USH A;  3P71 C;  3AUZ A;  1T70 A;  4HD0 A;  3RL5 A;  3DW8 C;  3EGG A;  3RL4 A;  2IAE C;  1HP1 A;  2DXN A;  3QG5 C;  1W24 A;  4H2F A;  4LAC C;  3E0J A;  1G5B A;  5HPE A;  1UTE A;  5IOH A;  3H63 A;  2BQ8 X;  2Z1A A;  3K7V C;  4ZX2 A;  4OR9 A;  1WAO 1;  4TUG A;  2QFP A;  4ORC A;  4MOY A;  3DSC A;  4FBK A;  1XZW A;  3H67 A;  3H68 A;  3D03 A;  4G9J A;  2ZO9 B;  1Z2X A;  1KBP A;  3FLO A;  2DFJ A;  3K7W C;  1MF8 A;  1S3M A;  1HPU A;  4UT2 A;  2KKN A;  5DNY A;  1WAR A;  2Z72 A;  4DT2 A;  3EGH A;  3N5U A;  1NNW A;  3ICF A;  2NYL C;  2QFR A;  3H66 A;  1UF3 A;  4V0W A;  4H1Y P;  3FGA C;  3PSO A;  3QFM A;  4FCX A;  1U32 A;  2Q8U A;  3C5W C;  4I5N C;  3V4Y A;  4UT3 A;  4H2I A;  1S70 A;  2NPP C;  3H60 A;  1S8E A;  2ZOA A;  3H62 B;  1JK7 A;  4V0V A;  2WDD A;  5GTU A;  2O8A A;  1S3L A;  3TGH A;  2WDE A;  3GVE A;  5C1V A;  2P6B A;  4YKE A;  1OIE A;  2O8G A;  1S3N A;  3QFO A;  4JA9 A;  5EQV A;  2IE3 C;  3THO B;  1FJM A;  2CV9 A;  5JPE A;  2GJU A;  4LTY A;  4DSY A;  4H2G A;  2QJC A;  2BCD A;  4WWL A;  4ZVZ A;  4O5G A;  1SU1 A;  2Z06 A;  4Q7F A;  2DXL A;  5B8I A;  2NYM C;  3KBP A;  2ZBM A;  2XMO A;  4O43 A;  3IVD A;  4ORB A;  2A22 A;  3AV0 A;  3ZTV A;  4I5L C;  4UWQ A;  3RL3 A;  1OID A;  5JPF A;  1M63 A;  2YVT A;  2WDC A;  4IL1 A;  1QFC A;  4TUI A;  4KBP A;  4JA7 A;  2WDF A;  3H61 A;  2NXF A;  4H1S A;  4KKZ A;  5F3W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...