4I5NC

Structural mechanism of trimeric pp2a holoenzyme involving pr70: insight for cdc6 dephosphorylation
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
293
structure length
293
Chain Sequence
DEKVFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein phosphatase 2A 65 kDa regulatory su
publication title Structure of the Ca(2+)-dependent PP2A heterotrimer and insights into Cdc6 dephosphorylation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/toxin
total genus 104
structure length 293
sequence length 293
chains with identical sequence F
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2012-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 4i5nC00
4V0VA 3C9FA 2Z72A 1SU1A 3AUZA 2HYPA 4I5NC 3IVEA 4TUIA 4UWQA 5F3WA 1Z2XA 2BQ8X 4FBKA 3ICFA 3THNA 2WDCA 5B8IA 1XZWA 4M0VA 2IAEC 1MF8A 4ORCA 2CV9A 4B2OA 2NPPC 4UT3A 1TCOA 2NYMC 3KBPA 3RL4A 1T71A 4JA9A 3H62B 1Z2WA 1JK7A 4DT2A 4F0ZA 2ZBMA 3EGGA 4ZVZA 3HVQA 1S95A 2GJUA 1OI8A 3GVEA 2IE4C 3N5UA 4H2FA 1S3MA 4JA7A 4NZVA 2USHA 3QG5C 4H2BA 4MP0A 5HPEA 5JPEA 2BCDA 1UF3A 4DHLA 3DSCA 1FJMA 2IE3C 1IT6A 1HO5A 2JOGA 4LACC 1S3NA 4ORAA 4V0WA 4H1YP 2A22A 2WDFA 3T1IA 1II7A 1USHA 4FBWA 4I5LC 1M63A 5DNYA 4HD0A 3TGHA 2XMOA 3C5WC 4FBQA 4O5GA 4UT3B 3EGHA 4J6OA 3DSDA 1G5BA 4H1SA 3QFNA 3P71C 3CK2A 3RQZA 2Q8UA 1OIDA 1KBPA 3H61A 3AV0A 5INBA 2HY1A 1HP1A 2NYLC 3H66A 4LTYA 2KKNA 3PSNA 1S70A 4O43A 4IYPC 1V73A 5J28A 4IL1A 3H68A 1AUIA 3IB8A 4H2GA 2NXFA 4O24A 1XM7A 1S8EA 3H64A 1HPUA 2WDDA 2AHDA 3QFOA 4UT2A 3H60A 3E7BA 3E7AA 4FCXA 4LU9A 3IVDA 4O4KA 4H2IA 2YVTA 3RL3A 1QHWA 3H69A 4V0XA 5EQVA 2QJCA 3ZU0A 3K7VC 4TUGA 3ZTVA 1S3LA 3PSOA 4ZX2A 4YKEA 1WAO1 4G9JA 2QFPA 2P6BA 3JYFA 2R17A 2O8GA 4KBPA 1NNWA 3V4YA 4MOYA 2DFJA 2BDXA 2Z06A 3H63A 3FGAC 2QFRA 3QFKA 5JPFA 2O8AA 5C1VA 3QFMA 3THOB 3K7WC 4WWLA 3IB7A 4ORBA 1W24A 4Q7FA 5GTUA 5JJTA 4KKZA 1WARA 1UTEA 3H67A 4OR9A 4XPNA 3LL8A 2HYOA 4MOVA 4DSYA 1OIEA 1QFCA 1T70A 5IOHA 3RL5A 1U32A 2WDEA 2Z1AA 3DW8C
chains in the Genus database with same CATH superfamily
4V0VA 3C9FA 2Z72A 1SU1A 3AUZA 2HYPA 4I5NC 3IVEA 4TUIA 4UWQA 5F3WA 1Z2XA 2BQ8X 4FBKA 3ICFA 3THNA 2WDCA 5B8IA 1XZWA 4M0VA 2IAEC 1MF8A 4NZVA 4ORCA 2CV9A 2ZOAA 4B2OA 2NPPC 4UT3A 1TCOA 2NYMC 3KBPA 3RL4A 1T71A 3FLOA 4JA9A 3H62B 1Z2WA 1JK7A 4DT2A 4F0ZA 2ZBMA 3EGGA 4ZVZA 3HVQA 2ZO9B 1S95A 2GJUA 2YEQA 1OI8A 2IE4C 3GVEA 3N5UA 1S3MA 4H2FA 4JA7A 2USHA 3QG5C 4H2BA 4MP0A 5HPEA 5JPEA 2BCDA 1UF3A 4DHLA 3DSCA 1FJMA 2IE3C 1IT6A 1HO5A 2JOGA 4LACC 1S3NA 4ORAA 4V0WA 4H1YP 2A22A 2WDFA 3T1IA 1II7A 1USHA 4FBWA 4I5LC 1M63A 5DNYA 4HD0A 3TGHA 2XMOA 3C5WC 4FBQA 4O5GA 4UT3B 3EGHA 4J6OA 3DSDA 1G5BA 4H1SA 3QFNA 3P71C 3CK2A 3RQZA 2Q8UA 1OIDA 1KBPA 3H61A 3AV0A 5INBA 2HY1A 1HP1A 2NYLC 3H66A 4LTYA 2KKNA 3PSNA 1S70A 4O43A 4IYPC 1V73A 5J28A 4IL1A 3H68A 1AUIA 3IB8A 4H2GA 2NXFA 4O24A 1XM7A 1S8EA 3H64A 1HPUA 2WDDA 3D03A 2AHDA 3QFOA 4UT2A 3H60A 3E7BA 3E7AA 4FCXA 4LU9A 3IVDA 4O4KA 4H2IA 2YVTA 3RL3A 1QHWA 2DXNA 3H69A 4V0XA 5EQVA 2QJCA 3ZU0A 3K7VC 4TUGA 3ZTVA 1S3LA 3PSOA 4ZX2A 4YKEA 1WAO1 4G9JA 2QFPA 2P6BA 3JYFA 2R17A 2O8GA 4KBPA 1NNWA 3V4YA 4MOYA 2DXLA 2DFJA 2BDXA 2Z06A 3H63A 3FGAC 2QFRA 3QFKA 5JPFA 2O8AA 5C1VA 3QFMA 3THOB 3K7WC 4WWLA 3IB7A 4ORBA 1W24A 4Q7FA 5GTUA 5JJTA 4KKZA 1WARA 1UTEA 3H67A 4OR9A 4XPNA 3LL8A 2HYOA 4MOVA 4DSYA 1OIEA 1QFCA 1T70A 5IOHA 3RL5A 1U32A 2WDEA 2Z1AA 3DW8C 3E0JA
chains in the Genus database with same CATH topology
4V0VA 3C9FA 2Z72A 1SU1A 3AUZA 2HYPA 4I5NC 3IVEA 4TUIA 4UWQA 5F3WA 1Z2XA 2BQ8X 4FBKA 3ICFA 3THNA 2WDCA 5B8IA 1XZWA 4M0VA 2IAEC 1MF8A 4NZVA 4ORCA 2CV9A 2ZOAA 4B2OA 2NPPC 4UT3A 1TCOA 2NYMC 3KBPA 3RL4A 1T71A 3FLOA 4JA9A 3H62B 1Z2WA 1JK7A 4DT2A 4F0ZA 2ZBMA 3EGGA 4ZVZA 3HVQA 2ZO9B 1S95A 2GJUA 2YEQA 1OI8A 2IE4C 3GVEA 3N5UA 1S3MA 4H2FA 4JA7A 2USHA 3QG5C 4H2BA 4MP0A 5HPEA 5JPEA 2BCDA 1UF3A 4DHLA 3DSCA 1FJMA 2IE3C 1IT6A 1HO5A 2JOGA 4LACC 1S3NA 4ORAA 4V0WA 4H1YP 2A22A 2WDFA 3T1IA 1II7A 1USHA 4FBWA 4I5LC 1M63A 5DNYA 4HD0A 3TGHA 2XMOA 3C5WC 4FBQA 4O5GA 4UT3B 3EGHA 4J6OA 3DSDA 1G5BA 4H1SA 3QFNA 3P71C 3CK2A 3RQZA 2Q8UA 1OIDA 1KBPA 3H61A 3AV0A 5INBA 2HY1A 1HP1A 2NYLC 3H66A 4LTYA 2KKNA 3PSNA 1S70A 4O43A 4IYPC 1V73A 5J28A 4IL1A 3H68A 1AUIA 3IB8A 4H2GA 2NXFA 4O24A 1XM7A 1S8EA 3H64A 1HPUA 2WDDA 3D03A 2AHDA 3QFOA 4UT2A 3H60A 3E7BA 3E7AA 4FCXA 4LU9A 3IVDA 4O4KA 4H2IA 2YVTA 3RL3A 1QHWA 2DXNA 3H69A 4V0XA 5EQVA 2QJCA 3ZU0A 3K7VC 4TUGA 3ZTVA 1S3LA 3PSOA 4ZX2A 4YKEA 1WAO1 4G9JA 2QFPA 2P6BA 3JYFA 2R17A 2O8GA 4KBPA 1NNWA 3V4YA 4MOYA 2DXLA 2DFJA 2BDXA 2Z06A 3H63A 3FGAC 2QFRA 3QFKA 5JPFA 2O8AA 5C1VA 3QFMA 3THOB 3K7WC 4WWLA 3IB7A 4ORBA 1W24A 4Q7FA 5GTUA 5JJTA 4KKZA 1WARA 1UTEA 3H67A 4OR9A 4XPNA 3LL8A 2HYOA 4MOVA 4DSYA 1OIEA 1QFCA 1T70A 5IOHA 3RL5A 1U32A 2WDEA 2Z1AA 3DW8C 3E0JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4V0V A;  3C9F A;  2Z72 A;  1SU1 A;  3AUZ A;  2HYP A;  4I5N C;  3IVE A;  4TUI A;  4UWQ A;  5F3W A;  1Z2X A;  2BQ8 X;  4FBK A;  3ICF A;  3THN A;  2WDC A;  5B8I A;  1XZW A;  4M0V A;  2IAE C;  1MF8 A;  4ORC A;  2CV9 A;  4B2O A;  2NPP C;  4UT3 A;  1TCO A;  2NYM C;  3KBP A;  3RL4 A;  1T71 A;  4JA9 A;  3H62 B;  1Z2W A;  1JK7 A;  4DT2 A;  4F0Z A;  2ZBM A;  3EGG A;  4ZVZ A;  3HVQ A;  1S95 A;  2GJU A;  1OI8 A;  3GVE A;  2IE4 C;  3N5U A;  4H2F A;  1S3M A;  4JA7 A;  4NZV A;  2USH A;  3QG5 C;  4H2B A;  4MP0 A;  5HPE A;  5JPE A;  2BCD A;  1UF3 A;  4DHL A;  3DSC A;  1FJM A;  2IE3 C;  1IT6 A;  1HO5 A;  2JOG A;  4LAC C;  1S3N A;  4ORA A;  4V0W A;  4H1Y P;  2A22 A;  2WDF A;  3T1I A;  1II7 A;  1USH A;  4FBW A;  4I5L C;  1M63 A;  5DNY A;  4HD0 A;  3TGH A;  2XMO A;  3C5W C;  4FBQ A;  4O5G A;  4UT3 B;  3EGH A;  4J6O A;  3DSD A;  1G5B A;  4H1S A;  3QFN A;  3P71 C;  3CK2 A;  3RQZ A;  2Q8U A;  1OID A;  1KBP A;  3H61 A;  3AV0 A;  5INB A;  2HY1 A;  1HP1 A;  2NYL C;  3H66 A;  4LTY A;  2KKN A;  3PSN A;  1S70 A;  4O43 A;  4IYP C;  1V73 A;  5J28 A;  4IL1 A;  3H68 A;  1AUI A;  3IB8 A;  4H2G A;  2NXF A;  4O24 A;  1XM7 A;  1S8E A;  3H64 A;  1HPU A;  2WDD A;  2AHD A;  3QFO A;  4UT2 A;  3H60 A;  3E7B A;  3E7A A;  4FCX A;  4LU9 A;  3IVD A;  4O4K A;  4H2I A;  2YVT A;  3RL3 A;  1QHW A;  3H69 A;  4V0X A;  5EQV A;  2QJC A;  3ZU0 A;  3K7V C;  4TUG A;  3ZTV A;  1S3L A;  3PSO A;  4ZX2 A;  4YKE A;  1WAO 1;  4G9J A;  2QFP A;  2P6B A;  3JYF A;  2R17 A;  2O8G A;  4KBP A;  1NNW A;  3V4Y A;  4MOY A;  2DFJ A;  2BDX A;  2Z06 A;  3H63 A;  3FGA C;  2QFR A;  3QFK A;  5JPF A;  2O8A A;  5C1V A;  3QFM A;  3THO B;  3K7W C;  4WWL A;  3IB7 A;  4ORB A;  1W24 A;  4Q7F A;  5GTU A;  5JJT A;  4KKZ A;  1WAR A;  1UTE A;  3H67 A;  4OR9 A;  4XPN A;  3LL8 A;  2HYO A;  4MOV A;  4DSY A;  1OIE A;  1QFC A;  1T70 A;  5IOH A;  3RL5 A;  1U32 A;  2WDE A;  2Z1A A;  3DW8 C; 
#chains in the Genus database with same CATH topology
 4V0V A;  3C9F A;  2Z72 A;  1SU1 A;  3AUZ A;  2HYP A;  4I5N C;  3IVE A;  4TUI A;  4UWQ A;  5F3W A;  1Z2X A;  2BQ8 X;  4FBK A;  3ICF A;  3THN A;  2WDC A;  5B8I A;  1XZW A;  4M0V A;  2IAE C;  1MF8 A;  4NZV A;  4ORC A;  2CV9 A;  2ZOA A;  4B2O A;  2NPP C;  4UT3 A;  1TCO A;  2NYM C;  3KBP A;  3RL4 A;  1T71 A;  3FLO A;  4JA9 A;  3H62 B;  1Z2W A;  1JK7 A;  4DT2 A;  4F0Z A;  2ZBM A;  3EGG A;  4ZVZ A;  3HVQ A;  2ZO9 B;  1S95 A;  2GJU A;  2YEQ A;  1OI8 A;  2IE4 C;  3GVE A;  3N5U A;  1S3M A;  4H2F A;  4JA7 A;  2USH A;  3QG5 C;  4H2B A;  4MP0 A;  5HPE A;  5JPE A;  2BCD A;  1UF3 A;  4DHL A;  3DSC A;  1FJM A;  2IE3 C;  1IT6 A;  1HO5 A;  2JOG A;  4LAC C;  1S3N A;  4ORA A;  4V0W A;  4H1Y P;  2A22 A;  2WDF A;  3T1I A;  1II7 A;  1USH A;  4FBW A;  4I5L C;  1M63 A;  5DNY A;  4HD0 A;  3TGH A;  2XMO A;  3C5W C;  4FBQ A;  4O5G A;  4UT3 B;  3EGH A;  4J6O A;  3DSD A;  1G5B A;  4H1S A;  3QFN A;  3P71 C;  3CK2 A;  3RQZ A;  2Q8U A;  1OID A;  1KBP A;  3H61 A;  3AV0 A;  5INB A;  2HY1 A;  1HP1 A;  2NYL C;  3H66 A;  4LTY A;  2KKN A;  3PSN A;  1S70 A;  4O43 A;  4IYP C;  1V73 A;  5J28 A;  4IL1 A;  3H68 A;  1AUI A;  3IB8 A;  4H2G A;  2NXF A;  4O24 A;  1XM7 A;  1S8E A;  3H64 A;  1HPU A;  2WDD A;  3D03 A;  2AHD A;  3QFO A;  4UT2 A;  3H60 A;  3E7B A;  3E7A A;  4FCX A;  4LU9 A;  3IVD A;  4O4K A;  4H2I A;  2YVT A;  3RL3 A;  1QHW A;  2DXN A;  3H69 A;  4V0X A;  5EQV A;  2QJC A;  3ZU0 A;  3K7V C;  4TUG A;  3ZTV A;  1S3L A;  3PSO A;  4ZX2 A;  4YKE A;  1WAO 1;  4G9J A;  2QFP A;  2P6B A;  3JYF A;  2R17 A;  2O8G A;  4KBP A;  1NNW A;  3V4Y A;  4MOY A;  2DXL A;  2DFJ A;  2BDX A;  2Z06 A;  3H63 A;  3FGA C;  2QFR A;  3QFK A;  5JPF A;  2O8A A;  5C1V A;  3QFM A;  3THO B;  3K7W C;  4WWL A;  3IB7 A;  4ORB A;  1W24 A;  4Q7F A;  5GTU A;  5JJT A;  4KKZ A;  1WAR A;  1UTE A;  3H67 A;  4OR9 A;  4XPN A;  3LL8 A;  2HYO A;  4MOV A;  4DSY A;  1OIE A;  1QFC A;  1T70 A;  5IOH A;  3RL5 A;  1U32 A;  2WDE A;  2Z1A A;  3DW8 C;  3E0J A; 
#chains in the Genus database with same CATH homology
 4V0V A;  3C9F A;  2Z72 A;  1SU1 A;  3AUZ A;  2HYP A;  4I5N C;  3IVE A;  4TUI A;  4UWQ A;  5F3W A;  1Z2X A;  2BQ8 X;  4FBK A;  3ICF A;  3THN A;  2WDC A;  5B8I A;  1XZW A;  4M0V A;  2IAE C;  1MF8 A;  4NZV A;  4ORC A;  2CV9 A;  2ZOA A;  4B2O A;  2NPP C;  4UT3 A;  1TCO A;  2NYM C;  3KBP A;  3RL4 A;  1T71 A;  3FLO A;  4JA9 A;  3H62 B;  1Z2W A;  1JK7 A;  4DT2 A;  4F0Z A;  2ZBM A;  3EGG A;  4ZVZ A;  3HVQ A;  2ZO9 B;  1S95 A;  2GJU A;  2YEQ A;  1OI8 A;  2IE4 C;  3GVE A;  3N5U A;  1S3M A;  4H2F A;  4JA7 A;  2USH A;  3QG5 C;  4H2B A;  4MP0 A;  5HPE A;  5JPE A;  2BCD A;  1UF3 A;  4DHL A;  3DSC A;  1FJM A;  2IE3 C;  1IT6 A;  1HO5 A;  2JOG A;  4LAC C;  1S3N A;  4ORA A;  4V0W A;  4H1Y P;  2A22 A;  2WDF A;  3T1I A;  1II7 A;  1USH A;  4FBW A;  4I5L C;  1M63 A;  5DNY A;  4HD0 A;  3TGH A;  2XMO A;  3C5W C;  4FBQ A;  4O5G A;  4UT3 B;  3EGH A;  4J6O A;  3DSD A;  1G5B A;  4H1S A;  3QFN A;  3P71 C;  3CK2 A;  3RQZ A;  2Q8U A;  1OID A;  1KBP A;  3H61 A;  3AV0 A;  5INB A;  2HY1 A;  1HP1 A;  2NYL C;  3H66 A;  4LTY A;  2KKN A;  3PSN A;  1S70 A;  4O43 A;  4IYP C;  1V73 A;  5J28 A;  4IL1 A;  3H68 A;  1AUI A;  3IB8 A;  4H2G A;  2NXF A;  4O24 A;  1XM7 A;  1S8E A;  3H64 A;  1HPU A;  2WDD A;  3D03 A;  2AHD A;  3QFO A;  4UT2 A;  3H60 A;  3E7B A;  3E7A A;  4FCX A;  4LU9 A;  3IVD A;  4O4K A;  4H2I A;  2YVT A;  3RL3 A;  1QHW A;  2DXN A;  3H69 A;  4V0X A;  5EQV A;  2QJC A;  3ZU0 A;  3K7V C;  4TUG A;  3ZTV A;  1S3L A;  3PSO A;  4ZX2 A;  4YKE A;  1WAO 1;  4G9J A;  2QFP A;  2P6B A;  3JYF A;  2R17 A;  2O8G A;  4KBP A;  1NNW A;  3V4Y A;  4MOY A;  2DXL A;  2DFJ A;  2BDX A;  2Z06 A;  3H63 A;  3FGA C;  2QFR A;  3QFK A;  5JPF A;  2O8A A;  5C1V A;  3QFM A;  3THO B;  3K7W C;  4WWL A;  3IB7 A;  4ORB A;  1W24 A;  4Q7F A;  5GTU A;  5JJT A;  4KKZ A;  1WAR A;  1UTE A;  3H67 A;  4OR9 A;  4XPN A;  3LL8 A;  2HYO A;  4MOV A;  4DSY A;  1OIE A;  1QFC A;  1T70 A;  5IOH A;  3RL5 A;  1U32 A;  2WDE A;  2Z1A A;  3DW8 C;  3E0J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...