4I6LB

Crystal structure of otub1 in complex with ubiquitin variant
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
75
structure length
75
Chain Sequence
GSMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQKLLFARKQLEDGRTLSDYNIHKESFLYLVLRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin thioesterase OTUB1
publication title A strategy for modulation of enzymes in the ubiquitin system.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 21
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2012-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4i6lB00
2BF8B 4MSQB 3PS6A 3TJPA 4JL9A 4B9KA 2G4DB 1OEYA 1WR1A 2DZKA 2LJ5A 3VTUA 2DYOA 2NPTA 1YIWA 3A4SC 3CSFA 4W9CA 2REXA 2KTRB 4GMVA 3BINA 2K39A 4B95A 4EKUA 2LGXA 4M8NA 2EMSA 3V62A 3ZW3A 1OQYA 5E6PA 1GG3A 2KX0A 5IA7A 5TR5A 4ANUA 1KM7A 4MM3A 4PS3A 2DX5B 2DAFA 3ZLZA 3DBRI 4ZYNA 1UH6A 3U30A 4A3OA 4DWFA 4GIVA 4KV2A 1WF9A 4IWOA 4BVUC 2L00B 3ML9A 4DXAB 3PVLA 5C23A 1BT0A 4G0NB 4DDGD 3U7DA 3APFA 4X57B 4G3XB 3B1LX 2BPSA 4NQLB 4KIKB 2ZZPB 1UELA 3VVWB 2AEHA 4EZLA 3APDA 3R3MA 2O2VB 4WJQA 3A9KA 4A20A 3WA0A 4EOYA 3Q3JA 3JVZX 4EZJA 5DCNA 2A4ZA 4LJPB 3RZWC 4TQ0A 3UGBB 1R4MI 1TTNA 5DPTA 2IBIB 2LRWA 1KJTA 3DVNU 2EKEC 3PHWB 3A9KB 4LJOB 2WX1A 3D32A 2FCSA 4HK2A 2HTHA 1ZW7A 2NR2A 1GJZA 3IHPC 2KDEB 3KYDD 2DHZA 3PREA 3UQBA 3WIMA 4BOSC 3QC8B 1NI2A 5JZEB 4WJPA 4FADA 4CYEA 3K9PB 3ZVVA 3SHQA 4K7UA 2RSUA 2KJRA 2ZVOA 3VDZA 2Z0DB 1ZKHA 2M17A 4F1SA 1WMHA 2PE6B 2L3ZA 4MJSA 3S2AA 3VTVA 2KK8A 4J6IA 4DHJD 2GMIC 4M8MA 2JVCA 3PRMB 2M4NA 1WYWB 4GDLA 3W1YA 1KOTA 2W9NA 3ONSA 4W9LA 1LFDA 2BWES 3BY4B 3ZIMA 4IM0A 4MJSB 2Z0EB 3W1SC 1I35A 2PPHA 3NHEB 2ZCBA 2Y5BB 2JZ3B 2AL3A 5DPWA 3RYTA 1IP9A 2M8SA 2BWFA 2IO3B 2MBBB 2AWTA 1YD8U 2YLMA 4IW0A 3KW5B 4LDTD 2KJHB 4JGHB 2GOWA 2ZVNA 3A1QB 2XK5A 5JHBA 3H7PA 1E5WA 4HDQA 4NY0A 3H9DA 3ZNGC 2JUOA 4MGKE 2MQJA 2KKCA 2RPQA 1S3SG 1WGDA 2N1WA 2V3SA 3IG3A 4HCNB 1TGZB 3JSVA 3L16A 5DPSA 2BKRB 3RD2A 1SIFA 4WJNA 3H6NA 4DK5A 2IYDB 2L0TA 1Q0WB 5E6NA 2B3AA 3AI5A 2KO3A 1K8RB 2PEAA 2J0MA 3CF6E 3DBLI 3CMMB 3H7PB 4I6NB 3VFKA 1Q1OA 1WX9A 4FA6A 3A9JA 2KDBA 2BGFA 2LUEA 4PS8A 1C3TA 1VCBA 2FIDA 2IO1B 2ZEQA 2LVQA 4EZKA 3GZNI 3ZDTA 4W9JA 3V6EB 3DQVA 4FULA 2CHWA 4MEMA 4ZRKA 1XT9B 4M0WB 4HLEA 2KWVB 4IWQA 2MWSB 5L95C 4HCPB 3K9OB 3ECIA 1V80A 1WM3A 2KN5A 3R66C 3QAQA 2HE7A 3OJ4B 2JY6A 1WH3A 3SDLC 2MLBA 5JHAA 4RM8A 2CS4A 1LM8B 2QHOA 4PYZA 4KVGB 2XEWA 4TUUA 4FN2A 1WX8A 3ZUNA 1WE7A 2LI5A 1AARA 1WM2A 4W9DA 2ZNVB 1YQBA 1LXDA 5CTRC 3AU4A 5DPRA 4BFRA 4ANWA 4DHJB 1LQBA 1E90A 1WY8A 1C1YB 4ANXA 4G11A 5C1ZA 2RR9A 1WE6A 2NPTB 2GBMA 2CU1A 5GMVA 3RCZA 3PSEB 3RUIB 3UF8A 3DCGA 3DDCB 2C7HA 4AJYB 2DYBA 2WYQA 2DZMA 2KC1A 4NJ7A 5AZFA 3LDZE 3WAOA 4MDKE 4MSMB 2UYZB 5LXHA 1F9JA 1E7VA 1UBQA 2LZ6A 1V81A 2KJ6A 2JRHA 4JQWC 4LDTB 2G4SA 1P98A 3L0WB 3NS8A 4IM2A 1G6JA 2C9WB 1T0YA 4GB9A 3HM3A 3LJ3A 2KANA 4WWPA 1ZGUB 2MW5A 3PV1A 3OJ3A 4P7IA 1WXAA 5AZGA 1WXMA 2BYFA 3EC8A 2IO2B 2K25A 2XBBC 3SD5A 1GC7A 1X1MA 2N9XA 2GBNA 3QIJA 2UWQA 4HDOA 2LVOA 2LWPA 1WZ0A 4GOCA 2IY0B 2ZPYA 1Q5WB 1WR6E 1WFYA 2V4LA 3PTFC 4IWPA 5AEKB 4FHJA 5D7GA 3RULA 1WGYA 2LRUA 1TZ1A 2N9EB 3DVNV 4HPLB 5G2NA 4DDID 2KOXA 3JYUA 4K81A 4W9IA 2JWZA 2N7DA 5CX3A 3UIOB 4FBJB 1V9JA 3ALBA 3PPAA 4W9EA 3PGEA 1V5OA 2IY1B 3UQAA 2KWUB 3VUWA 2HD5B 3N30A 4BKGA 2DZJA 3VTWA 2V1YA 2I1KA 3VH3B 2LASA 5D2MB 3DBHI 3CSTA 1VD2A 2MBQA 3DBSA 2MP2A 3KUCB 2M1MA 3M3JA 4FJYA 2GBJA 2JRIB 2KFKA 4EEWA 2KMCA 3MHSD 1E7UA 2FCNA 2IZVB 4AJWA 2KWCA 1WMHB 2LVPA 1MG8A 3V60A 3M63B 4TV3A 3X0WA 3VAWA 2J7QB 1PQSA 4WAAA 4BKTA 2K8HA 1EF1A 4BOZB 2OOBB 3WALA 1WXSA 4GGQA 3GOEA 3B08A 3N3KB 4RM9A 4W9KA 3TL5A 1V49A 3VXWA 3WANA 3ZNHB 3Q3FA 2D11A 4GDLB 4KZCA 4MH0E 1KLVA 3KYCD 2ZNVC 3QA8A 2BKFA 2KVRA 3L13A 4FHKA 2KFJA 4K7SA 2HJ8A 1YX5B 4AOFA 1EUVB 2N1VA 1Y8RC 2G45B 2N9PC 2KNBA 2RGFA 3APCA 4FJZA 4N9F4 2NCNA 4RMAA 2YVCA 3QQ8B 4WJOA 1UBIA 2KZRA 4XX5A 2XK5B 2KXJA 5HKHA 4E71A 4BBNF 2K1FA 3P2BA 2AYOB 3M95A 1RAXA 3JSVB 3HM6X 3EFUA 4II3B 3T8MA 4K7WA 1J8CA 4MGZE 1RFAA 1OTRB 4NPNA 1M94A 3KUDB 5FR6A 2NBWB 4HJKA 4E3CA 2OJRA 2MBEA 5LLIA 1FXTB 2A5UA 1E8XA 2LXCA 2MA9B 3NZSA 4LCDE 3DPDA 2L0FA 3VH4B 3IVFA 2GBRA 5L83A 1UGMA 3ZO5B 4AP4C 5J2RA 1NBFC 3AULA 3L17A 2FUHB 3A9JB 3QCAA 3ZDMC 2Z59B 3KVFB 5AZHA 2KQSA 5CHWA 3DOWA 3OLMD 3U8ZA 3H7SA 1RRBA 1RLFA 2J0JA 1SE9A 4WWOA 1E8WA 3W1SA 2ZPNA 4ZRJA 4E74A 2LXAA 2C7MB 2ZCCA 2O6VD 1P1AA 3HHMA 4XZ4A 2N7EA 4FLHA 2KTRA 3HIZA 2K8BA 2D2QA 1SGHA 3C0RB 4PS7A 4HPMB 3R7QA 4TQ1A 5J18A 4CO7A 2FCMA 4HXDA 4IG7B 4NAWA 2K6QA 2CHXA 4W9HA 1XD3B 4BBNC 2WWZA 4II2B 3T9LA 4GDKA 1WZ3A 4IUMB 3UIPB 2JT4B 4FJVB 3QJZA 1CMXB 1V5TA 3RT3B 3V6CB 3O65B 3ZRCA 1IYFA 4OVVA 2JXXA 4EUTA 1H4RA 3AXCA 4ICUA 2LGDA 3QWZB 4F8CB 2FCQA 2M0XA 2KQ7A 2NBUA 4KIKA 5J17A 1L2NA 4I6PA 3ZTCA 5EDSA 2MX2A 2CHZA 2PE9A 3ENEA 4NAWB 3B0AA 2KHWB 3MTNB 2G3QB 4YL8A 2WX0A 3ZNID 3HK0A 2O2VA 1TBEA 3QX1A 4GDKB 3ZNZB 5D94A 1L7YA 2ZJDA 5E6OA 3KUZA 3IFWB 2VRRB 5IAAC 5JH5C 3X23A 3TCAA 4ZRIA 3L10B 1WJNA 3N32A 4MGIE 3M62B 1UZXB 4IC7B 2FAZA 3JW0X 3AU5A 3TBLD 1Z2MA 2I1JA 2K6DB 4KDIC 1HE8A 3VQIA 2DZIA 5LXIB 2CKHB 2BYEA 1OGWA 4HWIB 1V86A 3NY5A 4K1RB 3VHTC 2FNJB 4GSWA 4KDLB 1NDDA 1WGRA 4ZDVA 2MBHA 2KDFB 2DAJA 3NZUA 2O6VA 1D3ZA 5D6JB 1V6EA 4JIOU 1GUAB 3QHTA 3SU8X 3TIXA 5KHQA 1I42A 3I3TB 2CR5A 1UD7A 1WRDB 4NNJB 4DHZE 1V2YA 2N4FA 4BKSD 4W9FA 3ZTDA 4NQKE 3R7RA 1E8ZA 3IBEA 4NJ6A 2L76A 3EECA 3TMPB 2O6VB 4EFOA 3PRZA 3MJWA 2KLCA 4GN1A 3A33B 4WWNA 5CHVC 2MP2B 4ICVA 3PRPB 3WAPA 2KTFA 2KFKB 3ML8A 2ASQA 4ASWC 4KSLC 2NVUI 3UINB 3WAMA 4DHZB 4PYUA 3ZRFA 2R2QA 2D07B 3VUXA 2AL6A 3QK0A 2D10A 4GXBA 2DENB 2DYMA 2KD0A 4GU2A 3DVGX 4DBGA 1XQQA 2J0KA 3A1QA 1YJ1A 2FIFA 4XC2A 5BO4B 4W9GA 3L54A 1P3QU 2IO0B 3A4RA 1WXVA 4TKNA 3V61A 1J0GA 1WI0A 4KZ0A 5G55A 4JLCA 4A3PA 1WIAA 2L05A 4AWJA 4MGYE 4B6WA 2MRPA 1J19A 1JRUA 2BYVE 2C60A 2K8CA 1OEYJ 1A5RA 1WJ6A 3L08A 1S1QB 2NBVB 2JF5A 3EHVA 1EO6A 1R4NI 2D3GA 4CHKA 1WJ4A 2JZZA 2MSED 2KC2A 3RZFA 2L7RA 2MCNB 3DVGY 1IPGA 1QZEA 1YX6B 3NOBA 4MELA 1EF5A 1GNUA 1Z5SB 2KMAA 3KH0A 2EMTA 2KX3A 3PLVA 2PJHA 5CHFA 3PT2B 2LD9A 1U4AA 4HVBA 2GBKA 2JPHA 4F7ZA 4IM3A 2KDIA 3PLUA 1H8CA 4OVUA 2MBOA 4G50A 3H1UA 4AUQC 1P9DU 1WGGA 2LGYA 4URKA 4BKSA 2C5LC 2RD0A 2WDTB 3OAWA 3QARA 4KSKC 4I6LB 1WJUA 3PHXB 2NS5A 3VUYA 1GC6A 4WQOB 1ISNA 1E8YA 1WGHA 3PZDA 5KHOA 1WX7A 2R2OA 4ANVA 2KLGA 2C7NB 2L8JA 1P0RA 3ZKJC
chains in the Genus database with same CATH superfamily
3AEAB 2BQQA 4JL9A 2WNMA 1TKYA 3BWUD 4WQMA 2NPTA 1JROA 1YIWA 3Q2AC 3VR9B 4W9CA 1GB4A 1FIQA 2EMSA 2QILA 1OQYA 1FMAD 1AWDA 3MC0B 3DHHC 3GP7A 3AE9B 4IWOA 5H92C 3U7DA 2JXTA 3AE2B 4KIKB 3DHGC 3AEFB 3Q8BA 4EZLA 2AEHA 3APDA 4USAA 3N9YC 5IN7A 1T3QA 1N61A 1ESFA 1TKGA 3MC8A 2IGDA 4RGNA 2L52A 4LJPB 2D3CA 1XLNA 1R4MI 4OZAA 5DPTA 2FE8A 2IBIB 3W2DA 3DVNU 3PHWB 4LNKA 2AX5A 1FD6A 4B0EA 1Q10A 4RF1A 2DHZA 3T3OA 4BOSC 1NI2A 3SHQA 3Q8FA 2CJOA 2ZVOA 2Z0DB 2M17A 2PE6B 1V1PA 2NMQA 2OJWA 3S2AA 2KK8A 2GMIC 1KRHA 1EWYC 1ZPSA 2HDEA 2WXHA 3W1YA 3ONSA 2INDC 3IT4B 3T3NA 1VZ7A 2Z0EB 5MPOA 2PPHA 3NHEB 3RYTA 1IP9A 2BWFA 2MBBB 2AWTA 1YD8U 3KW5B 4HJGE 1XLQA 2XK5A 2K3UA 1D5ZC 2KDMA 2G1EA 5C2TB 2N1WA 4HCNB 2QEJC 2V3SA 3JSVA 5FKAC 4KX6B 4WJNA 4DK5A 1R7SA 1Q0WB 4LNOA 2J0MA 3DBLI 2W3SA 4WAFA 2J42A 3V6EB 1TKEA 3LYYA 1VDVA 2WS3B 4FULA 1GB1A 4M0WB 2KWVB 2I38A 3LXFA 1TY2A 3ECIA 1SE4A 3QAQA 2HE7A 1RWSA 1JWMD 2QHOA 3ZYYX 1YQ4B 1DYQA 4TUUA 1AARA 2ZNVB 1YQBA 2LFIA 5AUIA 4BFRA 4N59A 1E7PB 4WH4A 2NPTB 1J7BA 2CU1A 2PMVA 3PSEB 3RUIB 4QAYA 4AJYB 2C7HA 2LUMA 3WAOA 1KFYB 1PDXA 1UBQA 2LZ6A 3BK2A 4IM2A 1T0YA 4GB9A 4C7ZA 1F1HA 1QOGA 3OJ3A 1WXAA 1SBBB 1WXMA 2BYFA 1X1MA 3AB5A 1WZ0A 1WFYA 2V4LA 1NEKB 5D7GA 1WGYA 2N9EB 1WSPA 4HPLB 1N6ZA 2FUG1 2W3RA 2N7DA 3PPAA 3PGEA 3U7ZA 2IY1B 3UQAA 2XN9C 3N1ZC 4CQNA 4BKGA 2I1KA 1IGCA 3CSTA 1GPXA 3DBSA 2M1MA 3MHSD 1E7UA 2IZVB 2KWCA 1L6VA 1V1PB 3M63B 4S0RA 1ZDVA 4BKTA 2K8HA 4BOZB 3TEWA 3SR6A 4GGQA 4RM9A 3TL5A 3WANA 1V49A 5H8YE 1N5XA 2D11A 4TSSA 1C79A 4RGOS 4K7SA 2HJ8A 3P1MA 1XCTL 2NCNA 1TJEA 2XK5B 1YJIA 2KXJA 3GE8C 1JWSD 4ACFA 3JSVB 1PGBA 1M94A 5FR6A 4A90A 4HJKA 2A5UA 1E8XA 2LXCA 1T0RC 4C7YA 1UGMA 1QOFA 3QCAA 4HRSA 3ZDMC 2KQSA 2M56B 2PLPA 2INNE 3DOWA 3U8ZA 1N63A 1RLFA 1VR9A 1E8WA 2G9HD 2IDYA 4B0MA 1DOXA 5T8IA 3P4PB 3HRDD 2K8BA 3BZDB 2FCMA 2K6QA 4W9HA 2RDBC 1ZXHA 2BS3B 3UIPB 1CMXB 1V5TA 3P4RB 3V6CB 3O65B 1E0ZA 1UWMA 3RN9C 2JXXA 1H4RA 4F8CB 4TMAB 3P4SB 1L2NA 2QDFA 4I6PA 4YL8A 2WX0A 4LLGM 1LO5D 4GDKB 4HROA 4N58A 2LGIA 3KUZA 3RNCC 3IFWB 3SFDB 3TCAA 1JWUD 4ZRIA 1JWBD 4YWGG 4IC7B 4LNIA 2I1JA 4L23A 2BW2A 5LXIB 1R4NB 2DZIA 4REZA 2JSVX 5EE9A 1WGRA 4NJCA 2DAJA 3NS1A 2LHEA 2O6VA 5TSSA 4P6VF 3GS2A 5KHQA 2X38A 1HA5A 2CR5A 1UD7A 1WRDB 4NNJB 3ZTDA 4H2AA 3I5JC 3GZNB 4NQKE 4AS1A 1E8ZA 2M0AA 3IBEA 2L76A 1WRIA 4EFOA 2KN4A 1AW7A 2K9XA 2JQRB 4OZCA 4A6QA 5CHVC 1V8CA 4P1BC 2NVUI 3ZRFA 3VUXA 3DVGX 4P1CC 1HXYD 3V61A 2SEBD 2GB1A 4DXFA 4MGYE 1ZOYB 1J19A 3MJ5A 1EO6A 4CHKA 1AYFA 1IPGA 2PIAA 4WURA 1C78A 1Z5SB 2DWQA 1SJED 2EMTA 3PLVA 4IM3A 1H8CA 3KQ4A 2MBOA 4G50A 5BMHA 3Q14C 2LGYA 4BKSA 3OAWA 3PHXB 1E9MA 1WX7A 4ANVA 4LNFA 1EU3A 5HG2A 3ZKJC 4MSQB 3PS6A 3TJPA 2DYOA 2J4XA 3BVZA 3CSFA 4D2KA 4B95A 4M8NA 3ZW3A 2PVOD 1I4RA 3DBHB 5E6PA 2KX0A 4KKIA 4ANUA 1KM7A 4MM3A 4PS3A 1RM6C 2DX5B 4XE0A 2Y5CA 3ZLZA 1KLUD 3DBRI 2E6XA 4ZYNA 3U30A 4A3OA 1QILA 1WF9A 2QIEB 2IPKD 5C23A 4G0NB 1FCCC 4DDGD 4X57B 3R2TA 2RMMA 3VVWB 4YXDB 2V4IB 5DCNA 1QF6A 3RZWC 4TQ0A 1TT5B 3UGBB 1SSNA 3BK1A 1TTNA 2WDVB 4K3CA 1K50A 4LJOB 4EE2A 3RNEC 2NR2A 1ET9A 3W5VB 2KDEB 3PREA 2UU7A 3WIMA 2N0SB 4CYEA 2QC8A 4K7UA 1L0YB 5D3IB 1FRRA 2KJRA 3VDZA 2JYTA 1WMHA 2KMMA 3AE3B 4J6IA 4DHJD 1WYWB 2ZW1A 1L6UA 1KOTA 3E56A 2KACA 5GXGB 1LFDA 2BWES 2RDHA 3Q69A 3ZQ4A 2ZCBA 2JZ3B 2WU2B 5DPWA 3AEGB 2IO3B 3P42A 2YLMA 1DGJA 2QMTA 2J52A 2KJHB 4A9AA 4HDQA 4NY0A 3U2SC 3ZNGC 4MGKE 1ROEA 4WWMA 2KKCA 4MACA 1HZ6A 2BKRB 3RD2A 2W54A 2IYDB 5E6NA 3AI5A 2BVCA 2KO3A 3VFKA 1KLGD 3H7PB 5BYRA 2KDBA 2LUEA 4DXGA 4RFBA 1C3TA 3UI3A 2ACZB 2FIDA 2IO1B 2ZEQA 3ETRA 4EZKA 4W9JA 2BS2B 3DQVA 2CHWA 3I57A 4MEMA 3MP9A 3K9OB 1SE3A 1V80A 4BZAA 3OJ4B 2MLBA 4RM8A 2CS4A 4ZRPA 1WX8A 1Y56A 3ZUNA 1WM2A 3AU4A 4XWTA 1E90A 1WY8A 4ANXA 2IGGA 2WDQB 1YJJA 1BUIC 3RCZA 2WYQA 5AZFA 3BYTB 5LXHA 2UYZB 4MM3B 3RI7C 1ZUD2 4IOIE 1F9JA 4L2YA 1E7VA 1EM7A 4LDTB 2G4SA 3L0WB 2KANA 1M4VA 1JWAD 4P7IA 5AZGA 2J53A 1FNUA 2K25A 1GC7A 3HUIA 2N9XA 3QIJA 1XLOA 2IY0B 3NG0A 2ZPYA 1Q5WB 1I4XA 5AUKA 4FHJA 5HI1A 4M00A 5BMIA 3H8HA 1XF5L 3PZ7A 4W9EA 2K22A 2KWUB 3RNFC 1L4DB 1D5MC 4S17A 1IBXA 3NRZA 3NVVA 2LASA 1CZPA 1VD2A 4EEWA 2GBJA 2JRIB 2KFKA 1LGRA 4AJWA 4US9A 1WMHB 2SAKA 1QOBA 4WAAA 2OOBB 2VZKD 3NVWA 2EKIA 1ACCA 3KYCD 2ZNVC 3QA8A 2BKFA 2KVRA 3L13A 4FHKA 1YN3A 2WU5B 1YX5B 1EUVB 2N1VA 2WXPA 4FJZA 1ZXIA 1FEHA 5EE0A 1OQQA 2OEDA 5HKHA 3P2BA 3M95A 1HZ5A 1HTOA 2BB6A 1ZP0B 2IJ0A 2D3AA 4K7WA 3T8MA 1J8CA 3U52E 4E3CA 3BYYB 5LLIA 3VH4B 3NZSA 4LCDE 3DPDA 5L83A 2AQ1B 4AP4C 1FNVA 1NBFC 1HQRD 1C77A 4FXCA 4WWOA 1K52A 3W1SA 2ZPNA 4E74A 2LXAA 2ZCCA 2O6VD 3FKYA 4XZ4A 4FLHA 2D3BA 2D2QA 1STEA 5J18A 4IG7B 2GLSA 2WWZA 2JWUA 3DWMA 4GDKA 1MFWA 2JT4B 4FJVB 3RT3B 3I63C 4EUTA 2N7JA 5J17A 2FCQA 2NBUA 2NTTA 2R61A 3ZXRA 2KHWB 2G3QB 3HK0A 5E6JA 3BVGA 5D94A 1L7YA 3AM9A 1PGXA 1K53A 5E6OA 3ZJTA 5BYSA 3X23A 5EE1A 2QCZA 1WJNA 3N32A 3M62B 3EFCA 2FAZA 3JW0X 3TBLD 1SIJA 4KDIC 1HE8A 2BYEA 4HWIB 1SJHD 3VHTC 1JCKB 3AV8A 1XO3A 4GSWA 4KDLB 1NDDA 4ZDVA 2MBHA 2KDFB 3GB1A 4P16A 1D3ZA 1QQRA 4JIOU 4XYCA 4DHZE 4BKSD 2N4FA 4W9FA 3HVDA 4NJ6A 1CQVA 2WXKA 3TMPB 1IBXB 3PRZA 1RFKA 3A33B 3L4PA 2KFKB 4ASWC 1NENB 4PYUA 5JXVA 2DYMA 2KD0A 1FO4A 2RPVA 2WXGA 5BO4B 3L54A 1P3QU 2INPE 4TKNA 3TSSA 2BBCA 3P4QB 1WI0A 2BT6A 4B6WA 4YTPB 1JRUA 1OEYJ 3L08A 1QKZA 2ICIA 2JF5A 1R4NI 2D3GA 1WJ4A 2KC2A 3RZFA 2L7RA 2MCNB 2VH1A 1QZEA 3GE3C 2LEKA 3IAM1 1B1ZA 4HKQA 4YSYB 2LD9A 1U4AA 4HVBA 2GBKA 2JPHA 3PLUA 4RCOA 1VLBA 2CU3A 2V3PA 4URKA 2V3NA 2RD0A 2WDTB 2OHFA 1QOAA 2NS5A 1ISNA 1WGHA 2L8JA 2BF8B 3MC9A 3Q8CA 4B9KA 1OEYA 1WR1A 2L32A 2DZKA 3VTUA 3NZ3A 4GMVA 2LGXA 3V62A 5IA7A 1UF0A 2H88B 2DAFA 4DWFA 4KV2A 3ML9A 1A70A 3PVLA 1NVID 1BT0A 3APFA 4G3XB 1UUPA 2BPSA 4NQLB 1UELA 2ONQA 1ZE3D 2Y5PA 3R3MA 3RNGC 4WJQA 1T0SC 4HPPA 3WA0A 3Q3JA 4EZJA 2MHJA 1YN5A 4RGMA 4ARCA 1N5WA 1KJTA 2WXRA 3A9KB 4ARIA 1KH0A 3D32A 3FAHA 2HTHA 4HK2A 4OW0A 1GJZA 3IHPC 1JALA 3QC8B 5JZEB 4FADA 4PK1A 2RSUA 1YMHE 2MH7A 1ZKHA 4F1SA 2NTSA 2L3ZA 4YTNB 2JVCA 3PRMB 2M4NA 4RF0A 3SEBA 3Q3MC 4W9LA 4MJSB 1NI3A 1I35A 2Y5BB 2AL3A 1PUTA 4JWUC 4IW0A 1QLBB 3LB8C 4JGHB 5JHBA 3H7PA 4LTUA 3H9DA 3ABVB 2MQJA 2RPQA 1WGDA 3IG3A 3L16A 1SIFA 4C4VA 2L0TA 1K8RB 2PEAA 1J7AA 1HEZE 1Q1OA 1WX9A 3AN1A 1FXAA 3A9JA 2Z8LA 2BGFA 2KAJA 1VCBA 3B2GA 2LVQA 3ZJUA 2ON8A 1N60A 4ZRKA 1XT9B 4HLEA 3W9CB 5IP4D 4IWQA 3AE8B 5G5HA 2KN5A 3R66C 3TEZA 4ZYSA 3SDLC 2JY6A 1WH3A 5JHAA 1LM8B 2LMCA 4PYZA 4KVGB 4FN2A 2LHDA 3KLSX 4R3DA 1LXDA 4OHJA 1JW9D 1C1YB 5C1ZA 2RR9A 1WE6A 1CJEA 2GBMA 3UF8A 2WXJA 3DDCB 3N1XC 2DYBA 2DZMA 1F77A 4NJ7A 4MDKE 2N9KA 4JQWC 1V81A 2KJ6A 3B2FA 5EE3A 1P98A 2C9WB 3LJ3A 2H89B 3PV1A 2DNFA 1KF6B 2XBBC 3EC8A 4YSXB 2GBNA 2UWQA 2GI9A 2L83A 2LVOA 4GOCA 4HEA1 1GOZA 1TS2A 3RULA 2LRUA 3DVNV 2KOXA 3JYUA 4FBJB 2JWZA 1V5OA 2HD5B 3Q8AA 2IGHA 3NUHB 3OWEB 4JPSA 2DZJA 3VTWA 2V1YA 1T0QC 3VH3B 4HDOA 3M3JA 2KMCA 1FFVA 2FCNA 4RNAA 1E6EB 4C56C 1BXTA 2JX5A 4TV3A 3X0WA 3VAWA 2J7QB 3DHIC 3RNAC 3WALA 4KGSA 2BS4B 2PTLA 3B08A 3N3KB 4W9KA 1KLVA 4AOFA 1HTQA 2N9PC 1Y8RC 2G45B 1RYJA 1ZDXA 1FXIA 4RMAA 2YVCA 5IKCM 1V1OA 4YSZB 1UBIA 2KZRA 3DBRB 2WXNA 2INCC 3NJTA 2YEPB 4BBNF 2AYOB 1RAXA 3HM6X 4II3B 3NVZA 4MGZE 3WCQA 4C4VB 1MG4A 1VZ6A 2PVGC 1E10A 3ZO5B 3BIID 3L17A 2FUHB 3A9JB 2Z59B 2BYTA 1C4CA 3AE7B 4MT5A 3OLMD 1XEEA 3H7SA 1RRBA 2J0JA 3RMKC 1SXTA 1P1AA 2WXQA 3NVYA 2HTME 2N7EA 2KTRA 3R7QA 1I4HA 2MJEA 4CO7A 1XD3B 3AE4B 2YEPF 3T9LA 4IUMB 1IYFA 3QJZA 3DWGC 3ZRCA 4OVVA 3AXCA 4ICUA 3QWZB 2KQ7A 3ZTCA 2MX2A 4NAWB 3OG5A 3ZNID 2O2VA 1TBEA 1PFDA 2ZJDA 1OQRA 3O13A 5JH5C 1GAQB 1JQ4A 3ZXVA 3MFGA 3AU5A 1ET6A 2K6DB 1IUEA 2VH2A 2CKHB 3NY5A 4K1RB 1TIFA 2FNJB 1J7CA 3J9CA 3HVZA 2KWDA 3Q3OC 4ZRQA 2N9LA 3QHTA 1NYRA 1I42A 1I4QA 1MPEA 3I3TB 1V2YA 3R7RA 3MJWA 2KLCA 4GN1A 3R8BA 3VR8B 4ICVA 2KTFA 4NZLB 1N62A 4DHZB 1WGKA 2D07B 3QK0A 2D10A 2DENB 4GU2A 1XQQA 2J0KA 3A1QA 1YJ1A 1T5XD 2FIFA 3I9V1 2IO0B 3A4RA 4XWWA 1WXVA 3P63A 1EWCA 5G55A 4A3PA 2L05A 4AWJA 2MRPA 1A5RA 5C3JB 2NBVB 2QSDA 4LK0M 2WGSA 1YX6B 3DVGY 4MELA 1EF5A 1NYQA 2KX3A 2WXOA 4N6EB 2WXLA 3ZGZA 4L1BA 4F7ZA 1R4MB 5FR3A 2CJNA 3URYA 4AUQC 1WGGA 4RGTA 3QARA 1XLPA 1WJUA 1GC6A 1WWTA 1YQ3B 2PW9A 2KQ4X 4NAMA 5KHOA 2R2OA 3PZ8A 4K3BA 2KLGA 4ZHPA 1P0RA 5D3DA 1FRDA 5G5GA 2G4DB 4RH6A 1I4PA 4US8A 1SE2A 2LJ5A 2K5PA 3A4SC 2REXA 2KTRB 3BINA 2K39A 4EKUA 1EU4A 1GG3A 5TR5A 1FM0D 1V97A 4IDIA 1UH6A 1MHXA 4LNNA 4GIVA 4BVUC 2L00B 1BMLC 4DXAB 2JU6X 3Q6BA 2JYEA 3B1LX 2ZZPB 2O2VB 3A9KA 4A20A 1QT9A 4EOYA 4ZOHC 3JVZX 2A4ZA 1DOYA 2AQ3B 3EGRA 1IGDA 2DBYA 1FCLA 2LRWA 2EKEC 1VJKA 3AEDB 2WX1A 3DBLB 1SF0A 3IAS1 2FCSA 4C80A 1ZW7A 3KYDD 3UQBA 3E9SA 4WJPA 1VZ8A 3K9PB 3ZVVA 1CK1A 1UWXA 3AEEB 3TEXA 4MJSA 5FK9C 3VTVA 1L0XB 3KWLA 4M8MA 2D5GA 2LJIA 4GDLA 3AMZA 2W9NA 3BVMA 3BY4B 3ZIMA 4IM0A 3W1SC 1YNTE 4JE3B 1L4ZB 2M8SA 4Q2JA 4LDTD 1KTKA 2GOWA 1F52A 2ZVNA 2WXIA 3A1QB 3AH7A 4DQOC 1E5WA 2JUOA 1L0VB 3R2IA 1S3SG 2EELA 3AE6B 4ZHOA 1TGZB 5DPSA 3PO0A 3H6NA 2B3AA 3CF6E 4I6NB 1P7FA 3CMMB 1PGAA 4FA6A 2V0GA 1FNWA 4XDDA 3SFEB 4PS8A 4JWSC 3VRBB 3GZNI 3ZDTA 3AEBB 4UDUC 2BB5A 5L95C 2MWSB 4HCPB 1WM3A 2WDRB 2WXFA 4KGRA 2ZW0A 2I2YA 2XEWA 1MI0A 4O1NA 1WE7A 2LI5A 4W9DA 4KKJA 5CTRC 2WP9B 5DPRA 4ANWA 4DHJB 1LQBA 4G11A 4YT0B 2M19A 2LGSA 3N20C 5GMVA 1JMLA 3DCGA 3AE1B 1XCQL 2E3TA 2KC1A 1F2RI 3LDZE 2K0PA 3AECB 4MSMB 2V9HA 4XGAB 2MJ3A 3Q3NC 1TZOA 2JRHA 1WXQA 3NS8A 1G6JA 3HM3A 4WWPA 1ZGUB 2MW5A 1I4GA 1T6BX 2WHIA 3SD5A 1C4PA 2IO2B 1FPYA 1F2RC 2LWPA 1WR6E 1P7EA 3PTFC 4IWPA 3TUOA 5AEKB 1YN4A 1D4BA 1TZ1A 1YOVB 5BMGA 5G2NA 4DDID 4K81A 4W9IA 3UIOB 2TSSA 5CX3A 1V9JA 1TY0A 2W82A 3ALBA 1F0ZA 3VUWA 3IT6B 3N30A 4YTMB 3RFZB 1ENFA 5D2MB 3DBHI 4JX1C 2MBQA 3KUCB 2MP2A 4FJYA 3EUB2 3AE5B 2LVPA 1MG8A 3V60A 1PQSA 1EF1A 1WXSA 3GOEA 1WYGA 3VXWA 1C76A 5HHDG 3ZNHB 3Q3FA 4GDLB 4MH0E 4KZCA 4BAXA 2KFJA 3V05A 5BYQA 2KNBA 2RGFA 3APCA 4N9F4 4PT5A 3FILA 3QQ8B 4WJOA 4XX5A 3TEYA 4E71A 1AN8A 1I7HA 3B9JA 2K1FA 2DLBA 3EFUA 2Q5WD 1RFAA 1OTRB 4NPNA 3KUDB 2NBWB 3RPFC 2OJRA 2MBEA 3RNBC 3VRAB 1FXTB 2JZPA 2MA9B 2L0FA 2X8XX 3IVFA 2GBRA 1DOIA 3U4EG 5J2RA 3AULA 1UNSA 2GRIA 3KVFB 5AZHA 2MJDA 1SB3C 5CHWA 4XDCA 1MJDA 5IO9A 1SE9A 2WXMA 5LNK1 4ZRJA 2C7MB 2KVZA 3HHMA 3HIZA 1SGHA 3C0RB 4PS7A 4HPMB 4C00A 4TQ1A 5I4DA 4HXDA 4NAWA 2CHXA 4BBNC 4II2B 1WZ3A 4M02A 3CIRB 2LGDA 4AQ7A 2M0XA 3KWVA 4KIKA 2VZKB 2PKOA 1PYWD 5EDSA 2CHZA 2PE9A 3ENEA 3B0AA 3MTNB 1UGJA 2WLBA 3QX1A 3ZNZB 5HFYA 2WQYB 4J3OD 2VRRB 5IAAC 1C4AA 3C8YA 3L10B 1B9RA 1JRPA 2AQ2B 4MGIE 1UZXB 1TS5A 1Z2MA 2XNAC 3VQIA 4MH8A 1OGWA 1V86A 3N1YC 3ZJVA 4IKGA 2QJLA 3V3XA 4WIPA 4OZBA 2Y3AA 3Q8EA 1FFUA 3NZUA 1SEBD 1VRAB 1TS3A 1L5PA 5D6JB 1V6EA 1GUAB 3SU8X 3TIXA 1C9FA 1D6EC 4ITKA 2W55A 3C19A 3EECA 3MHZA 2O6VB 2KT7A 4WWNA 2MP2B 3PRPB 3WAPA 3ML8A 2ASQA 4KSLC 3UINB 3WAMA 2R2QA 4HKZE 2AL6A 4GXBA 1XXGA 2KYWA 4DBGA 3CWIA 4XC2A 2L1AA 2B76B 4W9GA 1TYGB 4KGTA 1J0GA 1TS4A 4KZ0A 4JLCA 1WIAA 1K51A 4A8XC 2BYVE 2C60A 1MHHE 2K8CA 2MEKA 1WJ6A 1S1QB 3FILB 3IXSA 2FBWB 1MVKA 3EHVA 2JZZA 2MSED 4GLSC 3FC4A 3NOBA 1GNUA 2KMAA 3KH0A 2PJHA 5CHFA 3PT2B 4M0WA 2KDIA 4OVUA 3H1UA 1P9DU 4A55A 2HJ1A 2C5LC 3EA6A 4KSKC 3W5UB 4OVZA 4I6LB 2BTEA 3VUYA 4WQOB 5IOIA 1E8YA 1D5XC 3PZDA 1OFFA 2C7NB 2RDGA 4M01A
chains in the Genus database with same CATH topology
2BF8B 4MSQB 3PS6A 3TJPA 4JL9A 4B9KA 2G4DB 1OEYA 1WR1A 2DZKA 2LJ5A 3VTUA 2DYOA 2NPTA 1YIWA 3A4SC 3CSFA 4W9CA 2REXA 2KTRB 4GMVA 3BINA 2K39A 4B95A 4EKUA 2LGXA 4M8NA 2EMSA 3V62A 3ZW3A 1OQYA 5E6PA 1GG3A 2KX0A 5IA7A 5TR5A 4ANUA 1KM7A 4MM3A 4PS3A 2DX5B 2DAFA 3ZLZA 3DBRI 4ZYNA 1UH6A 3U30A 4A3OA 4DWFA 4GIVA 4KV2A 1WF9A 4IWOA 4BVUC 2L00B 3ML9A 4DXAB 3PVLA 5C23A 1BT0A 4G0NB 4DDGD 3U7DA 3APFA 4X57B 4G3XB 3B1LX 2BPSA 4NQLB 4KIKB 2ZZPB 1UELA 3VVWB 2AEHA 4EZLA 3APDA 3R3MA 2O2VB 4WJQA 3A9KA 4A20A 3WA0A 4EOYA 3Q3JA 3JVZX 4EZJA 5DCNA 2A4ZA 4LJPB 3RZWC 4TQ0A 3UGBB 1R4MI 1TTNA 5DPTA 2IBIB 2LRWA 1KJTA 3DVNU 2EKEC 3PHWB 3A9KB 4LJOB 2WX1A 3D32A 2FCSA 4HK2A 2HTHA 1ZW7A 2NR2A 1GJZA 3IHPC 2KDEB 3KYDD 2DHZA 3PREA 3UQBA 3WIMA 4BOSC 3QC8B 1NI2A 5JZEB 4WJPA 4FADA 4CYEA 3K9PB 3ZVVA 3SHQA 4K7UA 2RSUA 2KJRA 2ZVOA 3VDZA 2Z0DB 1ZKHA 2M17A 4F1SA 1WMHA 2PE6B 2L3ZA 4MJSA 3S2AA 3VTVA 2KK8A 4J6IA 4DHJD 2GMIC 4M8MA 2JVCA 3PRMB 2M4NA 1WYWB 4GDLA 3W1YA 1KOTA 2W9NA 3ONSA 4W9LA 1LFDA 2BWES 3BY4B 3ZIMA 4IM0A 4MJSB 2Z0EB 3W1SC 1I35A 2PPHA 3NHEB 2ZCBA 2Y5BB 2JZ3B 2AL3A 5DPWA 3RYTA 1IP9A 2M8SA 2BWFA 2IO3B 2MBBB 2AWTA 1YD8U 2YLMA 4IW0A 3KW5B 4LDTD 2KJHB 4JGHB 2GOWA 2ZVNA 3A1QB 2XK5A 5JHBA 3H7PA 1E5WA 4HDQA 4NY0A 3H9DA 3ZNGC 2JUOA 4MGKE 2MQJA 2KKCA 2RPQA 1S3SG 1WGDA 2N1WA 2V3SA 3IG3A 4HCNB 1TGZB 3JSVA 3L16A 5DPSA 2BKRB 3RD2A 1SIFA 4WJNA 3H6NA 4DK5A 2IYDB 2L0TA 1Q0WB 5E6NA 2B3AA 3AI5A 2KO3A 1K8RB 2PEAA 2J0MA 3CF6E 3DBLI 3CMMB 3H7PB 4I6NB 3VFKA 1Q1OA 1WX9A 4FA6A 3A9JA 2KDBA 2BGFA 2LUEA 4PS8A 1C3TA 1VCBA 2FIDA 2IO1B 2ZEQA 2LVQA 4EZKA 3GZNI 3ZDTA 4W9JA 3V6EB 3DQVA 4FULA 2CHWA 4MEMA 4ZRKA 1XT9B 4M0WB 4HLEA 2KWVB 4IWQA 2MWSB 5L95C 4HCPB 3K9OB 3ECIA 1V80A 1WM3A 2KN5A 3R66C 3QAQA 2HE7A 3OJ4B 2JY6A 1WH3A 3SDLC 2MLBA 5JHAA 4RM8A 2CS4A 1LM8B 2QHOA 4PYZA 4KVGB 2XEWA 4TUUA 4FN2A 1WX8A 3ZUNA 1WE7A 2LI5A 1AARA 1WM2A 4W9DA 2ZNVB 1YQBA 1LXDA 5CTRC 3AU4A 5DPRA 4BFRA 4ANWA 4DHJB 1LQBA 1E90A 1WY8A 1C1YB 4ANXA 4G11A 5C1ZA 2RR9A 1WE6A 2NPTB 2GBMA 2CU1A 5GMVA 3RCZA 3PSEB 3RUIB 3UF8A 3DCGA 3DDCB 2C7HA 4AJYB 2DYBA 2WYQA 2DZMA 2KC1A 4NJ7A 5AZFA 3LDZE 3WAOA 4MDKE 4MSMB 2UYZB 5LXHA 1F9JA 1E7VA 1UBQA 2LZ6A 1V81A 2KJ6A 2JRHA 4JQWC 4LDTB 2G4SA 1P98A 3L0WB 3NS8A 4IM2A 1G6JA 2C9WB 1T0YA 4GB9A 3HM3A 3LJ3A 2KANA 4WWPA 1ZGUB 2MW5A 3PV1A 3OJ3A 4P7IA 1WXAA 5AZGA 1WXMA 2BYFA 3EC8A 2IO2B 2K25A 2XBBC 3SD5A 1GC7A 1X1MA 2N9XA 2GBNA 3QIJA 2UWQA 4HDOA 2LVOA 2LWPA 1WZ0A 4GOCA 2IY0B 2ZPYA 1Q5WB 1WR6E 1WFYA 2V4LA 3PTFC 4IWPA 5AEKB 4FHJA 5D7GA 3RULA 1WGYA 2LRUA 1TZ1A 2N9EB 3DVNV 4HPLB 5G2NA 4DDID 2KOXA 3JYUA 4K81A 4W9IA 2JWZA 2N7DA 5CX3A 3UIOB 4FBJB 1V9JA 3ALBA 3PPAA 4W9EA 3PGEA 1V5OA 2IY1B 3UQAA 2KWUB 3VUWA 2HD5B 3N30A 4BKGA 2DZJA 3VTWA 2V1YA 2I1KA 3VH3B 2LASA 5D2MB 3DBHI 3CSTA 1VD2A 2MBQA 3DBSA 2MP2A 3KUCB 2M1MA 3M3JA 4FJYA 2GBJA 2JRIB 2KFKA 4EEWA 2KMCA 3MHSD 1E7UA 2FCNA 2IZVB 4AJWA 2KWCA 1WMHB 2LVPA 1MG8A 3V60A 3M63B 4TV3A 3X0WA 3VAWA 2J7QB 1PQSA 4WAAA 4BKTA 2K8HA 1EF1A 4BOZB 2OOBB 3WALA 1WXSA 4GGQA 3GOEA 3B08A 3N3KB 4RM9A 4W9KA 3TL5A 1V49A 3VXWA 3WANA 3ZNHB 3Q3FA 2D11A 4GDLB 4KZCA 4MH0E 1KLVA 3KYCD 2ZNVC 3QA8A 2BKFA 2KVRA 3L13A 4FHKA 2KFJA 4K7SA 2HJ8A 1YX5B 4AOFA 1EUVB 2N1VA 1Y8RC 2G45B 2N9PC 2KNBA 2RGFA 3APCA 4FJZA 4N9F4 2NCNA 4RMAA 2YVCA 3QQ8B 4WJOA 1UBIA 2KZRA 4XX5A 2XK5B 2KXJA 5HKHA 4E71A 4BBNF 2K1FA 3P2BA 2AYOB 3M95A 1RAXA 3JSVB 3HM6X 3EFUA 4II3B 3T8MA 4K7WA 1J8CA 4MGZE 1RFAA 1OTRB 4NPNA 1M94A 3KUDB 5FR6A 2NBWB 4HJKA 4E3CA 2OJRA 2MBEA 5LLIA 1FXTB 2A5UA 1E8XA 2LXCA 2MA9B 3NZSA 4LCDE 3DPDA 2L0FA 3VH4B 3IVFA 2GBRA 5L83A 1UGMA 3ZO5B 4AP4C 5J2RA 1NBFC 3AULA 3L17A 2FUHB 3A9JB 3QCAA 3ZDMC 2Z59B 3KVFB 5AZHA 2KQSA 5CHWA 3DOWA 3OLMD 3U8ZA 3H7SA 1RRBA 1RLFA 2J0JA 1SE9A 4WWOA 1E8WA 3W1SA 2ZPNA 4ZRJA 4E74A 2LXAA 2C7MB 2ZCCA 2O6VD 1P1AA 3HHMA 4XZ4A 2N7EA 4FLHA 2KTRA 3HIZA 2K8BA 2D2QA 1SGHA 3C0RB 4PS7A 4HPMB 3R7QA 4TQ1A 5J18A 4CO7A 2FCMA 4HXDA 4IG7B 4NAWA 2K6QA 2CHXA 4W9HA 1XD3B 4BBNC 2WWZA 4II2B 3T9LA 4GDKA 1WZ3A 4IUMB 3UIPB 2JT4B 4FJVB 3QJZA 1CMXB 1V5TA 3RT3B 3V6CB 3O65B 3ZRCA 1IYFA 4OVVA 2JXXA 4EUTA 1H4RA 3AXCA 4ICUA 2LGDA 3QWZB 4F8CB 2FCQA 2M0XA 2KQ7A 2NBUA 4KIKA 5J17A 1L2NA 4I6PA 3ZTCA 5EDSA 2MX2A 2CHZA 2PE9A 3ENEA 4NAWB 3B0AA 2KHWB 3MTNB 2G3QB 4YL8A 2WX0A 3ZNID 3HK0A 2O2VA 1TBEA 3QX1A 4GDKB 3ZNZB 5D94A 1L7YA 2ZJDA 5E6OA 3KUZA 3IFWB 2VRRB 5IAAC 5JH5C 3X23A 3TCAA 4ZRIA 3L10B 1WJNA 3N32A 4MGIE 3M62B 1UZXB 4IC7B 2FAZA 3JW0X 3AU5A 3TBLD 1Z2MA 2I1JA 2K6DB 4KDIC 1HE8A 3VQIA 2DZIA 5LXIB 2CKHB 2BYEA 1OGWA 4HWIB 1V86A 3NY5A 4K1RB 3VHTC 2FNJB 4GSWA 4KDLB 1NDDA 1WGRA 4ZDVA 2MBHA 2KDFB 2DAJA 3NZUA 2O6VA 1D3ZA 5D6JB 1V6EA 4JIOU 1GUAB 3QHTA 3SU8X 3TIXA 5KHQA 1I42A 3I3TB 2CR5A 1UD7A 1WRDB 4NNJB 4DHZE 1V2YA 2N4FA 4BKSD 4W9FA 3ZTDA 4NQKE 3R7RA 1E8ZA 3IBEA 4NJ6A 2L76A 3EECA 3TMPB 2O6VB 4EFOA 3PRZA 3MJWA 2KLCA 4GN1A 3A33B 4WWNA 5CHVC 2MP2B 4ICVA 3PRPB 3WAPA 2KTFA 2KFKB 3ML8A 2ASQA 4ASWC 4KSLC 2NVUI 3UINB 3WAMA 4DHZB 4PYUA 3ZRFA 2R2QA 2D07B 3VUXA 2AL6A 3QK0A 2D10A 4GXBA 2DENB 2DYMA 2KD0A 4GU2A 3DVGX 4DBGA 1XQQA 2J0KA 3A1QA 1YJ1A 2FIFA 4XC2A 5BO4B 4W9GA 3L54A 1P3QU 2IO0B 3A4RA 1WXVA 4TKNA 3V61A 1J0GA 1WI0A 4KZ0A 5G55A 4JLCA 4A3PA 1WIAA 2L05A 4AWJA 4MGYE 4B6WA 2MRPA 1J19A 1JRUA 2BYVE 2C60A 2K8CA 1OEYJ 1A5RA 1WJ6A 3L08A 1S1QB 2NBVB 2JF5A 3EHVA 1EO6A 1R4NI 2D3GA 4CHKA 1WJ4A 2JZZA 2MSED 2KC2A 3RZFA 2L7RA 2MCNB 3DVGY 1IPGA 1QZEA 1YX6B 3NOBA 4MELA 1EF5A 1GNUA 1Z5SB 2KMAA 3KH0A 2EMTA 2KX3A 3PLVA 2PJHA 5CHFA 3PT2B 2LD9A 1U4AA 4HVBA 2GBKA 2JPHA 4F7ZA 4IM3A 2KDIA 3PLUA 1H8CA 4OVUA 2MBOA 4G50A 3H1UA 4AUQC 1P9DU 1WGGA 2LGYA 4URKA 4BKSA 2C5LC 2RD0A 2WDTB 3OAWA 3QARA 4KSKC 4I6LB 1WJUA 3PHXB 2NS5A 3VUYA 1GC6A 4WQOB 1ISNA 1E8YA 1WGHA 3PZDA 5KHOA 1WX7A 2R2OA 4ANVA 2KLGA 2C7NB 2L8JA 1P0RA 3ZKJC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BF8 B;  4MSQ B;  3PS6 A;  3TJP A;  4JL9 A;  4B9K A;  2G4D B;  1OEY A;  1WR1 A;  2DZK A;  2LJ5 A;  3VTU A;  2DYO A;  2NPT A;  1YIW A;  3A4S C;  3CSF A;  4W9C A;  2REX A;  2KTR B;  4GMV A;  3BIN A;  2K39 A;  4B95 A;  4EKU A;  2LGX A;  4M8N A;  2EMS A;  3V62 A;  3ZW3 A;  1OQY A;  5E6P A;  1GG3 A;  2KX0 A;  5IA7 A;  5TR5 A;  4ANU A;  1KM7 A;  4MM3 A;  4PS3 A;  2DX5 B;  2DAF A;  3ZLZ A;  3DBR I;  4ZYN A;  1UH6 A;  3U30 A;  4A3O A;  4DWF A;  4GIV A;  4KV2 A;  1WF9 A;  4IWO A;  4BVU C;  2L00 B;  3ML9 A;  4DXA B;  3PVL A;  5C23 A;  1BT0 A;  4G0N B;  4DDG D;  3U7D A;  3APF A;  4X57 B;  4G3X B;  3B1L X;  2BPS A;  4NQL B;  4KIK B;  2ZZP B;  1UEL A;  3VVW B;  2AEH A;  4EZL A;  3APD A;  3R3M A;  2O2V B;  4WJQ A;  3A9K A;  4A20 A;  3WA0 A;  4EOY A;  3Q3J A;  3JVZ X;  4EZJ A;  5DCN A;  2A4Z A;  4LJP B;  3RZW C;  4TQ0 A;  3UGB B;  1R4M I;  1TTN A;  5DPT A;  2IBI B;  2LRW A;  1KJT A;  3DVN U;  2EKE C;  3PHW B;  3A9K B;  4LJO B;  2WX1 A;  3D32 A;  2FCS A;  4HK2 A;  2HTH A;  1ZW7 A;  2NR2 A;  1GJZ A;  3IHP C;  2KDE B;  3KYD D;  2DHZ A;  3PRE A;  3UQB A;  3WIM A;  4BOS C;  3QC8 B;  1NI2 A;  5JZE B;  4WJP A;  4FAD A;  4CYE A;  3K9P B;  3ZVV A;  3SHQ A;  4K7U A;  2RSU A;  2KJR A;  2ZVO A;  3VDZ A;  2Z0D B;  1ZKH A;  2M17 A;  4F1S A;  1WMH A;  2PE6 B;  2L3Z A;  4MJS A;  3S2A A;  3VTV A;  2KK8 A;  4J6I A;  4DHJ D;  2GMI C;  4M8M A;  2JVC A;  3PRM B;  2M4N A;  1WYW B;  4GDL A;  3W1Y A;  1KOT A;  2W9N A;  3ONS A;  4W9L A;  1LFD A;  2BWE S;  3BY4 B;  3ZIM A;  4IM0 A;  4MJS B;  2Z0E B;  3W1S C;  1I35 A;  2PPH A;  3NHE B;  2ZCB A;  2Y5B B;  2JZ3 B;  2AL3 A;  5DPW A;  3RYT A;  1IP9 A;  2M8S A;  2BWF A;  2IO3 B;  2MBB B;  2AWT A;  1YD8 U;  2YLM A;  4IW0 A;  3KW5 B;  4LDT D;  2KJH B;  4JGH B;  2GOW A;  2ZVN A;  3A1Q B;  2XK5 A;  5JHB A;  3H7P A;  1E5W A;  4HDQ A;  4NY0 A;  3H9D A;  3ZNG C;  2JUO A;  4MGK E;  2MQJ A;  2KKC A;  2RPQ A;  1S3S G;  1WGD A;  2N1W A;  2V3S A;  3IG3 A;  4HCN B;  1TGZ B;  3JSV A;  3L16 A;  5DPS A;  2BKR B;  3RD2 A;  1SIF A;  4WJN A;  3H6N A;  4DK5 A;  2IYD B;  2L0T A;  1Q0W B;  5E6N A;  2B3A A;  3AI5 A;  2KO3 A;  1K8R B;  2PEA A;  2J0M A;  3CF6 E;  3DBL I;  3CMM B;  3H7P B;  4I6N B;  3VFK A;  1Q1O A;  1WX9 A;  4FA6 A;  3A9J A;  2KDB A;  2BGF A;  2LUE A;  4PS8 A;  1C3T A;  1VCB A;  2FID A;  2IO1 B;  2ZEQ A;  2LVQ A;  4EZK A;  3GZN I;  3ZDT A;  4W9J A;  3V6E B;  3DQV A;  4FUL A;  2CHW A;  4MEM A;  4ZRK A;  1XT9 B;  4M0W B;  4HLE A;  2KWV B;  4IWQ A;  2MWS B;  5L95 C;  4HCP B;  3K9O B;  3ECI A;  1V80 A;  1WM3 A;  2KN5 A;  3R66 C;  3QAQ A;  2HE7 A;  3OJ4 B;  2JY6 A;  1WH3 A;  3SDL C;  2MLB A;  5JHA A;  4RM8 A;  2CS4 A;  1LM8 B;  2QHO A;  4PYZ A;  4KVG B;  2XEW A;  4TUU A;  4FN2 A;  1WX8 A;  3ZUN A;  1WE7 A;  2LI5 A;  1AAR A;  1WM2 A;  4W9D A;  2ZNV B;  1YQB A;  1LXD A;  5CTR C;  3AU4 A;  5DPR A;  4BFR A;  4ANW A;  4DHJ B;  1LQB A;  1E90 A;  1WY8 A;  1C1Y B;  4ANX A;  4G11 A;  5C1Z A;  2RR9 A;  1WE6 A;  2NPT B;  2GBM A;  2CU1 A;  5GMV A;  3RCZ A;  3PSE B;  3RUI B;  3UF8 A;  3DCG A;  3DDC B;  2C7H A;  4AJY B;  2DYB A;  2WYQ A;  2DZM A;  2KC1 A;  4NJ7 A;  5AZF A;  3LDZ E;  3WAO A;  4MDK E;  4MSM B;  2UYZ B;  5LXH A;  1F9J A;  1E7V A;  1UBQ A;  2LZ6 A;  1V81 A;  2KJ6 A;  2JRH A;  4JQW C;  4LDT B;  2G4S A;  1P98 A;  3L0W B;  3NS8 A;  4IM2 A;  1G6J A;  2C9W B;  1T0Y A;  4GB9 A;  3HM3 A;  3LJ3 A;  2KAN A;  4WWP A;  1ZGU B;  2MW5 A;  3PV1 A;  3OJ3 A;  4P7I A;  1WXA A;  5AZG A;  1WXM A;  2BYF A;  3EC8 A;  2IO2 B;  2K25 A;  2XBB C;  3SD5 A;  1GC7 A;  1X1M A;  2N9X A;  2GBN A;  3QIJ A;  2UWQ A;  4HDO A;  2LVO A;  2LWP A;  1WZ0 A;  4GOC A;  2IY0 B;  2ZPY A;  1Q5W B;  1WR6 E;  1WFY A;  2V4L A;  3PTF C;  4IWP A;  5AEK B;  4FHJ A;  5D7G A;  3RUL A;  1WGY A;  2LRU A;  1TZ1 A;  2N9E B;  3DVN V;  4HPL B;  5G2N A;  4DDI D;  2KOX A;  3JYU A;  4K81 A;  4W9I A;  2JWZ A;  2N7D A;  5CX3 A;  3UIO B;  4FBJ B;  1V9J A;  3ALB A;  3PPA A;  4W9E A;  3PGE A;  1V5O A;  2IY1 B;  3UQA A;  2KWU B;  3VUW A;  2HD5 B;  3N30 A;  4BKG A;  2DZJ A;  3VTW A;  2V1Y A;  2I1K A;  3VH3 B;  2LAS A;  5D2M B;  3DBH I;  3CST A;  1VD2 A;  2MBQ A;  3DBS A;  2MP2 A;  3KUC B;  2M1M A;  3M3J A;  4FJY A;  2GBJ A;  2JRI B;  2KFK A;  4EEW A;  2KMC A;  3MHS D;  1E7U A;  2FCN A;  2IZV B;  4AJW A;  2KWC A;  1WMH B;  2LVP A;  1MG8 A;  3V60 A;  3M63 B;  4TV3 A;  3X0W A;  3VAW A;  2J7Q B;  1PQS A;  4WAA A;  4BKT A;  2K8H A;  1EF1 A;  4BOZ B;  2OOB B;  3WAL A;  1WXS A;  4GGQ A;  3GOE A;  3B08 A;  3N3K B;  4RM9 A;  4W9K A;  3TL5 A;  1V49 A;  3VXW A;  3WAN A;  3ZNH B;  3Q3F A;  2D11 A;  4GDL B;  4KZC A;  4MH0 E;  1KLV A;  3KYC D;  2ZNV C;  3QA8 A;  2BKF A;  2KVR A;  3L13 A;  4FHK A;  2KFJ A;  4K7S A;  2HJ8 A;  1YX5 B;  4AOF A;  1EUV B;  2N1V A;  1Y8R C;  2G45 B;  2N9P C;  2KNB A;  2RGF A;  3APC A;  4FJZ A;  4N9F 4;  2NCN A;  4RMA A;  2YVC A;  3QQ8 B;  4WJO A;  1UBI A;  2KZR A;  4XX5 A;  2XK5 B;  2KXJ A;  5HKH A;  4E71 A;  4BBN F;  2K1F A;  3P2B A;  2AYO B;  3M95 A;  1RAX A;  3JSV B;  3HM6 X;  3EFU A;  4II3 B;  3T8M A;  4K7W A;  1J8C A;  4MGZ E;  1RFA A;  1OTR B;  4NPN A;  1M94 A;  3KUD B;  5FR6 A;  2NBW B;  4HJK A;  4E3C A;  2OJR A;  2MBE A;  5LLI A;  1FXT B;  2A5U A;  1E8X A;  2LXC A;  2MA9 B;  3NZS A;  4LCD E;  3DPD A;  2L0F A;  3VH4 B;  3IVF A;  2GBR A;  5L83 A;  1UGM A;  3ZO5 B;  4AP4 C;  5J2R A;  1NBF C;  3AUL A;  3L17 A;  2FUH B;  3A9J B;  3QCA A;  3ZDM C;  2Z59 B;  3KVF B;  5AZH A;  2KQS A;  5CHW A;  3DOW A;  3OLM D;  3U8Z A;  3H7S A;  1RRB A;  1RLF A;  2J0J A;  1SE9 A;  4WWO A;  1E8W A;  3W1S A;  2ZPN A;  4ZRJ A;  4E74 A;  2LXA A;  2C7M B;  2ZCC A;  2O6V D;  1P1A A;  3HHM A;  4XZ4 A;  2N7E A;  4FLH A;  2KTR A;  3HIZ A;  2K8B A;  2D2Q A;  1SGH A;  3C0R B;  4PS7 A;  4HPM B;  3R7Q A;  4TQ1 A;  5J18 A;  4CO7 A;  2FCM A;  4HXD A;  4IG7 B;  4NAW A;  2K6Q A;  2CHX A;  4W9H A;  1XD3 B;  4BBN C;  2WWZ A;  4II2 B;  3T9L A;  4GDK A;  1WZ3 A;  4IUM B;  3UIP B;  2JT4 B;  4FJV B;  3QJZ A;  1CMX B;  1V5T A;  3RT3 B;  3V6C B;  3O65 B;  3ZRC A;  1IYF A;  4OVV A;  2JXX A;  4EUT A;  1H4R A;  3AXC A;  4ICU A;  2LGD A;  3QWZ B;  4F8C B;  2FCQ A;  2M0X A;  2KQ7 A;  2NBU A;  4KIK A;  5J17 A;  1L2N A;  4I6P A;  3ZTC A;  5EDS A;  2MX2 A;  2CHZ A;  2PE9 A;  3ENE A;  4NAW B;  3B0A A;  2KHW B;  3MTN B;  2G3Q B;  4YL8 A;  2WX0 A;  3ZNI D;  3HK0 A;  2O2V A;  1TBE A;  3QX1 A;  4GDK B;  3ZNZ B;  5D94 A;  1L7Y A;  2ZJD A;  5E6O A;  3KUZ A;  3IFW B;  2VRR B;  5IAA C;  5JH5 C;  3X23 A;  3TCA A;  4ZRI A;  3L10 B;  1WJN A;  3N32 A;  4MGI E;  3M62 B;  1UZX B;  4IC7 B;  2FAZ A;  3JW0 X;  3AU5 A;  3TBL D;  1Z2M A;  2I1J A;  2K6D B;  4KDI C;  1HE8 A;  3VQI A;  2DZI A;  5LXI B;  2CKH B;  2BYE A;  1OGW A;  4HWI B;  1V86 A;  3NY5 A;  4K1R B;  3VHT C;  2FNJ B;  4GSW A;  4KDL B;  1NDD A;  1WGR A;  4ZDV A;  2MBH A;  2KDF B;  2DAJ A;  3NZU A;  2O6V A;  1D3Z A;  5D6J B;  1V6E A;  4JIO U;  1GUA B;  3QHT A;  3SU8 X;  3TIX A;  5KHQ A;  1I42 A;  3I3T B;  2CR5 A;  1UD7 A;  1WRD B;  4NNJ B;  4DHZ E;  1V2Y A;  2N4F A;  4BKS D;  4W9F A;  3ZTD A;  4NQK E;  3R7R A;  1E8Z A;  3IBE A;  4NJ6 A;  2L76 A;  3EEC A;  3TMP B;  2O6V B;  4EFO A;  3PRZ A;  3MJW A;  2KLC A;  4GN1 A;  3A33 B;  4WWN A;  5CHV C;  2MP2 B;  4ICV A;  3PRP B;  3WAP A;  2KTF A;  2KFK B;  3ML8 A;  2ASQ A;  4ASW C;  4KSL C;  2NVU I;  3UIN B;  3WAM A;  4DHZ B;  4PYU A;  3ZRF A;  2R2Q A;  2D07 B;  3VUX A;  2AL6 A;  3QK0 A;  2D10 A;  4GXB A;  2DEN B;  2DYM A;  2KD0 A;  4GU2 A;  3DVG X;  4DBG A;  1XQQ A;  2J0K A;  3A1Q A;  1YJ1 A;  2FIF A;  4XC2 A;  5BO4 B;  4W9G A;  3L54 A;  1P3Q U;  2IO0 B;  3A4R A;  1WXV A;  4TKN A;  3V61 A;  1J0G A;  1WI0 A;  4KZ0 A;  5G55 A;  4JLC A;  4A3P A;  1WIA A;  2L05 A;  4AWJ A;  4MGY E;  4B6W A;  2MRP A;  1J19 A;  1JRU A;  2BYV E;  2C60 A;  2K8C A;  1OEY J;  1A5R A;  1WJ6 A;  3L08 A;  1S1Q B;  2NBV B;  2JF5 A;  3EHV A;  1EO6 A;  1R4N I;  2D3G A;  4CHK A;  1WJ4 A;  2JZZ A;  2MSE D;  2KC2 A;  3RZF A;  2L7R A;  2MCN B;  3DVG Y;  1IPG A;  1QZE A;  1YX6 B;  3NOB A;  4MEL A;  1EF5 A;  1GNU A;  1Z5S B;  2KMA A;  3KH0 A;  2EMT A;  2KX3 A;  3PLV A;  2PJH A;  5CHF A;  3PT2 B;  2LD9 A;  1U4A A;  4HVB A;  2GBK A;  2JPH A;  4F7Z A;  4IM3 A;  2KDI A;  3PLU A;  1H8C A;  4OVU A;  2MBO A;  4G50 A;  3H1U A;  4AUQ C;  1P9D U;  1WGG A;  2LGY A;  4URK A;  4BKS A;  2C5L C;  2RD0 A;  2WDT B;  3OAW A;  3QAR A;  4KSK C;  4I6L B;  1WJU A;  3PHX B;  2NS5 A;  3VUY A;  1GC6 A;  4WQO B;  1ISN A;  1E8Y A;  1WGH A;  3PZD A;  5KHO A;  1WX7 A;  2R2O A;  4ANV A;  2KLG A;  2C7N B;  2L8J A;  1P0R A;  3ZKJ C; 
#chains in the Genus database with same CATH topology
 3AEA B;  2BQQ A;  4JL9 A;  2WNM A;  1TKY A;  3BWU D;  4WQM A;  2NPT A;  1JRO A;  1YIW A;  3Q2A C;  3VR9 B;  4W9C A;  1GB4 A;  1FIQ A;  2EMS A;  2QIL A;  1OQY A;  1FMA D;  1AWD A;  3MC0 B;  3DHH C;  3GP7 A;  3AE9 B;  4IWO A;  5H92 C;  3U7D A;  2JXT A;  3AE2 B;  4KIK B;  3DHG C;  3AEF B;  3Q8B A;  4EZL A;  2AEH A;  3APD A;  4USA A;  3N9Y C;  5IN7 A;  1T3Q A;  1N61 A;  1ESF A;  1TKG A;  3MC8 A;  2IGD A;  4RGN A;  2L52 A;  4LJP B;  2D3C A;  1XLN A;  1R4M I;  4OZA A;  5DPT A;  2FE8 A;  2IBI B;  3W2D A;  3DVN U;  3PHW B;  4LNK A;  2AX5 A;  1FD6 A;  4B0E A;  1Q10 A;  4RF1 A;  2DHZ A;  3T3O A;  4BOS C;  1NI2 A;  3SHQ A;  3Q8F A;  2CJO A;  2ZVO A;  2Z0D B;  2M17 A;  2PE6 B;  1V1P A;  2NMQ A;  2OJW A;  3S2A A;  2KK8 A;  2GMI C;  1KRH A;  1EWY C;  1ZPS A;  2HDE A;  2WXH A;  3W1Y A;  3ONS A;  2IND C;  3IT4 B;  3T3N A;  1VZ7 A;  2Z0E B;  5MPO A;  2PPH A;  3NHE B;  3RYT A;  1IP9 A;  2BWF A;  2MBB B;  2AWT A;  1YD8 U;  3KW5 B;  4HJG E;  1XLQ A;  2XK5 A;  2K3U A;  1D5Z C;  2KDM A;  2G1E A;  5C2T B;  2N1W A;  4HCN B;  2QEJ C;  2V3S A;  3JSV A;  5FKA C;  4KX6 B;  4WJN A;  4DK5 A;  1R7S A;  1Q0W B;  4LNO A;  2J0M A;  3DBL I;  2W3S A;  4WAF A;  2J42 A;  3V6E B;  1TKE A;  3LYY A;  1VDV A;  2WS3 B;  4FUL A;  1GB1 A;  4M0W B;  2KWV B;  2I38 A;  3LXF A;  1TY2 A;  3ECI A;  1SE4 A;  3QAQ A;  2HE7 A;  1RWS A;  1JWM D;  2QHO A;  3ZYY X;  1YQ4 B;  1DYQ A;  4TUU A;  1AAR A;  2ZNV B;  1YQB A;  2LFI A;  5AUI A;  4BFR A;  4N59 A;  1E7P B;  4WH4 A;  2NPT B;  1J7B A;  2CU1 A;  2PMV A;  3PSE B;  3RUI B;  4QAY A;  4AJY B;  2C7H A;  2LUM A;  3WAO A;  1KFY B;  1PDX A;  1UBQ A;  2LZ6 A;  3BK2 A;  4IM2 A;  1T0Y A;  4GB9 A;  4C7Z A;  1F1H A;  1QOG A;  3OJ3 A;  1WXA A;  1SBB B;  1WXM A;  2BYF A;  1X1M A;  3AB5 A;  1WZ0 A;  1WFY A;  2V4L A;  1NEK B;  5D7G A;  1WGY A;  2N9E B;  1WSP A;  4HPL B;  1N6Z A;  2FUG 1;  2W3R A;  2N7D A;  3PPA A;  3PGE A;  3U7Z A;  2IY1 B;  3UQA A;  2XN9 C;  3N1Z C;  4CQN A;  4BKG A;  2I1K A;  1IGC A;  3CST A;  1GPX A;  3DBS A;  2M1M A;  3MHS D;  1E7U A;  2IZV B;  2KWC A;  1L6V A;  1V1P B;  3M63 B;  4S0R A;  1ZDV A;  4BKT A;  2K8H A;  4BOZ B;  3TEW A;  3SR6 A;  4GGQ A;  4RM9 A;  3TL5 A;  3WAN A;  1V49 A;  5H8Y E;  1N5X A;  2D11 A;  4TSS A;  1C79 A;  4RGO S;  4K7S A;  2HJ8 A;  3P1M A;  1XCT L;  2NCN A;  1TJE A;  2XK5 B;  1YJI A;  2KXJ A;  3GE8 C;  1JWS D;  4ACF A;  3JSV B;  1PGB A;  1M94 A;  5FR6 A;  4A90 A;  4HJK A;  2A5U A;  1E8X A;  2LXC A;  1T0R C;  4C7Y A;  1UGM A;  1QOF A;  3QCA A;  4HRS A;  3ZDM C;  2KQS A;  2M56 B;  2PLP A;  2INN E;  3DOW A;  3U8Z A;  1N63 A;  1RLF A;  1VR9 A;  1E8W A;  2G9H D;  2IDY A;  4B0M A;  1DOX A;  5T8I A;  3P4P B;  3HRD D;  2K8B A;  3BZD B;  2FCM A;  2K6Q A;  4W9H A;  2RDB C;  1ZXH A;  2BS3 B;  3UIP B;  1CMX B;  1V5T A;  3P4R B;  3V6C B;  3O65 B;  1E0Z A;  1UWM A;  3RN9 C;  2JXX A;  1H4R A;  4F8C B;  4TMA B;  3P4S B;  1L2N A;  2QDF A;  4I6P A;  4YL8 A;  2WX0 A;  4LLG M;  1LO5 D;  4GDK B;  4HRO A;  4N58 A;  2LGI A;  3KUZ A;  3RNC C;  3IFW B;  3SFD B;  3TCA A;  1JWU D;  4ZRI A;  1JWB D;  4YWG G;  4IC7 B;  4LNI A;  2I1J A;  4L23 A;  2BW2 A;  5LXI B;  1R4N B;  2DZI A;  4REZ A;  2JSV X;  5EE9 A;  1WGR A;  4NJC A;  2DAJ A;  3NS1 A;  2LHE A;  2O6V A;  5TSS A;  4P6V F;  3GS2 A;  5KHQ A;  2X38 A;  1HA5 A;  2CR5 A;  1UD7 A;  1WRD B;  4NNJ B;  3ZTD A;  4H2A A;  3I5J C;  3GZN B;  4NQK E;  4AS1 A;  1E8Z A;  2M0A A;  3IBE A;  2L76 A;  1WRI A;  4EFO A;  2KN4 A;  1AW7 A;  2K9X A;  2JQR B;  4OZC A;  4A6Q A;  5CHV C;  1V8C A;  4P1B C;  2NVU I;  3ZRF A;  3VUX A;  3DVG X;  4P1C C;  1HXY D;  3V61 A;  2SEB D;  2GB1 A;  4DXF A;  4MGY E;  1ZOY B;  1J19 A;  3MJ5 A;  1EO6 A;  4CHK A;  1AYF A;  1IPG A;  2PIA A;  4WUR A;  1C78 A;  1Z5S B;  2DWQ A;  1SJE D;  2EMT A;  3PLV A;  4IM3 A;  1H8C A;  3KQ4 A;  2MBO A;  4G50 A;  5BMH A;  3Q14 C;  2LGY A;  4BKS A;  3OAW A;  3PHX B;  1E9M A;  1WX7 A;  4ANV A;  4LNF A;  1EU3 A;  5HG2 A;  3ZKJ C;  4MSQ B;  3PS6 A;  3TJP A;  2DYO A;  2J4X A;  3BVZ A;  3CSF A;  4D2K A;  4B95 A;  4M8N A;  3ZW3 A;  2PVO D;  1I4R A;  3DBH B;  5E6P A;  2KX0 A;  4KKI A;  4ANU A;  1KM7 A;  4MM3 A;  4PS3 A;  1RM6 C;  2DX5 B;  4XE0 A;  2Y5C A;  3ZLZ A;  1KLU D;  3DBR I;  2E6X A;  4ZYN A;  3U30 A;  4A3O A;  1QIL A;  1WF9 A;  2QIE B;  2IPK D;  5C23 A;  4G0N B;  1FCC C;  4DDG D;  4X57 B;  3R2T A;  2RMM A;  3VVW B;  4YXD B;  2V4I B;  5DCN A;  1QF6 A;  3RZW C;  4TQ0 A;  1TT5 B;  3UGB B;  1SSN A;  3BK1 A;  1TTN A;  2WDV B;  4K3C A;  1K50 A;  4LJO B;  4EE2 A;  3RNE C;  2NR2 A;  1ET9 A;  3W5V B;  2KDE B;  3PRE A;  2UU7 A;  3WIM A;  2N0S B;  4CYE A;  2QC8 A;  4K7U A;  1L0Y B;  5D3I B;  1FRR A;  2KJR A;  3VDZ A;  2JYT A;  1WMH A;  2KMM A;  3AE3 B;  4J6I A;  4DHJ D;  1WYW B;  2ZW1 A;  1L6U A;  1KOT A;  3E56 A;  2KAC A;  5GXG B;  1LFD A;  2BWE S;  2RDH A;  3Q69 A;  3ZQ4 A;  2ZCB A;  2JZ3 B;  2WU2 B;  5DPW A;  3AEG B;  2IO3 B;  3P42 A;  2YLM A;  1DGJ A;  2QMT A;  2J52 A;  2KJH B;  4A9A A;  4HDQ A;  4NY0 A;  3U2S C;  3ZNG C;  4MGK E;  1ROE A;  4WWM A;  2KKC A;  4MAC A;  1HZ6 A;  2BKR B;  3RD2 A;  2W54 A;  2IYD B;  5E6N A;  3AI5 A;  2BVC A;  2KO3 A;  3VFK A;  1KLG D;  3H7P B;  5BYR A;  2KDB A;  2LUE A;  4DXG A;  4RFB A;  1C3T A;  3UI3 A;  2ACZ B;  2FID A;  2IO1 B;  2ZEQ A;  3ETR A;  4EZK A;  4W9J A;  2BS2 B;  3DQV A;  2CHW A;  3I57 A;  4MEM A;  3MP9 A;  3K9O B;  1SE3 A;  1V80 A;  4BZA A;  3OJ4 B;  2MLB A;  4RM8 A;  2CS4 A;  4ZRP A;  1WX8 A;  1Y56 A;  3ZUN A;  1WM2 A;  3AU4 A;  4XWT A;  1E90 A;  1WY8 A;  4ANX A;  2IGG A;  2WDQ B;  1YJJ A;  1BUI C;  3RCZ A;  2WYQ A;  5AZF A;  3BYT B;  5LXH A;  2UYZ B;  4MM3 B;  3RI7 C;  1ZUD 2;  4IOI E;  1F9J A;  4L2Y A;  1E7V A;  1EM7 A;  4LDT B;  2G4S A;  3L0W B;  2KAN A;  1M4V A;  1JWA D;  4P7I A;  5AZG A;  2J53 A;  1FNU A;  2K25 A;  1GC7 A;  3HUI A;  2N9X A;  3QIJ A;  1XLO A;  2IY0 B;  3NG0 A;  2ZPY A;  1Q5W B;  1I4X A;  5AUK A;  4FHJ A;  5HI1 A;  4M00 A;  5BMI A;  3H8H A;  1XF5 L;  3PZ7 A;  4W9E A;  2K22 A;  2KWU B;  3RNF C;  1L4D B;  1D5M C;  4S17 A;  1IBX A;  3NRZ A;  3NVV A;  2LAS A;  1CZP A;  1VD2 A;  4EEW A;  2GBJ A;  2JRI B;  2KFK A;  1LGR A;  4AJW A;  4US9 A;  1WMH B;  2SAK A;  1QOB A;  4WAA A;  2OOB B;  2VZK D;  3NVW A;  2EKI A;  1ACC A;  3KYC D;  2ZNV C;  3QA8 A;  2BKF A;  2KVR A;  3L13 A;  4FHK A;  1YN3 A;  2WU5 B;  1YX5 B;  1EUV B;  2N1V A;  2WXP A;  4FJZ A;  1ZXI A;  1FEH A;  5EE0 A;  1OQQ A;  2OED A;  5HKH A;  3P2B A;  3M95 A;  1HZ5 A;  1HTO A;  2BB6 A;  1ZP0 B;  2IJ0 A;  2D3A A;  4K7W A;  3T8M A;  1J8C A;  3U52 E;  4E3C A;  3BYY B;  5LLI A;  3VH4 B;  3NZS A;  4LCD E;  3DPD A;  5L83 A;  2AQ1 B;  4AP4 C;  1FNV A;  1NBF C;  1HQR D;  1C77 A;  4FXC A;  4WWO A;  1K52 A;  3W1S A;  2ZPN A;  4E74 A;  2LXA A;  2ZCC A;  2O6V D;  3FKY A;  4XZ4 A;  4FLH A;  2D3B A;  2D2Q A;  1STE A;  5J18 A;  4IG7 B;  2GLS A;  2WWZ A;  2JWU A;  3DWM A;  4GDK A;  1MFW A;  2JT4 B;  4FJV B;  3RT3 B;  3I63 C;  4EUT A;  2N7J A;  5J17 A;  2FCQ A;  2NBU A;  2NTT A;  2R61 A;  3ZXR A;  2KHW B;  2G3Q B;  3HK0 A;  5E6J A;  3BVG A;  5D94 A;  1L7Y A;  3AM9 A;  1PGX A;  1K53 A;  5E6O A;  3ZJT A;  5BYS A;  3X23 A;  5EE1 A;  2QCZ A;  1WJN A;  3N32 A;  3M62 B;  3EFC A;  2FAZ A;  3JW0 X;  3TBL D;  1SIJ A;  4KDI C;  1HE8 A;  2BYE A;  4HWI B;  1SJH D;  3VHT C;  1JCK B;  3AV8 A;  1XO3 A;  4GSW A;  4KDL B;  1NDD A;  4ZDV A;  2MBH A;  2KDF B;  3GB1 A;  4P16 A;  1D3Z A;  1QQR A;  4JIO U;  4XYC A;  4DHZ E;  4BKS D;  2N4F A;  4W9F A;  3HVD A;  4NJ6 A;  1CQV A;  2WXK A;  3TMP B;  1IBX B;  3PRZ A;  1RFK A;  3A33 B;  3L4P A;  2KFK B;  4ASW C;  1NEN B;  4PYU A;  5JXV A;  2DYM A;  2KD0 A;  1FO4 A;  2RPV A;  2WXG A;  5BO4 B;  3L54 A;  1P3Q U;  2INP E;  4TKN A;  3TSS A;  2BBC A;  3P4Q B;  1WI0 A;  2BT6 A;  4B6W A;  4YTP B;  1JRU A;  1OEY J;  3L08 A;  1QKZ A;  2ICI A;  2JF5 A;  1R4N I;  2D3G A;  1WJ4 A;  2KC2 A;  3RZF A;  2L7R A;  2MCN B;  2VH1 A;  1QZE A;  3GE3 C;  2LEK A;  3IAM 1;  1B1Z A;  4HKQ A;  4YSY B;  2LD9 A;  1U4A A;  4HVB A;  2GBK A;  2JPH A;  3PLU A;  4RCO A;  1VLB A;  2CU3 A;  2V3P A;  4URK A;  2V3N A;  2RD0 A;  2WDT B;  2OHF A;  1QOA A;  2NS5 A;  1ISN A;  1WGH A;  2L8J A;  2BF8 B;  3MC9 A;  3Q8C A;  4B9K A;  1OEY A;  1WR1 A;  2L32 A;  2DZK A;  3VTU A;  3NZ3 A;  4GMV A;  2LGX A;  3V62 A;  5IA7 A;  1UF0 A;  2H88 B;  2DAF A;  4DWF A;  4KV2 A;  3ML9 A;  1A70 A;  3PVL A;  1NVI D;  1BT0 A;  3APF A;  4G3X B;  1UUP A;  2BPS A;  4NQL B;  1UEL A;  2ONQ A;  1ZE3 D;  2Y5P A;  3R3M A;  3RNG C;  4WJQ A;  1T0S C;  4HPP A;  3WA0 A;  3Q3J A;  4EZJ A;  2MHJ A;  1YN5 A;  4RGM A;  4ARC A;  1N5W A;  1KJT A;  2WXR A;  3A9K B;  4ARI A;  1KH0 A;  3D32 A;  3FAH A;  2HTH A;  4HK2 A;  4OW0 A;  1GJZ A;  3IHP C;  1JAL A;  3QC8 B;  5JZE B;  4FAD A;  4PK1 A;  2RSU A;  1YMH E;  2MH7 A;  1ZKH A;  4F1S A;  2NTS A;  2L3Z A;  4YTN B;  2JVC A;  3PRM B;  2M4N A;  4RF0 A;  3SEB A;  3Q3M C;  4W9L A;  4MJS B;  1NI3 A;  1I35 A;  2Y5B B;  2AL3 A;  1PUT A;  4JWU C;  4IW0 A;  1QLB B;  3LB8 C;  4JGH B;  5JHB A;  3H7P A;  4LTU A;  3H9D A;  3ABV B;  2MQJ A;  2RPQ A;  1WGD A;  3IG3 A;  3L16 A;  1SIF A;  4C4V A;  2L0T A;  1K8R B;  2PEA A;  1J7A A;  1HEZ E;  1Q1O A;  1WX9 A;  3AN1 A;  1FXA A;  3A9J A;  2Z8L A;  2BGF A;  2KAJ A;  1VCB A;  3B2G A;  2LVQ A;  3ZJU A;  2ON8 A;  1N60 A;  4ZRK A;  1XT9 B;  4HLE A;  3W9C B;  5IP4 D;  4IWQ A;  3AE8 B;  5G5H A;  2KN5 A;  3R66 C;  3TEZ A;  4ZYS A;  3SDL C;  2JY6 A;  1WH3 A;  5JHA A;  1LM8 B;  2LMC A;  4PYZ A;  4KVG B;  4FN2 A;  2LHD A;  3KLS X;  4R3D A;  1LXD A;  4OHJ A;  1JW9 D;  1C1Y B;  5C1Z A;  2RR9 A;  1WE6 A;  1CJE A;  2GBM A;  3UF8 A;  2WXJ A;  3DDC B;  3N1X C;  2DYB A;  2DZM A;  1F77 A;  4NJ7 A;  4MDK E;  2N9K A;  4JQW C;  1V81 A;  2KJ6 A;  3B2F A;  5EE3 A;  1P98 A;  2C9W B;  3LJ3 A;  2H89 B;  3PV1 A;  2DNF A;  1KF6 B;  2XBB C;  3EC8 A;  4YSX B;  2GBN A;  2UWQ A;  2GI9 A;  2L83 A;  2LVO A;  4GOC A;  4HEA 1;  1GOZ A;  1TS2 A;  3RUL A;  2LRU A;  3DVN V;  2KOX A;  3JYU A;  4FBJ B;  2JWZ A;  1V5O A;  2HD5 B;  3Q8A A;  2IGH A;  3NUH B;  3OWE B;  4JPS A;  2DZJ A;  3VTW A;  2V1Y A;  1T0Q C;  3VH3 B;  4HDO A;  3M3J A;  2KMC A;  1FFV A;  2FCN A;  4RNA A;  1E6E B;  4C56 C;  1BXT A;  2JX5 A;  4TV3 A;  3X0W A;  3VAW A;  2J7Q B;  3DHI C;  3RNA C;  3WAL A;  4KGS A;  2BS4 B;  2PTL A;  3B08 A;  3N3K B;  4W9K A;  1KLV A;  4AOF A;  1HTQ A;  2N9P C;  1Y8R C;  2G45 B;  1RYJ A;  1ZDX A;  1FXI A;  4RMA A;  2YVC A;  5IKC M;  1V1O A;  4YSZ B;  1UBI A;  2KZR A;  3DBR B;  2WXN A;  2INC C;  3NJT A;  2YEP B;  4BBN F;  2AYO B;  1RAX A;  3HM6 X;  4II3 B;  3NVZ A;  4MGZ E;  3WCQ A;  4C4V B;  1MG4 A;  1VZ6 A;  2PVG C;  1E10 A;  3ZO5 B;  3BII D;  3L17 A;  2FUH B;  3A9J B;  2Z59 B;  2BYT A;  1C4C A;  3AE7 B;  4MT5 A;  3OLM D;  1XEE A;  3H7S A;  1RRB A;  2J0J A;  3RMK C;  1SXT A;  1P1A A;  2WXQ A;  3NVY A;  2HTM E;  2N7E A;  2KTR A;  3R7Q A;  1I4H A;  2MJE A;  4CO7 A;  1XD3 B;  3AE4 B;  2YEP F;  3T9L A;  4IUM B;  1IYF A;  3QJZ A;  3DWG C;  3ZRC A;  4OVV A;  3AXC A;  4ICU A;  3QWZ B;  2KQ7 A;  3ZTC A;  2MX2 A;  4NAW B;  3OG5 A;  3ZNI D;  2O2V A;  1TBE A;  1PFD A;  2ZJD A;  1OQR A;  3O13 A;  5JH5 C;  1GAQ B;  1JQ4 A;  3ZXV A;  3MFG A;  3AU5 A;  1ET6 A;  2K6D B;  1IUE A;  2VH2 A;  2CKH B;  3NY5 A;  4K1R B;  1TIF A;  2FNJ B;  1J7C A;  3J9C A;  3HVZ A;  2KWD A;  3Q3O C;  4ZRQ A;  2N9L A;  3QHT A;  1NYR A;  1I42 A;  1I4Q A;  1MPE A;  3I3T B;  1V2Y A;  3R7R A;  3MJW A;  2KLC A;  4GN1 A;  3R8B A;  3VR8 B;  4ICV A;  2KTF A;  4NZL B;  1N62 A;  4DHZ B;  1WGK A;  2D07 B;  3QK0 A;  2D10 A;  2DEN B;  4GU2 A;  1XQQ A;  2J0K A;  3A1Q A;  1YJ1 A;  1T5X D;  2FIF A;  3I9V 1;  2IO0 B;  3A4R A;  4XWW A;  1WXV A;  3P63 A;  1EWC A;  5G55 A;  4A3P A;  2L05 A;  4AWJ A;  2MRP A;  1A5R A;  5C3J B;  2NBV B;  2QSD A;  4LK0 M;  2WGS A;  1YX6 B;  3DVG Y;  4MEL A;  1EF5 A;  1NYQ A;  2KX3 A;  2WXO A;  4N6E B;  2WXL A;  3ZGZ A;  4L1B A;  4F7Z A;  1R4M B;  5FR3 A;  2CJN A;  3URY A;  4AUQ C;  1WGG A;  4RGT A;  3QAR A;  1XLP A;  1WJU A;  1GC6 A;  1WWT A;  1YQ3 B;  2PW9 A;  2KQ4 X;  4NAM A;  5KHO A;  2R2O A;  3PZ8 A;  4K3B A;  2KLG A;  4ZHP A;  1P0R A;  5D3D A;  1FRD A;  5G5G A;  2G4D B;  4RH6 A;  1I4P A;  4US8 A;  1SE2 A;  2LJ5 A;  2K5P A;  3A4S C;  2REX A;  2KTR B;  3BIN A;  2K39 A;  4EKU A;  1EU4 A;  1GG3 A;  5TR5 A;  1FM0 D;  1V97 A;  4IDI A;  1UH6 A;  1MHX A;  4LNN A;  4GIV A;  4BVU C;  2L00 B;  1BML C;  4DXA B;  2JU6 X;  3Q6B A;  2JYE A;  3B1L X;  2ZZP B;  2O2V B;  3A9K A;  4A20 A;  1QT9 A;  4EOY A;  4ZOH C;  3JVZ X;  2A4Z A;  1DOY A;  2AQ3 B;  3EGR A;  1IGD A;  2DBY A;  1FCL A;  2LRW A;  2EKE C;  1VJK A;  3AED B;  2WX1 A;  3DBL B;  1SF0 A;  3IAS 1;  2FCS A;  4C80 A;  1ZW7 A;  3KYD D;  3UQB A;  3E9S A;  4WJP A;  1VZ8 A;  3K9P B;  3ZVV A;  1CK1 A;  1UWX A;  3AEE B;  3TEX A;  4MJS A;  5FK9 C;  3VTV A;  1L0X B;  3KWL A;  4M8M A;  2D5G A;  2LJI A;  4GDL A;  3AMZ A;  2W9N A;  3BVM A;  3BY4 B;  3ZIM A;  4IM0 A;  3W1S C;  1YNT E;  4JE3 B;  1L4Z B;  2M8S A;  4Q2J A;  4LDT D;  1KTK A;  2GOW A;  1F52 A;  2ZVN A;  2WXI A;  3A1Q B;  3AH7 A;  4DQO C;  1E5W A;  2JUO A;  1L0V B;  3R2I A;  1S3S G;  2EEL A;  3AE6 B;  4ZHO A;  1TGZ B;  5DPS A;  3PO0 A;  3H6N A;  2B3A A;  3CF6 E;  4I6N B;  1P7F A;  3CMM B;  1PGA A;  4FA6 A;  2V0G A;  1FNW A;  4XDD A;  3SFE B;  4PS8 A;  4JWS C;  3VRB B;  3GZN I;  3ZDT A;  3AEB B;  4UDU C;  2BB5 A;  5L95 C;  2MWS B;  4HCP B;  1WM3 A;  2WDR B;  2WXF A;  4KGR A;  2ZW0 A;  2I2Y A;  2XEW A;  1MI0 A;  4O1N A;  1WE7 A;  2LI5 A;  4W9D A;  4KKJ A;  5CTR C;  2WP9 B;  5DPR A;  4ANW A;  4DHJ B;  1LQB A;  4G11 A;  4YT0 B;  2M19 A;  2LGS A;  3N20 C;  5GMV A;  1JML A;  3DCG A;  3AE1 B;  1XCQ L;  2E3T A;  2KC1 A;  1F2R I;  3LDZ E;  2K0P A;  3AEC B;  4MSM B;  2V9H A;  4XGA B;  2MJ3 A;  3Q3N C;  1TZO A;  2JRH A;  1WXQ A;  3NS8 A;  1G6J A;  3HM3 A;  4WWP A;  1ZGU B;  2MW5 A;  1I4G A;  1T6B X;  2WHI A;  3SD5 A;  1C4P A;  2IO2 B;  1FPY A;  1F2R C;  2LWP A;  1WR6 E;  1P7E A;  3PTF C;  4IWP A;  3TUO A;  5AEK B;  1YN4 A;  1D4B A;  1TZ1 A;  1YOV B;  5BMG A;  5G2N A;  4DDI D;  4K81 A;  4W9I A;  3UIO B;  2TSS A;  5CX3 A;  1V9J A;  1TY0 A;  2W82 A;  3ALB A;  1F0Z A;  3VUW A;  3IT6 B;  3N30 A;  4YTM B;  3RFZ B;  1ENF A;  5D2M B;  3DBH I;  4JX1 C;  2MBQ A;  3KUC B;  2MP2 A;  4FJY A;  3EUB 2;  3AE5 B;  2LVP A;  1MG8 A;  3V60 A;  1PQS A;  1EF1 A;  1WXS A;  3GOE A;  1WYG A;  3VXW A;  1C76 A;  5HHD G;  3ZNH B;  3Q3F A;  4GDL B;  4MH0 E;  4KZC A;  4BAX A;  2KFJ A;  3V05 A;  5BYQ A;  2KNB A;  2RGF A;  3APC A;  4N9F 4;  4PT5 A;  3FIL A;  3QQ8 B;  4WJO A;  4XX5 A;  3TEY A;  4E71 A;  1AN8 A;  1I7H A;  3B9J A;  2K1F A;  2DLB A;  3EFU A;  2Q5W D;  1RFA A;  1OTR B;  4NPN A;  3KUD B;  2NBW B;  3RPF C;  2OJR A;  2MBE A;  3RNB C;  3VRA B;  1FXT B;  2JZP A;  2MA9 B;  2L0F A;  2X8X X;  3IVF A;  2GBR A;  1DOI A;  3U4E G;  5J2R A;  3AUL A;  1UNS A;  2GRI A;  3KVF B;  5AZH A;  2MJD A;  1SB3 C;  5CHW A;  4XDC A;  1MJD A;  5IO9 A;  1SE9 A;  2WXM A;  5LNK 1;  4ZRJ A;  2C7M B;  2KVZ A;  3HHM A;  3HIZ A;  1SGH A;  3C0R B;  4PS7 A;  4HPM B;  4C00 A;  4TQ1 A;  5I4D A;  4HXD A;  4NAW A;  2CHX A;  4BBN C;  4II2 B;  1WZ3 A;  4M02 A;  3CIR B;  2LGD A;  4AQ7 A;  2M0X A;  3KWV A;  4KIK A;  2VZK B;  2PKO A;  1PYW D;  5EDS A;  2CHZ A;  2PE9 A;  3ENE A;  3B0A A;  3MTN B;  1UGJ A;  2WLB A;  3QX1 A;  3ZNZ B;  5HFY A;  2WQY B;  4J3O D;  2VRR B;  5IAA C;  1C4A A;  3C8Y A;  3L10 B;  1B9R A;  1JRP A;  2AQ2 B;  4MGI E;  1UZX B;  1TS5 A;  1Z2M A;  2XNA C;  3VQI A;  4MH8 A;  1OGW A;  1V86 A;  3N1Y C;  3ZJV A;  4IKG A;  2QJL A;  3V3X A;  4WIP A;  4OZB A;  2Y3A A;  3Q8E A;  1FFU A;  3NZU A;  1SEB D;  1VRA B;  1TS3 A;  1L5P A;  5D6J B;  1V6E A;  1GUA B;  3SU8 X;  3TIX A;  1C9F A;  1D6E C;  4ITK A;  2W55 A;  3C19 A;  3EEC A;  3MHZ A;  2O6V B;  2KT7 A;  4WWN A;  2MP2 B;  3PRP B;  3WAP A;  3ML8 A;  2ASQ A;  4KSL C;  3UIN B;  3WAM A;  2R2Q A;  4HKZ E;  2AL6 A;  4GXB A;  1XXG A;  2KYW A;  4DBG A;  3CWI A;  4XC2 A;  2L1A A;  2B76 B;  4W9G A;  1TYG B;  4KGT A;  1J0G A;  1TS4 A;  4KZ0 A;  4JLC A;  1WIA A;  1K51 A;  4A8X C;  2BYV E;  2C60 A;  1MHH E;  2K8C A;  2MEK A;  1WJ6 A;  1S1Q B;  3FIL B;  3IXS A;  2FBW B;  1MVK A;  3EHV A;  2JZZ A;  2MSE D;  4GLS C;  3FC4 A;  3NOB A;  1GNU A;  2KMA A;  3KH0 A;  2PJH A;  5CHF A;  3PT2 B;  4M0W A;  2KDI A;  4OVU A;  3H1U A;  1P9D U;  4A55 A;  2HJ1 A;  2C5L C;  3EA6 A;  4KSK C;  3W5U B;  4OVZ A;  4I6L B;  2BTE A;  3VUY A;  4WQO B;  5IOI A;  1E8Y A;  1D5X C;  3PZD A;  1OFF A;  2C7N B;  2RDG A;  4M01 A; 
#chains in the Genus database with same CATH homology
 2BF8 B;  4MSQ B;  3PS6 A;  3TJP A;  4JL9 A;  4B9K A;  2G4D B;  1OEY A;  1WR1 A;  2DZK A;  2LJ5 A;  3VTU A;  2DYO A;  2NPT A;  1YIW A;  3A4S C;  3CSF A;  4W9C A;  2REX A;  2KTR B;  4GMV A;  3BIN A;  2K39 A;  4B95 A;  4EKU A;  2LGX A;  4M8N A;  2EMS A;  3V62 A;  3ZW3 A;  1OQY A;  5E6P A;  1GG3 A;  2KX0 A;  5IA7 A;  5TR5 A;  4ANU A;  1KM7 A;  4MM3 A;  4PS3 A;  2DX5 B;  2DAF A;  3ZLZ A;  3DBR I;  4ZYN A;  1UH6 A;  3U30 A;  4A3O A;  4DWF A;  4GIV A;  4KV2 A;  1WF9 A;  4IWO A;  4BVU C;  2L00 B;  3ML9 A;  4DXA B;  3PVL A;  5C23 A;  1BT0 A;  4G0N B;  4DDG D;  3U7D A;  3APF A;  4X57 B;  4G3X B;  3B1L X;  2BPS A;  4NQL B;  4KIK B;  2ZZP B;  1UEL A;  3VVW B;  2AEH A;  4EZL A;  3APD A;  3R3M A;  2O2V B;  4WJQ A;  3A9K A;  4A20 A;  3WA0 A;  4EOY A;  3Q3J A;  3JVZ X;  4EZJ A;  5DCN A;  2A4Z A;  4LJP B;  3RZW C;  4TQ0 A;  3UGB B;  1R4M I;  1TTN A;  5DPT A;  2IBI B;  2LRW A;  1KJT A;  3DVN U;  2EKE C;  3PHW B;  3A9K B;  4LJO B;  2WX1 A;  3D32 A;  2FCS A;  4HK2 A;  2HTH A;  1ZW7 A;  2NR2 A;  1GJZ A;  3IHP C;  2KDE B;  3KYD D;  2DHZ A;  3PRE A;  3UQB A;  3WIM A;  4BOS C;  3QC8 B;  1NI2 A;  5JZE B;  4WJP A;  4FAD A;  4CYE A;  3K9P B;  3ZVV A;  3SHQ A;  4K7U A;  2RSU A;  2KJR A;  2ZVO A;  3VDZ A;  2Z0D B;  1ZKH A;  2M17 A;  4F1S A;  1WMH A;  2PE6 B;  2L3Z A;  4MJS A;  3S2A A;  3VTV A;  2KK8 A;  4J6I A;  4DHJ D;  2GMI C;  4M8M A;  2JVC A;  3PRM B;  2M4N A;  1WYW B;  4GDL A;  3W1Y A;  1KOT A;  2W9N A;  3ONS A;  4W9L A;  1LFD A;  2BWE S;  3BY4 B;  3ZIM A;  4IM0 A;  4MJS B;  2Z0E B;  3W1S C;  1I35 A;  2PPH A;  3NHE B;  2ZCB A;  2Y5B B;  2JZ3 B;  2AL3 A;  5DPW A;  3RYT A;  1IP9 A;  2M8S A;  2BWF A;  2IO3 B;  2MBB B;  2AWT A;  1YD8 U;  2YLM A;  4IW0 A;  3KW5 B;  4LDT D;  2KJH B;  4JGH B;  2GOW A;  2ZVN A;  3A1Q B;  2XK5 A;  5JHB A;  3H7P A;  1E5W A;  4HDQ A;  4NY0 A;  3H9D A;  3ZNG C;  2JUO A;  4MGK E;  2MQJ A;  2KKC A;  2RPQ A;  1S3S G;  1WGD A;  2N1W A;  2V3S A;  3IG3 A;  4HCN B;  1TGZ B;  3JSV A;  3L16 A;  5DPS A;  2BKR B;  3RD2 A;  1SIF A;  4WJN A;  3H6N A;  4DK5 A;  2IYD B;  2L0T A;  1Q0W B;  5E6N A;  2B3A A;  3AI5 A;  2KO3 A;  1K8R B;  2PEA A;  2J0M A;  3CF6 E;  3DBL I;  3CMM B;  3H7P B;  4I6N B;  3VFK A;  1Q1O A;  1WX9 A;  4FA6 A;  3A9J A;  2KDB A;  2BGF A;  2LUE A;  4PS8 A;  1C3T A;  1VCB A;  2FID A;  2IO1 B;  2ZEQ A;  2LVQ A;  4EZK A;  3GZN I;  3ZDT A;  4W9J A;  3V6E B;  3DQV A;  4FUL A;  2CHW A;  4MEM A;  4ZRK A;  1XT9 B;  4M0W B;  4HLE A;  2KWV B;  4IWQ A;  2MWS B;  5L95 C;  4HCP B;  3K9O B;  3ECI A;  1V80 A;  1WM3 A;  2KN5 A;  3R66 C;  3QAQ A;  2HE7 A;  3OJ4 B;  2JY6 A;  1WH3 A;  3SDL C;  2MLB A;  5JHA A;  4RM8 A;  2CS4 A;  1LM8 B;  2QHO A;  4PYZ A;  4KVG B;  2XEW A;  4TUU A;  4FN2 A;  1WX8 A;  3ZUN A;  1WE7 A;  2LI5 A;  1AAR A;  1WM2 A;  4W9D A;  2ZNV B;  1YQB A;  1LXD A;  5CTR C;  3AU4 A;  5DPR A;  4BFR A;  4ANW A;  4DHJ B;  1LQB A;  1E90 A;  1WY8 A;  1C1Y B;  4ANX A;  4G11 A;  5C1Z A;  2RR9 A;  1WE6 A;  2NPT B;  2GBM A;  2CU1 A;  5GMV A;  3RCZ A;  3PSE B;  3RUI B;  3UF8 A;  3DCG A;  3DDC B;  2C7H A;  4AJY B;  2DYB A;  2WYQ A;  2DZM A;  2KC1 A;  4NJ7 A;  5AZF A;  3LDZ E;  3WAO A;  4MDK E;  4MSM B;  2UYZ B;  5LXH A;  1F9J A;  1E7V A;  1UBQ A;  2LZ6 A;  1V81 A;  2KJ6 A;  2JRH A;  4JQW C;  4LDT B;  2G4S A;  1P98 A;  3L0W B;  3NS8 A;  4IM2 A;  1G6J A;  2C9W B;  1T0Y A;  4GB9 A;  3HM3 A;  3LJ3 A;  2KAN A;  4WWP A;  1ZGU B;  2MW5 A;  3PV1 A;  3OJ3 A;  4P7I A;  1WXA A;  5AZG A;  1WXM A;  2BYF A;  3EC8 A;  2IO2 B;  2K25 A;  2XBB C;  3SD5 A;  1GC7 A;  1X1M A;  2N9X A;  2GBN A;  3QIJ A;  2UWQ A;  4HDO A;  2LVO A;  2LWP A;  1WZ0 A;  4GOC A;  2IY0 B;  2ZPY A;  1Q5W B;  1WR6 E;  1WFY A;  2V4L A;  3PTF C;  4IWP A;  5AEK B;  4FHJ A;  5D7G A;  3RUL A;  1WGY A;  2LRU A;  1TZ1 A;  2N9E B;  3DVN V;  4HPL B;  5G2N A;  4DDI D;  2KOX A;  3JYU A;  4K81 A;  4W9I A;  2JWZ A;  2N7D A;  5CX3 A;  3UIO B;  4FBJ B;  1V9J A;  3ALB A;  3PPA A;  4W9E A;  3PGE A;  1V5O A;  2IY1 B;  3UQA A;  2KWU B;  3VUW A;  2HD5 B;  3N30 A;  4BKG A;  2DZJ A;  3VTW A;  2V1Y A;  2I1K A;  3VH3 B;  2LAS A;  5D2M B;  3DBH I;  3CST A;  1VD2 A;  2MBQ A;  3DBS A;  2MP2 A;  3KUC B;  2M1M A;  3M3J A;  4FJY A;  2GBJ A;  2JRI B;  2KFK A;  4EEW A;  2KMC A;  3MHS D;  1E7U A;  2FCN A;  2IZV B;  4AJW A;  2KWC A;  1WMH B;  2LVP A;  1MG8 A;  3V60 A;  3M63 B;  4TV3 A;  3X0W A;  3VAW A;  2J7Q B;  1PQS A;  4WAA A;  4BKT A;  2K8H A;  1EF1 A;  4BOZ B;  2OOB B;  3WAL A;  1WXS A;  4GGQ A;  3GOE A;  3B08 A;  3N3K B;  4RM9 A;  4W9K A;  3TL5 A;  1V49 A;  3VXW A;  3WAN A;  3ZNH B;  3Q3F A;  2D11 A;  4GDL B;  4KZC A;  4MH0 E;  1KLV A;  3KYC D;  2ZNV C;  3QA8 A;  2BKF A;  2KVR A;  3L13 A;  4FHK A;  2KFJ A;  4K7S A;  2HJ8 A;  1YX5 B;  4AOF A;  1EUV B;  2N1V A;  1Y8R C;  2G45 B;  2N9P C;  2KNB A;  2RGF A;  3APC A;  4FJZ A;  4N9F 4;  2NCN A;  4RMA A;  2YVC A;  3QQ8 B;  4WJO A;  1UBI A;  2KZR A;  4XX5 A;  2XK5 B;  2KXJ A;  5HKH A;  4E71 A;  4BBN F;  2K1F A;  3P2B A;  2AYO B;  3M95 A;  1RAX A;  3JSV B;  3HM6 X;  3EFU A;  4II3 B;  3T8M A;  4K7W A;  1J8C A;  4MGZ E;  1RFA A;  1OTR B;  4NPN A;  1M94 A;  3KUD B;  5FR6 A;  2NBW B;  4HJK A;  4E3C A;  2OJR A;  2MBE A;  5LLI A;  1FXT B;  2A5U A;  1E8X A;  2LXC A;  2MA9 B;  3NZS A;  4LCD E;  3DPD A;  2L0F A;  3VH4 B;  3IVF A;  2GBR A;  5L83 A;  1UGM A;  3ZO5 B;  4AP4 C;  5J2R A;  1NBF C;  3AUL A;  3L17 A;  2FUH B;  3A9J B;  3QCA A;  3ZDM C;  2Z59 B;  3KVF B;  5AZH A;  2KQS A;  5CHW A;  3DOW A;  3OLM D;  3U8Z A;  3H7S A;  1RRB A;  1RLF A;  2J0J A;  1SE9 A;  4WWO A;  1E8W A;  3W1S A;  2ZPN A;  4ZRJ A;  4E74 A;  2LXA A;  2C7M B;  2ZCC A;  2O6V D;  1P1A A;  3HHM A;  4XZ4 A;  2N7E A;  4FLH A;  2KTR A;  3HIZ A;  2K8B A;  2D2Q A;  1SGH A;  3C0R B;  4PS7 A;  4HPM B;  3R7Q A;  4TQ1 A;  5J18 A;  4CO7 A;  2FCM A;  4HXD A;  4IG7 B;  4NAW A;  2K6Q A;  2CHX A;  4W9H A;  1XD3 B;  4BBN C;  2WWZ A;  4II2 B;  3T9L A;  4GDK A;  1WZ3 A;  4IUM B;  3UIP B;  2JT4 B;  4FJV B;  3QJZ A;  1CMX B;  1V5T A;  3RT3 B;  3V6C B;  3O65 B;  3ZRC A;  1IYF A;  4OVV A;  2JXX A;  4EUT A;  1H4R A;  3AXC A;  4ICU A;  2LGD A;  3QWZ B;  4F8C B;  2FCQ A;  2M0X A;  2KQ7 A;  2NBU A;  4KIK A;  5J17 A;  1L2N A;  4I6P A;  3ZTC A;  5EDS A;  2MX2 A;  2CHZ A;  2PE9 A;  3ENE A;  4NAW B;  3B0A A;  2KHW B;  3MTN B;  2G3Q B;  4YL8 A;  2WX0 A;  3ZNI D;  3HK0 A;  2O2V A;  1TBE A;  3QX1 A;  4GDK B;  3ZNZ B;  5D94 A;  1L7Y A;  2ZJD A;  5E6O A;  3KUZ A;  3IFW B;  2VRR B;  5IAA C;  5JH5 C;  3X23 A;  3TCA A;  4ZRI A;  3L10 B;  1WJN A;  3N32 A;  4MGI E;  3M62 B;  1UZX B;  4IC7 B;  2FAZ A;  3JW0 X;  3AU5 A;  3TBL D;  1Z2M A;  2I1J A;  2K6D B;  4KDI C;  1HE8 A;  3VQI A;  2DZI A;  5LXI B;  2CKH B;  2BYE A;  1OGW A;  4HWI B;  1V86 A;  3NY5 A;  4K1R B;  3VHT C;  2FNJ B;  4GSW A;  4KDL B;  1NDD A;  1WGR A;  4ZDV A;  2MBH A;  2KDF B;  2DAJ A;  3NZU A;  2O6V A;  1D3Z A;  5D6J B;  1V6E A;  4JIO U;  1GUA B;  3QHT A;  3SU8 X;  3TIX A;  5KHQ A;  1I42 A;  3I3T B;  2CR5 A;  1UD7 A;  1WRD B;  4NNJ B;  4DHZ E;  1V2Y A;  2N4F A;  4BKS D;  4W9F A;  3ZTD A;  4NQK E;  3R7R A;  1E8Z A;  3IBE A;  4NJ6 A;  2L76 A;  3EEC A;  3TMP B;  2O6V B;  4EFO A;  3PRZ A;  3MJW A;  2KLC A;  4GN1 A;  3A33 B;  4WWN A;  5CHV C;  2MP2 B;  4ICV A;  3PRP B;  3WAP A;  2KTF A;  2KFK B;  3ML8 A;  2ASQ A;  4ASW C;  4KSL C;  2NVU I;  3UIN B;  3WAM A;  4DHZ B;  4PYU A;  3ZRF A;  2R2Q A;  2D07 B;  3VUX A;  2AL6 A;  3QK0 A;  2D10 A;  4GXB A;  2DEN B;  2DYM A;  2KD0 A;  4GU2 A;  3DVG X;  4DBG A;  1XQQ A;  2J0K A;  3A1Q A;  1YJ1 A;  2FIF A;  4XC2 A;  5BO4 B;  4W9G A;  3L54 A;  1P3Q U;  2IO0 B;  3A4R A;  1WXV A;  4TKN A;  3V61 A;  1J0G A;  1WI0 A;  4KZ0 A;  5G55 A;  4JLC A;  4A3P A;  1WIA A;  2L05 A;  4AWJ A;  4MGY E;  4B6W A;  2MRP A;  1J19 A;  1JRU A;  2BYV E;  2C60 A;  2K8C A;  1OEY J;  1A5R A;  1WJ6 A;  3L08 A;  1S1Q B;  2NBV B;  2JF5 A;  3EHV A;  1EO6 A;  1R4N I;  2D3G A;  4CHK A;  1WJ4 A;  2JZZ A;  2MSE D;  2KC2 A;  3RZF A;  2L7R A;  2MCN B;  3DVG Y;  1IPG A;  1QZE A;  1YX6 B;  3NOB A;  4MEL A;  1EF5 A;  1GNU A;  1Z5S B;  2KMA A;  3KH0 A;  2EMT A;  2KX3 A;  3PLV A;  2PJH A;  5CHF A;  3PT2 B;  2LD9 A;  1U4A A;  4HVB A;  2GBK A;  2JPH A;  4F7Z A;  4IM3 A;  2KDI A;  3PLU A;  1H8C A;  4OVU A;  2MBO A;  4G50 A;  3H1U A;  4AUQ C;  1P9D U;  1WGG A;  2LGY A;  4URK A;  4BKS A;  2C5L C;  2RD0 A;  2WDT B;  3OAW A;  3QAR A;  4KSK C;  4I6L B;  1WJU A;  3PHX B;  2NS5 A;  3VUY A;  1GC6 A;  4WQO B;  1ISN A;  1E8Y A;  1WGH A;  3PZD A;  5KHO A;  1WX7 A;  2R2O A;  4ANV A;  2KLG A;  2C7N B;  2L8J A;  1P0R A;  3ZKJ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...