4I6LB

Crystal structure of otub1 in complex with ubiquitin variant
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
75
structure length
75
Chain Sequence
GSMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQKLLFARKQLEDGRTLSDYNIHKESFLYLVLRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A strategy for modulation of enzymes in the ubiquitin system.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Ubiquitin thioesterase OTUB1
total genus 21
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2012-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4i6lB00
4GOCA 2ZPNA 4NPNA 4GGQA 3JW0X 1RRBA 4FADA 1XT9B 3Q3JA 3PS6A 3U8ZA 3JSVA 2GBMA 2KMCA 3KUCB 3WAMA 2FCQA 1F9JA 2G45B 1S3SG 2KZRA 2M4NA 4NJ6A 3VAWA 1XQQA 2GBRA 1OTRB 2MBBB 1V81A 4DWFA 1IPGA 3PV1A 4GIVA 3B08A 3H7PB 1LXDA 3OJ3A 2KQ7A 4EZKA 2XK5A 4NNJB 3I3TB 1WJUA 4B9KA 3ZRFA 3APCA 2Z59B 3ZNID 1NBFC 2CHZA 5J2RA 3OAWA 1UBQA 4DHJB 3T8MA 4W9KA 2LXAA 2NBVB 3RUIB 2MW5A 1UD7A 1WZ3A 2KFKB 3RCZA 2A5UA 1TTNA 2CU1A 2FNJB 2YVCA 3M63B 3RULA 5AEKB 2KTFA 2MCNB 3PLUA 3ZKJC 3HHMA 4I6PA 2DZJA 4EZLA 3A9JB 4ZDVA 5L83A 2KWVB 4RM8A 2MWSB 3UQBA 3OJ4B 3TCAA 1ISNA 1RFAA 1G6JA 1GJZA 3O65B 4A3OA 4TUUA 4YL8A 2AL6A 4HDOA 4FULA 4F7ZA 1C1YB 3QARA 3VDZA 4EUTA 3RT3B 3H6NA 3A1QB 4N9F4 2N4FA 1WGHA 2B3AA 2DX5B 3R3MA 4NAWA 2D3GA 2KWUB 4DHZE 2DZIA 2BYFA 5KHQA 3PHXB 3QCAA 4ICVA 1V86A 3JVZX 1EF1A 1ZGUB 4K7UA 4WWPA 5IAAC 1WMHB 4W9JA 1BT0A 4FHKA 1P98A 2KLCA 5D6JB 2NBUA 1E8YA 2R2OA 2BPSA 2RD0A 3PLVA 2DYOA 5JZEB 3W1YA 4HPLB 1RLFA 2KX0A 2ZZPB 4IM2A 1WXVA 1C3TA 3IFWB 4TQ0A 5G2NA 2N7EA 2IO1B 1E5WA 2UYZB 3EHVA 3ZDMC 1Q5WB 2IO3B 1WXMA 4BKGA 3MHSD 2KDBA 4M8NA 2LVOA 4IWPA 1VCBA 3V60A 3ZW3A 3HK0A 3RD2A 2JXXA 2K6DB 2MA9B 1KOTA 2BYEA 1FXTB 2KQSA 4F8CB 2V4LA 3ZNHB 4KSLC 3V62A 4AJWA 2WDTB 4G3XB 4W9HA 2K6QA 4GDLB 5CHFA 4TV3A 1XD3B 5LLIA 5D2MB 5IA7A 5EDSA 4E71A 4FHJA 3ZTDA 4KSKC 5AZHA 3UQAA 3VUWA 2HD5B 2YLMA 2DHZA 2I1KA 5E6NA 2JPHA 3WAOA 4MM3A 1WI0A 3PHWB 5KHOA 2AYOB 2O6VA 2GBNA 5J18A 1P9DU 4GXBA 4HCNB 3ZLZA 1YD8U 3CSTA 1WM3A 1RAXA 2JZZA 3PRZA 1E8WA 1S1QB 1R4NI 2BGFA 2K8CA 4K1RB 3VUXA 3W1SC 4ANVA 2BWES 2MX2A 2DYBA 2CHXA 2NPTB 4KZCA 4FLHA 4TQ1A 1OEYA 3ZVVA 2OJRA 3CSFA 1MG8A 3VTVA 3QC8B 3ALBA 4PS7A 4MJSA 3VFKA 3RZFA 2CHWA 4HK2A 1H4RA 2MQJA 2N9XA 3TIXA 4ANUA 2K8BA 2WX0A 4PYZA 1Z2MA 3DBHI 5TR5A 3V61A 3PRPB 2L7RA 3NZSA 3L08A 1PQSA 4NQKE 3A9JA 2LASA 1T0YA 2N1WA 2HTHA 4M8MA 5CTRC 4LCDE 3VUYA 5L95C 4GSWA 3MTNB 3S2AA 3TJPA 2LVPA 3L17A 2C7HA 4G11A 3M62B 4MSQB 4MGZE 2EKEC 2KC1A 3KUDB 3ZTCA 2LI5A 4AJYB 4EFOA 4JL9A 4IM3A 5FR6A 2MBQA 2KJ6A 5DPRA 2KOXA 2W9NA 3HIZA 5BO4B 3WA0A 2G4SA 1E8XA 2RSUA 4JQWC 4F1SA 1J8CA 3L13A 1Z5SB 2FCSA 2LUEA 3K9PB 2LGDA 1I42A 4W9LA 2JT4B 1YJ1A 4MGIE 5LXHA 3SHQA 2KMAA 1V9JA 3N3KB 1GC7A 3Q3FA 1WX9A 4W9GA 1TBEA 3ZNZB 2RGFA 2RR9A 4GMVA 2JZ3B 3DCGA 3V6CB 2A4ZA 4DDID 3BINA 3NY5A 5J17A 3DDCB 2GBKA 4KZ0A 3KYCD 3R66C 1ZW7A 5CHWA 1WM2A 2ZJDA 2J0KA 1SE9A 1WRDB 2NBWB 4FJYA 1A5RA 2KVRA 3V6EB 2KNBA 2IBIB 2KN5A 3AU4A 4GDLA 4W9EA 4BKSA 3PREA 2IZVB 1GC6A 3AI5A 2G3QB 4BKTA 3ZUNA 4FJVB 1YX5B 1UELA 4RM9A 4K7SA 1KJTA 4HVBA 3ONSA 4IW0A 2KX3A 2K1FA 2KTRB 4GDKB 1YX6B 2QHOA 2KANA 3OLMD 3WAPA 4ANXA 3H9DA 3DVGX 2GBJA 1V2YA 4MH0E 2J7QB 2O6VB 4ZRIA 3ZO5B 3EECA 1V49A 4LDTD 5DCNA 4JLCA 1UGMA 1V80A 4GU2A 5E6OA 2BKFA 4KIKA 3UIOB 2JVCA 1IP9A 3PVLA 4JIOU 5JH5C 1E8ZA 2FIDA 3RZWC 4PS3A 5C1ZA 1VD2A 1GUAB 4ANWA 3U7DA 3SU8X 1Q1OA 2LRWA 4J6IA 1WZ0A 3UINB 2KHWB 3QJZA 1LM8B 1R4MI 3C0RB 3CMMB 4GB9A 2PPHA 4KIKB 2L8JA 4LJOB 2PJHA 4HLEA 5AZFA 4MELA 3APFA 2IYDB 2IO0B 4MEMA 2K39A 2D11A 4NY0A 2ASQA 3KW5B 5HKHA 1WFYA 3LDZE 1EF5A 2KFJA 2KFKA 4HWIB 4W9CA 2C60A 2R2QA 3QX1A 5JHAA 2D10A 1WX8A 1M94A 2FIFA 1QZEA 3W1SA 2MBEA 1WGYA 3VXWA 4BKSD 4CYEA 3B1LX 3DOWA 3VTUA 2EMSA 2XBBC 2JRIB 2L00B 2NR2A 1E7VA 2FUHB 2ZCCA 3DQVA 2ZEQA 1GG3A 3L54A 2KDEB 4BFRA 4WWOA 4E74A 2HE7A 5CX3A 1UH6A 4NJ7A 1V5TA 3D32A 4WWNA 3IHPC 2LVQA 4OVVA 5CHVC 2LWPA 1UBIA 1YQBA 4OVUA 3TBLD 4II3B 4WAAA 1WXAA 3R7QA 1WE7A 3IG3A 4BOSC 4BBNF 2KKCA 4XX5A 3K9OB 4EZJA 3A4RA 2OOBB 3GOEA 4AWJA 1P1AA 4WJNA 3APDA 1WJ4A 4P7IA 4AOFA 1OGWA 2N9PC 3QIJA 4K81A 2ZNVB 3JSVB 1IYFA 3DVNV 4DBGA 2L0FA 3DBLI 4X57B 2MBHA 4WJOA 4EEWA 1V5OA 1P3QU 3B0AA 2KD0A 2FCNA 1OQYA 3VQIA 2NVUI 3HM6X 1WE6A 4BBNC 2DYMA 2JF5A 5C23A 2O2VA 2LD9A 2XK5B 1UZXB 1HE8A 2LJ5A 1EO6A 4NQLB 3DBRI 2DAFA 3N32A 2BF8B 3SD5A 1CMXB 3JYUA 4JGHB 3QQ8B 5DPTA 2JWZA 1KLVA 2KLGA 3PZDA 1NI2A 2ZCBA 3QAQA 5G55A 3UIPB 2IY1B 3ML8A 4KDLB 3A9KB 3CF6E 2M8SA 3WIMA 4BVUC 2EMTA 4ICUA 3X23A 2G4DB 3P2BA 2BYVE 2KJHB 1L2NA 3AXCA 4MSMB 4PYUA 2J0JA 1WGGA 2NCNA 4HDQA 1H8CA 2L76A 4MJSB 4II2B 4I6NB 2PEAA 3ENEA 4K7WA 4ASWC 2BWFA 2MP2B 4NAWB 4G50A 1I35A 1SIFA 2MSED 1V6EA 3DVNU 2JY6A 3VH3B 4IUMB 2KXJA 3ZDTA 4DHZB 2KDIA 5AZGA 2AL3A 4LJPB 5D94A 4WQOB 2V1YA 3VVWB 3NOBA 1SGHA 4A20A 2M0XA 2CS4A 4DK5A 3NHEB 2LGYA 4AP4C 3WANA 2FCMA 3AULA 3ZIMA 2FAZA 2K8HA 2M17A 1WX7A 3NZUA 3L10B 3ZNGC 2C7MB 3GZNI 4E3CA 2N7DA 3TL5A 2KC2A 2ZNVC 3ECIA 1WR6E 4DXAB 3QA8A 2JUOA 3EC8A 3N30A 3UF8A 3ZRCA 3TMPB 2VRRB 5D7GA 1L7YA 2V3SA 4B95A 2AEHA 2ZVOA 2LRUA 2KDFB 2DENB 1LQBA 2REXA 1WY8A 4WJPA 4HPMB 1EUVB 3HM3A 2C7NB 2O2VB 3PPAA 2UWQA 2XEWA 1Y8RC 4AUQC 4HJKA 4ZYNA 4CHKA 1X1MA 2GMIC 1WIAA 2N9EB 4DHJD 1WH3A 2KO3A 2M1MA 1U4AA 2NPTA 4EOYA 3SDLC 3PGEA 2CKHB 3QHTA 1ZKHA 2LZ6A 3EFUA 3ML9A 1K8RB 3AU5A 2JRHA 4KV2A 2KJRA 2L05A 2MBOA 3LJ3A 2PE6B 4FBJB 3RYTA 1WXSA 4GDKA 4DDGD 3A9KA 4GN1A 2K25A 3T9LA 4EKUA 1E90A 2KK8A 5LXIB 1OEYJ 2WYQA 2C5LC 2L3ZA 4W9IA 4FJZA 4HCPB 4XZ4A 1WGDA 5DPWA 4URKA 3A4SC 4RMAA 3M95A 4KDIC 3R7RA 4IWQA 4WJQA 2PE9A 2LXCA 1JRUA 1LFDA 2GOWA 2AWTA 2D07B 4PS8A 2N1VA 5DPSA 1WJNA 2MLBA 2IO2B 2MP2A 2O6VD 3A33B 2ZPYA 1E7UA 3DBSA 1WR1A 3M3JA 3L16A 2DZKA 3VH4B 4I6LB 3H7SA 4B6WA 3KH0A 4IC7B 2DZMA 1AARA 2KWCA 2D2QA 4BOZB 1NDDA 3DVGY 3NS8A 2LGXA 4KVGB 3PRMB 2Z0EB 3VHTC 1P0RA 1GNUA 1J19A 3PSEB 4IM0A 5GMVA 2ZVNA 1KM7A 3A1QA 3H1UA 3MJWA 4MDKE 2L0TA 3UGBB 1WYWB 1Q0WB 3VTWA 2I1JA 3IBEA 3PT2B 2WWZA 1WF9A 2J0MA 4HXDA 3WALA 3QWZB 3U30A 1WMHA 2RPQA 4A3PA 3X0WA 4IWOA 4TKNA 4CO7A 4ZRKA 4ZRJA 1TZ1A 2Z0DB 2WX1A 1WJ6A 1J0GA 4FA6A 2CR5A 2MRPA 2BKRB 2DAJA 3IVFA 4MGKE 4M0WB 2C9WB 2HJ8A 3PTFC 3L0WB 4G0NB 3KYDD 4W9FA 1YIWA 3DPDA 4IG7B 4LDTB 2NS5A 1D3ZA 5JHBA 4FN2A 3QK0A 3BY4B 4XC2A 2Y5BB 1TGZB 2IY0B 3KUZA 3KVFB 4W9DA 2KTRA 4MGYE 3H7PA 1WGRA 5E6PA
chains in the Genus database with same CATH superfamily
1HTOA 5AUIA 3JW0X 1RRBA 4FADA 3Q3JA 5H8YE 2KMCA 1F9JA 2KZRA 1E7PB 1MJDA 2BQQA 4NJ6A 3VAWA 1XQQA 2BB6A 4ARIA 1UWMA 3W9CB 3PV1A 4S0RA 1C77A 1C79A 2Z59B 5T8IA 3OAWA 4W9KA 1TT5B 2IGHA 2N7JA 1I4RA 2NBVB 1C76A 1WZ3A 2KFKB 1TTNA 1VLBA 1QF6A 2KTFA 1SE3A 3HHMA 1VZ7A 2JWUA 1HXYD 3BYYB 4HRSA 2BYTA 2KWVB 4RM8A 2L83A 1RFAA 1J7AA 3TEZA 1G6JA 1NYQA 1GJZA 1ACCA 4TUUA 4FULA 4F7ZA 1PUTA 3FKYA 2I38A 3H6NA 2ON8A 1WGHA 3AE7B 5KHQA 1Y56A 3ETRA 3B9JA 1EF1A 4WWPA 3Q8CA 1WMHB 4XWWA 1P98A 2KLCA 2CU3A 2BPSA 2DYOA 4WAFA 1WXVA 3BK1A 3P4PB 1C3TA 4TQ0A 1AW7A 4M01A 3EHVA 1WXMA 3P4SB 3V60A 2JXXA 1T6BX 1KOTA 2BYEA 1FXTB 1WGKA 2PVOD 2WDTB 1DGJA 1I4PA 5LLIA 4WURA 3P4RB 5IA7A 4HEA1 3ZTDA 2DBYA 2I1KA 3IT4B 3PHWB 1JWAD 2O6VA 1ESFA 1FFUA 1P9DU 4HCNB 1YD8U 3CSTA 2NPTB 2CHXA 4TQ1A 1KTKA 1MG8A 4ZHPA 3QC8B 1C78A 3PO0A 4HK2A 2BS2B 2NTTA 4PYZA 1F0ZA 2XN9C 2G9HD 1JWMD 2HTHA 4REZA 4RGOS 4LCDE 3VUYA 5L95C 3MTNB 3N20C 3GE8C 4Q2JA 3L17A 1VR9A 2VH1A 2KC1A 3KUDB 3DWGC 2JZPA 4JL9A 2MBQA 1SJHD 5BO4B 3ZGZA 4F1SA 5LXHA 2OJWA 3N3KB 4OZAA 2RGFA 1OFFA 2RR9A 4K3CA 1MFWA 4YTPB 3DCGA 3AM9A 3NY5A 1B9RA 3DDCB 2GBKA 2H89B 3KYCD 3GS2A 3Q3NC 2NBWB 1WRDB 4H2AA 1FNWA 1RWSA 1Q10A 2KNBA 2IBIB 2PIAA 4C00A 4M0WA 4BKTA 3ZUNA 2KACA 1XEEA 4HKQA 4YXDB 1EWCA 4IW0A 1ET6A 2K1FA 3OLMD 1FXIA 2GBJA 1V2YA 4ZRIA 3EECA 1YJIA 1QOFA 4JLCA 4KIKA 4N59A 5JH5C 1NYRA 1QLBB 3RN9C 3AE2B 1GUAB 3Q2AC 1Q1OA 3UINB 3QJZA 1LM8B 3TEXA 2M0AA 3CMMB 2PPHA 4KIKB 5AZFA 2IYDB 1CQVA 4MEMA 4USAA 3KW5B 4B0MA 3MFGA 1EF5A 2KFJA 4W9CA 2WXNA 2JSVX 1LO5D 3LXFA 2WXKA 1GAQB 2MBEA 3VXWA 3DOWA 1L0XB 3B2FA 3WCQA 2NR2A 3L54A 2ZEQA 2KDEB 3RNGC 4C56C 5CX3A 1UH6A 3D32A 3IHPC 2LWPA 1HEZE 4OVUA 3TBLD 1KFYB 4YTMB 2Y5CA 1WE7A 2KKCA 4XX5A 4EZJA 3A4RA 1FMAD 3NVZA 3DVNV 2KMMA 2E3TA 4X57B 4WJOA 1XXGA 3B0AA 3KWLA 4WH4A 3U4EG 1I4QA 2JF5A 5C23A 3AE9B 2LD9A 1TS2A 2XK5B 2KDMA 1HE8A 3ZXVA 3Q14C 3N32A 4RF0A 3JYUA 1KLVA 2KLGA 5G55A 3RNBC 2IY1B 2M8SA 2JXTA 3RNAC 2AQ3B 3T3NA 2WDVB 4PYUA 1YN3A 2PEAA 4K7WA 4G50A 4L1BA 1J7CA 3DVNU 4RF1A 2JY6A 2LGSA 2FBWB 4IOIE 4DHZB 2KDIA 5IOIA 3BVGA 2V1YA 3NOBA 1SGHA 3V05A 2X8XX 3NHEB 2LGYA 3SEBA 4AP4C 3BK2A 3WANA 3ZIMA 3I5JC 4WQMA 2M17A 3GZNI 4E3CA 2N7DA 4WWMA 3TL5A 1WR6E 4DXAB 1QOGA 2JUOA 1TIFA 3EC8A 4C7ZA 3N30A 2VRRB 2V3SA 4B95A 2AEHA 2LRUA 2KDFB 1RYJA 5BYQA 2OEDA 2REXA 4HPMB 2C7NB 3O13A 2UWQA 2AQ1B 3KLSX 4DHJD 1WH3A 2N9LA 1FRRA 2NPTA 2PKOA 3PGEA 3QHTA 3AEBB 3AU5A 2KJRA 1R4MB 2L05A 1WXSA 1L4ZB 1M4VA 2K25A 2JYTA 1OEYJ 2C5LC 2L3ZA 1MVKA 4HCPB 3A4SC 4IWQA 2PE9A 2LXCA 2GOWA 1UUPA 2D07B 1JQ4A 1WJNA 4HLEA 2K3UA 2ZPYA 1E7UA 3KH0A 1IBXB 4C80A 2BTEA 2D2QA 4LNNA 1FPYA 1SIJA 1FCLA 2LGXA 4KVGB 3PRMB 1GNUA 4IM0A 3A1QA 3MJWA 1Q0WB 3VTWA 2I1JA 2WWZA 2H88B 2WXIA 3U30A 2RPQA 1HA5A 4TKNA 3TEWA 1TY0A 4ZRKA 4ZRJA 2B76B 2Z0DB 2WX1A 2BKRB 4MGKE 4M0WB 3GP7A 3PTFC 3KYDD 4IG7B 2JQRB 2MJEA 1D3ZA 1ZPSA 3GE3C 4FN2A 4XC2A 3BY4B 1TGZB 2V3NA 4MGYE 2WS3B 3U7ZA 2ZPNA 2WHIA 1XT9B 3U8ZA 3JSVA 2GBMA 2IJ0A 3WAMA 2M4NA 1ZOYB 4YTNB 2MBBB 1V81A 3B08A 3H7PB 1LXDA 3E56A 2KQ7A 2V4IB 4NNJB 2GLSA 2R61A 2M19A 4DHJB 3T8MA 2MW5A 3RCZA 2A5UA 2CU1A 3RULA 4XYCA 5AEKB 2HDEA 2MCNB 2DZJA 3DBRB 5FR3A 1YN5A 3HVDA 5L83A 1TS3A 3DHIC 3OJ4B 2MH7A 3TCAA 2AL6A 1D5ZC 1T0RC 3VDZA 4NAWA 4DHZE 2KN4A 1FIQA 1V86A 3JVZX 3ZJVA 5IAAC 3FAHA 1BT0A 4A9AA 4FHKA 2NBUA 1E8YA 2R2OA 2BT6A 2RD0A 3RI7C 2PLPA 4HPLB 4IDIA 3ZXRA 2ZZPB 3AE3B 5IKCM 1Q5WB 4BKGA 1FRDA 2BS4B 1VCBA 2MA9B 1SBBB 3HVZA 2W82A 4GLSC 4TV3A 1HZ5A 3AE8B 1XF5L 5D2MB 1L4DB 5EDSA 4FHJA 1EWYC 4KSKC 5AZHA 3UQAA 3VUWA 1SE2A 2JPHA 3TUOA 3BZDB 3WAOA 1WI0A 1JW9D 5KHOA 4YSZB 5J18A 4OW0A 3VR8B 1F2RI 5I4DA 1RAXA 1GOZA 2JZZA 1E8WA 2BGFA 4K1RB 3V3XA 3VUXA 4ANVA 4R3DA 1OEYA 2NTSA 2XNAC 3AECB 3VFKA 1FNVA 3RZFA 2CHWA 2MQJA 2N9XA 4KKIA 1FO4A 3TIXA 1I4XA 4ANUA 1IGCA 4ZRQA 3PRPB 2L7RA 1N61A 2D3AA 2LASA 1MI0A 4M8MA 4GSWA 3S2AA 3TJPA 2LVPA 4MGZE 1YN4A 3AEGB 5EE1A 5BMGA 3HIZA 3TSSA 3WA0A 4JQWC 1E8XA 2GRIA 2RSUA 1WSPA 3K9PB 4MGIE 3SHQA 1STEA 2V9HA 3Q3FA 1GC7A 1PGAA 1WX9A 4W9GA 3ZNZB 3NVYA 4GMVA 3RMKC 2A4ZA 5J17A 4ZOHC 1ZW7A 4MH8A 2LFIA 1SE9A 4FJYA 1ET9A 1A5RA 2ACZB 3AU4A 1DOYA 3CIRB 3AI5A 1TKEA 1XO3A 1YX5B 4RM9A 2VZKB 4K7SA 3ONSA 2KX3A 2KTRB 3EUB2 3H9DA 3DVGX 3MC8A 2O6VB 3ZO5B 3I9V1 1B1ZA 4LDTD 5DCNA 1UGMA 1V80A 4GU2A 1GB4A 1V97A 2FIDA 3PZ7A 4PS3A 2LHEA 3KQ4A 2CJNA 2V3PA 4IKGA 4P16A 3NVVA 3AE5B 2WXMA 1NEKB 2D3CA 5HI1A 1IBXA 4MELA 1ZUD2 5FK9C 4NY0A 2K39A 5HKHA 1WFYA 1JCKB 1GPXA 2R2QA 3Q8FA 2D10A 2FIFA 4CYEA 1WGYA 2N0SB 4BKSD 1C4CA 3B1LX 2EMSA 2INDC 2JRIB 3DQVA 3BWUD 3HRDD 1YQBA 4L2YA 1PYWD 1KF6B 4J3OD 2V0GA 4BOSC 1YQ4B 3K9OB 2OOBB 3GOEA 4AWJA 3APDA 2KVZA 1MHHE 2WU5B 4K81A 2ZNVB 3JSVB 4DBGA 1PGBA 2L0FA 2MBHA 1NENB 1BMLC 5D3DA 4RH6A 3R2TA 2QMTA 3RPFC 2IGDA 1IGDA 2I2YA 1FXAA 2DAFA 3SD5A 2BF8B 5DPTA 4M00A 2KAJA 3AE1B 3AV8A 3BIID 3N1ZC 2KJHB 2J0JA 2K5PA 4JWSC 4AS1A 1PGXA 3GZNB 1FCCC 2L76A 4MJSB 4II2B 4I6NB 3ENEA 4ASWC 2MP2B 3W5VB 4DQOC 1YOVB 3N1YC 1SIFA 2MSED 1V6EA 3Q3MC 1I4GA 2QIEB 3VH3B 2QJLA 2IPKD 3ZDTA 2DWQA 1RM6C 1E10A 2WXFA 1FEHA 2AL3A 1V8CA 2INNE 1N6ZA 3VVWB 2M0XA 1QKZA 2CS4A 4DK5A 2K9XA 3B2GA 1L5PA 1ZP0B 2FAZA 1WX7A 1QT9A 1TYGB 2LEKA 5MPOA 4BZAA 2ZNVC 1TS5A 4JX1C 3AEAB 4DXFA 1MHXA 3TMPB 1L7YA 1SE4A 1LQBA 1WY8A 5BYSA 1P7FA 4US9A 2XEWA 1Y8RC 3P42A 4KX6B 2N9EB 5EE0A 2M1MA 3P63A 1U4AA 3SDLC 1ZKHA 1K8RB 2WXRA 1YQ3B 3RYTA 4GDKA 4EKUA 1ZDXA 1DYQA 4WIPA 2WYQA 4W9IA 4RMAA 4EE2A 1J7BA 2LMCA 1YNTE 4CQNA 2MLBA 2IO2B 3A33B 5D6JB 1JALA 1WR1A 2DZKA 1F77A 3Q6BA 1L6UA 1TJEA 4IC7B 1AARA 4S17A 3DVGY 3VHTC 2Z0EB 2WXPA 5GMVA 3IXSA 2LHDA 3UGBB 3IBEA 3PT2B 2RDBC 4HXDA 2WU2B 1JRPA 3X0WA 1C9FA 4HPPA 4CO7A 1P7EA 2L1AA 2ONQA 4FA6A 2DAJA 5IN7A 2HJ8A 4G0NB 2CJOA 2QC8A 1YIWA 3DPDA 3P1MA 2NS5A 4N6EB 3KUZA 4W9DA 2KTRA 3H7PA 1R4NB 4NAMA 4NPNA 4P1BC 3PS6A 2FCQA 2G45B 1TY2A 1S3SG 4LK0M 4OZCA 4DWFA 3KWVA 1IPGA 4GIVA 3OJ3A 4EZKA 1A70A 4ZRPA 3I3TB 1WJUA 4B9KA 1OQQA 2N9KA 2YEPF 3IAM1 3RUIB 2YVCA 3M63B 3W2DA 3PLUA 1FNUA 3A9JB 4ZDVA 3LB8C 1VRAB 1N63A 1YMHE 3O65B 4YL8A 1NVID 3OG5A 1C1YB 3QARA 2JU6X 4EUTA 2Z8LA 3RT3B 3A1QB 4N9F4 2N4FA 3R3MA 2B3AA 2DX5B 3N9YC 2WNMA 4XWTA 4ICVA 1BUIC 1ZGUB 4K7UA 4ACFA 4W9JA 1VZ6A 3PLVA 5JZEB 2DLBA 4ITKA 2KX0A 4IM2A 5G2NA 2IO1B 1E5WA 3RNFC 3ZDMC 2IO3B 2LVOA 2K6DB 3NG0A 4XDDA 2KQSA 4F8CB 2V4LA 4KSLC 3V62A 4AJWA 3PZ8A 4G3XB 4W9HA 3AEFB 4GDLB 3MJ5A 4TMAB 1XD3B 2KT7A 2RDHA 2WLBA 4C4VA 3BVZA 3GB1A 2DHZA 2BBCA 5E6NA 2AYOB 2GBNA 4GXBA 5G5HA 4LTUA 3ZLZA 5HFYA 3PRZA 1S1QB 3W1SC 2BWES 2DYBA 5EE3A 3CSFA 4PS7A 4MJSA 2L52A 2K8BA 2WX0A 3DBHI 3V61A 3NZSA 3A9JA 1T0YA 3MC9A 5CTRC 2WXLA 4KKJA 2C7HA 1RFKA 2DNFA 3ZTCA 1HZ6A 4EFOA 5FR6A 1XLQA 2K22A 5DPRA 1XCTL 1J8CA 2G4SA 3L13A 1Z5SB 2FCSA 2LUEA 1I42A 4W9LA 1YJ1A 1JWUD 1K53A 5LNK1 4DDID 3BINA 3R66C 4KGTA 1WM2A 2ZJDA 3DHHC 2J0KA 2KVRA 3V6EB 4GDLA 4W9EA 3AB5A 4BKSA 2IZVB 2G3QB 4FJVB 4C4VB 1KJTA 2WXOA 3LYYA 2RPVA 4GDKB 1KH0A 4KGRA 4MH0E 1I4HA 1V49A 1PDXA 2JVCA 4YSYB 4XDCA 3PVLA 4JIOU 1E8ZA 1IUEA 3RZWC 1MG4A 1N62A 2WXHA 1VD2A 4ANWA 3U7DA 3SU8X 4J6IA 2QEJC 5JXVA 1WZ0A 2KHWB 2E6XA 3C0RB 1R4MI 1EM7A 4LJOB 2L8JA 3APFA 2D11A 1D6EC 2ASQA 3LDZE 4JWUC 2KFKA 4HWIB 1N60A 2WP9B 3ZJTA 2SAKA 4PT5A 3BVMA 1C4AA 1M94A 1WX8A 1QZEA 3W1SA 5JHAA 3Q8BA 2GI9A 3NZ3A 3W5UB 2L00B 1E7VA 1GG3A 3AEDB 3N1XC 1K50A 4OVVA 3URYA 1YJJA 1EU4A 2PTLA 2MJ3A 4II3B 5GXGB 4WAAA 4BBNF 4QAYA 1L0YB 4WJNA 1LGRA 2N9PC 3I63C 1IYFA 4A90A 1VJKA 3FILA 4EEWA 1V5OA 3VQIA 1QOAA 2KD0A 2FCNA 1OQYA 1C4PA 1JROA 3P4QB 2O2VA 1PFDA 1JMLA 1UZXB 2LJ5A 1EO6A 1QOBA 3DBRI 3FILB 1CMXB 4JGHB 4ZHOA 2JWZA 2NMQA 2WXGA 3IAS1 2ZCBA 3UIPB 4P6VF 3FC4A 3ML8A 3WIMA 3NUHB 2EELA 2IGGA 3X23A 1D5MC 5AUKA 1ZE3D 2EKIA 1R7SA 3P2BA 2BYVE 4DXGA 1L2NA 2KYWA 5IP4D 2NCNA 2PMVA 1FM0D 4MT5A 4NAWB 2KXJA 5AZGA 5D94A 2GB1A 3AH7A 2FCMA 3AULA 2K8HA 3NZUA 4L23A 2KC2A 3AE4B 3QA8A 5H92C 4XGAB 2J42A 2DENB 3I57A 5EE9A 4LLGM 2ZW0A 4KGSA 3HM3A 3PPAA 4ZYNA 1WIAA 1HQRD 3SFDB 1JWSD 3EFUA 2KQ4X 2MBOA 4RNAA 1AYFA 4DDGD 4GN1A 1BXTA 1E90A 2KK8A 4XZ4A 4FJZA 2WDRB 2VZKD 1ROEA 2K0PA 4URKA 3R7RA 1F2RC 1LFDA 4ARCA 5DPSA 3R2IA 3RNEC 2MP2A 2O6VD 3M3JA 3L16A 4I6LB 2Y5PA 2VH2A 4B6WA 2DZMA 3C19A 4BOZB 1NDDA 4NJCA 4ZYSA 3DBHB 1J19A 2ZVNA 3EA6A 3H1UA 1WF9A 3WALA 2RMMA 4TSSA 4IWOA 1TZ1A 1WJ6A 1TZOA 2W55A 3IVFA 3Q8EA 2C9WB 3L0WB 2QILA 4RGNA 5JHBA 5BMIA 2Y5BB 1E9MA 2IY0B 3KVFB 1F1HA 1WGRA 4GOCA 4GGQA 5BMHA 2ZW1A 3KUCB 1OQRA 2GBRA 1OTRB 1WWTA 4HROA 2XK5A 3ZRFA 3APCA 1KRHA 3ZNID 1NBFC 2CHZA 5J2RA 1UBQA 3DHGC 2LXAA 1T5XD 1UD7A 2FNJB 3DWMA 2FE8A 3ZKJC 2W3SA 1D5XC 4I6PA 4EZLA 3UQBA 2MWSB 2MEKA 1ISNA 4A3OA 4HDOA 2WXJA 1CK1A 1UNSA 2D3GA 2KWUB 2DZIA 2BYFA 4PK1A 3PHXB 3QCAA 4B0EA 4RFBA 1SSNA 2HJ1A 1FFVA 2MHJA 3W1YA 3ZYYX 1RLFA 4XE0A 1QQRA 1FD6A 3IFWB 1ENFA 2N7EA 2UYZB 2LGIA 3MHSD 2KDBA 4M8NA 4IWPA 5HHDG 3ZW3A 3HK0A 2PVGC 3RD2A 1JWBD 1XLPA 1I7HA 3E9SA 2OHFA 3ZNHB 2K6QA 5CHFA 1QILA 2WXQA 2Q5WD 4E71A 3EFCA 2HD5B 2YLMA 3NRZA 4BAXA 1TKYA 4MM3A 1XCQL 2RDGA 1WM3A 4YSXB 1R4NI 2K8CA 2MX2A 4KZCA 4FLHA 3NVWA 3ZVVA 2OJRA 3VTVA 4RCOA 3ALBA 1H4RA 3AN1A 4HKZE 1SJED 1TS4A 5TR5A 1Z2MA 3L08A 4LNIA 1PQSA 4NQKE 2N1WA 1WRIA 4G11A 3M62B 4MSQB 2EKEC 2LI5A 4AJYB 1TKGA 4N58A 4IM3A 1D4BA 2KJ6A 2KOXA 2W9NA 3SR6A 1CJEA 2PW9A 2M56B 1DOIA 2LGDA 2JT4B 1VZ8A 2KMAA 1V9JA 4P1CC 1TBEA 1KLUD 2JZ3B 3V6CB 4JPSA 4KZ0A 5CHWA 2KN5A 3PREA 1DOXA 1GC6A 3MC0B 4OHJA 1UELA 5C2TB 4HVBA 1V1PB 1YX6B 2QHOA 2KANA 3WAPA 1UGJA 4ANXA 2J7QB 5E6OA 2BKFA 3UIOB 1IP9A 5FKAC 1UF0A 5C1ZA 5HG2A 1T0QC 3CWIA 4UDUC 2LRWA 4GB9A 2PJHA 2IO0B 2UU7A 1ZXHA 2YEPB 2C60A 5TSSA 4RGTA 3QX1A 4NZLB 1N5WA 1KLGD 2X38A 1NI3A 4LNOA 3AMZA 4D2KA 2IDYA 3RNCC 3VTUA 2JYEA 2XBBC 3U52E 4A6QA 1SXTA 2BS3B 2FUHB 1E6EB 2SEBD 2ZCCA 4BFRA 4E74A 4WWOA 2HE7A 1V1OA 4NJ7A 1AWDA 1V5TA 3Q69A 4WWNA 2AX5A 4MACA 3U2SC 2LVQA 3J9CA 5CHVC 2QDFA 1UBIA 1WXAA 2Y3AA 3R7QA 3IG3A 1HTQA 3DBLB 1P1AA 1ZXIA 1WJ4A 4P7IA 2WQYB 1OGWA 3BYTB 4AOFA 4A55A 3QIJA 1VDVA 5C3JB 3DBLI 1P3QU 2NVUI 2W54A 3HM6X 1WE6A 4BBNC 2DYMA 4AQ7A 2MJDA 4US8A 1E0ZA 1CZPA 5IO9A 3MHZA 4NQLB 3IT6B 2L32A 3MP9A 4A8XC 3QQ8B 3PZDA 4YWGG 1NI2A 3QAQA 1K51A 1EU3A 3AEEB 4KDLB 3A9KB 3CF6E 1N5XA 4BVUC 2EMTA 4ICUA 2G4DB 5BYRA 4YT0B 3AXCA 4MSMB 1AN8A 2JX5A 2WGSA 5E6JA 1WGGA 4HDQA 1H8CA 2BWFA 1I35A 4HJGE 1GB1A 3ZJUA 3VRBB 4IUMB 1WXQA 4LJPB 5G5GA 2INPE 4WQOB 2BB5A 2WDQB 4FXCA 4A20A 3Q3OC 1F52A 1T3QA 3VR9B 2LJIA 3TEYA 3L10B 1SEBD 1XLNA 2C7MB 3ZNGC 3ZQ4A 3UI3A 4LNKA 3ECIA 3NJTA 3RFZB 3UF8A 3ZRCA 3L4PA 5D7GA 2ZVOA 4OVZA 3ABVB 3HUIA 1MPEA 4RGMA 4MM3B 4WJPA 1K52A 1EUVB 3AE6B 2O2VB 4AUQC 3R8BA 4HJKA 4JE3B 4CHKA 1X1MA 2GMIC 4OZBA 2KO3A 1SB3C 1T0SC 1V1PA 4EOYA 3NS1A 2CKHB 2LZ6A 3ML9A 2JRHA 3Q8AA 4KV2A 4FBJB 3LJ3A 2PE6B 2QSDA 3A9KA 3T9LA 3T3OA 5LXIB 4M02A 1WGDA 5DPWA 2D3BA 5D3IB 3M95A 4KDIC 4WJQA 2D5GA 1ZDVA 1JRUA 2AWTA 2J52A 4PS8A 2N1VA 2BVCA 3DBSA 3VH4B 4C7YA 3H7SA 3H8HA 4LNFA 4O1NA 2KWCA 2FUG1 2BW2A 3NS8A 3VRAB 1WYGA 1P0RA 1UWXA 3EGRA 3PSEB 1KM7A 4MDKE 2L0TA 1WYWB 3C8YA 4K3BA 2TSSA 2J0MA 2J4XA 1XLOA 3SFEB 3QWZB 2J53A 1WMHA 2AQ2B 4A3PA 1L6VA 2W3RA 2INCC 2G1EA 1SF0A 1J0GA 2CR5A 2MRPA 3OWEB 1L0VB 4W9FA 2LUMA 2QCZA 4LDTB 2KWDA 2ICIA 3QK0A 2HTME 5E6PA
chains in the Genus database with same CATH topology
4GOCA 2ZPNA 4NPNA 4GGQA 3JW0X 1RRBA 4FADA 1XT9B 3Q3JA 3PS6A 3U8ZA 3JSVA 2GBMA 2KMCA 3KUCB 3WAMA 2FCQA 1F9JA 2G45B 1S3SG 2KZRA 2M4NA 4NJ6A 3VAWA 1XQQA 2GBRA 1OTRB 2MBBB 1V81A 4DWFA 1IPGA 3PV1A 4GIVA 3B08A 3H7PB 1LXDA 3OJ3A 2KQ7A 4EZKA 2XK5A 4NNJB 3I3TB 1WJUA 4B9KA 3ZRFA 3APCA 2Z59B 3ZNID 1NBFC 2CHZA 5J2RA 3OAWA 1UBQA 4DHJB 3T8MA 4W9KA 2LXAA 2NBVB 3RUIB 2MW5A 1UD7A 1WZ3A 2KFKB 3RCZA 2A5UA 1TTNA 2CU1A 2FNJB 2YVCA 3M63B 3RULA 5AEKB 2KTFA 2MCNB 3PLUA 3ZKJC 3HHMA 4I6PA 2DZJA 4EZLA 3A9JB 4ZDVA 5L83A 2KWVB 4RM8A 2MWSB 3UQBA 3OJ4B 3TCAA 1ISNA 1RFAA 1G6JA 1GJZA 3O65B 4A3OA 4TUUA 4YL8A 2AL6A 4HDOA 4FULA 4F7ZA 1C1YB 3QARA 3VDZA 4EUTA 3RT3B 3H6NA 3A1QB 4N9F4 2N4FA 1WGHA 2B3AA 2DX5B 3R3MA 4NAWA 2D3GA 2KWUB 4DHZE 2DZIA 2BYFA 5KHQA 3PHXB 3QCAA 4ICVA 1V86A 3JVZX 1EF1A 1ZGUB 4K7UA 4WWPA 5IAAC 1WMHB 4W9JA 1BT0A 4FHKA 1P98A 2KLCA 5D6JB 2NBUA 1E8YA 2R2OA 2BPSA 2RD0A 3PLVA 2DYOA 5JZEB 3W1YA 4HPLB 1RLFA 2KX0A 2ZZPB 4IM2A 1WXVA 1C3TA 3IFWB 4TQ0A 5G2NA 2N7EA 2IO1B 1E5WA 2UYZB 3EHVA 3ZDMC 1Q5WB 2IO3B 1WXMA 4BKGA 3MHSD 2KDBA 4M8NA 2LVOA 4IWPA 1VCBA 3V60A 3ZW3A 3HK0A 3RD2A 2JXXA 2K6DB 2MA9B 1KOTA 2BYEA 1FXTB 2KQSA 4F8CB 2V4LA 3ZNHB 4KSLC 3V62A 4AJWA 2WDTB 4G3XB 4W9HA 2K6QA 4GDLB 5CHFA 4TV3A 1XD3B 5LLIA 5D2MB 5IA7A 5EDSA 4E71A 4FHJA 3ZTDA 4KSKC 5AZHA 3UQAA 3VUWA 2HD5B 2YLMA 2DHZA 2I1KA 5E6NA 2JPHA 3WAOA 4MM3A 1WI0A 3PHWB 5KHOA 2AYOB 2O6VA 2GBNA 5J18A 1P9DU 4GXBA 4HCNB 3ZLZA 1YD8U 3CSTA 1WM3A 1RAXA 2JZZA 3PRZA 1E8WA 1S1QB 1R4NI 2BGFA 2K8CA 4K1RB 3VUXA 3W1SC 4ANVA 2BWES 2MX2A 2DYBA 2CHXA 2NPTB 4KZCA 4FLHA 4TQ1A 1OEYA 3ZVVA 2OJRA 3CSFA 1MG8A 3VTVA 3QC8B 3ALBA 4PS7A 4MJSA 3VFKA 3RZFA 2CHWA 4HK2A 1H4RA 2MQJA 2N9XA 3TIXA 4ANUA 2K8BA 2WX0A 4PYZA 1Z2MA 3DBHI 5TR5A 3V61A 3PRPB 2L7RA 3NZSA 3L08A 1PQSA 4NQKE 3A9JA 2LASA 1T0YA 2N1WA 2HTHA 4M8MA 5CTRC 4LCDE 3VUYA 5L95C 4GSWA 3MTNB 3S2AA 3TJPA 2LVPA 3L17A 2C7HA 4G11A 3M62B 4MSQB 4MGZE 2EKEC 2KC1A 3KUDB 3ZTCA 2LI5A 4AJYB 4EFOA 4JL9A 4IM3A 5FR6A 2MBQA 2KJ6A 5DPRA 2KOXA 2W9NA 3HIZA 5BO4B 3WA0A 2G4SA 1E8XA 2RSUA 4JQWC 4F1SA 1J8CA 3L13A 1Z5SB 2FCSA 2LUEA 3K9PB 2LGDA 1I42A 4W9LA 2JT4B 1YJ1A 4MGIE 5LXHA 3SHQA 2KMAA 1V9JA 3N3KB 1GC7A 3Q3FA 1WX9A 4W9GA 1TBEA 3ZNZB 2RGFA 2RR9A 4GMVA 2JZ3B 3DCGA 3V6CB 2A4ZA 4DDID 3BINA 3NY5A 5J17A 3DDCB 2GBKA 4KZ0A 3KYCD 3R66C 1ZW7A 5CHWA 1WM2A 2ZJDA 2J0KA 1SE9A 1WRDB 2NBWB 4FJYA 1A5RA 2KVRA 3V6EB 2KNBA 2IBIB 2KN5A 3AU4A 4GDLA 4W9EA 4BKSA 3PREA 2IZVB 1GC6A 3AI5A 2G3QB 4BKTA 3ZUNA 4FJVB 1YX5B 1UELA 4RM9A 4K7SA 1KJTA 4HVBA 3ONSA 4IW0A 2KX3A 2K1FA 2KTRB 4GDKB 1YX6B 2QHOA 2KANA 3OLMD 3WAPA 4ANXA 3H9DA 3DVGX 2GBJA 1V2YA 4MH0E 2J7QB 2O6VB 4ZRIA 3ZO5B 3EECA 1V49A 4LDTD 5DCNA 4JLCA 1UGMA 1V80A 4GU2A 5E6OA 2BKFA 4KIKA 3UIOB 2JVCA 1IP9A 3PVLA 4JIOU 5JH5C 1E8ZA 2FIDA 3RZWC 4PS3A 5C1ZA 1VD2A 1GUAB 4ANWA 3U7DA 3SU8X 1Q1OA 2LRWA 4J6IA 1WZ0A 3UINB 2KHWB 3QJZA 1LM8B 1R4MI 3C0RB 3CMMB 4GB9A 2PPHA 4KIKB 2L8JA 4LJOB 2PJHA 4HLEA 5AZFA 4MELA 3APFA 2IYDB 2IO0B 4MEMA 2K39A 2D11A 4NY0A 2ASQA 3KW5B 5HKHA 1WFYA 3LDZE 1EF5A 2KFJA 2KFKA 4HWIB 4W9CA 2C60A 2R2QA 3QX1A 5JHAA 2D10A 1WX8A 1M94A 2FIFA 1QZEA 3W1SA 2MBEA 1WGYA 3VXWA 4BKSD 4CYEA 3B1LX 3DOWA 3VTUA 2EMSA 2XBBC 2JRIB 2L00B 2NR2A 1E7VA 2FUHB 2ZCCA 3DQVA 2ZEQA 1GG3A 3L54A 2KDEB 4BFRA 4WWOA 4E74A 2HE7A 5CX3A 1UH6A 4NJ7A 1V5TA 3D32A 4WWNA 3IHPC 2LVQA 4OVVA 5CHVC 2LWPA 1UBIA 1YQBA 4OVUA 3TBLD 4II3B 4WAAA 1WXAA 3R7QA 1WE7A 3IG3A 4BOSC 4BBNF 2KKCA 4XX5A 3K9OB 4EZJA 3A4RA 2OOBB 3GOEA 4AWJA 1P1AA 4WJNA 3APDA 1WJ4A 4P7IA 4AOFA 1OGWA 2N9PC 3QIJA 4K81A 2ZNVB 3JSVB 1IYFA 3DVNV 4DBGA 2L0FA 3DBLI 4X57B 2MBHA 4WJOA 4EEWA 1V5OA 1P3QU 3B0AA 2KD0A 2FCNA 1OQYA 3VQIA 2NVUI 3HM6X 1WE6A 4BBNC 2DYMA 2JF5A 5C23A 2O2VA 2LD9A 2XK5B 1UZXB 1HE8A 2LJ5A 1EO6A 4NQLB 3DBRI 2DAFA 3N32A 2BF8B 3SD5A 1CMXB 3JYUA 4JGHB 3QQ8B 5DPTA 2JWZA 1KLVA 2KLGA 3PZDA 1NI2A 2ZCBA 3QAQA 5G55A 3UIPB 2IY1B 3ML8A 4KDLB 3A9KB 3CF6E 2M8SA 3WIMA 4BVUC 2EMTA 4ICUA 3X23A 2G4DB 3P2BA 2BYVE 2KJHB 1L2NA 3AXCA 4MSMB 4PYUA 2J0JA 1WGGA 2NCNA 4HDQA 1H8CA 2L76A 4MJSB 4II2B 4I6NB 2PEAA 3ENEA 4K7WA 4ASWC 2BWFA 2MP2B 4NAWB 4G50A 1I35A 1SIFA 2MSED 1V6EA 3DVNU 2JY6A 3VH3B 4IUMB 2KXJA 3ZDTA 4DHZB 2KDIA 5AZGA 2AL3A 4LJPB 5D94A 4WQOB 2V1YA 3VVWB 3NOBA 1SGHA 4A20A 2M0XA 2CS4A 4DK5A 3NHEB 2LGYA 4AP4C 3WANA 2FCMA 3AULA 3ZIMA 2FAZA 2K8HA 2M17A 1WX7A 3NZUA 3L10B 3ZNGC 2C7MB 3GZNI 4E3CA 2N7DA 3TL5A 2KC2A 2ZNVC 3ECIA 1WR6E 4DXAB 3QA8A 2JUOA 3EC8A 3N30A 3UF8A 3ZRCA 3TMPB 2VRRB 5D7GA 1L7YA 2V3SA 4B95A 2AEHA 2ZVOA 2LRUA 2KDFB 2DENB 1LQBA 2REXA 1WY8A 4WJPA 4HPMB 1EUVB 3HM3A 2C7NB 2O2VB 3PPAA 2UWQA 2XEWA 1Y8RC 4AUQC 4HJKA 4ZYNA 4CHKA 1X1MA 2GMIC 1WIAA 2N9EB 4DHJD 1WH3A 2KO3A 2M1MA 1U4AA 2NPTA 4EOYA 3SDLC 3PGEA 2CKHB 3QHTA 1ZKHA 2LZ6A 3EFUA 3ML9A 1K8RB 3AU5A 2JRHA 4KV2A 2KJRA 2L05A 2MBOA 3LJ3A 2PE6B 4FBJB 3RYTA 1WXSA 4GDKA 4DDGD 3A9KA 4GN1A 2K25A 3T9LA 4EKUA 1E90A 2KK8A 5LXIB 1OEYJ 2WYQA 2C5LC 2L3ZA 4W9IA 4FJZA 4HCPB 4XZ4A 1WGDA 5DPWA 4URKA 3A4SC 4RMAA 3M95A 4KDIC 3R7RA 4IWQA 4WJQA 2PE9A 2LXCA 1JRUA 1LFDA 2GOWA 2AWTA 2D07B 4PS8A 2N1VA 5DPSA 1WJNA 2MLBA 2IO2B 2MP2A 2O6VD 3A33B 2ZPYA 1E7UA 3DBSA 1WR1A 3M3JA 3L16A 2DZKA 3VH4B 4I6LB 3H7SA 4B6WA 3KH0A 4IC7B 2DZMA 1AARA 2KWCA 2D2QA 4BOZB 1NDDA 3DVGY 3NS8A 2LGXA 4KVGB 3PRMB 2Z0EB 3VHTC 1P0RA 1GNUA 1J19A 3PSEB 4IM0A 5GMVA 2ZVNA 1KM7A 3A1QA 3H1UA 3MJWA 4MDKE 2L0TA 3UGBB 1WYWB 1Q0WB 3VTWA 2I1JA 3IBEA 3PT2B 2WWZA 1WF9A 2J0MA 4HXDA 3WALA 3QWZB 3U30A 1WMHA 2RPQA 4A3PA 3X0WA 4IWOA 4TKNA 4CO7A 4ZRKA 4ZRJA 1TZ1A 2Z0DB 2WX1A 1WJ6A 1J0GA 4FA6A 2CR5A 2MRPA 2BKRB 2DAJA 3IVFA 4MGKE 4M0WB 2C9WB 2HJ8A 3PTFC 3L0WB 4G0NB 3KYDD 4W9FA 1YIWA 3DPDA 4IG7B 4LDTB 2NS5A 1D3ZA 5JHBA 4FN2A 3QK0A 3BY4B 4XC2A 2Y5BB 1TGZB 2IY0B 3KUZA 3KVFB 4W9DA 2KTRA 4MGYE 3H7PA 1WGRA 5E6PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GOC A;  2ZPN A;  4NPN A;  4GGQ A;  3JW0 X;  1RRB A;  4FAD A;  1XT9 B;  3Q3J A;  3PS6 A;  3U8Z A;  3JSV A;  2GBM A;  2KMC A;  3KUC B;  3WAM A;  2FCQ A;  1F9J A;  2G45 B;  1S3S G;  2KZR A;  2M4N A;  4NJ6 A;  3VAW A;  1XQQ A;  2GBR A;  1OTR B;  2MBB B;  1V81 A;  4DWF A;  1IPG A;  3PV1 A;  4GIV A;  3B08 A;  3H7P B;  1LXD A;  3OJ3 A;  2KQ7 A;  4EZK A;  2XK5 A;  4NNJ B;  3I3T B;  1WJU A;  4B9K A;  3ZRF A;  3APC A;  2Z59 B;  3ZNI D;  1NBF C;  2CHZ A;  5J2R A;  3OAW A;  1UBQ A;  4DHJ B;  3T8M A;  4W9K A;  2LXA A;  2NBV B;  3RUI B;  2MW5 A;  1UD7 A;  1WZ3 A;  2KFK B;  3RCZ A;  2A5U A;  1TTN A;  2CU1 A;  2FNJ B;  2YVC A;  3M63 B;  3RUL A;  5AEK B;  2KTF A;  2MCN B;  3PLU A;  3ZKJ C;  3HHM A;  4I6P A;  2DZJ A;  4EZL A;  3A9J B;  4ZDV A;  5L83 A;  2KWV B;  4RM8 A;  2MWS B;  3UQB A;  3OJ4 B;  3TCA A;  1ISN A;  1RFA A;  1G6J A;  1GJZ A;  3O65 B;  4A3O A;  4TUU A;  4YL8 A;  2AL6 A;  4HDO A;  4FUL A;  4F7Z A;  1C1Y B;  3QAR A;  3VDZ A;  4EUT A;  3RT3 B;  3H6N A;  3A1Q B;  4N9F 4;  2N4F A;  1WGH A;  2B3A A;  2DX5 B;  3R3M A;  4NAW A;  2D3G A;  2KWU B;  4DHZ E;  2DZI A;  2BYF A;  5KHQ A;  3PHX B;  3QCA A;  4ICV A;  1V86 A;  3JVZ X;  1EF1 A;  1ZGU B;  4K7U A;  4WWP A;  5IAA C;  1WMH B;  4W9J A;  1BT0 A;  4FHK A;  1P98 A;  2KLC A;  5D6J B;  2NBU A;  1E8Y A;  2R2O A;  2BPS A;  2RD0 A;  3PLV A;  2DYO A;  5JZE B;  3W1Y A;  4HPL B;  1RLF A;  2KX0 A;  2ZZP B;  4IM2 A;  1WXV A;  1C3T A;  3IFW B;  4TQ0 A;  5G2N A;  2N7E A;  2IO1 B;  1E5W A;  2UYZ B;  3EHV A;  3ZDM C;  1Q5W B;  2IO3 B;  1WXM A;  4BKG A;  3MHS D;  2KDB A;  4M8N A;  2LVO A;  4IWP A;  1VCB A;  3V60 A;  3ZW3 A;  3HK0 A;  3RD2 A;  2JXX A;  2K6D B;  2MA9 B;  1KOT A;  2BYE A;  1FXT B;  2KQS A;  4F8C B;  2V4L A;  3ZNH B;  4KSL C;  3V62 A;  4AJW A;  2WDT B;  4G3X B;  4W9H A;  2K6Q A;  4GDL B;  5CHF A;  4TV3 A;  1XD3 B;  5LLI A;  5D2M B;  5IA7 A;  5EDS A;  4E71 A;  4FHJ A;  3ZTD A;  4KSK C;  5AZH A;  3UQA A;  3VUW A;  2HD5 B;  2YLM A;  2DHZ A;  2I1K A;  5E6N A;  2JPH A;  3WAO A;  4MM3 A;  1WI0 A;  3PHW B;  5KHO A;  2AYO B;  2O6V A;  2GBN A;  5J18 A;  1P9D U;  4GXB A;  4HCN B;  3ZLZ A;  1YD8 U;  3CST A;  1WM3 A;  1RAX A;  2JZZ A;  3PRZ A;  1E8W A;  1S1Q B;  1R4N I;  2BGF A;  2K8C A;  4K1R B;  3VUX A;  3W1S C;  4ANV A;  2BWE S;  2MX2 A;  2DYB A;  2CHX A;  2NPT B;  4KZC A;  4FLH A;  4TQ1 A;  1OEY A;  3ZVV A;  2OJR A;  3CSF A;  1MG8 A;  3VTV A;  3QC8 B;  3ALB A;  4PS7 A;  4MJS A;  3VFK A;  3RZF A;  2CHW A;  4HK2 A;  1H4R A;  2MQJ A;  2N9X A;  3TIX A;  4ANU A;  2K8B A;  2WX0 A;  4PYZ A;  1Z2M A;  3DBH I;  5TR5 A;  3V61 A;  3PRP B;  2L7R A;  3NZS A;  3L08 A;  1PQS A;  4NQK E;  3A9J A;  2LAS A;  1T0Y A;  2N1W A;  2HTH A;  4M8M A;  5CTR C;  4LCD E;  3VUY A;  5L95 C;  4GSW A;  3MTN B;  3S2A A;  3TJP A;  2LVP A;  3L17 A;  2C7H A;  4G11 A;  3M62 B;  4MSQ B;  4MGZ E;  2EKE C;  2KC1 A;  3KUD B;  3ZTC A;  2LI5 A;  4AJY B;  4EFO A;  4JL9 A;  4IM3 A;  5FR6 A;  2MBQ A;  2KJ6 A;  5DPR A;  2KOX A;  2W9N A;  3HIZ A;  5BO4 B;  3WA0 A;  2G4S A;  1E8X A;  2RSU A;  4JQW C;  4F1S A;  1J8C A;  3L13 A;  1Z5S B;  2FCS A;  2LUE A;  3K9P B;  2LGD A;  1I42 A;  4W9L A;  2JT4 B;  1YJ1 A;  4MGI E;  5LXH A;  3SHQ A;  2KMA A;  1V9J A;  3N3K B;  1GC7 A;  3Q3F A;  1WX9 A;  4W9G A;  1TBE A;  3ZNZ B;  2RGF A;  2RR9 A;  4GMV A;  2JZ3 B;  3DCG A;  3V6C B;  2A4Z A;  4DDI D;  3BIN A;  3NY5 A;  5J17 A;  3DDC B;  2GBK A;  4KZ0 A;  3KYC D;  3R66 C;  1ZW7 A;  5CHW A;  1WM2 A;  2ZJD A;  2J0K A;  1SE9 A;  1WRD B;  2NBW B;  4FJY A;  1A5R A;  2KVR A;  3V6E B;  2KNB A;  2IBI B;  2KN5 A;  3AU4 A;  4GDL A;  4W9E A;  4BKS A;  3PRE A;  2IZV B;  1GC6 A;  3AI5 A;  2G3Q B;  4BKT A;  3ZUN A;  4FJV B;  1YX5 B;  1UEL A;  4RM9 A;  4K7S A;  1KJT A;  4HVB A;  3ONS A;  4IW0 A;  2KX3 A;  2K1F A;  2KTR B;  4GDK B;  1YX6 B;  2QHO A;  2KAN A;  3OLM D;  3WAP A;  4ANX A;  3H9D A;  3DVG X;  2GBJ A;  1V2Y A;  4MH0 E;  2J7Q B;  2O6V B;  4ZRI A;  3ZO5 B;  3EEC A;  1V49 A;  4LDT D;  5DCN A;  4JLC A;  1UGM A;  1V80 A;  4GU2 A;  5E6O A;  2BKF A;  4KIK A;  3UIO B;  2JVC A;  1IP9 A;  3PVL A;  4JIO U;  5JH5 C;  1E8Z A;  2FID A;  3RZW C;  4PS3 A;  5C1Z A;  1VD2 A;  1GUA B;  4ANW A;  3U7D A;  3SU8 X;  1Q1O A;  2LRW A;  4J6I A;  1WZ0 A;  3UIN B;  2KHW B;  3QJZ A;  1LM8 B;  1R4M I;  3C0R B;  3CMM B;  4GB9 A;  2PPH A;  4KIK B;  2L8J A;  4LJO B;  2PJH A;  4HLE A;  5AZF A;  4MEL A;  3APF A;  2IYD B;  2IO0 B;  4MEM A;  2K39 A;  2D11 A;  4NY0 A;  2ASQ A;  3KW5 B;  5HKH A;  1WFY A;  3LDZ E;  1EF5 A;  2KFJ A;  2KFK A;  4HWI B;  4W9C A;  2C60 A;  2R2Q A;  3QX1 A;  5JHA A;  2D10 A;  1WX8 A;  1M94 A;  2FIF A;  1QZE A;  3W1S A;  2MBE A;  1WGY A;  3VXW A;  4BKS D;  4CYE A;  3B1L X;  3DOW A;  3VTU A;  2EMS A;  2XBB C;  2JRI B;  2L00 B;  2NR2 A;  1E7V A;  2FUH B;  2ZCC A;  3DQV A;  2ZEQ A;  1GG3 A;  3L54 A;  2KDE B;  4BFR A;  4WWO A;  4E74 A;  2HE7 A;  5CX3 A;  1UH6 A;  4NJ7 A;  1V5T A;  3D32 A;  4WWN A;  3IHP C;  2LVQ A;  4OVV A;  5CHV C;  2LWP A;  1UBI A;  1YQB A;  4OVU A;  3TBL D;  4II3 B;  4WAA A;  1WXA A;  3R7Q A;  1WE7 A;  3IG3 A;  4BOS C;  4BBN F;  2KKC A;  4XX5 A;  3K9O B;  4EZJ A;  3A4R A;  2OOB B;  3GOE A;  4AWJ A;  1P1A A;  4WJN A;  3APD A;  1WJ4 A;  4P7I A;  4AOF A;  1OGW A;  2N9P C;  3QIJ A;  4K81 A;  2ZNV B;  3JSV B;  1IYF A;  3DVN V;  4DBG A;  2L0F A;  3DBL I;  4X57 B;  2MBH A;  4WJO A;  4EEW A;  1V5O A;  1P3Q U;  3B0A A;  2KD0 A;  2FCN A;  1OQY A;  3VQI A;  2NVU I;  3HM6 X;  1WE6 A;  4BBN C;  2DYM A;  2JF5 A;  5C23 A;  2O2V A;  2LD9 A;  2XK5 B;  1UZX B;  1HE8 A;  2LJ5 A;  1EO6 A;  4NQL B;  3DBR I;  2DAF A;  3N32 A;  2BF8 B;  3SD5 A;  1CMX B;  3JYU A;  4JGH B;  3QQ8 B;  5DPT A;  2JWZ A;  1KLV A;  2KLG A;  3PZD A;  1NI2 A;  2ZCB A;  3QAQ A;  5G55 A;  3UIP B;  2IY1 B;  3ML8 A;  4KDL B;  3A9K B;  3CF6 E;  2M8S A;  3WIM A;  4BVU C;  2EMT A;  4ICU A;  3X23 A;  2G4D B;  3P2B A;  2BYV E;  2KJH B;  1L2N A;  3AXC A;  4MSM B;  4PYU A;  2J0J A;  1WGG A;  2NCN A;  4HDQ A;  1H8C A;  2L76 A;  4MJS B;  4II2 B;  4I6N B;  2PEA A;  3ENE A;  4K7W A;  4ASW C;  2BWF A;  2MP2 B;  4NAW B;  4G50 A;  1I35 A;  1SIF A;  2MSE D;  1V6E A;  3DVN U;  2JY6 A;  3VH3 B;  4IUM B;  2KXJ A;  3ZDT A;  4DHZ B;  2KDI A;  5AZG A;  2AL3 A;  4LJP B;  5D94 A;  4WQO B;  2V1Y A;  3VVW B;  3NOB A;  1SGH A;  4A20 A;  2M0X A;  2CS4 A;  4DK5 A;  3NHE B;  2LGY A;  4AP4 C;  3WAN A;  2FCM A;  3AUL A;  3ZIM A;  2FAZ A;  2K8H A;  2M17 A;  1WX7 A;  3NZU A;  3L10 B;  3ZNG C;  2C7M B;  3GZN I;  4E3C A;  2N7D A;  3TL5 A;  2KC2 A;  2ZNV C;  3ECI A;  1WR6 E;  4DXA B;  3QA8 A;  2JUO A;  3EC8 A;  3N30 A;  3UF8 A;  3ZRC A;  3TMP B;  2VRR B;  5D7G A;  1L7Y A;  2V3S A;  4B95 A;  2AEH A;  2ZVO A;  2LRU A;  2KDF B;  2DEN B;  1LQB A;  2REX A;  1WY8 A;  4WJP A;  4HPM B;  1EUV B;  3HM3 A;  2C7N B;  2O2V B;  3PPA A;  2UWQ A;  2XEW A;  1Y8R C;  4AUQ C;  4HJK A;  4ZYN A;  4CHK A;  1X1M A;  2GMI C;  1WIA A;  2N9E B;  4DHJ D;  1WH3 A;  2KO3 A;  2M1M A;  1U4A A;  2NPT A;  4EOY A;  3SDL C;  3PGE A;  2CKH B;  3QHT A;  1ZKH A;  2LZ6 A;  3EFU A;  3ML9 A;  1K8R B;  3AU5 A;  2JRH A;  4KV2 A;  2KJR A;  2L05 A;  2MBO A;  3LJ3 A;  2PE6 B;  4FBJ B;  3RYT A;  1WXS A;  4GDK A;  4DDG D;  3A9K A;  4GN1 A;  2K25 A;  3T9L A;  4EKU A;  1E90 A;  2KK8 A;  5LXI B;  1OEY J;  2WYQ A;  2C5L C;  2L3Z A;  4W9I A;  4FJZ A;  4HCP B;  4XZ4 A;  1WGD A;  5DPW A;  4URK A;  3A4S C;  4RMA A;  3M95 A;  4KDI C;  3R7R A;  4IWQ A;  4WJQ A;  2PE9 A;  2LXC A;  1JRU A;  1LFD A;  2GOW A;  2AWT A;  2D07 B;  4PS8 A;  2N1V A;  5DPS A;  1WJN A;  2MLB A;  2IO2 B;  2MP2 A;  2O6V D;  3A33 B;  2ZPY A;  1E7U A;  3DBS A;  1WR1 A;  3M3J A;  3L16 A;  2DZK A;  3VH4 B;  4I6L B;  3H7S A;  4B6W A;  3KH0 A;  4IC7 B;  2DZM A;  1AAR A;  2KWC A;  2D2Q A;  4BOZ B;  1NDD A;  3DVG Y;  3NS8 A;  2LGX A;  4KVG B;  3PRM B;  2Z0E B;  3VHT C;  1P0R A;  1GNU A;  1J19 A;  3PSE B;  4IM0 A;  5GMV A;  2ZVN A;  1KM7 A;  3A1Q A;  3H1U A;  3MJW A;  4MDK E;  2L0T A;  3UGB B;  1WYW B;  1Q0W B;  3VTW A;  2I1J A;  3IBE A;  3PT2 B;  2WWZ A;  1WF9 A;  2J0M A;  4HXD A;  3WAL A;  3QWZ B;  3U30 A;  1WMH A;  2RPQ A;  4A3P A;  3X0W A;  4IWO A;  4TKN A;  4CO7 A;  4ZRK A;  4ZRJ A;  1TZ1 A;  2Z0D B;  2WX1 A;  1WJ6 A;  1J0G A;  4FA6 A;  2CR5 A;  2MRP A;  2BKR B;  2DAJ A;  3IVF A;  4MGK E;  4M0W B;  2C9W B;  2HJ8 A;  3PTF C;  3L0W B;  4G0N B;  3KYD D;  4W9F A;  1YIW A;  3DPD A;  4IG7 B;  4LDT B;  2NS5 A;  1D3Z A;  5JHB A;  4FN2 A;  3QK0 A;  3BY4 B;  4XC2 A;  2Y5B B;  1TGZ B;  2IY0 B;  3KUZ A;  3KVF B;  4W9D A;  2KTR A;  4MGY E;  3H7P A;  1WGR A;  5E6P A; 
#chains in the Genus database with same CATH topology
 1HTO A;  5AUI A;  3JW0 X;  1RRB A;  4FAD A;  3Q3J A;  5H8Y E;  2KMC A;  1F9J A;  2KZR A;  1E7P B;  1MJD A;  2BQQ A;  4NJ6 A;  3VAW A;  1XQQ A;  2BB6 A;  4ARI A;  1UWM A;  3W9C B;  3PV1 A;  4S0R A;  1C77 A;  1C79 A;  2Z59 B;  5T8I A;  3OAW A;  4W9K A;  1TT5 B;  2IGH A;  2N7J A;  1I4R A;  2NBV B;  1C76 A;  1WZ3 A;  2KFK B;  1TTN A;  1VLB A;  1QF6 A;  2KTF A;  1SE3 A;  3HHM A;  1VZ7 A;  2JWU A;  1HXY D;  3BYY B;  4HRS A;  2BYT A;  2KWV B;  4RM8 A;  2L83 A;  1RFA A;  1J7A A;  3TEZ A;  1G6J A;  1NYQ A;  1GJZ A;  1ACC A;  4TUU A;  4FUL A;  4F7Z A;  1PUT A;  3FKY A;  2I38 A;  3H6N A;  2ON8 A;  1WGH A;  3AE7 B;  5KHQ A;  1Y56 A;  3ETR A;  3B9J A;  1EF1 A;  4WWP A;  3Q8C A;  1WMH B;  4XWW A;  1P98 A;  2KLC A;  2CU3 A;  2BPS A;  2DYO A;  4WAF A;  1WXV A;  3BK1 A;  3P4P B;  1C3T A;  4TQ0 A;  1AW7 A;  4M01 A;  3EHV A;  1WXM A;  3P4S B;  3V60 A;  2JXX A;  1T6B X;  1KOT A;  2BYE A;  1FXT B;  1WGK A;  2PVO D;  2WDT B;  1DGJ A;  1I4P A;  5LLI A;  4WUR A;  3P4R B;  5IA7 A;  4HEA 1;  3ZTD A;  2DBY A;  2I1K A;  3IT4 B;  3PHW B;  1JWA D;  2O6V A;  1ESF A;  1FFU A;  1P9D U;  4HCN B;  1YD8 U;  3CST A;  2NPT B;  2CHX A;  4TQ1 A;  1KTK A;  1MG8 A;  4ZHP A;  3QC8 B;  1C78 A;  3PO0 A;  4HK2 A;  2BS2 B;  2NTT A;  4PYZ A;  1F0Z A;  2XN9 C;  2G9H D;  1JWM D;  2HTH A;  4REZ A;  4RGO S;  4LCD E;  3VUY A;  5L95 C;  3MTN B;  3N20 C;  3GE8 C;  4Q2J A;  3L17 A;  1VR9 A;  2VH1 A;  2KC1 A;  3KUD B;  3DWG C;  2JZP A;  4JL9 A;  2MBQ A;  1SJH D;  5BO4 B;  3ZGZ A;  4F1S A;  5LXH A;  2OJW A;  3N3K B;  4OZA A;  2RGF A;  1OFF A;  2RR9 A;  4K3C A;  1MFW A;  4YTP B;  3DCG A;  3AM9 A;  3NY5 A;  1B9R A;  3DDC B;  2GBK A;  2H89 B;  3KYC D;  3GS2 A;  3Q3N C;  2NBW B;  1WRD B;  4H2A A;  1FNW A;  1RWS A;  1Q10 A;  2KNB A;  2IBI B;  2PIA A;  4C00 A;  4M0W A;  4BKT A;  3ZUN A;  2KAC A;  1XEE A;  4HKQ A;  4YXD B;  1EWC A;  4IW0 A;  1ET6 A;  2K1F A;  3OLM D;  1FXI A;  2GBJ A;  1V2Y A;  4ZRI A;  3EEC A;  1YJI A;  1QOF A;  4JLC A;  4KIK A;  4N59 A;  5JH5 C;  1NYR A;  1QLB B;  3RN9 C;  3AE2 B;  1GUA B;  3Q2A C;  1Q1O A;  3UIN B;  3QJZ A;  1LM8 B;  3TEX A;  2M0A A;  3CMM B;  2PPH A;  4KIK B;  5AZF A;  2IYD B;  1CQV A;  4MEM A;  4USA A;  3KW5 B;  4B0M A;  3MFG A;  1EF5 A;  2KFJ A;  4W9C A;  2WXN A;  2JSV X;  1LO5 D;  3LXF A;  2WXK A;  1GAQ B;  2MBE A;  3VXW A;  3DOW A;  1L0X B;  3B2F A;  3WCQ A;  2NR2 A;  3L54 A;  2ZEQ A;  2KDE B;  3RNG C;  4C56 C;  5CX3 A;  1UH6 A;  3D32 A;  3IHP C;  2LWP A;  1HEZ E;  4OVU A;  3TBL D;  1KFY B;  4YTM B;  2Y5C A;  1WE7 A;  2KKC A;  4XX5 A;  4EZJ A;  3A4R A;  1FMA D;  3NVZ A;  3DVN V;  2KMM A;  2E3T A;  4X57 B;  4WJO A;  1XXG A;  3B0A A;  3KWL A;  4WH4 A;  3U4E G;  1I4Q A;  2JF5 A;  5C23 A;  3AE9 B;  2LD9 A;  1TS2 A;  2XK5 B;  2KDM A;  1HE8 A;  3ZXV A;  3Q14 C;  3N32 A;  4RF0 A;  3JYU A;  1KLV A;  2KLG A;  5G55 A;  3RNB C;  2IY1 B;  2M8S A;  2JXT A;  3RNA C;  2AQ3 B;  3T3N A;  2WDV B;  4PYU A;  1YN3 A;  2PEA A;  4K7W A;  4G50 A;  4L1B A;  1J7C A;  3DVN U;  4RF1 A;  2JY6 A;  2LGS A;  2FBW B;  4IOI E;  4DHZ B;  2KDI A;  5IOI A;  3BVG A;  2V1Y A;  3NOB A;  1SGH A;  3V05 A;  2X8X X;  3NHE B;  2LGY A;  3SEB A;  4AP4 C;  3BK2 A;  3WAN A;  3ZIM A;  3I5J C;  4WQM A;  2M17 A;  3GZN I;  4E3C A;  2N7D A;  4WWM A;  3TL5 A;  1WR6 E;  4DXA B;  1QOG A;  2JUO A;  1TIF A;  3EC8 A;  4C7Z A;  3N30 A;  2VRR B;  2V3S A;  4B95 A;  2AEH A;  2LRU A;  2KDF B;  1RYJ A;  5BYQ A;  2OED A;  2REX A;  4HPM B;  2C7N B;  3O13 A;  2UWQ A;  2AQ1 B;  3KLS X;  4DHJ D;  1WH3 A;  2N9L A;  1FRR A;  2NPT A;  2PKO A;  3PGE A;  3QHT A;  3AEB B;  3AU5 A;  2KJR A;  1R4M B;  2L05 A;  1WXS A;  1L4Z B;  1M4V A;  2K25 A;  2JYT A;  1OEY J;  2C5L C;  2L3Z A;  1MVK A;  4HCP B;  3A4S C;  4IWQ A;  2PE9 A;  2LXC A;  2GOW A;  1UUP A;  2D07 B;  1JQ4 A;  1WJN A;  4HLE A;  2K3U A;  2ZPY A;  1E7U A;  3KH0 A;  1IBX B;  4C80 A;  2BTE A;  2D2Q A;  4LNN A;  1FPY A;  1SIJ A;  1FCL A;  2LGX A;  4KVG B;  3PRM B;  1GNU A;  4IM0 A;  3A1Q A;  3MJW A;  1Q0W B;  3VTW A;  2I1J A;  2WWZ A;  2H88 B;  2WXI A;  3U30 A;  2RPQ A;  1HA5 A;  4TKN A;  3TEW A;  1TY0 A;  4ZRK A;  4ZRJ A;  2B76 B;  2Z0D B;  2WX1 A;  2BKR B;  4MGK E;  4M0W B;  3GP7 A;  3PTF C;  3KYD D;  4IG7 B;  2JQR B;  2MJE A;  1D3Z A;  1ZPS A;  3GE3 C;  4FN2 A;  4XC2 A;  3BY4 B;  1TGZ B;  2V3N A;  4MGY E;  2WS3 B;  3U7Z A;  2ZPN A;  2WHI A;  1XT9 B;  3U8Z A;  3JSV A;  2GBM A;  2IJ0 A;  3WAM A;  2M4N A;  1ZOY B;  4YTN B;  2MBB B;  1V81 A;  3B08 A;  3H7P B;  1LXD A;  3E56 A;  2KQ7 A;  2V4I B;  4NNJ B;  2GLS A;  2R61 A;  2M19 A;  4DHJ B;  3T8M A;  2MW5 A;  3RCZ A;  2A5U A;  2CU1 A;  3RUL A;  4XYC A;  5AEK B;  2HDE A;  2MCN B;  2DZJ A;  3DBR B;  5FR3 A;  1YN5 A;  3HVD A;  5L83 A;  1TS3 A;  3DHI C;  3OJ4 B;  2MH7 A;  3TCA A;  2AL6 A;  1D5Z C;  1T0R C;  3VDZ A;  4NAW A;  4DHZ E;  2KN4 A;  1FIQ A;  1V86 A;  3JVZ X;  3ZJV A;  5IAA C;  3FAH A;  1BT0 A;  4A9A A;  4FHK A;  2NBU A;  1E8Y A;  2R2O A;  2BT6 A;  2RD0 A;  3RI7 C;  2PLP A;  4HPL B;  4IDI A;  3ZXR A;  2ZZP B;  3AE3 B;  5IKC M;  1Q5W B;  4BKG A;  1FRD A;  2BS4 B;  1VCB A;  2MA9 B;  1SBB B;  3HVZ A;  2W82 A;  4GLS C;  4TV3 A;  1HZ5 A;  3AE8 B;  1XF5 L;  5D2M B;  1L4D B;  5EDS A;  4FHJ A;  1EWY C;  4KSK C;  5AZH A;  3UQA A;  3VUW A;  1SE2 A;  2JPH A;  3TUO A;  3BZD B;  3WAO A;  1WI0 A;  1JW9 D;  5KHO A;  4YSZ B;  5J18 A;  4OW0 A;  3VR8 B;  1F2R I;  5I4D A;  1RAX A;  1GOZ A;  2JZZ A;  1E8W A;  2BGF A;  4K1R B;  3V3X A;  3VUX A;  4ANV A;  4R3D A;  1OEY A;  2NTS A;  2XNA C;  3AEC B;  3VFK A;  1FNV A;  3RZF A;  2CHW A;  2MQJ A;  2N9X A;  4KKI A;  1FO4 A;  3TIX A;  1I4X A;  4ANU A;  1IGC A;  4ZRQ A;  3PRP B;  2L7R A;  1N61 A;  2D3A A;  2LAS A;  1MI0 A;  4M8M A;  4GSW A;  3S2A A;  3TJP A;  2LVP A;  4MGZ E;  1YN4 A;  3AEG B;  5EE1 A;  5BMG A;  3HIZ A;  3TSS A;  3WA0 A;  4JQW C;  1E8X A;  2GRI A;  2RSU A;  1WSP A;  3K9P B;  4MGI E;  3SHQ A;  1STE A;  2V9H A;  3Q3F A;  1GC7 A;  1PGA A;  1WX9 A;  4W9G A;  3ZNZ B;  3NVY A;  4GMV A;  3RMK C;  2A4Z A;  5J17 A;  4ZOH C;  1ZW7 A;  4MH8 A;  2LFI A;  1SE9 A;  4FJY A;  1ET9 A;  1A5R A;  2ACZ B;  3AU4 A;  1DOY A;  3CIR B;  3AI5 A;  1TKE A;  1XO3 A;  1YX5 B;  4RM9 A;  2VZK B;  4K7S A;  3ONS A;  2KX3 A;  2KTR B;  3EUB 2;  3H9D A;  3DVG X;  3MC8 A;  2O6V B;  3ZO5 B;  3I9V 1;  1B1Z A;  4LDT D;  5DCN A;  1UGM A;  1V80 A;  4GU2 A;  1GB4 A;  1V97 A;  2FID A;  3PZ7 A;  4PS3 A;  2LHE A;  3KQ4 A;  2CJN A;  2V3P A;  4IKG A;  4P16 A;  3NVV A;  3AE5 B;  2WXM A;  1NEK B;  2D3C A;  5HI1 A;  1IBX A;  4MEL A;  1ZUD 2;  5FK9 C;  4NY0 A;  2K39 A;  5HKH A;  1WFY A;  1JCK B;  1GPX A;  2R2Q A;  3Q8F A;  2D10 A;  2FIF A;  4CYE A;  1WGY A;  2N0S B;  4BKS D;  1C4C A;  3B1L X;  2EMS A;  2IND C;  2JRI B;  3DQV A;  3BWU D;  3HRD D;  1YQB A;  4L2Y A;  1PYW D;  1KF6 B;  4J3O D;  2V0G A;  4BOS C;  1YQ4 B;  3K9O B;  2OOB B;  3GOE A;  4AWJ A;  3APD A;  2KVZ A;  1MHH E;  2WU5 B;  4K81 A;  2ZNV B;  3JSV B;  4DBG A;  1PGB A;  2L0F A;  2MBH A;  1NEN B;  1BML C;  5D3D A;  4RH6 A;  3R2T A;  2QMT A;  3RPF C;  2IGD A;  1IGD A;  2I2Y A;  1FXA A;  2DAF A;  3SD5 A;  2BF8 B;  5DPT A;  4M00 A;  2KAJ A;  3AE1 B;  3AV8 A;  3BII D;  3N1Z C;  2KJH B;  2J0J A;  2K5P A;  4JWS C;  4AS1 A;  1PGX A;  3GZN B;  1FCC C;  2L76 A;  4MJS B;  4II2 B;  4I6N B;  3ENE A;  4ASW C;  2MP2 B;  3W5V B;  4DQO C;  1YOV B;  3N1Y C;  1SIF A;  2MSE D;  1V6E A;  3Q3M C;  1I4G A;  2QIE B;  3VH3 B;  2QJL A;  2IPK D;  3ZDT A;  2DWQ A;  1RM6 C;  1E10 A;  2WXF A;  1FEH A;  2AL3 A;  1V8C A;  2INN E;  1N6Z A;  3VVW B;  2M0X A;  1QKZ A;  2CS4 A;  4DK5 A;  2K9X A;  3B2G A;  1L5P A;  1ZP0 B;  2FAZ A;  1WX7 A;  1QT9 A;  1TYG B;  2LEK A;  5MPO A;  4BZA A;  2ZNV C;  1TS5 A;  4JX1 C;  3AEA B;  4DXF A;  1MHX A;  3TMP B;  1L7Y A;  1SE4 A;  1LQB A;  1WY8 A;  5BYS A;  1P7F A;  4US9 A;  2XEW A;  1Y8R C;  3P42 A;  4KX6 B;  2N9E B;  5EE0 A;  2M1M A;  3P63 A;  1U4A A;  3SDL C;  1ZKH A;  1K8R B;  2WXR A;  1YQ3 B;  3RYT A;  4GDK A;  4EKU A;  1ZDX A;  1DYQ A;  4WIP A;  2WYQ A;  4W9I A;  4RMA A;  4EE2 A;  1J7B A;  2LMC A;  1YNT E;  4CQN A;  2MLB A;  2IO2 B;  3A33 B;  5D6J B;  1JAL A;  1WR1 A;  2DZK A;  1F77 A;  3Q6B A;  1L6U A;  1TJE A;  4IC7 B;  1AAR A;  4S17 A;  3DVG Y;  3VHT C;  2Z0E B;  2WXP A;  5GMV A;  3IXS A;  2LHD A;  3UGB B;  3IBE A;  3PT2 B;  2RDB C;  4HXD A;  2WU2 B;  1JRP A;  3X0W A;  1C9F A;  4HPP A;  4CO7 A;  1P7E A;  2L1A A;  2ONQ A;  4FA6 A;  2DAJ A;  5IN7 A;  2HJ8 A;  4G0N B;  2CJO A;  2QC8 A;  1YIW A;  3DPD A;  3P1M A;  2NS5 A;  4N6E B;  3KUZ A;  4W9D A;  2KTR A;  3H7P A;  1R4N B;  4NAM A;  4NPN A;  4P1B C;  3PS6 A;  2FCQ A;  2G45 B;  1TY2 A;  1S3S G;  4LK0 M;  4OZC A;  4DWF A;  3KWV A;  1IPG A;  4GIV A;  3OJ3 A;  4EZK A;  1A70 A;  4ZRP A;  3I3T B;  1WJU A;  4B9K A;  1OQQ A;  2N9K A;  2YEP F;  3IAM 1;  3RUI B;  2YVC A;  3M63 B;  3W2D A;  3PLU A;  1FNU A;  3A9J B;  4ZDV A;  3LB8 C;  1VRA B;  1N63 A;  1YMH E;  3O65 B;  4YL8 A;  1NVI D;  3OG5 A;  1C1Y B;  3QAR A;  2JU6 X;  4EUT A;  2Z8L A;  3RT3 B;  3A1Q B;  4N9F 4;  2N4F A;  3R3M A;  2B3A A;  2DX5 B;  3N9Y C;  2WNM A;  4XWT A;  4ICV A;  1BUI C;  1ZGU B;  4K7U A;  4ACF A;  4W9J A;  1VZ6 A;  3PLV A;  5JZE B;  2DLB A;  4ITK A;  2KX0 A;  4IM2 A;  5G2N A;  2IO1 B;  1E5W A;  3RNF C;  3ZDM C;  2IO3 B;  2LVO A;  2K6D B;  3NG0 A;  4XDD A;  2KQS A;  4F8C B;  2V4L A;  4KSL C;  3V62 A;  4AJW A;  3PZ8 A;  4G3X B;  4W9H A;  3AEF B;  4GDL B;  3MJ5 A;  4TMA B;  1XD3 B;  2KT7 A;  2RDH A;  2WLB A;  4C4V A;  3BVZ A;  3GB1 A;  2DHZ A;  2BBC A;  5E6N A;  2AYO B;  2GBN A;  4GXB A;  5G5H A;  4LTU A;  3ZLZ A;  5HFY A;  3PRZ A;  1S1Q B;  3W1S C;  2BWE S;  2DYB A;  5EE3 A;  3CSF A;  4PS7 A;  4MJS A;  2L52 A;  2K8B A;  2WX0 A;  3DBH I;  3V61 A;  3NZS A;  3A9J A;  1T0Y A;  3MC9 A;  5CTR C;  2WXL A;  4KKJ A;  2C7H A;  1RFK A;  2DNF A;  3ZTC A;  1HZ6 A;  4EFO A;  5FR6 A;  1XLQ A;  2K22 A;  5DPR A;  1XCT L;  1J8C A;  2G4S A;  3L13 A;  1Z5S B;  2FCS A;  2LUE A;  1I42 A;  4W9L A;  1YJ1 A;  1JWU D;  1K53 A;  5LNK 1;  4DDI D;  3BIN A;  3R66 C;  4KGT A;  1WM2 A;  2ZJD A;  3DHH C;  2J0K A;  2KVR A;  3V6E B;  4GDL A;  4W9E A;  3AB5 A;  4BKS A;  2IZV B;  2G3Q B;  4FJV B;  4C4V B;  1KJT A;  2WXO A;  3LYY A;  2RPV A;  4GDK B;  1KH0 A;  4KGR A;  4MH0 E;  1I4H A;  1V49 A;  1PDX A;  2JVC A;  4YSY B;  4XDC A;  3PVL A;  4JIO U;  1E8Z A;  1IUE A;  3RZW C;  1MG4 A;  1N62 A;  2WXH A;  1VD2 A;  4ANW A;  3U7D A;  3SU8 X;  4J6I A;  2QEJ C;  5JXV A;  1WZ0 A;  2KHW B;  2E6X A;  3C0R B;  1R4M I;  1EM7 A;  4LJO B;  2L8J A;  3APF A;  2D11 A;  1D6E C;  2ASQ A;  3LDZ E;  4JWU C;  2KFK A;  4HWI B;  1N60 A;  2WP9 B;  3ZJT A;  2SAK A;  4PT5 A;  3BVM A;  1C4A A;  1M94 A;  1WX8 A;  1QZE A;  3W1S A;  5JHA A;  3Q8B A;  2GI9 A;  3NZ3 A;  3W5U B;  2L00 B;  1E7V A;  1GG3 A;  3AED B;  3N1X C;  1K50 A;  4OVV A;  3URY A;  1YJJ A;  1EU4 A;  2PTL A;  2MJ3 A;  4II3 B;  5GXG B;  4WAA A;  4BBN F;  4QAY A;  1L0Y B;  4WJN A;  1LGR A;  2N9P C;  3I63 C;  1IYF A;  4A90 A;  1VJK A;  3FIL A;  4EEW A;  1V5O A;  3VQI A;  1QOA A;  2KD0 A;  2FCN A;  1OQY A;  1C4P A;  1JRO A;  3P4Q B;  2O2V A;  1PFD A;  1JML A;  1UZX B;  2LJ5 A;  1EO6 A;  1QOB A;  3DBR I;  3FIL B;  1CMX B;  4JGH B;  4ZHO A;  2JWZ A;  2NMQ A;  2WXG A;  3IAS 1;  2ZCB A;  3UIP B;  4P6V F;  3FC4 A;  3ML8 A;  3WIM A;  3NUH B;  2EEL A;  2IGG A;  3X23 A;  1D5M C;  5AUK A;  1ZE3 D;  2EKI A;  1R7S A;  3P2B A;  2BYV E;  4DXG A;  1L2N A;  2KYW A;  5IP4 D;  2NCN A;  2PMV A;  1FM0 D;  4MT5 A;  4NAW B;  2KXJ A;  5AZG A;  5D94 A;  2GB1 A;  3AH7 A;  2FCM A;  3AUL A;  2K8H A;  3NZU A;  4L23 A;  2KC2 A;  3AE4 B;  3QA8 A;  5H92 C;  4XGA B;  2J42 A;  2DEN B;  3I57 A;  5EE9 A;  4LLG M;  2ZW0 A;  4KGS A;  3HM3 A;  3PPA A;  4ZYN A;  1WIA A;  1HQR D;  3SFD B;  1JWS D;  3EFU A;  2KQ4 X;  2MBO A;  4RNA A;  1AYF A;  4DDG D;  4GN1 A;  1BXT A;  1E90 A;  2KK8 A;  4XZ4 A;  4FJZ A;  2WDR B;  2VZK D;  1ROE A;  2K0P A;  4URK A;  3R7R A;  1F2R C;  1LFD A;  4ARC A;  5DPS A;  3R2I A;  3RNE C;  2MP2 A;  2O6V D;  3M3J A;  3L16 A;  4I6L B;  2Y5P A;  2VH2 A;  4B6W A;  2DZM A;  3C19 A;  4BOZ B;  1NDD A;  4NJC A;  4ZYS A;  3DBH B;  1J19 A;  2ZVN A;  3EA6 A;  3H1U A;  1WF9 A;  3WAL A;  2RMM A;  4TSS A;  4IWO A;  1TZ1 A;  1WJ6 A;  1TZO A;  2W55 A;  3IVF A;  3Q8E A;  2C9W B;  3L0W B;  2QIL A;  4RGN A;  5JHB A;  5BMI A;  2Y5B B;  1E9M A;  2IY0 B;  3KVF B;  1F1H A;  1WGR A;  4GOC A;  4GGQ A;  5BMH A;  2ZW1 A;  3KUC B;  1OQR A;  2GBR A;  1OTR B;  1WWT A;  4HRO A;  2XK5 A;  3ZRF A;  3APC A;  1KRH A;  3ZNI D;  1NBF C;  2CHZ A;  5J2R A;  1UBQ A;  3DHG C;  2LXA A;  1T5X D;  1UD7 A;  2FNJ B;  3DWM A;  2FE8 A;  3ZKJ C;  2W3S A;  1D5X C;  4I6P A;  4EZL A;  3UQB A;  2MWS B;  2MEK A;  1ISN A;  4A3O A;  4HDO A;  2WXJ A;  1CK1 A;  1UNS A;  2D3G A;  2KWU B;  2DZI A;  2BYF A;  4PK1 A;  3PHX B;  3QCA A;  4B0E A;  4RFB A;  1SSN A;  2HJ1 A;  1FFV A;  2MHJ A;  3W1Y A;  3ZYY X;  1RLF A;  4XE0 A;  1QQR A;  1FD6 A;  3IFW B;  1ENF A;  2N7E A;  2UYZ B;  2LGI A;  3MHS D;  2KDB A;  4M8N A;  4IWP A;  5HHD G;  3ZW3 A;  3HK0 A;  2PVG C;  3RD2 A;  1JWB D;  1XLP A;  1I7H A;  3E9S A;  2OHF A;  3ZNH B;  2K6Q A;  5CHF A;  1QIL A;  2WXQ A;  2Q5W D;  4E71 A;  3EFC A;  2HD5 B;  2YLM A;  3NRZ A;  4BAX A;  1TKY A;  4MM3 A;  1XCQ L;  2RDG A;  1WM3 A;  4YSX B;  1R4N I;  2K8C A;  2MX2 A;  4KZC A;  4FLH A;  3NVW A;  3ZVV A;  2OJR A;  3VTV A;  4RCO A;  3ALB A;  1H4R A;  3AN1 A;  4HKZ E;  1SJE D;  1TS4 A;  5TR5 A;  1Z2M A;  3L08 A;  4LNI A;  1PQS A;  4NQK E;  2N1W A;  1WRI A;  4G11 A;  3M62 B;  4MSQ B;  2EKE C;  2LI5 A;  4AJY B;  1TKG A;  4N58 A;  4IM3 A;  1D4B A;  2KJ6 A;  2KOX A;  2W9N A;  3SR6 A;  1CJE A;  2PW9 A;  2M56 B;  1DOI A;  2LGD A;  2JT4 B;  1VZ8 A;  2KMA A;  1V9J A;  4P1C C;  1TBE A;  1KLU D;  2JZ3 B;  3V6C B;  4JPS A;  4KZ0 A;  5CHW A;  2KN5 A;  3PRE A;  1DOX A;  1GC6 A;  3MC0 B;  4OHJ A;  1UEL A;  5C2T B;  4HVB A;  1V1P B;  1YX6 B;  2QHO A;  2KAN A;  3WAP A;  1UGJ A;  4ANX A;  2J7Q B;  5E6O A;  2BKF A;  3UIO B;  1IP9 A;  5FKA C;  1UF0 A;  5C1Z A;  5HG2 A;  1T0Q C;  3CWI A;  4UDU C;  2LRW A;  4GB9 A;  2PJH A;  2IO0 B;  2UU7 A;  1ZXH A;  2YEP B;  2C60 A;  5TSS A;  4RGT A;  3QX1 A;  4NZL B;  1N5W A;  1KLG D;  2X38 A;  1NI3 A;  4LNO A;  3AMZ A;  4D2K A;  2IDY A;  3RNC C;  3VTU A;  2JYE A;  2XBB C;  3U52 E;  4A6Q A;  1SXT A;  2BS3 B;  2FUH B;  1E6E B;  2SEB D;  2ZCC A;  4BFR A;  4E74 A;  4WWO A;  2HE7 A;  1V1O A;  4NJ7 A;  1AWD A;  1V5T A;  3Q69 A;  4WWN A;  2AX5 A;  4MAC A;  3U2S C;  2LVQ A;  3J9C A;  5CHV C;  2QDF A;  1UBI A;  1WXA A;  2Y3A A;  3R7Q A;  3IG3 A;  1HTQ A;  3DBL B;  1P1A A;  1ZXI A;  1WJ4 A;  4P7I A;  2WQY B;  1OGW A;  3BYT B;  4AOF A;  4A55 A;  3QIJ A;  1VDV A;  5C3J B;  3DBL I;  1P3Q U;  2NVU I;  2W54 A;  3HM6 X;  1WE6 A;  4BBN C;  2DYM A;  4AQ7 A;  2MJD A;  4US8 A;  1E0Z A;  1CZP A;  5IO9 A;  3MHZ A;  4NQL B;  3IT6 B;  2L32 A;  3MP9 A;  4A8X C;  3QQ8 B;  3PZD A;  4YWG G;  1NI2 A;  3QAQ A;  1K51 A;  1EU3 A;  3AEE B;  4KDL B;  3A9K B;  3CF6 E;  1N5X A;  4BVU C;  2EMT A;  4ICU A;  2G4D B;  5BYR A;  4YT0 B;  3AXC A;  4MSM B;  1AN8 A;  2JX5 A;  2WGS A;  5E6J A;  1WGG A;  4HDQ A;  1H8C A;  2BWF A;  1I35 A;  4HJG E;  1GB1 A;  3ZJU A;  3VRB B;  4IUM B;  1WXQ A;  4LJP B;  5G5G A;  2INP E;  4WQO B;  2BB5 A;  2WDQ B;  4FXC A;  4A20 A;  3Q3O C;  1F52 A;  1T3Q A;  3VR9 B;  2LJI A;  3TEY A;  3L10 B;  1SEB D;  1XLN A;  2C7M B;  3ZNG C;  3ZQ4 A;  3UI3 A;  4LNK A;  3ECI A;  3NJT A;  3RFZ B;  3UF8 A;  3ZRC A;  3L4P A;  5D7G A;  2ZVO A;  4OVZ A;  3ABV B;  3HUI A;  1MPE A;  4RGM A;  4MM3 B;  4WJP A;  1K52 A;  1EUV B;  3AE6 B;  2O2V B;  4AUQ C;  3R8B A;  4HJK A;  4JE3 B;  4CHK A;  1X1M A;  2GMI C;  4OZB A;  2KO3 A;  1SB3 C;  1T0S C;  1V1P A;  4EOY A;  3NS1 A;  2CKH B;  2LZ6 A;  3ML9 A;  2JRH A;  3Q8A A;  4KV2 A;  4FBJ B;  3LJ3 A;  2PE6 B;  2QSD A;  3A9K A;  3T9L A;  3T3O A;  5LXI B;  4M02 A;  1WGD A;  5DPW A;  2D3B A;  5D3I B;  3M95 A;  4KDI C;  4WJQ A;  2D5G A;  1ZDV A;  1JRU A;  2AWT A;  2J52 A;  4PS8 A;  2N1V A;  2BVC A;  3DBS A;  3VH4 B;  4C7Y A;  3H7S A;  3H8H A;  4LNF A;  4O1N A;  2KWC A;  2FUG 1;  2BW2 A;  3NS8 A;  3VRA B;  1WYG A;  1P0R A;  1UWX A;  3EGR A;  3PSE B;  1KM7 A;  4MDK E;  2L0T A;  1WYW B;  3C8Y A;  4K3B A;  2TSS A;  2J0M A;  2J4X A;  1XLO A;  3SFE B;  3QWZ B;  2J53 A;  1WMH A;  2AQ2 B;  4A3P A;  1L6V A;  2W3R A;  2INC C;  2G1E A;  1SF0 A;  1J0G A;  2CR5 A;  2MRP A;  3OWE B;  1L0V B;  4W9F A;  2LUM A;  2QCZ A;  4LDT B;  2KWD A;  2ICI A;  3QK0 A;  2HTM E;  5E6P A; 
#chains in the Genus database with same CATH homology
 4GOC A;  2ZPN A;  4NPN A;  4GGQ A;  3JW0 X;  1RRB A;  4FAD A;  1XT9 B;  3Q3J A;  3PS6 A;  3U8Z A;  3JSV A;  2GBM A;  2KMC A;  3KUC B;  3WAM A;  2FCQ A;  1F9J A;  2G45 B;  1S3S G;  2KZR A;  2M4N A;  4NJ6 A;  3VAW A;  1XQQ A;  2GBR A;  1OTR B;  2MBB B;  1V81 A;  4DWF A;  1IPG A;  3PV1 A;  4GIV A;  3B08 A;  3H7P B;  1LXD A;  3OJ3 A;  2KQ7 A;  4EZK A;  2XK5 A;  4NNJ B;  3I3T B;  1WJU A;  4B9K A;  3ZRF A;  3APC A;  2Z59 B;  3ZNI D;  1NBF C;  2CHZ A;  5J2R A;  3OAW A;  1UBQ A;  4DHJ B;  3T8M A;  4W9K A;  2LXA A;  2NBV B;  3RUI B;  2MW5 A;  1UD7 A;  1WZ3 A;  2KFK B;  3RCZ A;  2A5U A;  1TTN A;  2CU1 A;  2FNJ B;  2YVC A;  3M63 B;  3RUL A;  5AEK B;  2KTF A;  2MCN B;  3PLU A;  3ZKJ C;  3HHM A;  4I6P A;  2DZJ A;  4EZL A;  3A9J B;  4ZDV A;  5L83 A;  2KWV B;  4RM8 A;  2MWS B;  3UQB A;  3OJ4 B;  3TCA A;  1ISN A;  1RFA A;  1G6J A;  1GJZ A;  3O65 B;  4A3O A;  4TUU A;  4YL8 A;  2AL6 A;  4HDO A;  4FUL A;  4F7Z A;  1C1Y B;  3QAR A;  3VDZ A;  4EUT A;  3RT3 B;  3H6N A;  3A1Q B;  4N9F 4;  2N4F A;  1WGH A;  2B3A A;  2DX5 B;  3R3M A;  4NAW A;  2D3G A;  2KWU B;  4DHZ E;  2DZI A;  2BYF A;  5KHQ A;  3PHX B;  3QCA A;  4ICV A;  1V86 A;  3JVZ X;  1EF1 A;  1ZGU B;  4K7U A;  4WWP A;  5IAA C;  1WMH B;  4W9J A;  1BT0 A;  4FHK A;  1P98 A;  2KLC A;  5D6J B;  2NBU A;  1E8Y A;  2R2O A;  2BPS A;  2RD0 A;  3PLV A;  2DYO A;  5JZE B;  3W1Y A;  4HPL B;  1RLF A;  2KX0 A;  2ZZP B;  4IM2 A;  1WXV A;  1C3T A;  3IFW B;  4TQ0 A;  5G2N A;  2N7E A;  2IO1 B;  1E5W A;  2UYZ B;  3EHV A;  3ZDM C;  1Q5W B;  2IO3 B;  1WXM A;  4BKG A;  3MHS D;  2KDB A;  4M8N A;  2LVO A;  4IWP A;  1VCB A;  3V60 A;  3ZW3 A;  3HK0 A;  3RD2 A;  2JXX A;  2K6D B;  2MA9 B;  1KOT A;  2BYE A;  1FXT B;  2KQS A;  4F8C B;  2V4L A;  3ZNH B;  4KSL C;  3V62 A;  4AJW A;  2WDT B;  4G3X B;  4W9H A;  2K6Q A;  4GDL B;  5CHF A;  4TV3 A;  1XD3 B;  5LLI A;  5D2M B;  5IA7 A;  5EDS A;  4E71 A;  4FHJ A;  3ZTD A;  4KSK C;  5AZH A;  3UQA A;  3VUW A;  2HD5 B;  2YLM A;  2DHZ A;  2I1K A;  5E6N A;  2JPH A;  3WAO A;  4MM3 A;  1WI0 A;  3PHW B;  5KHO A;  2AYO B;  2O6V A;  2GBN A;  5J18 A;  1P9D U;  4GXB A;  4HCN B;  3ZLZ A;  1YD8 U;  3CST A;  1WM3 A;  1RAX A;  2JZZ A;  3PRZ A;  1E8W A;  1S1Q B;  1R4N I;  2BGF A;  2K8C A;  4K1R B;  3VUX A;  3W1S C;  4ANV A;  2BWE S;  2MX2 A;  2DYB A;  2CHX A;  2NPT B;  4KZC A;  4FLH A;  4TQ1 A;  1OEY A;  3ZVV A;  2OJR A;  3CSF A;  1MG8 A;  3VTV A;  3QC8 B;  3ALB A;  4PS7 A;  4MJS A;  3VFK A;  3RZF A;  2CHW A;  4HK2 A;  1H4R A;  2MQJ A;  2N9X A;  3TIX A;  4ANU A;  2K8B A;  2WX0 A;  4PYZ A;  1Z2M A;  3DBH I;  5TR5 A;  3V61 A;  3PRP B;  2L7R A;  3NZS A;  3L08 A;  1PQS A;  4NQK E;  3A9J A;  2LAS A;  1T0Y A;  2N1W A;  2HTH A;  4M8M A;  5CTR C;  4LCD E;  3VUY A;  5L95 C;  4GSW A;  3MTN B;  3S2A A;  3TJP A;  2LVP A;  3L17 A;  2C7H A;  4G11 A;  3M62 B;  4MSQ B;  4MGZ E;  2EKE C;  2KC1 A;  3KUD B;  3ZTC A;  2LI5 A;  4AJY B;  4EFO A;  4JL9 A;  4IM3 A;  5FR6 A;  2MBQ A;  2KJ6 A;  5DPR A;  2KOX A;  2W9N A;  3HIZ A;  5BO4 B;  3WA0 A;  2G4S A;  1E8X A;  2RSU A;  4JQW C;  4F1S A;  1J8C A;  3L13 A;  1Z5S B;  2FCS A;  2LUE A;  3K9P B;  2LGD A;  1I42 A;  4W9L A;  2JT4 B;  1YJ1 A;  4MGI E;  5LXH A;  3SHQ A;  2KMA A;  1V9J A;  3N3K B;  1GC7 A;  3Q3F A;  1WX9 A;  4W9G A;  1TBE A;  3ZNZ B;  2RGF A;  2RR9 A;  4GMV A;  2JZ3 B;  3DCG A;  3V6C B;  2A4Z A;  4DDI D;  3BIN A;  3NY5 A;  5J17 A;  3DDC B;  2GBK A;  4KZ0 A;  3KYC D;  3R66 C;  1ZW7 A;  5CHW A;  1WM2 A;  2ZJD A;  2J0K A;  1SE9 A;  1WRD B;  2NBW B;  4FJY A;  1A5R A;  2KVR A;  3V6E B;  2KNB A;  2IBI B;  2KN5 A;  3AU4 A;  4GDL A;  4W9E A;  4BKS A;  3PRE A;  2IZV B;  1GC6 A;  3AI5 A;  2G3Q B;  4BKT A;  3ZUN A;  4FJV B;  1YX5 B;  1UEL A;  4RM9 A;  4K7S A;  1KJT A;  4HVB A;  3ONS A;  4IW0 A;  2KX3 A;  2K1F A;  2KTR B;  4GDK B;  1YX6 B;  2QHO A;  2KAN A;  3OLM D;  3WAP A;  4ANX A;  3H9D A;  3DVG X;  2GBJ A;  1V2Y A;  4MH0 E;  2J7Q B;  2O6V B;  4ZRI A;  3ZO5 B;  3EEC A;  1V49 A;  4LDT D;  5DCN A;  4JLC A;  1UGM A;  1V80 A;  4GU2 A;  5E6O A;  2BKF A;  4KIK A;  3UIO B;  2JVC A;  1IP9 A;  3PVL A;  4JIO U;  5JH5 C;  1E8Z A;  2FID A;  3RZW C;  4PS3 A;  5C1Z A;  1VD2 A;  1GUA B;  4ANW A;  3U7D A;  3SU8 X;  1Q1O A;  2LRW A;  4J6I A;  1WZ0 A;  3UIN B;  2KHW B;  3QJZ A;  1LM8 B;  1R4M I;  3C0R B;  3CMM B;  4GB9 A;  2PPH A;  4KIK B;  2L8J A;  4LJO B;  2PJH A;  4HLE A;  5AZF A;  4MEL A;  3APF A;  2IYD B;  2IO0 B;  4MEM A;  2K39 A;  2D11 A;  4NY0 A;  2ASQ A;  3KW5 B;  5HKH A;  1WFY A;  3LDZ E;  1EF5 A;  2KFJ A;  2KFK A;  4HWI B;  4W9C A;  2C60 A;  2R2Q A;  3QX1 A;  5JHA A;  2D10 A;  1WX8 A;  1M94 A;  2FIF A;  1QZE A;  3W1S A;  2MBE A;  1WGY A;  3VXW A;  4BKS D;  4CYE A;  3B1L X;  3DOW A;  3VTU A;  2EMS A;  2XBB C;  2JRI B;  2L00 B;  2NR2 A;  1E7V A;  2FUH B;  2ZCC A;  3DQV A;  2ZEQ A;  1GG3 A;  3L54 A;  2KDE B;  4BFR A;  4WWO A;  4E74 A;  2HE7 A;  5CX3 A;  1UH6 A;  4NJ7 A;  1V5T A;  3D32 A;  4WWN A;  3IHP C;  2LVQ A;  4OVV A;  5CHV C;  2LWP A;  1UBI A;  1YQB A;  4OVU A;  3TBL D;  4II3 B;  4WAA A;  1WXA A;  3R7Q A;  1WE7 A;  3IG3 A;  4BOS C;  4BBN F;  2KKC A;  4XX5 A;  3K9O B;  4EZJ A;  3A4R A;  2OOB B;  3GOE A;  4AWJ A;  1P1A A;  4WJN A;  3APD A;  1WJ4 A;  4P7I A;  4AOF A;  1OGW A;  2N9P C;  3QIJ A;  4K81 A;  2ZNV B;  3JSV B;  1IYF A;  3DVN V;  4DBG A;  2L0F A;  3DBL I;  4X57 B;  2MBH A;  4WJO A;  4EEW A;  1V5O A;  1P3Q U;  3B0A A;  2KD0 A;  2FCN A;  1OQY A;  3VQI A;  2NVU I;  3HM6 X;  1WE6 A;  4BBN C;  2DYM A;  2JF5 A;  5C23 A;  2O2V A;  2LD9 A;  2XK5 B;  1UZX B;  1HE8 A;  2LJ5 A;  1EO6 A;  4NQL B;  3DBR I;  2DAF A;  3N32 A;  2BF8 B;  3SD5 A;  1CMX B;  3JYU A;  4JGH B;  3QQ8 B;  5DPT A;  2JWZ A;  1KLV A;  2KLG A;  3PZD A;  1NI2 A;  2ZCB A;  3QAQ A;  5G55 A;  3UIP B;  2IY1 B;  3ML8 A;  4KDL B;  3A9K B;  3CF6 E;  2M8S A;  3WIM A;  4BVU C;  2EMT A;  4ICU A;  3X23 A;  2G4D B;  3P2B A;  2BYV E;  2KJH B;  1L2N A;  3AXC A;  4MSM B;  4PYU A;  2J0J A;  1WGG A;  2NCN A;  4HDQ A;  1H8C A;  2L76 A;  4MJS B;  4II2 B;  4I6N B;  2PEA A;  3ENE A;  4K7W A;  4ASW C;  2BWF A;  2MP2 B;  4NAW B;  4G50 A;  1I35 A;  1SIF A;  2MSE D;  1V6E A;  3DVN U;  2JY6 A;  3VH3 B;  4IUM B;  2KXJ A;  3ZDT A;  4DHZ B;  2KDI A;  5AZG A;  2AL3 A;  4LJP B;  5D94 A;  4WQO B;  2V1Y A;  3VVW B;  3NOB A;  1SGH A;  4A20 A;  2M0X A;  2CS4 A;  4DK5 A;  3NHE B;  2LGY A;  4AP4 C;  3WAN A;  2FCM A;  3AUL A;  3ZIM A;  2FAZ A;  2K8H A;  2M17 A;  1WX7 A;  3NZU A;  3L10 B;  3ZNG C;  2C7M B;  3GZN I;  4E3C A;  2N7D A;  3TL5 A;  2KC2 A;  2ZNV C;  3ECI A;  1WR6 E;  4DXA B;  3QA8 A;  2JUO A;  3EC8 A;  3N30 A;  3UF8 A;  3ZRC A;  3TMP B;  2VRR B;  5D7G A;  1L7Y A;  2V3S A;  4B95 A;  2AEH A;  2ZVO A;  2LRU A;  2KDF B;  2DEN B;  1LQB A;  2REX A;  1WY8 A;  4WJP A;  4HPM B;  1EUV B;  3HM3 A;  2C7N B;  2O2V B;  3PPA A;  2UWQ A;  2XEW A;  1Y8R C;  4AUQ C;  4HJK A;  4ZYN A;  4CHK A;  1X1M A;  2GMI C;  1WIA A;  2N9E B;  4DHJ D;  1WH3 A;  2KO3 A;  2M1M A;  1U4A A;  2NPT A;  4EOY A;  3SDL C;  3PGE A;  2CKH B;  3QHT A;  1ZKH A;  2LZ6 A;  3EFU A;  3ML9 A;  1K8R B;  3AU5 A;  2JRH A;  4KV2 A;  2KJR A;  2L05 A;  2MBO A;  3LJ3 A;  2PE6 B;  4FBJ B;  3RYT A;  1WXS A;  4GDK A;  4DDG D;  3A9K A;  4GN1 A;  2K25 A;  3T9L A;  4EKU A;  1E90 A;  2KK8 A;  5LXI B;  1OEY J;  2WYQ A;  2C5L C;  2L3Z A;  4W9I A;  4FJZ A;  4HCP B;  4XZ4 A;  1WGD A;  5DPW A;  4URK A;  3A4S C;  4RMA A;  3M95 A;  4KDI C;  3R7R A;  4IWQ A;  4WJQ A;  2PE9 A;  2LXC A;  1JRU A;  1LFD A;  2GOW A;  2AWT A;  2D07 B;  4PS8 A;  2N1V A;  5DPS A;  1WJN A;  2MLB A;  2IO2 B;  2MP2 A;  2O6V D;  3A33 B;  2ZPY A;  1E7U A;  3DBS A;  1WR1 A;  3M3J A;  3L16 A;  2DZK A;  3VH4 B;  4I6L B;  3H7S A;  4B6W A;  3KH0 A;  4IC7 B;  2DZM A;  1AAR A;  2KWC A;  2D2Q A;  4BOZ B;  1NDD A;  3DVG Y;  3NS8 A;  2LGX A;  4KVG B;  3PRM B;  2Z0E B;  3VHT C;  1P0R A;  1GNU A;  1J19 A;  3PSE B;  4IM0 A;  5GMV A;  2ZVN A;  1KM7 A;  3A1Q A;  3H1U A;  3MJW A;  4MDK E;  2L0T A;  3UGB B;  1WYW B;  1Q0W B;  3VTW A;  2I1J A;  3IBE A;  3PT2 B;  2WWZ A;  1WF9 A;  2J0M A;  4HXD A;  3WAL A;  3QWZ B;  3U30 A;  1WMH A;  2RPQ A;  4A3P A;  3X0W A;  4IWO A;  4TKN A;  4CO7 A;  4ZRK A;  4ZRJ A;  1TZ1 A;  2Z0D B;  2WX1 A;  1WJ6 A;  1J0G A;  4FA6 A;  2CR5 A;  2MRP A;  2BKR B;  2DAJ A;  3IVF A;  4MGK E;  4M0W B;  2C9W B;  2HJ8 A;  3PTF C;  3L0W B;  4G0N B;  3KYD D;  4W9F A;  1YIW A;  3DPD A;  4IG7 B;  4LDT B;  2NS5 A;  1D3Z A;  5JHB A;  4FN2 A;  3QK0 A;  3BY4 B;  4XC2 A;  2Y5B B;  1TGZ B;  2IY0 B;  3KUZ A;  3KVF B;  4W9D A;  2KTR A;  4MGY E;  3H7P A;  1WGR A;  5E6P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...