4I6PA

Crystal structure of par3-ntd domain
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
84
structure length
84
Chain Sequence
b'SEFKVTVCFGRTRVVVPCGDGRMKVFSLIQQAVTRYRKAVAKDPNYWIQVHRLEHGDGGILDLDDILCDVADDKDRLVAVFDEQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Partitioning defective 3 homolog
publication title Structural insights into the intrinsic self-assembly of par-3 N-terminal domain.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
total genus 19
structure length 84
sequence length 84
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4i6pA00
1YX6B 1V2YA 3PPAA 2D2QA 3T8MA 5C1ZA 2LJ5A 1MG8A 3IHPC 3W1SC 3ZTDA 2XBBC 3PRMB 1WI0A 4M8NA 2XEWA 3R7RA 2Z0EB 2ZPNA 4M0WB 4HLEA 1WE6A 3ZW3A 1YX5B 2ZVNA 3CSTA 3DOWA 1VD2A 3M62B 3NY5A 1WGHA 2J0MA 4EEWA 1H8CA 4BKGA 2D11A 3RT3B 3ZIMA 1OGWA 3KH0A 2C7MB 2A5UA 2N9XA 3DBSA 4IG7B 2J7QB 3B0AA 4DDID 4KZ0A 1WMHA 3QA8A 2HJ8A 3ZTCA 4URKA 4LJPB 3DBHI 2MBEA 1AARA 2GOWA 4KIKA 1WGDA 2EKEC 2R2QA 3JW0X 4PYUA 5DPRA 2FUHB 2ZPYA 4F1SA 2IZVB 3UGBB 5D7GA 4FHKA 5LXIB 2KDFB 1TBEA 2GBKA 2KFKB 4HPLB 1EF5A 3AULA 3DCGA 4GN1A 2J0JA 4IM3A 2FNJB 2XK5B 3RD2A 4K7SA 1WY8A 3TMPB 1UZXB 2DHZA 4W9EA 3TL5A 2DZIA 2NS5A 3UQAA 3CF6E 3PHWB 2R2OA 2LASA 2JRIB 2KWVB 2L8JA 3WIMA 3ML8A 3R7QA 2REXA 3QJZA 4JQWC 5LLIA 4KDLB 3RZFA 4DDGD 4G3XB 4EFOA 2M4NA 1P9DU 2OJRA 3U8ZA 4ASWC 2M1MA 2LD9A 2CKHB 3A9KA 2KMAA 3ONSA 3PVLA 3PRPB 1QZEA 3QAQA 4NAWA 3TCAA 3W1YA 3RCZA 3SDLC 2LGXA 3VH3B 4TV3A 2CU1A 4BOSC 1GUAB 2BKRB 2KO3A 2N1WA 2JXXA 4W9GA 3ZKJC 3WAPA 5GMVA 3PS6A 2PE9A 1EF1A 3KVFB 3HIZA 5E6PA 3MHSD 3QARA 2AYOB 2KC2A 3DVGY 3ALBA 3A1QA 5EDSA 3L13A 3WA0A 4GU2A 2K8CA 4AUQC 1L2NA 2N7DA 1BT0A 4PYZA 2L0TA 1G6JA 2UYZB 2JZZA 2LVPA 2GBNA 4TUUA 1GC7A 4AWJA 4GMVA 2JY6A 2LRWA 3Q3FA 4MJSB 4NPNA 2L05A 1SE9A 3AU4A 1YIWA 3PRZA 4F8CB 2KZRA 2L3ZA 1J0GA 3RULA 4WJNA 4WJOA 2V4LA 2C60A 3B1LX 2LI5A 3TIXA 2RSUA 4OVVA 1WYWB 3M63B 4MM3A 4GDLA 3JSVA 3KYDD 3S2AA 1NI2A 5AEKB 2Z0DB 3DVNU 1WMHB 4ANXA 2KHWB 4W9CA 3RZWC 1LFDA 4JLCA 4K7WA 2V1YA 4LJOB 4KIKB 1WXMA 1UD7A 2AWTA 2MW5A 2HTHA 3L0WB 3M3JA 4HJKA 1WGGA 4I6NB 2PJHA 4A3PA 4KSKC 2FCSA 4WWPA 5DCNA 2V3SA 1E7VA 2KFJA 2VRRB 1RRBA 1TGZB 2BYEA 2IBIB 3ZO5B 1RAXA 3IBEA 3IFWB 3N32A 1R4NI 4IC7B 2DZJA 2IO3B 4JIOU 4HWIB 3PLUA 4ANUA 2NPTA 3CSFA 4HVBA 4BBNC 3APDA 2EMTA 2NCNA 2K8BA 4HXDA 3TBLD 3TJPA 3Q3JA 2MBQA 3ZNID 2KDEB 3QK0A 1D3ZA 2I1JA 2C7NB 2NBWB 1WZ3A 5L95C 3K9OB 2HE7A 4FHJA 1WJ4A 2W9NA 1KM7A 3IG3A 4BVUC 2O2VB 4FA6A 4ZYNA 2FIFA 1OTRB 4WWNA 3HM6X 2ASQA 2DYMA 2I1KA 4DBGA 4WJPA 4E74A 1KJTA 1L7YA 1XT9B 1OQYA 2D07B 5FR6A 2M0XA 2DZKA 2K1FA 4NAWB 3V6EB 4WWOA 4CHKA 1WR1A 2GBRA 2KWUB 2G4SA 3H7SA 3OLMD 3VXWA 2LZ6A 4ZRIA 2OOBB 3R66C 1GJZA 1WJNA 2QHOA 3OJ4B 2KJRA 2KANA 2LVOA 4NQLB 3ZVVA 3D32A 3A1QB 1ISNA 4HCPB 1P3QU 1WJUA 1E8WA 2BGFA 2KDIA 5DPTA 1WGRA 3BINA 4K7UA 4TKNA 1R4MI 2KLCA 4PS3A 4BOZB 5J17A 4GGQA 3C0RB 1WJ6A 2MP2A 3KUZA 2JVCA 2LUEA 1LQBA 3KUCB 1WM2A 2WYQA 1T0YA 2LWPA 4IWPA 2YLMA 4JL9A 2DYBA 3U30A 1IYFA 2FIDA 1U4AA 4HPMB 1S3SG 4A20A 5AZGA 3OJ3A 4KSLC 3AU5A 2L76A 3APCA 1V49A 4CO7A 1C3TA 2KQ7A 1E8YA 1WX9A 4GDLB 1WR6E 2ZNVC 3JSVB 5JH5C 3VUWA 2MSED 1WXVA 1I35A 3EHVA 2L00B 4DHZE 1RLFA 2FCMA 3O65B 3QCAA 1UBQA 3MJWA 3V62A 4DHZB 3DVNV 4LDTD 4NY0A 4BKSA 3X0WA 5E6NA 4II2B 5CX3A 1KLVA 4NJ6A 4FN2A 1Q5WB 1UBIA 2LXAA 1H4RA 5AZFA 2KDBA 1WH3A 2ZEQA 4B6WA 4P7IA 4CYEA 1V5TA 2ZVOA 5CHWA 5J18A 2MQJA 2BF8B 3KUDB 3VUYA 3WAMA 3VH4B 4HDQA 2BPSA 3ML9A 3V61A 4W9KA 3A33B 2MLBA 4MDKE 4BKSD 3DVGX 2ZNVB 2IO2B 3PSEB 3EFUA 3HM3A 3UQBA 1LM8B 2KTRA 2NR2A 1NDDA 2O6VA 4OVUA 4GDKA 4PS8A 2N9EB 1NBFC 4AJWA 3QQ8B 4ZDVA 2K6DB 2FCQA 1GG3A 2IO1B 1SIFA 1P1AA 1V9JA 2LXCA 2WX1A 3IVFA 2GBMA 3N30A 2KKCA 2LGDA 3ZNGC 2CHWA 1JRUA 4DK5A 2JUOA 2MRPA 2DZMA 2DYOA 2KX0A 4MELA 3VTVA 4KV2A 2LRUA 3H1UA 3VHTC 3A4RA 3H7PA 2Z59B 4WQOB 2O6VD 2RR9A 1A5RA 1E5WA 3A9JA 1WZ0A 3WANA 2IY1B 2G45B 1PQSA 2G4DB 2BYVE 3R3MA 1V5OA 3SU8X 3VFKA 4XC2A 2CHZA 3NS8A 2BYFA 4IWOA 5C23A 4B9KA 1V80A 2RPQA 4W9HA 4EZKA 3LDZE 1RFAA 4TQ0A 3H6NA 4G0NB 2MX2A 2IYDB 2MBOA 5JHAA 3VUXA 2PEAA 3RYTA 5CHFA 1WXSA 3APFA 2D3GA 2L7RA 3WAOA 3L54A 3ZRFA 2IO0B 1EO6A 3EC8A 3NZUA 4I6LB 4LDTB 2KLGA 2KN5A 1ZKHA 4MSMB 4NQKE 4E71A 2L0FA 1ZGUB 2LVQA 3PV1A 5AZHA 3QIJA 1Z5SB 3QWZB 3T9LA 1Z2MA 1XQQA 3DQVA 3B08A 3BY4B 1WE7A 2BWES 3KW5B 3PREA 4NNJB 4W9LA 1V6EA 1TTNA 4XZ4A 1UELA 5CHVC 3UIPB 4B95A 1J19A 2JWZA 4K1RB 2ZCCA 4W9FA 3A9KB 2EMSA 4AP4C 2KC1A 2PE6B 4ICVA 1J8CA 2JZ3B 4GB9A 4W9IA 3L10B 5D2MB 5KHOA 3UIOB 2K8HA 4HDOA 2AL6A 1EUVB 3PZDA 4MJSA 4IW0A 4G50A 4KZCA 2M8SA 5D6JB 4AOFA 5G55A 4EUTA 1M94A 3WALA 5L83A 5LXHA 3PHXB 3H9DA 2MBBB 2DAFA 1E90A 2K39A 4EOYA 4FADA 2JT4B 2N1VA 3UF8A 5IA7A 3RUIB 1WXAA 3P2BA 3ZNZB 2HD5B 1Q0WB 2RGFA 4EZJA 4ZRJA 4DXAB 1I42A 4FULA 4RM9A 5JHBA 2NVUI 4FJVB 3PT2B 2AL3A 4GXBA 3GZNI 2ZCBA 4ANVA 3ZNHB 3CMMB 3QC8B 2KTRB 4IM0A 1HE8A 3L16A 3UINB 4MGKE 2O6VB 2M17A 4MEMA 4F7ZA 1WF9A 4GDKB 3DDCB 2JRHA 2N7EA 1GC6A 3L17A 4TQ1A 1VCBA 1CMXB 2YVCA 4FJZA 3ZLZA 3PTFC 4WAAA 3SD5A 1XD3B 2C5LC 2GBJA 3PGEA 1FXTB 2WDTB 4RM8A 4M8MA 3V60A 5HKHA 4MH0E 1P0RA 2DENB 4IUMB 4IWQA 4HCNB 2K6QA 2KOXA 2Y5BB 3HK0A 4J6IA 4ICUA 3X23A 2JPHA 1WIAA 3LJ3A 2NBVB 3H7PB 3N3KB 2JF5A 2FCNA 3A9JB 1LXDA 2IY0B 4GSWA 2PPHA 1GNUA 2MWSB 2MCNB 3M95A 1YQBA 2N4FA 5CTRC 2D10A 3JVZX 2O2VA 5KHQA 4W9JA 2B3AA 4II3B 3VAWA 3ZDTA 4MGZE 1KOTA 1SGHA 2ZJDA 2KNBA 1S1QB 2MA9B 4MGYE 1YJ1A 2FAZA 4WJQA 1WGYA 2NPTB 2UWQA 4X57B 4A3OA 3JYUA 4DHJD 2J0KA 4HK2A 3ECIA 4BFRA 3ZRCA 3KYCD 2CR5A 2KK8A 3VTWA 3EECA 1E7UA 3V6CB 3W1SA 1X1MA 1IPGA 2KVRA 2KFKA 4GOCA 4EZLA 3QHTA 4GIVA 2C7HA 3VTUA 3I3TB 3ZDMC 2AEHA 2XK5A 2RD0A 5DPSA 3VVWB 1OEYA 2C9WB 4BKTA 3DPDA 3QX1A 2A4ZA 2N9PC 1P98A 4AJYB 1OEYJ 3DBLI 4I6PA 5G2NA 3K9PB 5J2RA 4YL8A 4G11A 1UH6A 1Y8RC 1C1YB 2KJHB 2KXJA 4LCDE 1V86A 1Q1OA 4FBJB 4DWFA 2K25A 2KX3A 5DPWA 2CHXA 5IAAC 1WX8A 3AXCA 3NOBA 1ZW7A 4KVGB 3U7DA 1WFYA 4E3CA 4K81A 2LGYA 3ZUNA 3DBRI 3GOEA 3NHEB 2G3QB 1TZ1A 1E8XA 5D94A 2CS4A 1V81A 3OAWA 5TR5A 4MGIE 2MP2B 3ENEA 4FLHA 3SHQA 3PLVA 4XX5A 2KWCA 3A4SC 4JGHB 2GMIC 2KTFA 4NJ7A 1WX7A 4RMAA 1WM3A 4BBNF 2MBHA 2KQSA 4MSQB 3VQIA 3VDZA 1F9JA 4ZRKA 2BWFA 5E6OA 3AI5A 2WWZA 2KD0A 2WX0A 4FJYA 1UGMA 4PS7A 1K8RB 2DAJA 2NBUA 4ANWA 5JZEB 1YD8U 3NZSA 4N9F4 2DX5B 2ZZPB 3L08A 3MTNB 4W9DA 4EKUA 3HHMA 4KDIC 2KMCA 1IP9A 2KJ6A 2BKFA 4IM2A 4DHJB 1E8ZA 1WRDB 5BO4B
chains in the Genus database with same CATH superfamily
3HRDD 5C1ZA 2NTSA 3PRMB 2INCC 3R7RA 1JWBD 3ZW3A 1YX5B 3NY5A 4EEWA 2C7MB 1SF0A 4RCOA 2Y3AA 4D2KA 1VRAB 1L6UA 1DYQA 1FD6A 2FUHB 2IZVB 3UGBB 5IKCM 5D7GA 3VR9B 2KDFB 3RFZB 1EF5A 3DCGA 4GN1A 4IM3A 3RD2A 5I4DA 1C78A 2CJNA 3TMPB 2W55A 2DHZA 4W9EA 2UU7A 2JRIB 3R7QA 2REXA 1MPEA 3RZFA 2KN4A 2LGSA 2FE8A 3ZXVA 3A9KA 1QZEA 3R2TA 4TV3A 2WS3B 4BOSC 4RF1A 4W9GA 5C3JB 2G9HD 3KVFB 5MPOA 3MHSD 3QARA 2IGDA 1PGBA 3WA0A 2N7DA 4PYZA 1SJHD 2BS2B 2J53A 5C2TB 2WXLA 2GBNA 3FKYA 2WXRA 3Q3FA 2LRWA 4M02A 4BZAA 1SE9A 2KZRA 1J0GA 3BK1A 4XDDA 2LI5A 3M63B 2PW9A 3S2AA 5AEKB 1RWSA 1J7CA 1HQRD 3H8HA 2V1YA 2JYEA 4KIKB 1WXMA 3L0WB 1KTKA 4A3PA 3AE4B 4WWPA 2KFJA 1RRBA 2MJEA 2IBIB 2WXHA 3IFWB 3N32A 1MI0A 1R4NI 4IC7B 4HWIB 2LFIA 2GLSA 3APDA 2WXPA 3TBLD 4EE2A 2ZW0A 1D3ZA 2C7NB 1ZP0B 1WJ4A 3IG3A 1FNWA 2N9KA 1E7PB 2VH2A 1FRRA 1XT9B 2M0AA 2M0XA 2OEDA 1IBXB 4ARIA 3NVVA 1XCQL 4RFBA 4RGOS 3R66C 2QHOA 2KANA 4M00A 2PTLA 4NQLB 3ZVVA 5DPTA 4L23A 3BINA 1PUTA 4US8A 4ACFA 4GLSC 3AEAB 1E6EB 1FXIA 3KUCB 1GPXA 1T0YA 3GE3C 4IWPA 3U30A 2J52A 4HPMB 1K51A 1S3SG 5AZGA 3P63A 4ZOHC 2L76A 1C3TA 1KLGD 1E8YA 1WX9A 3JSVB 1CK1A 1WR6E 1D5MC 2ZNVC 3DHIC 3SFEB 2KQ4X 4DHZE 1RLFA 1UBQA 1ZOYB 3MJWA 3V62A 3DVNV 3X0WA 1ZPSA 3NS1A 4II2B 1WGKA 4NJ6A 3LXFA 1H4RA 5AZFA 2KDBA 4CYEA 1N60A 1ZXIA 5CHWA 1OQRA 2ONQA 5J18A 3KUDB 3VUYA 3RNEC 2L1AA 4HDQA 1T0RC 1M4VA 4ZYSA 1HZ5A 3E9SA 2M19A 2D3AA 3AEBB 3A33B 3EFUA 2KMMA 2O6VA 1JQ4A 1N5WA 3NG0A 2N9EB 4ZDVA 2IO1B 1V9JA 3N30A 2LGDA 1JRUA 3AEDB 4ZRPA 2DZMA 3TEZA 4MELA 4KV2A 2LRUA 2Z59B 1E5WA 4RGTA 1GB4A 2G45B 1PQSA 1CQVA 2G4DB 3DBHB 3U4EG 4XC2A 1PFDA 2QSDA 3NS8A 5C23A 3MC9A 2NMQA 3MHZA 1RFAA 3VRBB 1AW7A 3H6NA 1FNUA 3OG5A 2PEAA 2MJ3A 3AM9A 3Q8CA 4A55A 2AQ3B 3APFA 4OW0A 3RNBC 2JYTA 3WAOA 1DOYA 3ZRFA 2IO0B 4I6LB 3EC8A 4MSMB 4E71A 5GXGB 5IN7A 3R8BA 1BUIC 1PGXA 3DQVA 3KW5B 2YEPF 1TS5A 1TTNA 1UELA 1L0XB 3A9KB 1TIFA 3L10B 3TSSA 3J9CA 3Q8BA 2K8HA 2BW2A 4KZCA 1KFYB 5IO9A 5G55A 1TS4A 3MC0B 2MBBB 5D3DA 2EELA 2JT4B 3UF8A 3I9V1 3AECB 1WXAA 2Y5CA 4EZJA 3B2GA 1I42A 4TMAB 2NVUI 4P1BC 2AL3A 3IAS1 3GZNI 2PMVA 4ANVA 3UINB 4MGKE 4MEMA 1T6BX 3DDCB 2JRHA 2N7EA 3L17A 4IKGA 3BYTB 1T0QC 3SD5A 3PGEA 4M8MA 2QEJC 4IUMB 3DHHC 3HK0A 1J7BA 2Z8LA 1UWXA 2LMCA 1Y56A 3N3KB 3PO0A 1JALA 2FBWB 2PPHA 2MWSB 4KGSA 5CTRC 2D10A 4II3B 3VAWA 2CJOA 2ZJDA 2KNBA 2MA9B 4X57B 3JYUA 3NJTA 3ZRCA 3N1YC 3W5VB 5JXVA 2KK8A 2XN9C 1DOIA 5D3IB 2QILA 3QHTA 2C7HA 2H89B 3VTUA 1UWMA 2AEHA 1P7FA 2QCZA 2QMTA 2RD0A 5DPSA 1T3QA 2N9PC 4ZRQA 1OEYJ 3DBLI 1Q10A 5G2NA 5J2RA 4AQ7A 1XEEA 3U2SC 1C1YB 2KXJA 3NRZA 5DPWA 1C77A 1L6VA 5IP4D 1N62A 1N63A 3NHEB 4A8XC 4MGIE 3ENEA 3PLVA 1EU3A 3AE7B 2KTFA 5AUKA 2W3SA 2D5GA 1FO4A 3VQIA 1F9JA 2BWFA 5E6OA 5G5GA 4EKUA 2PVGC 3FILB 3Q2AC 4WWMA 1JWAD 1E8ZA 5BO4B 2WU5B 3PPAA 2K5PA 1D5ZC 2ZPNA 4M0WB 4HLEA 1WE6A 1N61A 4B0EA 3DOWA 1VD2A 3M62B 2INPE 3Q8EA 3KH0A 3RNFC 2SEBD 4IG7B 2BS3B 4RGNA 2J7QB 1HTOA 4KZ0A 3PZ7A 3ZJUA 4KIKA 1WGDA 2EKEC 1SBBB 2PLPA 4F1SA 5H92C 1D4BA 1E9MA 2KFKB 2GI9A 2LUMA 3AULA 2WHIA 2FNJB 1WY8A 1UZXB 2X8XX 1E10A 2DZIA 3DWGC 2LASA 4ZHOA 5TSSA 4K3CA 4EFOA 1VZ7A 2QJLA 2OJRA 4ASWC 2JXTA 3OWEB 2LD9A 2CKHB 3FAHA 2V9HA 2KMAA 3AE2B 4HPPA 3TCAA 3SDLC 4HKZE 2JQRB 2KO3A 2N1WA 3PS6A 1SB3C 2PE9A 2W82A 2AYOB 2KC2A 3DVGY 2WP9B 3L13A 2K8CA 1L4DB 2UYZB 1QLBB 1C4AA 4AS1A 1YOVB 2J4XA 1EWYC 4F8CB 2L3ZA 2H88B 2V4LA 2C60A 3TIXA 4QAYA 2RSUA 4OVVA 1UF0A 3JSVA 1AYFA 2Z0DB 4NZLB 1FXAA 4JLCA 1DOXA 4LJOB 1UNSA 1UD7A 3M3JA 2HTHA 4HJKA 2MHJA 2BYEA 4HJGE 1RAXA 2IJ0A 2IO3B 4JIOU 3PLUA 1FRDA 4BBNC 1QOBA 2BT6A 3Q3JA 2KDEB 1I4PA 4YXDB 1RFKA 1XLOA 3I63C 2I2YA 4FHJA 1VLBA 2HE7A 2WXKA 4XDCA 4XYCA 4ZYNA 2FIFA 4WWNA 3BVMA 4DBGA 4WJPA 4E74A 1L7YA 1AN8A 2K1FA 4NAWB 4IDIA 3RMKC 4CHKA 3OLMD 4PK1A 2LZ6A 2OOBB 4JX1C 1ET6A 3D32A 3A1QB 4KKIA 4S17A 4YT0B 1KLUD 2BGFA 1IGCA 1WGRA 4K7UA 4TKNA 2K22A 2Q5WD 3IAM1 4GGQA 2MP2A 2JVCA 2LUEA 4OZCA 3ABVB 2LEKA 4JL9A 1D6EC 2FIDA 1RM6C 5HFYA 4KKJA 1V49A 2V3PA 1B1ZA 2FUG1 2MSED 1I35A 3EHVA 2L00B 3O65B 3QCAA 2L52A 4NY0A 5CX3A 1UBIA 2LXAA 4WIPA 4LNIA 3WAMA 3VH4B 1HA5A 2BPSA 4C56C 2K3UA 4MDKE 1R4NB 4BKSD 2JWUA 2ZNVB 3HM3A 3UQBA 5BMIA 4LLGM 2LHDA 1CJEA 1QILA 4PS8A 1PDXA 1GOZA 1SIFA 1P1AA 1QT9A 3MFGA 3ZJTA 2JUOA 2JZPA 3FC4A 1A5RA 3NVZA 4N59A 3R3MA 1GAQB 2WXFA 3MJ5A 1MHXA 1JROA 4OVZA 2NTTA 1V80A 3IT6B 1LO5D 3O13A 1KRHA 1WXSA 3AEFB 3L54A 1XF5L 1VR9A 2PIAA 4OHJA 5IOIA 1ZGUB 3PV1A 5AZHA 1Z2MA 1SEBD 4W9LA 4B95A 1HXYD 1J19A 2JWZA 2DWQA 4W9FA 2KC1A 1J8CA 4GB9A 4W9IA 5D2MB 2DBYA 1EUVB 3PZDA 1XLNA 5D6JB 4EUTA 5BMHA 5L83A 1E90A 1JWMD 1OFFA 3ZNZB 1Q0WB 1C79A 4DXAB 1UUPA 4RM9A 4FJVB 3PT2B 2ZCBA 3ZNHB 2KTRB 1HE8A 1MVKA 3L16A 4C7YA 1SE3A 1FCLA 2BB5A 1GC6A 1VCBA 3Q3MC 4FJZA 3ZLZA 3PTFC 1XD3B 2C5LC 4RM8A 2WDTB 3RPFC 5HKHA 4MH0E 1P0RA 1YJIA 4IWQA 3FILA 2K6QA 2KOXA 2Y5BB 3X23A 1WIAA 4HEA1 3H7PB 2BYTA 2MCNB 4M0WA 1YQBA 3JVZX 3ZJVA 5KHQA 2SAKA 4MGZE 2WU2B 5EE0A 1YJ1A 2UWQA 4DHJD 4HRSA 1A70A 3VTWA 2V0GA 1QKZA 1E7UA 1X1MA 3ETRA 2PKOA 1YQ4B 3URYA 2KFKA 4US9A 4EZLA 3I3TB 1XO3A 1F0ZA 2WXJA 2C9WB 4BKTA 3DPDA 1P98A 2N7JA 4AJYB 5BYSA 2AQ2B 4G11A 1Y8RC 2W54A 1V86A 4FBJB 2KX3A 5IAAC 3AXCA 4KVGB 1WFYA 2WXIA 2LGYA 3DBRI 3GOEA 1TZ1A 5D94A 5TR5A 2MP2B 3SHQA 1R4MB 2GMIC 2RPVA 3P1MA 4NJ7A 2KQSA 3AI5A 2R61A 4LNOA 2WWZA 2WX0A 4PS7A 1UGMA 1K8RB 5JZEB 3L08A 4KDIC 4LNFA 2BKFA 2LGIA 3NZ3A 3TEYA 4DHJB 3ZUNA 3T8MA 2D2QA 2LJ5A 3W1SC 3IHPC 1HEZE 1V8CA 4USAA 4M8NA 2XEWA 2Z0EB 4TSSA 3CSTA 1YJJA 1WGHA 1H8CA 2D11A 3RT3B 3ZIMA 1OGWA 4Q2JA 2A5UA 2DNFA 5BMGA 2BVCA 2HJ8A 1WRIA 4L2YA 3DBHI 4PYUA 5DPRA 1TKGA 4N6EB 1J7AA 4FHKA 5LXIB 1TBEA 4HPLB 2WGSA 4DQOC 2J0JA 2XK5B 4LNNA 4K7SA 3CF6E 3PHWB 2E6XA 2BS4B 2KWVB 2L8JA 5T8IA 4JPSA 1K52A 5LLIA 3NVWA 4KDLB 4FXCA 4P1CC 4N58A 2M1MA 3RNAC 1VJKA 1L0VB 4IOIE 4YSZB 3AE3B 3ONSA 3PVLA 4NAWA 3W1YA 4LK0M 4KGRA 1TY0A 3BYYB 1F52A 1GUAB 1NYRA 2BKRB 1VZ8A 3P4PB 3KWVA 1HTQA 3HIZA 5E6PA 3A1QA 5EDSA 4AUQC 1TKYA 2L32A 3Q6BA 1BT0A 1G6JA 2JZZA 4YWGG 3AEGB 2LVPA 2G1EA 3SFDB 1GC7A 2JY6A 2L05A 3MP9A 3KWLA 1YIWA 3PRZA 1YN3A 3RULA 4WJNA 1WYWB 3KYDD 1NI2A 3NVYA 1TS2A 1WMHB 4ANXA 1TYGB 1LFDA 4K7WA 1JCKB 2AWTA 1WGGA 2PJHA 2FCSA 2V3SA 1E7VA 1TGZB 5BYQA 2DZJA 3AE1B 4HVBA 2NPTA 4OZAA 1F1HA 2EMTA 3TJPA 2N0SB 3UI3A 1BMLC 3QK0A 2NBWB 1WZ3A 1PYWD 5FR3A 3K9OB 4BVUC 1NENB 3SR6A 4NAMA 3RNGC 2IDYA 3ZGZA 1KJTA 5FR6A 3AEEB 3ZYYX 2DZKA 3N1ZC 4WWOA 1V1PB 1WR1A 2BBCA 2G4SA 3H7SA 1TT5B 1KH0A 2KJRA 4DXGA 3CWIA 4WQMA 2E3TA 1WJUA 1E8WA 2JSVX 1E0ZA 3B9JA 2KLCA 1I4GA 4PS3A 4BOZB 1WJ6A 2KAJA 1LQBA 1WM2A 4UDUC 2YLMA 3L4PA 5AUIA 1IYFA 1QOAA 1U4AA 4KSLC 3AU5A 3U52E 3KQ4A 4CO7A 1I4RA 4MM3B 4GDLB 1SE4A 1WXVA 3GS2A 2FCMA 4DHZB 4LDTD 4BKSA 4A6QA 2D3BA 2WXOA 4FN2A 1Q5WB 2ZEQA 4B6WA 1V5TA 4REZA 3HVZA 3V61A 4W9KA 3IT4B 2MLBA 2WXMA 2IO2B 2KTRA 3TEWA 1NDDA 1YNTE 1TZOA 1NBFC 1T5XD 4AJWA 2K6DB 2FCQA 3HVDA 2WX1A 3IVFA 1GB1A 2KKCA 2CHWA 4DK5A 4RGMA 2MRPA 2DYOA 4P16A 3GE8C 3V3XA 4HKQA 3H7PA 3GB1A 3SU8X 3VFKA 1NI3A 2CHZA 2BTEA 2BYFA 4IWOA 2RDBC 2RPQA 4RH6A 2KDMA 2MBOA 1ET9A 2BB6A 4R3DA 5JHAA 4XGAB 3VRAB 1V1OA 2HTME 2L7RA 1JWUD 1TY2A 1EO6A 3NZUA 4LDTB 2KLGA 2RMMA 4KGTA 2L0FA 1D5XC 4MT5A 1Z5SB 1B9RA 1PGAA 1XQQA 4WH4A 3BY4B 1C4CA 1I4XA 2BWES 3PREA 4MACA 4NNJB 5CHVC 5LNK1 2ZCCA 2JU6X 4ICVA 3UIOB 2WXQA 4RNAA 3AE9B 2AL6A 4MJSA 2Y5PA 4G50A 2M8SA 2WXNA 1NYQA 5LXHA 1ZE3D 3PHXB 4FADA 2K39A 2N1VA 3RUIB 2RGFA 4A90A 5FKAC 1QOGA 4GXBA 1ACCA 3CMMB 3QC8B 1ZDXA 4F7ZA 1WF9A 4GDKB 2KVZA 4TQ1A 1CMXB 2YVCA 4WAAA 2GBJA 3V60A 2DENB 3BVGA 5HG2A 5E6JA 3BIID 4J6IA 2JPHA 3LJ3A 2JF5A 2FCNA 3A9JB 1JW9D 1LXDA 2IY0B 1P7EA 4GSWA 1FCCC 2QDFA 2O2VA 4W9JA 1XXGA 3VR8B 3ZDTA 1SGHA 1S1QB 4S0RA 2FAZA 1WGYA 2NPTB 1ROEA 4A3OA 2J0KA 4HK2A 3ECIA 1IGDA 3T3NA 3EECA 3Q8FA 1VDVA 3V6CB 1L0YB 2D3CA 3BVZA 2KVRA 2MEKA 4GOCA 4JWSC 4GIVA 2ICIA 3BWUD 2XK5A 2KACA 2LHEA 4ARCA 1ZUD2 1JMLA 2A4ZA 2PVOD 4I6PA 3W2DA 1I7HA 3DWMA 3K9PB 4YL8A 3N9YC 1UH6A 1L4ZB 2KJHB 3LB8C 4DWFA 1XLPA 4E3CA 2KT7A 2CS4A 1SJED 1V81A 3AV8A 1C76A 4FLHA 4XX5A 3A4SC 4JGHB 2XNAC 1ESFA 4ZHPA 1WX7A 1WM3A 1IUEA 2INDC 3RI7C 3VDZA 4B0MA 4FJYA 2IGHA 2DAJA 4ANWA 3NUHB 3NZSA 4RF0A 4N9F4 4W9DA 3HHMA 3P4SB 2KMCA 2KJ6A 3TEXA 1YX6B 1V2YA 1MG8A 3ZTDA 2XBBC 1WI0A 2ZVNA 2J0MA 1YN4A 4BKGA 1QQRA 3Q3NC 2N9XA 3DBSA 2ACZB 3N1XC 3B0AA 4DDID 1WMHA 3QA8A 3EGRA 3ZTCA 4URKA 4LJPB 2MBEA 1AARA 2GOWA 3B2FA 2K0PA 2R2QA 3JW0X 2ZPYA 4DXFA 1NVID 2YEPB 1TS3A 3WCQA 2GBKA 1BXTA 3TL5A 2ON8A 3UQAA 2NS5A 2R2OA 4YSYB 1JWSD 4LNKA 3WIMA 2HDEA 2MH7A 3ML8A 3QJZA 4JQWC 4DDGD 4G3XB 4C4VB 2M4NA 1P9DU 3U8ZA 1HZ6A 1YN5A 3PRPB 3QAQA 1ZDVA 3BZDB 4WURA 3RCZA 4BAXA 3VH3B 2LGXA 1V1PA 1C4PA 2CU1A 3DBRB 1NEKB 2QC8A 3ZKJC 2JXXA 3WAPA 5GMVA 4YTMB 1EF1A 2GRIA 2KWDA 1FEHA 3ALBA 4GU2A 4WAFA 1L2NA 2L0TA 4P6VF 1SSNA 1TJEA 4TUUA 4JWUC 3P4RB 2L83A 4AWJA 4GMVA 2MJDA 4MJSB 1FPYA 4NPNA 2KYWA 1WXQA 3AU4A 2VH1A 3EFCA 4WJOA 3P42A 3B1LX 5FK9C 3AE6B 4MM3A 4GDLA 5HI1A 3DVNU 3IXSA 3SEBA 2KHWB 4W9CA 3I5JC 3RZWC 3HUIA 3I57A 2MW5A 3E56A 1K50A 4I6NB 2M56B 3GZNB 4LTUA 4KSKC 2AQ1B 5DCNA 2VRRB 1QOFA 3ZO5B 3V05A 3IBEA 1V97A 3EUB2 1SXTA 3PZ8A 5BYRA 4ANUA 3CSFA 2CU3A 2NCNA 2K8BA 1K53A 4HXDA 2MBQA 2OHFA 3ZNID 2JX5A 2IPKD 4YSXB 2I1JA 5L95C 3AMZA 2W9NA 1KM7A 2O2VB 3LYYA 5H8YE 4FA6A 1YMHE 1OTRB 3HM6X 2ASQA 2DYMA 2I1KA 1TKEA 1OQYA 1RYJA 2D07B 3V6EB 2GBRA 2KWUB 3KLSX 3VXWA 3GP7A 4HROA 4ZRIA 1GJZA 1WJNA 2K9XA 3OJ4B 4H2AA 1SE2A 2LVOA 3ZXRA 1JRPA 1ISNA 4HCPB 3CIRB 1FFUA 1P3QU 2KDIA 1R4MI 2VZKD 1MG4A 5J17A 4CQNA 3C0RB 2QIEB 2WNMA 3KUZA 3MC8A 1FIQA 3TUOA 2INNE 2WYQA 2LWPA 1VZ6A 2WXGA 2DYBA 3DBLB 3ZQ4A 1XLQA 1QF6A 4A20A 3OJ3A 1EM7A 2BQQA 3APCA 2KQ7A 1MJDA 1STEA 5JH5C 3VUWA 2J42A 1CZPA 3BK2A 5E6NA 2WLBA 1KLVA 1F77A 2V3NA 3C19A 1WH3A 2W3RA 4P7IA 2ZVOA 3R2IA 2MQJA 2BF8B 3ML9A 2RDGA 1F2RI 3T3OA 3DVGX 3PSEB 2N9LA 1LM8B 2NR2A 4NJCA 2I38A 2RDHA 4OVUA 1C9FA 4GDKA 1ZXHA 3QQ8B 1GG3A 2LXCA 2GBMA 1AWDA 3ZNGC 4YTNB 2KX0A 2VZKB 1EU4A 3VTVA 4PT5A 1ENFA 3H1UA 3VHTC 3A4RA 4WQOB 2O6VD 2RR9A 3A9JA 1WZ0A 1WWTA 2DLBA 2IY1B 3WANA 4O1NA 2BYVE 1V5OA 4B9KA 4EZKA 3N20C 4W9HA 3LDZE 4TQ0A 4G0NB 2MX2A 2IYDB 3W5UB 1WSPA 3VUXA 1XCTL 3RYTA 5CHFA 2D3GA 2GB1A 1MHHE 1FM0D 2KN5A 1ZKHA 4NQKE 2LVQA 3QIJA 3QWZB 3T9LA 2WDVB 3B08A 1WE7A 4XE0A 1V6EA 4XZ4A 3UIPB 4C00A 1FMAD 4K1RB 4ITKA 1N6ZA 2EMSA 4AP4C 2WDRB 2PE6B 2JZ3B 5EE9A 5KHOA 1F2RC 4HDOA 4IW0A 1MFWA 4AOFA 5EE3A 3P4QB 1M94A 3WALA 3H9DA 2DAFA 4EOYA 5IA7A 3P2BA 2HD5B 4ZRJA 4FULA 5JHBA 2WQYB 1KF6B 2ZW1A 4IM0A 3W9CB 2O6VB 2M17A 2WDQB 2TSSA 1FXTB 3DHGC 1DGJA 4J3OD 4HCNB 1R7SA 4K3BA 4ICUA 2NBVB 3AE5B 1SIJA 4OZBA 4XWWA 1N5XA 1GNUA 2IGGA 3M95A 2N4FA 1L5PA 3RN9C 4MH8A 3C8YA 3RNCC 4XWTA 2B3AA 1YQ3B 1KOTA 4C80A 3EA6A 4KX6B 1I4HA 4MGYE 4WJQA 1IBXA 4BFRA 3Q3OC 3KYCD 2CR5A 4C7ZA 1OQQA 4JE3B 3Q69A 3W1SA 1IPGA 3AE8B 2AX5A 5G5HA 3ZDMC 4YTPB 3VVWB 1OEYA 3QX1A 2V4IB 2X38A 2EKIA 3AN1A 3Q8AA 2OJWA 4A9AA 1FFVA 4C4VA 4LCDE 1T0SC 1I4QA 1Q1OA 2K25A 5EE1A 2CHXA 1WX8A 3NOBA 3AH7A 1ZW7A 3U7DA 4K81A 4L1BA 1FNVA 2G3QB 1WYGA 1E8XA 2LJIA 3AB5A 3OAWA 2KWCA 5HHDG 1EWCA 4RMAA 4BBNF 2MBHA 2B76B 4MSQB 4ZRKA 2KD0A 4M01A 2NBUA 1YD8U 2HJ1A 3U7ZA 1LGRA 2DX5B 2ZZPB 3MTNB 1UGJA 1IP9A 3Q14C 4IM2A 1WRDB
chains in the Genus database with same CATH topology
1YX6B 1V2YA 3PPAA 2D2QA 3T8MA 5C1ZA 2LJ5A 1MG8A 3IHPC 3W1SC 3ZTDA 2XBBC 3PRMB 1WI0A 4M8NA 2XEWA 3R7RA 2Z0EB 2ZPNA 4M0WB 4HLEA 1WE6A 3ZW3A 1YX5B 2ZVNA 3CSTA 3DOWA 1VD2A 3M62B 3NY5A 1WGHA 2J0MA 4EEWA 1H8CA 4BKGA 2D11A 3RT3B 3ZIMA 1OGWA 3KH0A 2C7MB 2A5UA 2N9XA 3DBSA 4IG7B 2J7QB 3B0AA 4DDID 4KZ0A 1WMHA 3QA8A 2HJ8A 3ZTCA 4URKA 4LJPB 3DBHI 2MBEA 1AARA 2GOWA 4KIKA 1WGDA 2EKEC 2R2QA 3JW0X 4PYUA 5DPRA 2FUHB 2ZPYA 4F1SA 2IZVB 3UGBB 5D7GA 4FHKA 5LXIB 2KDFB 1TBEA 2GBKA 2KFKB 4HPLB 1EF5A 3AULA 3DCGA 4GN1A 2J0JA 4IM3A 2FNJB 2XK5B 3RD2A 4K7SA 1WY8A 3TMPB 1UZXB 2DHZA 4W9EA 3TL5A 2DZIA 2NS5A 3UQAA 3CF6E 3PHWB 2R2OA 2LASA 2JRIB 2KWVB 2L8JA 3WIMA 3ML8A 3R7QA 2REXA 3QJZA 4JQWC 5LLIA 4KDLB 3RZFA 4DDGD 4G3XB 4EFOA 2M4NA 1P9DU 2OJRA 3U8ZA 4ASWC 2M1MA 2LD9A 2CKHB 3A9KA 2KMAA 3ONSA 3PVLA 3PRPB 1QZEA 3QAQA 4NAWA 3TCAA 3W1YA 3RCZA 3SDLC 2LGXA 3VH3B 4TV3A 2CU1A 4BOSC 1GUAB 2BKRB 2KO3A 2N1WA 2JXXA 4W9GA 3ZKJC 3WAPA 5GMVA 3PS6A 2PE9A 1EF1A 3KVFB 3HIZA 5E6PA 3MHSD 3QARA 2AYOB 2KC2A 3DVGY 3ALBA 3A1QA 5EDSA 3L13A 3WA0A 4GU2A 2K8CA 4AUQC 1L2NA 2N7DA 1BT0A 4PYZA 2L0TA 1G6JA 2UYZB 2JZZA 2LVPA 2GBNA 4TUUA 1GC7A 4AWJA 4GMVA 2JY6A 2LRWA 3Q3FA 4MJSB 4NPNA 2L05A 1SE9A 3AU4A 1YIWA 3PRZA 4F8CB 2KZRA 2L3ZA 1J0GA 3RULA 4WJNA 4WJOA 2V4LA 2C60A 3B1LX 2LI5A 3TIXA 2RSUA 4OVVA 1WYWB 3M63B 4MM3A 4GDLA 3JSVA 3KYDD 3S2AA 1NI2A 5AEKB 2Z0DB 3DVNU 1WMHB 4ANXA 2KHWB 4W9CA 3RZWC 1LFDA 4JLCA 4K7WA 2V1YA 4LJOB 4KIKB 1WXMA 1UD7A 2AWTA 2MW5A 2HTHA 3L0WB 3M3JA 4HJKA 1WGGA 4I6NB 2PJHA 4A3PA 4KSKC 2FCSA 4WWPA 5DCNA 2V3SA 1E7VA 2KFJA 2VRRB 1RRBA 1TGZB 2BYEA 2IBIB 3ZO5B 1RAXA 3IBEA 3IFWB 3N32A 1R4NI 4IC7B 2DZJA 2IO3B 4JIOU 4HWIB 3PLUA 4ANUA 2NPTA 3CSFA 4HVBA 4BBNC 3APDA 2EMTA 2NCNA 2K8BA 4HXDA 3TBLD 3TJPA 3Q3JA 2MBQA 3ZNID 2KDEB 3QK0A 1D3ZA 2I1JA 2C7NB 2NBWB 1WZ3A 5L95C 3K9OB 2HE7A 4FHJA 1WJ4A 2W9NA 1KM7A 3IG3A 4BVUC 2O2VB 4FA6A 4ZYNA 2FIFA 1OTRB 4WWNA 3HM6X 2ASQA 2DYMA 2I1KA 4DBGA 4WJPA 4E74A 1KJTA 1L7YA 1XT9B 1OQYA 2D07B 5FR6A 2M0XA 2DZKA 2K1FA 4NAWB 3V6EB 4WWOA 4CHKA 1WR1A 2GBRA 2KWUB 2G4SA 3H7SA 3OLMD 3VXWA 2LZ6A 4ZRIA 2OOBB 3R66C 1GJZA 1WJNA 2QHOA 3OJ4B 2KJRA 2KANA 2LVOA 4NQLB 3ZVVA 3D32A 3A1QB 1ISNA 4HCPB 1P3QU 1WJUA 1E8WA 2BGFA 2KDIA 5DPTA 1WGRA 3BINA 4K7UA 4TKNA 1R4MI 2KLCA 4PS3A 4BOZB 5J17A 4GGQA 3C0RB 1WJ6A 2MP2A 3KUZA 2JVCA 2LUEA 1LQBA 3KUCB 1WM2A 2WYQA 1T0YA 2LWPA 4IWPA 2YLMA 4JL9A 2DYBA 3U30A 1IYFA 2FIDA 1U4AA 4HPMB 1S3SG 4A20A 5AZGA 3OJ3A 4KSLC 3AU5A 2L76A 3APCA 1V49A 4CO7A 1C3TA 2KQ7A 1E8YA 1WX9A 4GDLB 1WR6E 2ZNVC 3JSVB 5JH5C 3VUWA 2MSED 1WXVA 1I35A 3EHVA 2L00B 4DHZE 1RLFA 2FCMA 3O65B 3QCAA 1UBQA 3MJWA 3V62A 4DHZB 3DVNV 4LDTD 4NY0A 4BKSA 3X0WA 5E6NA 4II2B 5CX3A 1KLVA 4NJ6A 4FN2A 1Q5WB 1UBIA 2LXAA 1H4RA 5AZFA 2KDBA 1WH3A 2ZEQA 4B6WA 4P7IA 4CYEA 1V5TA 2ZVOA 5CHWA 5J18A 2MQJA 2BF8B 3KUDB 3VUYA 3WAMA 3VH4B 4HDQA 2BPSA 3ML9A 3V61A 4W9KA 3A33B 2MLBA 4MDKE 4BKSD 3DVGX 2ZNVB 2IO2B 3PSEB 3EFUA 3HM3A 3UQBA 1LM8B 2KTRA 2NR2A 1NDDA 2O6VA 4OVUA 4GDKA 4PS8A 2N9EB 1NBFC 4AJWA 3QQ8B 4ZDVA 2K6DB 2FCQA 1GG3A 2IO1B 1SIFA 1P1AA 1V9JA 2LXCA 2WX1A 3IVFA 2GBMA 3N30A 2KKCA 2LGDA 3ZNGC 2CHWA 1JRUA 4DK5A 2JUOA 2MRPA 2DZMA 2DYOA 2KX0A 4MELA 3VTVA 4KV2A 2LRUA 3H1UA 3VHTC 3A4RA 3H7PA 2Z59B 4WQOB 2O6VD 2RR9A 1A5RA 1E5WA 3A9JA 1WZ0A 3WANA 2IY1B 2G45B 1PQSA 2G4DB 2BYVE 3R3MA 1V5OA 3SU8X 3VFKA 4XC2A 2CHZA 3NS8A 2BYFA 4IWOA 5C23A 4B9KA 1V80A 2RPQA 4W9HA 4EZKA 3LDZE 1RFAA 4TQ0A 3H6NA 4G0NB 2MX2A 2IYDB 2MBOA 5JHAA 3VUXA 2PEAA 3RYTA 5CHFA 1WXSA 3APFA 2D3GA 2L7RA 3WAOA 3L54A 3ZRFA 2IO0B 1EO6A 3EC8A 3NZUA 4I6LB 4LDTB 2KLGA 2KN5A 1ZKHA 4MSMB 4NQKE 4E71A 2L0FA 1ZGUB 2LVQA 3PV1A 5AZHA 3QIJA 1Z5SB 3QWZB 3T9LA 1Z2MA 1XQQA 3DQVA 3B08A 3BY4B 1WE7A 2BWES 3KW5B 3PREA 4NNJB 4W9LA 1V6EA 1TTNA 4XZ4A 1UELA 5CHVC 3UIPB 4B95A 1J19A 2JWZA 4K1RB 2ZCCA 4W9FA 3A9KB 2EMSA 4AP4C 2KC1A 2PE6B 4ICVA 1J8CA 2JZ3B 4GB9A 4W9IA 3L10B 5D2MB 5KHOA 3UIOB 2K8HA 4HDOA 2AL6A 1EUVB 3PZDA 4MJSA 4IW0A 4G50A 4KZCA 2M8SA 5D6JB 4AOFA 5G55A 4EUTA 1M94A 3WALA 5L83A 5LXHA 3PHXB 3H9DA 2MBBB 2DAFA 1E90A 2K39A 4EOYA 4FADA 2JT4B 2N1VA 3UF8A 5IA7A 3RUIB 1WXAA 3P2BA 3ZNZB 2HD5B 1Q0WB 2RGFA 4EZJA 4ZRJA 4DXAB 1I42A 4FULA 4RM9A 5JHBA 2NVUI 4FJVB 3PT2B 2AL3A 4GXBA 3GZNI 2ZCBA 4ANVA 3ZNHB 3CMMB 3QC8B 2KTRB 4IM0A 1HE8A 3L16A 3UINB 4MGKE 2O6VB 2M17A 4MEMA 4F7ZA 1WF9A 4GDKB 3DDCB 2JRHA 2N7EA 1GC6A 3L17A 4TQ1A 1VCBA 1CMXB 2YVCA 4FJZA 3ZLZA 3PTFC 4WAAA 3SD5A 1XD3B 2C5LC 2GBJA 3PGEA 1FXTB 2WDTB 4RM8A 4M8MA 3V60A 5HKHA 4MH0E 1P0RA 2DENB 4IUMB 4IWQA 4HCNB 2K6QA 2KOXA 2Y5BB 3HK0A 4J6IA 4ICUA 3X23A 2JPHA 1WIAA 3LJ3A 2NBVB 3H7PB 3N3KB 2JF5A 2FCNA 3A9JB 1LXDA 2IY0B 4GSWA 2PPHA 1GNUA 2MWSB 2MCNB 3M95A 1YQBA 2N4FA 5CTRC 2D10A 3JVZX 2O2VA 5KHQA 4W9JA 2B3AA 4II3B 3VAWA 3ZDTA 4MGZE 1KOTA 1SGHA 2ZJDA 2KNBA 1S1QB 2MA9B 4MGYE 1YJ1A 2FAZA 4WJQA 1WGYA 2NPTB 2UWQA 4X57B 4A3OA 3JYUA 4DHJD 2J0KA 4HK2A 3ECIA 4BFRA 3ZRCA 3KYCD 2CR5A 2KK8A 3VTWA 3EECA 1E7UA 3V6CB 3W1SA 1X1MA 1IPGA 2KVRA 2KFKA 4GOCA 4EZLA 3QHTA 4GIVA 2C7HA 3VTUA 3I3TB 3ZDMC 2AEHA 2XK5A 2RD0A 5DPSA 3VVWB 1OEYA 2C9WB 4BKTA 3DPDA 3QX1A 2A4ZA 2N9PC 1P98A 4AJYB 1OEYJ 3DBLI 4I6PA 5G2NA 3K9PB 5J2RA 4YL8A 4G11A 1UH6A 1Y8RC 1C1YB 2KJHB 2KXJA 4LCDE 1V86A 1Q1OA 4FBJB 4DWFA 2K25A 2KX3A 5DPWA 2CHXA 5IAAC 1WX8A 3AXCA 3NOBA 1ZW7A 4KVGB 3U7DA 1WFYA 4E3CA 4K81A 2LGYA 3ZUNA 3DBRI 3GOEA 3NHEB 2G3QB 1TZ1A 1E8XA 5D94A 2CS4A 1V81A 3OAWA 5TR5A 4MGIE 2MP2B 3ENEA 4FLHA 3SHQA 3PLVA 4XX5A 2KWCA 3A4SC 4JGHB 2GMIC 2KTFA 4NJ7A 1WX7A 4RMAA 1WM3A 4BBNF 2MBHA 2KQSA 4MSQB 3VQIA 3VDZA 1F9JA 4ZRKA 2BWFA 5E6OA 3AI5A 2WWZA 2KD0A 2WX0A 4FJYA 1UGMA 4PS7A 1K8RB 2DAJA 2NBUA 4ANWA 5JZEB 1YD8U 3NZSA 4N9F4 2DX5B 2ZZPB 3L08A 3MTNB 4W9DA 4EKUA 3HHMA 4KDIC 2KMCA 1IP9A 2KJ6A 2BKFA 4IM2A 4DHJB 1E8ZA 1WRDB 5BO4B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YX6 B;  1V2Y A;  3PPA A;  2D2Q A;  3T8M A;  5C1Z A;  2LJ5 A;  1MG8 A;  3IHP C;  3W1S C;  3ZTD A;  2XBB C;  3PRM B;  1WI0 A;  4M8N A;  2XEW A;  3R7R A;  2Z0E B;  2ZPN A;  4M0W B;  4HLE A;  1WE6 A;  3ZW3 A;  1YX5 B;  2ZVN A;  3CST A;  3DOW A;  1VD2 A;  3M62 B;  3NY5 A;  1WGH A;  2J0M A;  4EEW A;  1H8C A;  4BKG A;  2D11 A;  3RT3 B;  3ZIM A;  1OGW A;  3KH0 A;  2C7M B;  2A5U A;  2N9X A;  3DBS A;  4IG7 B;  2J7Q B;  3B0A A;  4DDI D;  4KZ0 A;  1WMH A;  3QA8 A;  2HJ8 A;  3ZTC A;  4URK A;  4LJP B;  3DBH I;  2MBE A;  1AAR A;  2GOW A;  4KIK A;  1WGD A;  2EKE C;  2R2Q A;  3JW0 X;  4PYU A;  5DPR A;  2FUH B;  2ZPY A;  4F1S A;  2IZV B;  3UGB B;  5D7G A;  4FHK A;  5LXI B;  2KDF B;  1TBE A;  2GBK A;  2KFK B;  4HPL B;  1EF5 A;  3AUL A;  3DCG A;  4GN1 A;  2J0J A;  4IM3 A;  2FNJ B;  2XK5 B;  3RD2 A;  4K7S A;  1WY8 A;  3TMP B;  1UZX B;  2DHZ A;  4W9E A;  3TL5 A;  2DZI A;  2NS5 A;  3UQA A;  3CF6 E;  3PHW B;  2R2O A;  2LAS A;  2JRI B;  2KWV B;  2L8J A;  3WIM A;  3ML8 A;  3R7Q A;  2REX A;  3QJZ A;  4JQW C;  5LLI A;  4KDL B;  3RZF A;  4DDG D;  4G3X B;  4EFO A;  2M4N A;  1P9D U;  2OJR A;  3U8Z A;  4ASW C;  2M1M A;  2LD9 A;  2CKH B;  3A9K A;  2KMA A;  3ONS A;  3PVL A;  3PRP B;  1QZE A;  3QAQ A;  4NAW A;  3TCA A;  3W1Y A;  3RCZ A;  3SDL C;  2LGX A;  3VH3 B;  4TV3 A;  2CU1 A;  4BOS C;  1GUA B;  2BKR B;  2KO3 A;  2N1W A;  2JXX A;  4W9G A;  3ZKJ C;  3WAP A;  5GMV A;  3PS6 A;  2PE9 A;  1EF1 A;  3KVF B;  3HIZ A;  5E6P A;  3MHS D;  3QAR A;  2AYO B;  2KC2 A;  3DVG Y;  3ALB A;  3A1Q A;  5EDS A;  3L13 A;  3WA0 A;  4GU2 A;  2K8C A;  4AUQ C;  1L2N A;  2N7D A;  1BT0 A;  4PYZ A;  2L0T A;  1G6J A;  2UYZ B;  2JZZ A;  2LVP A;  2GBN A;  4TUU A;  1GC7 A;  4AWJ A;  4GMV A;  2JY6 A;  2LRW A;  3Q3F A;  4MJS B;  4NPN A;  2L05 A;  1SE9 A;  3AU4 A;  1YIW A;  3PRZ A;  4F8C B;  2KZR A;  2L3Z A;  1J0G A;  3RUL A;  4WJN A;  4WJO A;  2V4L A;  2C60 A;  3B1L X;  2LI5 A;  3TIX A;  2RSU A;  4OVV A;  1WYW B;  3M63 B;  4MM3 A;  4GDL A;  3JSV A;  3KYD D;  3S2A A;  1NI2 A;  5AEK B;  2Z0D B;  3DVN U;  1WMH B;  4ANX A;  2KHW B;  4W9C A;  3RZW C;  1LFD A;  4JLC A;  4K7W A;  2V1Y A;  4LJO B;  4KIK B;  1WXM A;  1UD7 A;  2AWT A;  2MW5 A;  2HTH A;  3L0W B;  3M3J A;  4HJK A;  1WGG A;  4I6N B;  2PJH A;  4A3P A;  4KSK C;  2FCS A;  4WWP A;  5DCN A;  2V3S A;  1E7V A;  2KFJ A;  2VRR B;  1RRB A;  1TGZ B;  2BYE A;  2IBI B;  3ZO5 B;  1RAX A;  3IBE A;  3IFW B;  3N32 A;  1R4N I;  4IC7 B;  2DZJ A;  2IO3 B;  4JIO U;  4HWI B;  3PLU A;  4ANU A;  2NPT A;  3CSF A;  4HVB A;  4BBN C;  3APD A;  2EMT A;  2NCN A;  2K8B A;  4HXD A;  3TBL D;  3TJP A;  3Q3J A;  2MBQ A;  3ZNI D;  2KDE B;  3QK0 A;  1D3Z A;  2I1J A;  2C7N B;  2NBW B;  1WZ3 A;  5L95 C;  3K9O B;  2HE7 A;  4FHJ A;  1WJ4 A;  2W9N A;  1KM7 A;  3IG3 A;  4BVU C;  2O2V B;  4FA6 A;  4ZYN A;  2FIF A;  1OTR B;  4WWN A;  3HM6 X;  2ASQ A;  2DYM A;  2I1K A;  4DBG A;  4WJP A;  4E74 A;  1KJT A;  1L7Y A;  1XT9 B;  1OQY A;  2D07 B;  5FR6 A;  2M0X A;  2DZK A;  2K1F A;  4NAW B;  3V6E B;  4WWO A;  4CHK A;  1WR1 A;  2GBR A;  2KWU B;  2G4S A;  3H7S A;  3OLM D;  3VXW A;  2LZ6 A;  4ZRI A;  2OOB B;  3R66 C;  1GJZ A;  1WJN A;  2QHO A;  3OJ4 B;  2KJR A;  2KAN A;  2LVO A;  4NQL B;  3ZVV A;  3D32 A;  3A1Q B;  1ISN A;  4HCP B;  1P3Q U;  1WJU A;  1E8W A;  2BGF A;  2KDI A;  5DPT A;  1WGR A;  3BIN A;  4K7U A;  4TKN A;  1R4M I;  2KLC A;  4PS3 A;  4BOZ B;  5J17 A;  4GGQ A;  3C0R B;  1WJ6 A;  2MP2 A;  3KUZ A;  2JVC A;  2LUE A;  1LQB A;  3KUC B;  1WM2 A;  2WYQ A;  1T0Y A;  2LWP A;  4IWP A;  2YLM A;  4JL9 A;  2DYB A;  3U30 A;  1IYF A;  2FID A;  1U4A A;  4HPM B;  1S3S G;  4A20 A;  5AZG A;  3OJ3 A;  4KSL C;  3AU5 A;  2L76 A;  3APC A;  1V49 A;  4CO7 A;  1C3T A;  2KQ7 A;  1E8Y A;  1WX9 A;  4GDL B;  1WR6 E;  2ZNV C;  3JSV B;  5JH5 C;  3VUW A;  2MSE D;  1WXV A;  1I35 A;  3EHV A;  2L00 B;  4DHZ E;  1RLF A;  2FCM A;  3O65 B;  3QCA A;  1UBQ A;  3MJW A;  3V62 A;  4DHZ B;  3DVN V;  4LDT D;  4NY0 A;  4BKS A;  3X0W A;  5E6N A;  4II2 B;  5CX3 A;  1KLV A;  4NJ6 A;  4FN2 A;  1Q5W B;  1UBI A;  2LXA A;  1H4R A;  5AZF A;  2KDB A;  1WH3 A;  2ZEQ A;  4B6W A;  4P7I A;  4CYE A;  1V5T A;  2ZVO A;  5CHW A;  5J18 A;  2MQJ A;  2BF8 B;  3KUD B;  3VUY A;  3WAM A;  3VH4 B;  4HDQ A;  2BPS A;  3ML9 A;  3V61 A;  4W9K A;  3A33 B;  2MLB A;  4MDK E;  4BKS D;  3DVG X;  2ZNV B;  2IO2 B;  3PSE B;  3EFU A;  3HM3 A;  3UQB A;  1LM8 B;  2KTR A;  2NR2 A;  1NDD A;  2O6V A;  4OVU A;  4GDK A;  4PS8 A;  2N9E B;  1NBF C;  4AJW A;  3QQ8 B;  4ZDV A;  2K6D B;  2FCQ A;  1GG3 A;  2IO1 B;  1SIF A;  1P1A A;  1V9J A;  2LXC A;  2WX1 A;  3IVF A;  2GBM A;  3N30 A;  2KKC A;  2LGD A;  3ZNG C;  2CHW A;  1JRU A;  4DK5 A;  2JUO A;  2MRP A;  2DZM A;  2DYO A;  2KX0 A;  4MEL A;  3VTV A;  4KV2 A;  2LRU A;  3H1U A;  3VHT C;  3A4R A;  3H7P A;  2Z59 B;  4WQO B;  2O6V D;  2RR9 A;  1A5R A;  1E5W A;  3A9J A;  1WZ0 A;  3WAN A;  2IY1 B;  2G45 B;  1PQS A;  2G4D B;  2BYV E;  3R3M A;  1V5O A;  3SU8 X;  3VFK A;  4XC2 A;  2CHZ A;  3NS8 A;  2BYF A;  4IWO A;  5C23 A;  4B9K A;  1V80 A;  2RPQ A;  4W9H A;  4EZK A;  3LDZ E;  1RFA A;  4TQ0 A;  3H6N A;  4G0N B;  2MX2 A;  2IYD B;  2MBO A;  5JHA A;  3VUX A;  2PEA A;  3RYT A;  5CHF A;  1WXS A;  3APF A;  2D3G A;  2L7R A;  3WAO A;  3L54 A;  3ZRF A;  2IO0 B;  1EO6 A;  3EC8 A;  3NZU A;  4I6L B;  4LDT B;  2KLG A;  2KN5 A;  1ZKH A;  4MSM B;  4NQK E;  4E71 A;  2L0F A;  1ZGU B;  2LVQ A;  3PV1 A;  5AZH A;  3QIJ A;  1Z5S B;  3QWZ B;  3T9L A;  1Z2M A;  1XQQ A;  3DQV A;  3B08 A;  3BY4 B;  1WE7 A;  2BWE S;  3KW5 B;  3PRE A;  4NNJ B;  4W9L A;  1V6E A;  1TTN A;  4XZ4 A;  1UEL A;  5CHV C;  3UIP B;  4B95 A;  1J19 A;  2JWZ A;  4K1R B;  2ZCC A;  4W9F A;  3A9K B;  2EMS A;  4AP4 C;  2KC1 A;  2PE6 B;  4ICV A;  1J8C A;  2JZ3 B;  4GB9 A;  4W9I A;  3L10 B;  5D2M B;  5KHO A;  3UIO B;  2K8H A;  4HDO A;  2AL6 A;  1EUV B;  3PZD A;  4MJS A;  4IW0 A;  4G50 A;  4KZC A;  2M8S A;  5D6J B;  4AOF A;  5G55 A;  4EUT A;  1M94 A;  3WAL A;  5L83 A;  5LXH A;  3PHX B;  3H9D A;  2MBB B;  2DAF A;  1E90 A;  2K39 A;  4EOY A;  4FAD A;  2JT4 B;  2N1V A;  3UF8 A;  5IA7 A;  3RUI B;  1WXA A;  3P2B A;  3ZNZ B;  2HD5 B;  1Q0W B;  2RGF A;  4EZJ A;  4ZRJ A;  4DXA B;  1I42 A;  4FUL A;  4RM9 A;  5JHB A;  2NVU I;  4FJV B;  3PT2 B;  2AL3 A;  4GXB A;  3GZN I;  2ZCB A;  4ANV A;  3ZNH B;  3CMM B;  3QC8 B;  2KTR B;  4IM0 A;  1HE8 A;  3L16 A;  3UIN B;  4MGK E;  2O6V B;  2M17 A;  4MEM A;  4F7Z A;  1WF9 A;  4GDK B;  3DDC B;  2JRH A;  2N7E A;  1GC6 A;  3L17 A;  4TQ1 A;  1VCB A;  1CMX B;  2YVC A;  4FJZ A;  3ZLZ A;  3PTF C;  4WAA A;  3SD5 A;  1XD3 B;  2C5L C;  2GBJ A;  3PGE A;  1FXT B;  2WDT B;  4RM8 A;  4M8M A;  3V60 A;  5HKH A;  4MH0 E;  1P0R A;  2DEN B;  4IUM B;  4IWQ A;  4HCN B;  2K6Q A;  2KOX A;  2Y5B B;  3HK0 A;  4J6I A;  4ICU A;  3X23 A;  2JPH A;  1WIA A;  3LJ3 A;  2NBV B;  3H7P B;  3N3K B;  2JF5 A;  2FCN A;  3A9J B;  1LXD A;  2IY0 B;  4GSW A;  2PPH A;  1GNU A;  2MWS B;  2MCN B;  3M95 A;  1YQB A;  2N4F A;  5CTR C;  2D10 A;  3JVZ X;  2O2V A;  5KHQ A;  4W9J A;  2B3A A;  4II3 B;  3VAW A;  3ZDT A;  4MGZ E;  1KOT A;  1SGH A;  2ZJD A;  2KNB A;  1S1Q B;  2MA9 B;  4MGY E;  1YJ1 A;  2FAZ A;  4WJQ A;  1WGY A;  2NPT B;  2UWQ A;  4X57 B;  4A3O A;  3JYU A;  4DHJ D;  2J0K A;  4HK2 A;  3ECI A;  4BFR A;  3ZRC A;  3KYC D;  2CR5 A;  2KK8 A;  3VTW A;  3EEC A;  1E7U A;  3V6C B;  3W1S A;  1X1M A;  1IPG A;  2KVR A;  2KFK A;  4GOC A;  4EZL A;  3QHT A;  4GIV A;  2C7H A;  3VTU A;  3I3T B;  3ZDM C;  2AEH A;  2XK5 A;  2RD0 A;  5DPS A;  3VVW B;  1OEY A;  2C9W B;  4BKT A;  3DPD A;  3QX1 A;  2A4Z A;  2N9P C;  1P98 A;  4AJY B;  1OEY J;  3DBL I;  4I6P A;  5G2N A;  3K9P B;  5J2R A;  4YL8 A;  4G11 A;  1UH6 A;  1Y8R C;  1C1Y B;  2KJH B;  2KXJ A;  4LCD E;  1V86 A;  1Q1O A;  4FBJ B;  4DWF A;  2K25 A;  2KX3 A;  5DPW A;  2CHX A;  5IAA C;  1WX8 A;  3AXC A;  3NOB A;  1ZW7 A;  4KVG B;  3U7D A;  1WFY A;  4E3C A;  4K81 A;  2LGY A;  3ZUN A;  3DBR I;  3GOE A;  3NHE B;  2G3Q B;  1TZ1 A;  1E8X A;  5D94 A;  2CS4 A;  1V81 A;  3OAW A;  5TR5 A;  4MGI E;  2MP2 B;  3ENE A;  4FLH A;  3SHQ A;  3PLV A;  4XX5 A;  2KWC A;  3A4S C;  4JGH B;  2GMI C;  2KTF A;  4NJ7 A;  1WX7 A;  4RMA A;  1WM3 A;  4BBN F;  2MBH A;  2KQS A;  4MSQ B;  3VQI A;  3VDZ A;  1F9J A;  4ZRK A;  2BWF A;  5E6O A;  3AI5 A;  2WWZ A;  2KD0 A;  2WX0 A;  4FJY A;  1UGM A;  4PS7 A;  1K8R B;  2DAJ A;  2NBU A;  4ANW A;  5JZE B;  1YD8 U;  3NZS A;  4N9F 4;  2DX5 B;  2ZZP B;  3L08 A;  3MTN B;  4W9D A;  4EKU A;  3HHM A;  4KDI C;  2KMC A;  1IP9 A;  2KJ6 A;  2BKF A;  4IM2 A;  4DHJ B;  1E8Z A;  1WRD B;  5BO4 B; 
#chains in the Genus database with same CATH topology
 3HRD D;  5C1Z A;  2NTS A;  3PRM B;  2INC C;  3R7R A;  1JWB D;  3ZW3 A;  1YX5 B;  3NY5 A;  4EEW A;  2C7M B;  1SF0 A;  4RCO A;  2Y3A A;  4D2K A;  1VRA B;  1L6U A;  1DYQ A;  1FD6 A;  2FUH B;  2IZV B;  3UGB B;  5IKC M;  5D7G A;  3VR9 B;  2KDF B;  3RFZ B;  1EF5 A;  3DCG A;  4GN1 A;  4IM3 A;  3RD2 A;  5I4D A;  1C78 A;  2CJN A;  3TMP B;  2W55 A;  2DHZ A;  4W9E A;  2UU7 A;  2JRI B;  3R7Q A;  2REX A;  1MPE A;  3RZF A;  2KN4 A;  2LGS A;  2FE8 A;  3ZXV A;  3A9K A;  1QZE A;  3R2T A;  4TV3 A;  2WS3 B;  4BOS C;  4RF1 A;  4W9G A;  5C3J B;  2G9H D;  3KVF B;  5MPO A;  3MHS D;  3QAR A;  2IGD A;  1PGB A;  3WA0 A;  2N7D A;  4PYZ A;  1SJH D;  2BS2 B;  2J53 A;  5C2T B;  2WXL A;  2GBN A;  3FKY A;  2WXR A;  3Q3F A;  2LRW A;  4M02 A;  4BZA A;  1SE9 A;  2KZR A;  1J0G A;  3BK1 A;  4XDD A;  2LI5 A;  3M63 B;  2PW9 A;  3S2A A;  5AEK B;  1RWS A;  1J7C A;  1HQR D;  3H8H A;  2V1Y A;  2JYE A;  4KIK B;  1WXM A;  3L0W B;  1KTK A;  4A3P A;  3AE4 B;  4WWP A;  2KFJ A;  1RRB A;  2MJE A;  2IBI B;  2WXH A;  3IFW B;  3N32 A;  1MI0 A;  1R4N I;  4IC7 B;  4HWI B;  2LFI A;  2GLS A;  3APD A;  2WXP A;  3TBL D;  4EE2 A;  2ZW0 A;  1D3Z A;  2C7N B;  1ZP0 B;  1WJ4 A;  3IG3 A;  1FNW A;  2N9K A;  1E7P B;  2VH2 A;  1FRR A;  1XT9 B;  2M0A A;  2M0X A;  2OED A;  1IBX B;  4ARI A;  3NVV A;  1XCQ L;  4RFB A;  4RGO S;  3R66 C;  2QHO A;  2KAN A;  4M00 A;  2PTL A;  4NQL B;  3ZVV A;  5DPT A;  4L23 A;  3BIN A;  1PUT A;  4US8 A;  4ACF A;  4GLS C;  3AEA B;  1E6E B;  1FXI A;  3KUC B;  1GPX A;  1T0Y A;  3GE3 C;  4IWP A;  3U30 A;  2J52 A;  4HPM B;  1K51 A;  1S3S G;  5AZG A;  3P63 A;  4ZOH C;  2L76 A;  1C3T A;  1KLG D;  1E8Y A;  1WX9 A;  3JSV B;  1CK1 A;  1WR6 E;  1D5M C;  2ZNV C;  3DHI C;  3SFE B;  2KQ4 X;  4DHZ E;  1RLF A;  1UBQ A;  1ZOY B;  3MJW A;  3V62 A;  3DVN V;  3X0W A;  1ZPS A;  3NS1 A;  4II2 B;  1WGK A;  4NJ6 A;  3LXF A;  1H4R A;  5AZF A;  2KDB A;  4CYE A;  1N60 A;  1ZXI A;  5CHW A;  1OQR A;  2ONQ A;  5J18 A;  3KUD B;  3VUY A;  3RNE C;  2L1A A;  4HDQ A;  1T0R C;  1M4V A;  4ZYS A;  1HZ5 A;  3E9S A;  2M19 A;  2D3A A;  3AEB B;  3A33 B;  3EFU A;  2KMM A;  2O6V A;  1JQ4 A;  1N5W A;  3NG0 A;  2N9E B;  4ZDV A;  2IO1 B;  1V9J A;  3N30 A;  2LGD A;  1JRU A;  3AED B;  4ZRP A;  2DZM A;  3TEZ A;  4MEL A;  4KV2 A;  2LRU A;  2Z59 B;  1E5W A;  4RGT A;  1GB4 A;  2G45 B;  1PQS A;  1CQV A;  2G4D B;  3DBH B;  3U4E G;  4XC2 A;  1PFD A;  2QSD A;  3NS8 A;  5C23 A;  3MC9 A;  2NMQ A;  3MHZ A;  1RFA A;  3VRB B;  1AW7 A;  3H6N A;  1FNU A;  3OG5 A;  2PEA A;  2MJ3 A;  3AM9 A;  3Q8C A;  4A55 A;  2AQ3 B;  3APF A;  4OW0 A;  3RNB C;  2JYT A;  3WAO A;  1DOY A;  3ZRF A;  2IO0 B;  4I6L B;  3EC8 A;  4MSM B;  4E71 A;  5GXG B;  5IN7 A;  3R8B A;  1BUI C;  1PGX A;  3DQV A;  3KW5 B;  2YEP F;  1TS5 A;  1TTN A;  1UEL A;  1L0X B;  3A9K B;  1TIF A;  3L10 B;  3TSS A;  3J9C A;  3Q8B A;  2K8H A;  2BW2 A;  4KZC A;  1KFY B;  5IO9 A;  5G55 A;  1TS4 A;  3MC0 B;  2MBB B;  5D3D A;  2EEL A;  2JT4 B;  3UF8 A;  3I9V 1;  3AEC B;  1WXA A;  2Y5C A;  4EZJ A;  3B2G A;  1I42 A;  4TMA B;  2NVU I;  4P1B C;  2AL3 A;  3IAS 1;  3GZN I;  2PMV A;  4ANV A;  3UIN B;  4MGK E;  4MEM A;  1T6B X;  3DDC B;  2JRH A;  2N7E A;  3L17 A;  4IKG A;  3BYT B;  1T0Q C;  3SD5 A;  3PGE A;  4M8M A;  2QEJ C;  4IUM B;  3DHH C;  3HK0 A;  1J7B A;  2Z8L A;  1UWX A;  2LMC A;  1Y56 A;  3N3K B;  3PO0 A;  1JAL A;  2FBW B;  2PPH A;  2MWS B;  4KGS A;  5CTR C;  2D10 A;  4II3 B;  3VAW A;  2CJO A;  2ZJD A;  2KNB A;  2MA9 B;  4X57 B;  3JYU A;  3NJT A;  3ZRC A;  3N1Y C;  3W5V B;  5JXV A;  2KK8 A;  2XN9 C;  1DOI A;  5D3I B;  2QIL A;  3QHT A;  2C7H A;  2H89 B;  3VTU A;  1UWM A;  2AEH A;  1P7F A;  2QCZ A;  2QMT A;  2RD0 A;  5DPS A;  1T3Q A;  2N9P C;  4ZRQ A;  1OEY J;  3DBL I;  1Q10 A;  5G2N A;  5J2R A;  4AQ7 A;  1XEE A;  3U2S C;  1C1Y B;  2KXJ A;  3NRZ A;  5DPW A;  1C77 A;  1L6V A;  5IP4 D;  1N62 A;  1N63 A;  3NHE B;  4A8X C;  4MGI E;  3ENE A;  3PLV A;  1EU3 A;  3AE7 B;  2KTF A;  5AUK A;  2W3S A;  2D5G A;  1FO4 A;  3VQI A;  1F9J A;  2BWF A;  5E6O A;  5G5G A;  4EKU A;  2PVG C;  3FIL B;  3Q2A C;  4WWM A;  1JWA D;  1E8Z A;  5BO4 B;  2WU5 B;  3PPA A;  2K5P A;  1D5Z C;  2ZPN A;  4M0W B;  4HLE A;  1WE6 A;  1N61 A;  4B0E A;  3DOW A;  1VD2 A;  3M62 B;  2INP E;  3Q8E A;  3KH0 A;  3RNF C;  2SEB D;  4IG7 B;  2BS3 B;  4RGN A;  2J7Q B;  1HTO A;  4KZ0 A;  3PZ7 A;  3ZJU A;  4KIK A;  1WGD A;  2EKE C;  1SBB B;  2PLP A;  4F1S A;  5H92 C;  1D4B A;  1E9M A;  2KFK B;  2GI9 A;  2LUM A;  3AUL A;  2WHI A;  2FNJ B;  1WY8 A;  1UZX B;  2X8X X;  1E10 A;  2DZI A;  3DWG C;  2LAS A;  4ZHO A;  5TSS A;  4K3C A;  4EFO A;  1VZ7 A;  2QJL A;  2OJR A;  4ASW C;  2JXT A;  3OWE B;  2LD9 A;  2CKH B;  3FAH A;  2V9H A;  2KMA A;  3AE2 B;  4HPP A;  3TCA A;  3SDL C;  4HKZ E;  2JQR B;  2KO3 A;  2N1W A;  3PS6 A;  1SB3 C;  2PE9 A;  2W82 A;  2AYO B;  2KC2 A;  3DVG Y;  2WP9 B;  3L13 A;  2K8C A;  1L4D B;  2UYZ B;  1QLB B;  1C4A A;  4AS1 A;  1YOV B;  2J4X A;  1EWY C;  4F8C B;  2L3Z A;  2H88 B;  2V4L A;  2C60 A;  3TIX A;  4QAY A;  2RSU A;  4OVV A;  1UF0 A;  3JSV A;  1AYF A;  2Z0D B;  4NZL B;  1FXA A;  4JLC A;  1DOX A;  4LJO B;  1UNS A;  1UD7 A;  3M3J A;  2HTH A;  4HJK A;  2MHJ A;  2BYE A;  4HJG E;  1RAX A;  2IJ0 A;  2IO3 B;  4JIO U;  3PLU A;  1FRD A;  4BBN C;  1QOB A;  2BT6 A;  3Q3J A;  2KDE B;  1I4P A;  4YXD B;  1RFK A;  1XLO A;  3I63 C;  2I2Y A;  4FHJ A;  1VLB A;  2HE7 A;  2WXK A;  4XDC A;  4XYC A;  4ZYN A;  2FIF A;  4WWN A;  3BVM A;  4DBG A;  4WJP A;  4E74 A;  1L7Y A;  1AN8 A;  2K1F A;  4NAW B;  4IDI A;  3RMK C;  4CHK A;  3OLM D;  4PK1 A;  2LZ6 A;  2OOB B;  4JX1 C;  1ET6 A;  3D32 A;  3A1Q B;  4KKI A;  4S17 A;  4YT0 B;  1KLU D;  2BGF A;  1IGC A;  1WGR A;  4K7U A;  4TKN A;  2K22 A;  2Q5W D;  3IAM 1;  4GGQ A;  2MP2 A;  2JVC A;  2LUE A;  4OZC A;  3ABV B;  2LEK A;  4JL9 A;  1D6E C;  2FID A;  1RM6 C;  5HFY A;  4KKJ A;  1V49 A;  2V3P A;  1B1Z A;  2FUG 1;  2MSE D;  1I35 A;  3EHV A;  2L00 B;  3O65 B;  3QCA A;  2L52 A;  4NY0 A;  5CX3 A;  1UBI A;  2LXA A;  4WIP A;  4LNI A;  3WAM A;  3VH4 B;  1HA5 A;  2BPS A;  4C56 C;  2K3U A;  4MDK E;  1R4N B;  4BKS D;  2JWU A;  2ZNV B;  3HM3 A;  3UQB A;  5BMI A;  4LLG M;  2LHD A;  1CJE A;  1QIL A;  4PS8 A;  1PDX A;  1GOZ A;  1SIF A;  1P1A A;  1QT9 A;  3MFG A;  3ZJT A;  2JUO A;  2JZP A;  3FC4 A;  1A5R A;  3NVZ A;  4N59 A;  3R3M A;  1GAQ B;  2WXF A;  3MJ5 A;  1MHX A;  1JRO A;  4OVZ A;  2NTT A;  1V80 A;  3IT6 B;  1LO5 D;  3O13 A;  1KRH A;  1WXS A;  3AEF B;  3L54 A;  1XF5 L;  1VR9 A;  2PIA A;  4OHJ A;  5IOI A;  1ZGU B;  3PV1 A;  5AZH A;  1Z2M A;  1SEB D;  4W9L A;  4B95 A;  1HXY D;  1J19 A;  2JWZ A;  2DWQ A;  4W9F A;  2KC1 A;  1J8C A;  4GB9 A;  4W9I A;  5D2M B;  2DBY A;  1EUV B;  3PZD A;  1XLN A;  5D6J B;  4EUT A;  5BMH A;  5L83 A;  1E90 A;  1JWM D;  1OFF A;  3ZNZ B;  1Q0W B;  1C79 A;  4DXA B;  1UUP A;  4RM9 A;  4FJV B;  3PT2 B;  2ZCB A;  3ZNH B;  2KTR B;  1HE8 A;  1MVK A;  3L16 A;  4C7Y A;  1SE3 A;  1FCL A;  2BB5 A;  1GC6 A;  1VCB A;  3Q3M C;  4FJZ A;  3ZLZ A;  3PTF C;  1XD3 B;  2C5L C;  4RM8 A;  2WDT B;  3RPF C;  5HKH A;  4MH0 E;  1P0R A;  1YJI A;  4IWQ A;  3FIL A;  2K6Q A;  2KOX A;  2Y5B B;  3X23 A;  1WIA A;  4HEA 1;  3H7P B;  2BYT A;  2MCN B;  4M0W A;  1YQB A;  3JVZ X;  3ZJV A;  5KHQ A;  2SAK A;  4MGZ E;  2WU2 B;  5EE0 A;  1YJ1 A;  2UWQ A;  4DHJ D;  4HRS A;  1A70 A;  3VTW A;  2V0G A;  1QKZ A;  1E7U A;  1X1M A;  3ETR A;  2PKO A;  1YQ4 B;  3URY A;  2KFK A;  4US9 A;  4EZL A;  3I3T B;  1XO3 A;  1F0Z A;  2WXJ A;  2C9W B;  4BKT A;  3DPD A;  1P98 A;  2N7J A;  4AJY B;  5BYS A;  2AQ2 B;  4G11 A;  1Y8R C;  2W54 A;  1V86 A;  4FBJ B;  2KX3 A;  5IAA C;  3AXC A;  4KVG B;  1WFY A;  2WXI A;  2LGY A;  3DBR I;  3GOE A;  1TZ1 A;  5D94 A;  5TR5 A;  2MP2 B;  3SHQ A;  1R4M B;  2GMI C;  2RPV A;  3P1M A;  4NJ7 A;  2KQS A;  3AI5 A;  2R61 A;  4LNO A;  2WWZ A;  2WX0 A;  4PS7 A;  1UGM A;  1K8R B;  5JZE B;  3L08 A;  4KDI C;  4LNF A;  2BKF A;  2LGI A;  3NZ3 A;  3TEY A;  4DHJ B;  3ZUN A;  3T8M A;  2D2Q A;  2LJ5 A;  3W1S C;  3IHP C;  1HEZ E;  1V8C A;  4USA A;  4M8N A;  2XEW A;  2Z0E B;  4TSS A;  3CST A;  1YJJ A;  1WGH A;  1H8C A;  2D11 A;  3RT3 B;  3ZIM A;  1OGW A;  4Q2J A;  2A5U A;  2DNF A;  5BMG A;  2BVC A;  2HJ8 A;  1WRI A;  4L2Y A;  3DBH I;  4PYU A;  5DPR A;  1TKG A;  4N6E B;  1J7A A;  4FHK A;  5LXI B;  1TBE A;  4HPL B;  2WGS A;  4DQO C;  2J0J A;  2XK5 B;  4LNN A;  4K7S A;  3CF6 E;  3PHW B;  2E6X A;  2BS4 B;  2KWV B;  2L8J A;  5T8I A;  4JPS A;  1K52 A;  5LLI A;  3NVW A;  4KDL B;  4FXC A;  4P1C C;  4N58 A;  2M1M A;  3RNA C;  1VJK A;  1L0V B;  4IOI E;  4YSZ B;  3AE3 B;  3ONS A;  3PVL A;  4NAW A;  3W1Y A;  4LK0 M;  4KGR A;  1TY0 A;  3BYY B;  1F52 A;  1GUA B;  1NYR A;  2BKR B;  1VZ8 A;  3P4P B;  3KWV A;  1HTQ A;  3HIZ A;  5E6P A;  3A1Q A;  5EDS A;  4AUQ C;  1TKY A;  2L32 A;  3Q6B A;  1BT0 A;  1G6J A;  2JZZ A;  4YWG G;  3AEG B;  2LVP A;  2G1E A;  3SFD B;  1GC7 A;  2JY6 A;  2L05 A;  3MP9 A;  3KWL A;  1YIW A;  3PRZ A;  1YN3 A;  3RUL A;  4WJN A;  1WYW B;  3KYD D;  1NI2 A;  3NVY A;  1TS2 A;  1WMH B;  4ANX A;  1TYG B;  1LFD A;  4K7W A;  1JCK B;  2AWT A;  1WGG A;  2PJH A;  2FCS A;  2V3S A;  1E7V A;  1TGZ B;  5BYQ A;  2DZJ A;  3AE1 B;  4HVB A;  2NPT A;  4OZA A;  1F1H A;  2EMT A;  3TJP A;  2N0S B;  3UI3 A;  1BML C;  3QK0 A;  2NBW B;  1WZ3 A;  1PYW D;  5FR3 A;  3K9O B;  4BVU C;  1NEN B;  3SR6 A;  4NAM A;  3RNG C;  2IDY A;  3ZGZ A;  1KJT A;  5FR6 A;  3AEE B;  3ZYY X;  2DZK A;  3N1Z C;  4WWO A;  1V1P B;  1WR1 A;  2BBC A;  2G4S A;  3H7S A;  1TT5 B;  1KH0 A;  2KJR A;  4DXG A;  3CWI A;  4WQM A;  2E3T A;  1WJU A;  1E8W A;  2JSV X;  1E0Z A;  3B9J A;  2KLC A;  1I4G A;  4PS3 A;  4BOZ B;  1WJ6 A;  2KAJ A;  1LQB A;  1WM2 A;  4UDU C;  2YLM A;  3L4P A;  5AUI A;  1IYF A;  1QOA A;  1U4A A;  4KSL C;  3AU5 A;  3U52 E;  3KQ4 A;  4CO7 A;  1I4R A;  4MM3 B;  4GDL B;  1SE4 A;  1WXV A;  3GS2 A;  2FCM A;  4DHZ B;  4LDT D;  4BKS A;  4A6Q A;  2D3B A;  2WXO A;  4FN2 A;  1Q5W B;  2ZEQ A;  4B6W A;  1V5T A;  4REZ A;  3HVZ A;  3V61 A;  4W9K A;  3IT4 B;  2MLB A;  2WXM A;  2IO2 B;  2KTR A;  3TEW A;  1NDD A;  1YNT E;  1TZO A;  1NBF C;  1T5X D;  4AJW A;  2K6D B;  2FCQ A;  3HVD A;  2WX1 A;  3IVF A;  1GB1 A;  2KKC A;  2CHW A;  4DK5 A;  4RGM A;  2MRP A;  2DYO A;  4P16 A;  3GE8 C;  3V3X A;  4HKQ A;  3H7P A;  3GB1 A;  3SU8 X;  3VFK A;  1NI3 A;  2CHZ A;  2BTE A;  2BYF A;  4IWO A;  2RDB C;  2RPQ A;  4RH6 A;  2KDM A;  2MBO A;  1ET9 A;  2BB6 A;  4R3D A;  5JHA A;  4XGA B;  3VRA B;  1V1O A;  2HTM E;  2L7R A;  1JWU D;  1TY2 A;  1EO6 A;  3NZU A;  4LDT B;  2KLG A;  2RMM A;  4KGT A;  2L0F A;  1D5X C;  4MT5 A;  1Z5S B;  1B9R A;  1PGA A;  1XQQ A;  4WH4 A;  3BY4 B;  1C4C A;  1I4X A;  2BWE S;  3PRE A;  4MAC A;  4NNJ B;  5CHV C;  5LNK 1;  2ZCC A;  2JU6 X;  4ICV A;  3UIO B;  2WXQ A;  4RNA A;  3AE9 B;  2AL6 A;  4MJS A;  2Y5P A;  4G50 A;  2M8S A;  2WXN A;  1NYQ A;  5LXH A;  1ZE3 D;  3PHX B;  4FAD A;  2K39 A;  2N1V A;  3RUI B;  2RGF A;  4A90 A;  5FKA C;  1QOG A;  4GXB A;  1ACC A;  3CMM B;  3QC8 B;  1ZDX A;  4F7Z A;  1WF9 A;  4GDK B;  2KVZ A;  4TQ1 A;  1CMX B;  2YVC A;  4WAA A;  2GBJ A;  3V60 A;  2DEN B;  3BVG A;  5HG2 A;  5E6J A;  3BII D;  4J6I A;  2JPH A;  3LJ3 A;  2JF5 A;  2FCN A;  3A9J B;  1JW9 D;  1LXD A;  2IY0 B;  1P7E A;  4GSW A;  1FCC C;  2QDF A;  2O2V A;  4W9J A;  1XXG A;  3VR8 B;  3ZDT A;  1SGH A;  1S1Q B;  4S0R A;  2FAZ A;  1WGY A;  2NPT B;  1ROE A;  4A3O A;  2J0K A;  4HK2 A;  3ECI A;  1IGD A;  3T3N A;  3EEC A;  3Q8F A;  1VDV A;  3V6C B;  1L0Y B;  2D3C A;  3BVZ A;  2KVR A;  2MEK A;  4GOC A;  4JWS C;  4GIV A;  2ICI A;  3BWU D;  2XK5 A;  2KAC A;  2LHE A;  4ARC A;  1ZUD 2;  1JML A;  2A4Z A;  2PVO D;  4I6P A;  3W2D A;  1I7H A;  3DWM A;  3K9P B;  4YL8 A;  3N9Y C;  1UH6 A;  1L4Z B;  2KJH B;  3LB8 C;  4DWF A;  1XLP A;  4E3C A;  2KT7 A;  2CS4 A;  1SJE D;  1V81 A;  3AV8 A;  1C76 A;  4FLH A;  4XX5 A;  3A4S C;  4JGH B;  2XNA C;  1ESF A;  4ZHP A;  1WX7 A;  1WM3 A;  1IUE A;  2IND C;  3RI7 C;  3VDZ A;  4B0M A;  4FJY A;  2IGH A;  2DAJ A;  4ANW A;  3NUH B;  3NZS A;  4RF0 A;  4N9F 4;  4W9D A;  3HHM A;  3P4S B;  2KMC A;  2KJ6 A;  3TEX A;  1YX6 B;  1V2Y A;  1MG8 A;  3ZTD A;  2XBB C;  1WI0 A;  2ZVN A;  2J0M A;  1YN4 A;  4BKG A;  1QQR A;  3Q3N C;  2N9X A;  3DBS A;  2ACZ B;  3N1X C;  3B0A A;  4DDI D;  1WMH A;  3QA8 A;  3EGR A;  3ZTC A;  4URK A;  4LJP B;  2MBE A;  1AAR A;  2GOW A;  3B2F A;  2K0P A;  2R2Q A;  3JW0 X;  2ZPY A;  4DXF A;  1NVI D;  2YEP B;  1TS3 A;  3WCQ A;  2GBK A;  1BXT A;  3TL5 A;  2ON8 A;  3UQA A;  2NS5 A;  2R2O A;  4YSY B;  1JWS D;  4LNK A;  3WIM A;  2HDE A;  2MH7 A;  3ML8 A;  3QJZ A;  4JQW C;  4DDG D;  4G3X B;  4C4V B;  2M4N A;  1P9D U;  3U8Z A;  1HZ6 A;  1YN5 A;  3PRP B;  3QAQ A;  1ZDV A;  3BZD B;  4WUR A;  3RCZ A;  4BAX A;  3VH3 B;  2LGX A;  1V1P A;  1C4P A;  2CU1 A;  3DBR B;  1NEK B;  2QC8 A;  3ZKJ C;  2JXX A;  3WAP A;  5GMV A;  4YTM B;  1EF1 A;  2GRI A;  2KWD A;  1FEH A;  3ALB A;  4GU2 A;  4WAF A;  1L2N A;  2L0T A;  4P6V F;  1SSN A;  1TJE A;  4TUU A;  4JWU C;  3P4R B;  2L83 A;  4AWJ A;  4GMV A;  2MJD A;  4MJS B;  1FPY A;  4NPN A;  2KYW A;  1WXQ A;  3AU4 A;  2VH1 A;  3EFC A;  4WJO A;  3P42 A;  3B1L X;  5FK9 C;  3AE6 B;  4MM3 A;  4GDL A;  5HI1 A;  3DVN U;  3IXS A;  3SEB A;  2KHW B;  4W9C A;  3I5J C;  3RZW C;  3HUI A;  3I57 A;  2MW5 A;  3E56 A;  1K50 A;  4I6N B;  2M56 B;  3GZN B;  4LTU A;  4KSK C;  2AQ1 B;  5DCN A;  2VRR B;  1QOF A;  3ZO5 B;  3V05 A;  3IBE A;  1V97 A;  3EUB 2;  1SXT A;  3PZ8 A;  5BYR A;  4ANU A;  3CSF A;  2CU3 A;  2NCN A;  2K8B A;  1K53 A;  4HXD A;  2MBQ A;  2OHF A;  3ZNI D;  2JX5 A;  2IPK D;  4YSX B;  2I1J A;  5L95 C;  3AMZ A;  2W9N A;  1KM7 A;  2O2V B;  3LYY A;  5H8Y E;  4FA6 A;  1YMH E;  1OTR B;  3HM6 X;  2ASQ A;  2DYM A;  2I1K A;  1TKE A;  1OQY A;  1RYJ A;  2D07 B;  3V6E B;  2GBR A;  2KWU B;  3KLS X;  3VXW A;  3GP7 A;  4HRO A;  4ZRI A;  1GJZ A;  1WJN A;  2K9X A;  3OJ4 B;  4H2A A;  1SE2 A;  2LVO A;  3ZXR A;  1JRP A;  1ISN A;  4HCP B;  3CIR B;  1FFU A;  1P3Q U;  2KDI A;  1R4M I;  2VZK D;  1MG4 A;  5J17 A;  4CQN A;  3C0R B;  2QIE B;  2WNM A;  3KUZ A;  3MC8 A;  1FIQ A;  3TUO A;  2INN E;  2WYQ A;  2LWP A;  1VZ6 A;  2WXG A;  2DYB A;  3DBL B;  3ZQ4 A;  1XLQ A;  1QF6 A;  4A20 A;  3OJ3 A;  1EM7 A;  2BQQ A;  3APC A;  2KQ7 A;  1MJD A;  1STE A;  5JH5 C;  3VUW A;  2J42 A;  1CZP A;  3BK2 A;  5E6N A;  2WLB A;  1KLV A;  1F77 A;  2V3N A;  3C19 A;  1WH3 A;  2W3R A;  4P7I A;  2ZVO A;  3R2I A;  2MQJ A;  2BF8 B;  3ML9 A;  2RDG A;  1F2R I;  3T3O A;  3DVG X;  3PSE B;  2N9L A;  1LM8 B;  2NR2 A;  4NJC A;  2I38 A;  2RDH A;  4OVU A;  1C9F A;  4GDK A;  1ZXH A;  3QQ8 B;  1GG3 A;  2LXC A;  2GBM A;  1AWD A;  3ZNG C;  4YTN B;  2KX0 A;  2VZK B;  1EU4 A;  3VTV A;  4PT5 A;  1ENF A;  3H1U A;  3VHT C;  3A4R A;  4WQO B;  2O6V D;  2RR9 A;  3A9J A;  1WZ0 A;  1WWT A;  2DLB A;  2IY1 B;  3WAN A;  4O1N A;  2BYV E;  1V5O A;  4B9K A;  4EZK A;  3N20 C;  4W9H A;  3LDZ E;  4TQ0 A;  4G0N B;  2MX2 A;  2IYD B;  3W5U B;  1WSP A;  3VUX A;  1XCT L;  3RYT A;  5CHF A;  2D3G A;  2GB1 A;  1MHH E;  1FM0 D;  2KN5 A;  1ZKH A;  4NQK E;  2LVQ A;  3QIJ A;  3QWZ B;  3T9L A;  2WDV B;  3B08 A;  1WE7 A;  4XE0 A;  1V6E A;  4XZ4 A;  3UIP B;  4C00 A;  1FMA D;  4K1R B;  4ITK A;  1N6Z A;  2EMS A;  4AP4 C;  2WDR B;  2PE6 B;  2JZ3 B;  5EE9 A;  5KHO A;  1F2R C;  4HDO A;  4IW0 A;  1MFW A;  4AOF A;  5EE3 A;  3P4Q B;  1M94 A;  3WAL A;  3H9D A;  2DAF A;  4EOY A;  5IA7 A;  3P2B A;  2HD5 B;  4ZRJ A;  4FUL A;  5JHB A;  2WQY B;  1KF6 B;  2ZW1 A;  4IM0 A;  3W9C B;  2O6V B;  2M17 A;  2WDQ B;  2TSS A;  1FXT B;  3DHG C;  1DGJ A;  4J3O D;  4HCN B;  1R7S A;  4K3B A;  4ICU A;  2NBV B;  3AE5 B;  1SIJ A;  4OZB A;  4XWW A;  1N5X A;  1GNU A;  2IGG A;  3M95 A;  2N4F A;  1L5P A;  3RN9 C;  4MH8 A;  3C8Y A;  3RNC C;  4XWT A;  2B3A A;  1YQ3 B;  1KOT A;  4C80 A;  3EA6 A;  4KX6 B;  1I4H A;  4MGY E;  4WJQ A;  1IBX A;  4BFR A;  3Q3O C;  3KYC D;  2CR5 A;  4C7Z A;  1OQQ A;  4JE3 B;  3Q69 A;  3W1S A;  1IPG A;  3AE8 B;  2AX5 A;  5G5H A;  3ZDM C;  4YTP B;  3VVW B;  1OEY A;  3QX1 A;  2V4I B;  2X38 A;  2EKI A;  3AN1 A;  3Q8A A;  2OJW A;  4A9A A;  1FFV A;  4C4V A;  4LCD E;  1T0S C;  1I4Q A;  1Q1O A;  2K25 A;  5EE1 A;  2CHX A;  1WX8 A;  3NOB A;  3AH7 A;  1ZW7 A;  3U7D A;  4K81 A;  4L1B A;  1FNV A;  2G3Q B;  1WYG A;  1E8X A;  2LJI A;  3AB5 A;  3OAW A;  2KWC A;  5HHD G;  1EWC A;  4RMA A;  4BBN F;  2MBH A;  2B76 B;  4MSQ B;  4ZRK A;  2KD0 A;  4M01 A;  2NBU A;  1YD8 U;  2HJ1 A;  3U7Z A;  1LGR A;  2DX5 B;  2ZZP B;  3MTN B;  1UGJ A;  1IP9 A;  3Q14 C;  4IM2 A;  1WRD B; 
#chains in the Genus database with same CATH homology
 1YX6 B;  1V2Y A;  3PPA A;  2D2Q A;  3T8M A;  5C1Z A;  2LJ5 A;  1MG8 A;  3IHP C;  3W1S C;  3ZTD A;  2XBB C;  3PRM B;  1WI0 A;  4M8N A;  2XEW A;  3R7R A;  2Z0E B;  2ZPN A;  4M0W B;  4HLE A;  1WE6 A;  3ZW3 A;  1YX5 B;  2ZVN A;  3CST A;  3DOW A;  1VD2 A;  3M62 B;  3NY5 A;  1WGH A;  2J0M A;  4EEW A;  1H8C A;  4BKG A;  2D11 A;  3RT3 B;  3ZIM A;  1OGW A;  3KH0 A;  2C7M B;  2A5U A;  2N9X A;  3DBS A;  4IG7 B;  2J7Q B;  3B0A A;  4DDI D;  4KZ0 A;  1WMH A;  3QA8 A;  2HJ8 A;  3ZTC A;  4URK A;  4LJP B;  3DBH I;  2MBE A;  1AAR A;  2GOW A;  4KIK A;  1WGD A;  2EKE C;  2R2Q A;  3JW0 X;  4PYU A;  5DPR A;  2FUH B;  2ZPY A;  4F1S A;  2IZV B;  3UGB B;  5D7G A;  4FHK A;  5LXI B;  2KDF B;  1TBE A;  2GBK A;  2KFK B;  4HPL B;  1EF5 A;  3AUL A;  3DCG A;  4GN1 A;  2J0J A;  4IM3 A;  2FNJ B;  2XK5 B;  3RD2 A;  4K7S A;  1WY8 A;  3TMP B;  1UZX B;  2DHZ A;  4W9E A;  3TL5 A;  2DZI A;  2NS5 A;  3UQA A;  3CF6 E;  3PHW B;  2R2O A;  2LAS A;  2JRI B;  2KWV B;  2L8J A;  3WIM A;  3ML8 A;  3R7Q A;  2REX A;  3QJZ A;  4JQW C;  5LLI A;  4KDL B;  3RZF A;  4DDG D;  4G3X B;  4EFO A;  2M4N A;  1P9D U;  2OJR A;  3U8Z A;  4ASW C;  2M1M A;  2LD9 A;  2CKH B;  3A9K A;  2KMA A;  3ONS A;  3PVL A;  3PRP B;  1QZE A;  3QAQ A;  4NAW A;  3TCA A;  3W1Y A;  3RCZ A;  3SDL C;  2LGX A;  3VH3 B;  4TV3 A;  2CU1 A;  4BOS C;  1GUA B;  2BKR B;  2KO3 A;  2N1W A;  2JXX A;  4W9G A;  3ZKJ C;  3WAP A;  5GMV A;  3PS6 A;  2PE9 A;  1EF1 A;  3KVF B;  3HIZ A;  5E6P A;  3MHS D;  3QAR A;  2AYO B;  2KC2 A;  3DVG Y;  3ALB A;  3A1Q A;  5EDS A;  3L13 A;  3WA0 A;  4GU2 A;  2K8C A;  4AUQ C;  1L2N A;  2N7D A;  1BT0 A;  4PYZ A;  2L0T A;  1G6J A;  2UYZ B;  2JZZ A;  2LVP A;  2GBN A;  4TUU A;  1GC7 A;  4AWJ A;  4GMV A;  2JY6 A;  2LRW A;  3Q3F A;  4MJS B;  4NPN A;  2L05 A;  1SE9 A;  3AU4 A;  1YIW A;  3PRZ A;  4F8C B;  2KZR A;  2L3Z A;  1J0G A;  3RUL A;  4WJN A;  4WJO A;  2V4L A;  2C60 A;  3B1L X;  2LI5 A;  3TIX A;  2RSU A;  4OVV A;  1WYW B;  3M63 B;  4MM3 A;  4GDL A;  3JSV A;  3KYD D;  3S2A A;  1NI2 A;  5AEK B;  2Z0D B;  3DVN U;  1WMH B;  4ANX A;  2KHW B;  4W9C A;  3RZW C;  1LFD A;  4JLC A;  4K7W A;  2V1Y A;  4LJO B;  4KIK B;  1WXM A;  1UD7 A;  2AWT A;  2MW5 A;  2HTH A;  3L0W B;  3M3J A;  4HJK A;  1WGG A;  4I6N B;  2PJH A;  4A3P A;  4KSK C;  2FCS A;  4WWP A;  5DCN A;  2V3S A;  1E7V A;  2KFJ A;  2VRR B;  1RRB A;  1TGZ B;  2BYE A;  2IBI B;  3ZO5 B;  1RAX A;  3IBE A;  3IFW B;  3N32 A;  1R4N I;  4IC7 B;  2DZJ A;  2IO3 B;  4JIO U;  4HWI B;  3PLU A;  4ANU A;  2NPT A;  3CSF A;  4HVB A;  4BBN C;  3APD A;  2EMT A;  2NCN A;  2K8B A;  4HXD A;  3TBL D;  3TJP A;  3Q3J A;  2MBQ A;  3ZNI D;  2KDE B;  3QK0 A;  1D3Z A;  2I1J A;  2C7N B;  2NBW B;  1WZ3 A;  5L95 C;  3K9O B;  2HE7 A;  4FHJ A;  1WJ4 A;  2W9N A;  1KM7 A;  3IG3 A;  4BVU C;  2O2V B;  4FA6 A;  4ZYN A;  2FIF A;  1OTR B;  4WWN A;  3HM6 X;  2ASQ A;  2DYM A;  2I1K A;  4DBG A;  4WJP A;  4E74 A;  1KJT A;  1L7Y A;  1XT9 B;  1OQY A;  2D07 B;  5FR6 A;  2M0X A;  2DZK A;  2K1F A;  4NAW B;  3V6E B;  4WWO A;  4CHK A;  1WR1 A;  2GBR A;  2KWU B;  2G4S A;  3H7S A;  3OLM D;  3VXW A;  2LZ6 A;  4ZRI A;  2OOB B;  3R66 C;  1GJZ A;  1WJN A;  2QHO A;  3OJ4 B;  2KJR A;  2KAN A;  2LVO A;  4NQL B;  3ZVV A;  3D32 A;  3A1Q B;  1ISN A;  4HCP B;  1P3Q U;  1WJU A;  1E8W A;  2BGF A;  2KDI A;  5DPT A;  1WGR A;  3BIN A;  4K7U A;  4TKN A;  1R4M I;  2KLC A;  4PS3 A;  4BOZ B;  5J17 A;  4GGQ A;  3C0R B;  1WJ6 A;  2MP2 A;  3KUZ A;  2JVC A;  2LUE A;  1LQB A;  3KUC B;  1WM2 A;  2WYQ A;  1T0Y A;  2LWP A;  4IWP A;  2YLM A;  4JL9 A;  2DYB A;  3U30 A;  1IYF A;  2FID A;  1U4A A;  4HPM B;  1S3S G;  4A20 A;  5AZG A;  3OJ3 A;  4KSL C;  3AU5 A;  2L76 A;  3APC A;  1V49 A;  4CO7 A;  1C3T A;  2KQ7 A;  1E8Y A;  1WX9 A;  4GDL B;  1WR6 E;  2ZNV C;  3JSV B;  5JH5 C;  3VUW A;  2MSE D;  1WXV A;  1I35 A;  3EHV A;  2L00 B;  4DHZ E;  1RLF A;  2FCM A;  3O65 B;  3QCA A;  1UBQ A;  3MJW A;  3V62 A;  4DHZ B;  3DVN V;  4LDT D;  4NY0 A;  4BKS A;  3X0W A;  5E6N A;  4II2 B;  5CX3 A;  1KLV A;  4NJ6 A;  4FN2 A;  1Q5W B;  1UBI A;  2LXA A;  1H4R A;  5AZF A;  2KDB A;  1WH3 A;  2ZEQ A;  4B6W A;  4P7I A;  4CYE A;  1V5T A;  2ZVO A;  5CHW A;  5J18 A;  2MQJ A;  2BF8 B;  3KUD B;  3VUY A;  3WAM A;  3VH4 B;  4HDQ A;  2BPS A;  3ML9 A;  3V61 A;  4W9K A;  3A33 B;  2MLB A;  4MDK E;  4BKS D;  3DVG X;  2ZNV B;  2IO2 B;  3PSE B;  3EFU A;  3HM3 A;  3UQB A;  1LM8 B;  2KTR A;  2NR2 A;  1NDD A;  2O6V A;  4OVU A;  4GDK A;  4PS8 A;  2N9E B;  1NBF C;  4AJW A;  3QQ8 B;  4ZDV A;  2K6D B;  2FCQ A;  1GG3 A;  2IO1 B;  1SIF A;  1P1A A;  1V9J A;  2LXC A;  2WX1 A;  3IVF A;  2GBM A;  3N30 A;  2KKC A;  2LGD A;  3ZNG C;  2CHW A;  1JRU A;  4DK5 A;  2JUO A;  2MRP A;  2DZM A;  2DYO A;  2KX0 A;  4MEL A;  3VTV A;  4KV2 A;  2LRU A;  3H1U A;  3VHT C;  3A4R A;  3H7P A;  2Z59 B;  4WQO B;  2O6V D;  2RR9 A;  1A5R A;  1E5W A;  3A9J A;  1WZ0 A;  3WAN A;  2IY1 B;  2G45 B;  1PQS A;  2G4D B;  2BYV E;  3R3M A;  1V5O A;  3SU8 X;  3VFK A;  4XC2 A;  2CHZ A;  3NS8 A;  2BYF A;  4IWO A;  5C23 A;  4B9K A;  1V80 A;  2RPQ A;  4W9H A;  4EZK A;  3LDZ E;  1RFA A;  4TQ0 A;  3H6N A;  4G0N B;  2MX2 A;  2IYD B;  2MBO A;  5JHA A;  3VUX A;  2PEA A;  3RYT A;  5CHF A;  1WXS A;  3APF A;  2D3G A;  2L7R A;  3WAO A;  3L54 A;  3ZRF A;  2IO0 B;  1EO6 A;  3EC8 A;  3NZU A;  4I6L B;  4LDT B;  2KLG A;  2KN5 A;  1ZKH A;  4MSM B;  4NQK E;  4E71 A;  2L0F A;  1ZGU B;  2LVQ A;  3PV1 A;  5AZH A;  3QIJ A;  1Z5S B;  3QWZ B;  3T9L A;  1Z2M A;  1XQQ A;  3DQV A;  3B08 A;  3BY4 B;  1WE7 A;  2BWE S;  3KW5 B;  3PRE A;  4NNJ B;  4W9L A;  1V6E A;  1TTN A;  4XZ4 A;  1UEL A;  5CHV C;  3UIP B;  4B95 A;  1J19 A;  2JWZ A;  4K1R B;  2ZCC A;  4W9F A;  3A9K B;  2EMS A;  4AP4 C;  2KC1 A;  2PE6 B;  4ICV A;  1J8C A;  2JZ3 B;  4GB9 A;  4W9I A;  3L10 B;  5D2M B;  5KHO A;  3UIO B;  2K8H A;  4HDO A;  2AL6 A;  1EUV B;  3PZD A;  4MJS A;  4IW0 A;  4G50 A;  4KZC A;  2M8S A;  5D6J B;  4AOF A;  5G55 A;  4EUT A;  1M94 A;  3WAL A;  5L83 A;  5LXH A;  3PHX B;  3H9D A;  2MBB B;  2DAF A;  1E90 A;  2K39 A;  4EOY A;  4FAD A;  2JT4 B;  2N1V A;  3UF8 A;  5IA7 A;  3RUI B;  1WXA A;  3P2B A;  3ZNZ B;  2HD5 B;  1Q0W B;  2RGF A;  4EZJ A;  4ZRJ A;  4DXA B;  1I42 A;  4FUL A;  4RM9 A;  5JHB A;  2NVU I;  4FJV B;  3PT2 B;  2AL3 A;  4GXB A;  3GZN I;  2ZCB A;  4ANV A;  3ZNH B;  3CMM B;  3QC8 B;  2KTR B;  4IM0 A;  1HE8 A;  3L16 A;  3UIN B;  4MGK E;  2O6V B;  2M17 A;  4MEM A;  4F7Z A;  1WF9 A;  4GDK B;  3DDC B;  2JRH A;  2N7E A;  1GC6 A;  3L17 A;  4TQ1 A;  1VCB A;  1CMX B;  2YVC A;  4FJZ A;  3ZLZ A;  3PTF C;  4WAA A;  3SD5 A;  1XD3 B;  2C5L C;  2GBJ A;  3PGE A;  1FXT B;  2WDT B;  4RM8 A;  4M8M A;  3V60 A;  5HKH A;  4MH0 E;  1P0R A;  2DEN B;  4IUM B;  4IWQ A;  4HCN B;  2K6Q A;  2KOX A;  2Y5B B;  3HK0 A;  4J6I A;  4ICU A;  3X23 A;  2JPH A;  1WIA A;  3LJ3 A;  2NBV B;  3H7P B;  3N3K B;  2JF5 A;  2FCN A;  3A9J B;  1LXD A;  2IY0 B;  4GSW A;  2PPH A;  1GNU A;  2MWS B;  2MCN B;  3M95 A;  1YQB A;  2N4F A;  5CTR C;  2D10 A;  3JVZ X;  2O2V A;  5KHQ A;  4W9J A;  2B3A A;  4II3 B;  3VAW A;  3ZDT A;  4MGZ E;  1KOT A;  1SGH A;  2ZJD A;  2KNB A;  1S1Q B;  2MA9 B;  4MGY E;  1YJ1 A;  2FAZ A;  4WJQ A;  1WGY A;  2NPT B;  2UWQ A;  4X57 B;  4A3O A;  3JYU A;  4DHJ D;  2J0K A;  4HK2 A;  3ECI A;  4BFR A;  3ZRC A;  3KYC D;  2CR5 A;  2KK8 A;  3VTW A;  3EEC A;  1E7U A;  3V6C B;  3W1S A;  1X1M A;  1IPG A;  2KVR A;  2KFK A;  4GOC A;  4EZL A;  3QHT A;  4GIV A;  2C7H A;  3VTU A;  3I3T B;  3ZDM C;  2AEH A;  2XK5 A;  2RD0 A;  5DPS A;  3VVW B;  1OEY A;  2C9W B;  4BKT A;  3DPD A;  3QX1 A;  2A4Z A;  2N9P C;  1P98 A;  4AJY B;  1OEY J;  3DBL I;  4I6P A;  5G2N A;  3K9P B;  5J2R A;  4YL8 A;  4G11 A;  1UH6 A;  1Y8R C;  1C1Y B;  2KJH B;  2KXJ A;  4LCD E;  1V86 A;  1Q1O A;  4FBJ B;  4DWF A;  2K25 A;  2KX3 A;  5DPW A;  2CHX A;  5IAA C;  1WX8 A;  3AXC A;  3NOB A;  1ZW7 A;  4KVG B;  3U7D A;  1WFY A;  4E3C A;  4K81 A;  2LGY A;  3ZUN A;  3DBR I;  3GOE A;  3NHE B;  2G3Q B;  1TZ1 A;  1E8X A;  5D94 A;  2CS4 A;  1V81 A;  3OAW A;  5TR5 A;  4MGI E;  2MP2 B;  3ENE A;  4FLH A;  3SHQ A;  3PLV A;  4XX5 A;  2KWC A;  3A4S C;  4JGH B;  2GMI C;  2KTF A;  4NJ7 A;  1WX7 A;  4RMA A;  1WM3 A;  4BBN F;  2MBH A;  2KQS A;  4MSQ B;  3VQI A;  3VDZ A;  1F9J A;  4ZRK A;  2BWF A;  5E6O A;  3AI5 A;  2WWZ A;  2KD0 A;  2WX0 A;  4FJY A;  1UGM A;  4PS7 A;  1K8R B;  2DAJ A;  2NBU A;  4ANW A;  5JZE B;  1YD8 U;  3NZS A;  4N9F 4;  2DX5 B;  2ZZP B;  3L08 A;  3MTN B;  4W9D A;  4EKU A;  3HHM A;  4KDI C;  2KMC A;  1IP9 A;  2KJ6 A;  2BKF A;  4IM2 A;  4DHJ B;  1E8Z A;  1WRD B;  5BO4 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...