4I6PA

Crystal structure of par3-ntd domain
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
84
structure length
84
Chain Sequence
SEFKVTVCFGRTRVVVPCGDGRMKVFSLIQQAVTRYRKAVAKDPNYWIQVHRLEHGDGGILDLDDILCDVADDKDRLVAVFDEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into the intrinsic self-assembly of par-3 N-terminal domain.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
molecule keywords Partitioning defective 3 homolog
total genus 19
structure length 84
sequence length 84
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4i6pA00
4W9KA 4FLHA 4BOZB 2KFKB 4GGQA 4FHKA 1UGMA 2NVUI 4TKNA 3L54A 3QX1A 4E71A 2IYDB 4A3OA 4N9F4 3D32A 3KYCD 3QA8A 4LCDE 1WXSA 3UGBB 2NCNA 4ZDVA 2Z59B 5C1ZA 3IHPC 2KLCA 5IA7A 3CSFA 5D6JB 2BYEA 2GBNA 3VQIA 4AJYB 1WGYA 2JRIB 4WJQA 4K81A 2KC2A 2ZNVB 2NBUA 2R2OA 4DBGA 1E90A 2KZRA 1YIWA 2RSUA 2CHZA 3N32A 4HK2A 4MM3A 1NDDA 2LGXA 2ASQA 4MGIE 2BKFA 5L83A 2M17A 3DVNV 2KX0A 2PJHA 4E74A 1UH6A 1X1MA 2D3GA 2KDBA 4AP4C 2C60A 3A9JB 4GN1A 4WWNA 4LDTB 4WQOB 2G45B 3UF8A 5KHOA 1EF5A 4BBNF 4GSWA 3TL5A 4DHZE 2M8SA 2ZNVC 1V86A 3DPDA 4MELA 2C9WB 2BYFA 2MP2A 3ZLZA 3NY5A 1J0GA 3VUYA 5G2NA 2CU1A 3ZO5B 2Z0DB 1S1QB 2CKHB 4TQ0A 4FN2A 1GC7A 3DBHI 3M62B 3QC8B 2MP2B 4E3CA 4HVBA 3HM3A 2G4SA 4DDGD 2KC1A 2UWQA 5CX3A 4MGYE 5CHFA 4LDTD 2DZMA 2MBHA 3B0AA 2C5LC 5E6OA 2KDIA 4GDKB 3VUWA 1GG3A 2W9NA 4BKSA 4NQKE 1NBFC 4KZCA 3AXCA 4K7SA 2I1JA 3GZNI 5JH5C 2DAFA 2MBBB 3H1UA 2V1YA 1KOTA 2PE9A 5CHVC 5J2RA 2KWCA 5DPTA 1WI0A 2JZ3B 5JHAA 3SDLC 2AWTA 4MEMA 1LQBA 2FIDA 3DCGA 3L13A 4IM0A 2KANA 1UELA 3ZRCA 3HK0A 3RD2A 4ZRKA 5E6NA 2N9EB 4MSQB 3GOEA 5HKHA 4DWFA 4LJOB 3DVGX 1SGHA 3DVGY 4B9KA 4BKSD 3ML8A 2LGYA 2MLBA 4YL8A 3UQAA 2L00B 4XC2A 1XQQA 3PLUA 3L16A 2NPTA 3LDZE 4FHJA 3NOBA 3JVZX 1WMHB 2KK8A 2LRWA 3LJ3A 3PS6A 4J6IA 1WGDA 2J0KA 3ZKJC 3IFWB 3QK0A 4MGZE 4BKGA 3APCA 3ALBA 2RPQA 2JT4B 1E8ZA 3H7SA 3KUCB 2D10A 3MHSD 5BO4B 3RUIB 1I42A 1GNUA 1I35A 2MBQA 2NPTB 2O6VA 1WFYA 2LI5A 2L0TA 2Z0EB 5DPRA 4EZKA 3WAOA 5L95C 1P1AA 1WGGA 1P9DU 3VUXA 2OOBB 4DDID 3A9KB 4K1RB 2A5UA 1E5WA 1WXMA 2N1VA 3MJWA 3SHQA 1NI2A 1UBIA 3QARA 1Z5SB 5DCNA 4RMAA 5G55A 4IC7B 2EMTA 2KTRA 4P7IA 1WR6E 3QIJA 2RD0A 4NPNA 2LVOA 3H7PA 1V80A 1Z2MA 3KUZA 1KLVA 3PRMB 2KJHB 4MJSB 4K7UA 4PS3A 2D07B 4B95A 3PV1A 4ASWC 2KTFA 4KIKA 5AZHA 2G3QB 1UZXB 2LJ5A 4I6PA 2C7HA 3V6CB 3B08A 3VXWA 2WX0A 1WJNA 4I6NB 4GB9A 4GMVA 4ZRIA 3TCAA 1F9JA 1E7UA 2CHXA 2KWUB 4KZ0A 4HPMB 1LM8B 5IAAC 1KJTA 2IO3B 2KMAA 2FCNA 2K6DB 4ZRJA 3O65B 4G0NB 2LGDA 1WX7A 3UINB 3R7QA 4ANXA 1K8RB 3VTVA 2KTRB 2DYMA 3DOWA 3PVLA 1YD8U 2B3AA 3QHTA 4II3B 3N3KB 5CTRC 2LXCA 3AU5A 3PHWB 3QCAA 4MGKE 1ZGUB 2JVCA 2KJ6A 3VH4B 3V6EB 3L08A 3ECIA 2LVQA 4WJPA 4W9JA 5D94A 3CMMB 4FULA 3DBRI 3KYDD 1JRUA 4GDLB 1VD2A 3ZW3A 2REXA 2KQ7A 3WAPA 2JZZA 2HJ8A 2C7MB 2L8JA 4GXBA 3ZDMC 2MBOA 2GMIC 1WH3A 2D2QA 3DQVA 3JSVA 1XD3B 1Q0WB 1TTNA 1WYWB 1BT0A 4W9EA 3U7DA 3SU8X 2IY1B 3APFA 2KO3A 2XK5A 3DDCB 4GDKA 4HCPB 2KWVB 1PQSA 1LXDA 4HDQA 3WAMA 1WM3A 1G6JA 2O2VB 5D7GA 2KJRA 4AOFA 1A5RA 4PYUA 3VTWA 1WJ4A 1WE6A 2MSED 4IWPA 4BKTA 1YJ1A 3WA0A 3I3TB 2UYZB 4NJ7A 5E6PA 3BY4B 3OJ4B 3KW5B 1RAXA 3CSTA 2M4NA 4IM3A 4NAWA 3UIPB 3WANA 1AARA 1GJZA 3PRPB 3OAWA 4M8MA 4EKUA 2KN5A 1H8CA 3PTFC 2ZPYA 2JXXA 2MX2A 5LLIA 2NS5A 2V3SA 3L0WB 2N7DA 1Q5WB 3CF6E 4GIVA 2K6QA 1P3QU 4GOCA 3VHTC 1Q1OA 2NBVB 4KV2A 2WDTB 1WX8A 3W1YA 2K8HA 3UIOB 4WJOA 3UQBA 1OTRB 2WX1A 3R66C 3RULA 4FADA 1RRBA 1P0RA 3AU4A 3RCZA 4IG7B 4NNJB 4OVVA 4NQLB 3ZTCA 1WIAA 4ZYNA 2K25A 3APDA 2MCNB 4F1SA 3NHEB 3L10B 1WXVA 2N7EA 4HJKA 2YLMA 3AI5A 4EEWA 2DENB 3T8MA 1XT9B 4MH0E 2MQJA 3R7RA 2FCMA 3M95A 5D2MB 1YX6B 2JPHA 4IM2A 2HE7A 1WM2A 2FCQA 4WWOA 2HD5B 3JW0X 1Y8RC 3ENEA 2ZVNA 1V6EA 3VDZA 2BWFA 3ZUNA 4JIOU 2D11A 1WE7A 4FJYA 3ZNID 3R3MA 4PYZA 1E8WA 1YX5B 1RFAA 2I1KA 3ZTDA 4HCNB 5C23A 2R2QA 3QJZA 2AEHA 2MA9B 3PZDA 4ANVA 1WMHA 2NR2A 2CR5A 2LASA 3M3JA 3N30A 3P2BA 4NY0A 4ANWA 2FUHB 5J17A 3PPAA 2IBIB 4KDLB 2G4DB 4KDIC 2PE6B 2KQSA 3A4RA 3K9OB 4DHZB 3ONSA 3TIXA 3U8ZA 3L17A 3WIMA 1OEYJ 3KVFB 2EMSA 2DZIA 3PREA 2L76A 1IP9A 4AWJA 4W9CA 3QWZB 4CHKA 2CS4A 2LD9A 3RZFA 2L7RA 3ZRFA 2L05A 3BINA 1L2NA 3DBLI 1CMXB 1M94A 3NZSA 3ZVVA 2N4FA 2K39A 2KFKA 2KHWB 1WGHA 3A4SC 4X57B 1TGZB 2N9XA 3VFKA 1WZ0A 2JRHA 5LXIB 1C1YB 5EDSA 3IBEA 4GDLA 4LJPB 3VVWB 3JSVB 2K1FA 1FXTB 4TQ1A 4K7WA 3NS8A 2WWZA 2LRUA 4OVUA 2ZZPB 1R4MI 2IZVB 3W1SA 3KH0A 2K8BA 1V5OA 2ZPNA 3SD5A 4A3PA 3Q3JA 1WJ6A 2MRPA 4IUMB 2O2VA 3QAQA 1EUVB 4W9GA 3WALA 4FBJB 4EZLA 3VTUA 2J7QB 3Q3FA 3S2AA 3B1LX 2CHWA 2MBEA 4W9FA 3DBSA 4GU2A 1L7YA 2VRRB 3V62A 4DXAB 4RM9A 1E7VA 1WF9A 4G3XB 3V61A 1WGRA 3VAWA 4HDOA 4BOSC 2AYOB 1T0YA 2BWES 4EOYA 2YVCA 1V81A 2PEAA 1U4AA 2OJRA 4EZJA 2DX5B 2IO2B 4BBNC 2JWZA 4FA6A 1OQYA 1GUAB 2LZ6A 1WR1A 2KKCA 3HM6X 2N1WA 1SE9A 1UBQA 2IO0B 1EO6A 1HE8A 2DHZA 2ZEQA 2L0FA 4M0WB 1WY8A 1WZ3A 2ZCBA 4ANUA 1SIFA 3OJ3A 3VH3B 3W1SC 3TMPB 2J0MA 1WJUA 4MJSA 3ZNGC 3ZNZB 2QHOA 1YQBA 2KDEB 3H7PB 3IVFA 2AL3A 1OEYA 1H4RA 3NZUA 1KM7A 2DAJA 1WRDB 3RT3B 2KD0A 3H6NA 3PLVA 4XX5A 2RGFA 3OLMD 2BGFA 4WWPA 3X0WA 2XBBC 5AEKB 2MWSB 3V60A 3ZIMA 4JL9A 1EF1A 2PPHA 3A1QA 2GBKA 3K9PB 4G50A 4FJVB 2A4ZA 2KXJA 4DHJB 4WAAA 2IO1B 4JQWC 1IYFA 4HXDA 1S3SG 2O6VD 1TZ1A 2JY6A 2DZJA 2DZKA 4B6WA 4BFRA 4F8CB 1C3TA 4PS8A 5TR5A 4AUQC 2LUEA 3EECA 1LFDA 2XEWA 4ICUA 2KLGA 3X23A 2EKEC 2ZJDA 4DK5A 4II2B 2IY0B 5LXHA 2LVPA 1V5TA 3IG3A 3ML9A 3TJPA 3HIZA 5AZFA 2XK5B 4HLEA 2FCSA 4URKA 2JF5A 2KFJA 2RR9A 2Y5BB 3RZWC 2KX3A 4HPLB 3ZNHB 3PHXB 2GBMA 2WYQA 4F7ZA 2O6VB 1GC6A 1UD7A 2LXAA 2KMCA 2GOWA 4IWOA 4NAWB 3T9LA 2K8CA 3H9DA 1IPGA 3EHVA 4RM8A 4ICVA 4JGHB 3C0RB 2KVRA 1ZKHA 2FNJB 1P98A 4TUUA 3ZDTA 4IWQA 3DVNU 4W9DA 4IW0A 5GMVA 2BPSA 2L3ZA 2KDFB 3PRZA 4I6LB 2BYVE 4HWIB 4W9LA 3U30A 3QQ8B 4JLCA 4A20A 2MW5A 4M8NA 3A33B 4KVGB 1ISNA 2ZVOA 4W9IA 3PSEB 5CHWA 3TBLD 2J0JA 4AJWA 4DHJD 4WJNA 5FR6A 2BKRB 1E8YA 1E8XA 3EFUA 5DPSA 1J8CA 4KIKB 3A1QB 1V2YA 3JYUA 5JHBA 1WXAA 4CYEA 5DPWA 5JZEB 4CO7A 2N9PC 1RLFA 1WX9A 3A9JA 2DYOA 5J18A 3PGEA 1D3ZA 2C7NB 2GBRA 4KSLC 1V49A 2M1MA 1QZEA 2KNBA 2FAZA 1MG8A 2BF8B 4TV3A 4EUTA 1VCBA 2V4LA 5KHQA 3KUDB 4XZ4A 3HHMA 1OGWA 2GBJA 4KSKC 1J19A 3MTNB 4NJ6A 2HTHA 3AULA 4FJZA 4MDKE 4MSMB 1TBEA 4G11A 4W9HA 3PT2B 2M0XA 4PS7A 3RYTA 4EFOA 2FIFA 1ZW7A 2KOXA 1R4NI 2LWPA 2NBWB 3M63B 1V9JA 4BVUC 2ZCCA 2AL6A 2DYBA 3EC8A 3A9KA 2JUOA 5AZGA
chains in the Genus database with same CATH superfamily
4FLHA 2NVUI 4E71A 3NVYA 1WXSA 5C1ZA 2KLCA 3CSFA 2GBNA 5FR3A 4AJYB 2ZNVB 2WNMA 4DBGA 1L0XB 4HK2A 1JWBD 4C4VB 1KLGD 4AQ7A 2D3GA 4AP4C 3PZ8A 1FFVA 5KHOA 3GZNB 2FE8A 1JWUD 2KYWA 2XNAC 3N9YC 4LNFA 2K5PA 3J9CA 2QDFA 2BTEA 3ZO5B 4N58A 2VZKD 3BZDB 1GC7A 3DBHI 1EM7A 4LNIA 4DDGD 2Y5PA 2KC1A 2N0SB 5CX3A 2UU7A 2IPKD 3VUWA 1GG3A 4BKSA 1DGJA 2GRIA 1MHHE 4KKIA 5JH5C 1KOTA 3H1UA 3H8HA 2D3BA 2PE9A 2KWCA 4JWSC 3SDLC 2AWTA 3DCGA 2FIDA 3HK0A 1JQ4A 1TS2A 1ESFA 2N9EB 3GOEA 4B9KA 2LGYA 2MLBA 1V8CA 3TUOA 1MVKA 2M56B 1XQQA 2IGDA 2KK8A 1D5MC 2LRWA 4YTNB 3IFWB 4MGZE 3ALBA 2RPQA 2JT4B 2D10A 1HTQA 2G9HD 4EZKA 3WAOA 1TY0A 1P1AA 3VUXA 1FD6A 2OOBB 4K1RB 2N1VA 1WXMA 1UBIA 2V3NA 4IC7B 3H7PA 1V80A 4K7UA 3U2SC 2ZW1A 2D07B 4KIKA 4REZA 4UDUC 2LJ5A 4P6VF 4I6NB 1IGDA 4GMVA 3T3OA 1F9JA 2CHXA 5I4DA 2KMAA 2K6DB 3O65B 2LGDA 2LEKA 4ANXA 1JCKB 2Y5CA 2KTRB 1OQRA 2B3AA 3QCAA 2JVCA 3VH4B 5D94A 4WIPA 4GDLB 3URYA 2REXA 4KGRA 2XN9C 1WRIA 2KQ7A 3WAPA 4YT0B 1XCQL 2L8JA 2HJ8A 4GXBA 1QOBA 3AEEB 3DQVA 2D2QA 1VLBA 1TTNA 4C4VA 4W9EA 1CQVA 2IY1B 3IT4B 2XK5A 2QJLA 1PQSA 2GB1A 2M19A 2CJNA 2O2VB 3ZJVA 3V05A 3IT6B 4PYUA 3VTWA 3I3TB 2D5GA 5E6PA 3OJ4B 3CSTA 3WANA 3V3XA 2G1EA 2QEJC 3FAHA 3U4EG 1GJZA 3PRPB 1NI3A 3MHZA 3L0WB 4GIVA 2K6QA 4GOCA 1Q1OA 2NBVB 1JWMD 1HTOA 2B76B 3UQBA 1OTRB 3AH7A 3RULA 1RRBA 1Y56A 3AU4A 4NNJB 4OVVA 3ZTCA 1N62A 4KX6B 1C4PA 4F1SA 1FNWA 1WXVA 4YTPB 5FK9C 3T8MA 1JWSD 5D2MB 1YX6B 4IM2A 2FCQA 4LK0M 1OQQA 1V1PB 3R3MA 1E8WA 1GAQB 2I1KA 2AQ1B 3ZTDA 1L6VA 3Q3NC 2WLBA 2NR2A 2LASA 1AW7A 2FUHB 3AE6B 2G4DB 2KQSA 1UWXA 3K9OB 4WH4A 1OEYJ 2EMSA 2DZIA 2L76A 1FRRA 1IP9A 2WXRA 3BK2A 3QWZB 3LXFA 2WHIA 4RFBA 1L2NA 1CMXB 2K39A 5AUKA 1EU4A 3N20C 1WGHA 1L6UA 3VFKA 2N9XA 1C1YB 1QOGA 3IBEA 3VVWB 1ROEA 3BVGA 2WWZA 1MFWA 1D4BA 3GB1A 3W1SA 3KH0A 4IUMB 3HVDA 3P4PB 2J7QB 3B1LX 2CHWA 3AB5A 4W9FA 1P7EA 4OZCA 3DBSA 3O13A 3R2TA 3RNBC 4DXAB 4G3XB 3VAWA 5C2TB 2OJRA 3GS2A 4EZJA 2DX5B 2IO2B 1FO4A 4BBNC 1ENFA 2JWZA 4FA6A 2QILA 3MC9A 2L0FA 2WXNA 2J0MA 1WJUA 4A90A 5C3JB 5BMGA 3ZNZB 1YQBA 3IVFA 4HRSA 1C4AA 1PGAA 2KWDA 2DAJA 4K3BA 1WRDB 1SSNA 4XX5A 3OLMD 1D5XC 3AE2B 2MWSB 5E6JA 1I4RA 1SIJA 1J7BA 2JYEA 1FPYA 4FJVB 4WAAA 2RDGA 1PUTA 3AMZA 2JY6A 4KGTA 3W5UB 2DZKA 1C3TA 2MHJA 2XEWA 1TKGA 3ZXVA 2BB6A 1AN8A 5LXHA 3IG3A 3TJPA 3ML9A 5AZFA 2JF5A 3RZWC 3ZNHB 2GBMA 1IBXB 1FNVA 2O6VB 3R2IA 1F52A 4IWOA 4YSZB 2WXMA 1IPGA 1NENB 3C0RB 1ZKHA 4NJCA 1I4PA 4W9DA 4IW0A 5GMVA 3B9JA 2BYVE 3KWLA 4W9LA 3QQ8B 4A55A 3TBLD 4WJNA 5HFYA 2INCC 1E8XA 3A1QB 1V2YA 3RNGC 2BS3B 5JZEB 4CO7A 1RLFA 3A9JA 5J18A 2DYOA 3PGEA 4TV3A 2M1MA 4EUTA 4DQOC 3KWVA 4BAXA 5KHQA 3KUDB 1OGWA 1J19A 4YWGG 4FJZA 4MDKE 4MM3B 3RYTA 2L83A 2PW9A 1E0ZA 1ZW7A 3AE7B 4M0WA 1V9JA 2DYBA 3EC8A 5AZGA 4W9KA 4BOZB 2KFKB 2BBCA 4FHKA 1UGMA 1DOIA 4TKNA 2WXHA 2IYDB 3BVZA 4MH8A 3D32A 3KYCD 4LCDE 3UGBB 2NCNA 1GB1A 2Z59B 3E56A 2BYEA 2Q5WD 1RFKA 4K81A 3P63A 2ONQA 1SF0A 2W3SA 2RSUA 2CHZA 3N32A 4MM3A 3CIRB 2LGXA 2BKFA 2MJ3A 5IO9A 2M17A 1JROA 2KX0A 2PJHA 3DVNV 1UH6A 1X1MA 3A9JB 4GN1A 4HEA1 4WWNA 4LDTB 2V0GA 2G45B 1TKEA 3UF8A 2JWUA 4GSWA 2M8SA 1V86A 4MELA 2C9WB 5MPOA 1L5PA 4OW0A 1XEEA 2CU1A 3TEWA 2Z0DB 4TQ0A 4FN2A 1C77A 1C78A 5CHFA 2DZMA 2MBHA 2KDIA 2W9NA 1C79A 3U7ZA 4OVZA 4KZCA 4K7SA 2I1JA 3HVZA 2MBBB 2K9XA 5CHVC 2JZ3B 4ZYSA 3ZRCA 3AEGB 4ZRKA 4MSQB 4DWFA 4LJOB 2D3CA 1WXQA 1CJEA 1YN5A 3UQAA 2V3PA 3L16A 2NPTA 4FHJA 2LUMA 2LGSA 3APCA 4RCOA 1V97A 3H7SA 1E8ZA 3MHSD 2MBQA 1WFYA 2Z0EB 3AM9A 3ZJUA 3R8BA 5EE1A 1P9DU 1KLUD 4L2YA 4XDCA 3MJWA 1GPXA 2PVGC 4RMAA 5G55A 2FUG1 1LO5D 4P7IA 2PMVA 2RD0A 1XF5L 4NPNA 2LGIA 3KUZA 1UUPA 3PV1A 2D3AA 3MC0B 4AS1A 3BK1A 1YN3A 2NTSA 1UZXB 2LHEA 3V6CB 3VXWA 2WX0A 1XLQA 1WJNA 2KAJA 3TCAA 1E7UA 4HPPA 1RYJA 4HPMB 2FBWB 1LM8B 2WXLA 3FC4A 4RGOS 3R7QA 2KMMA 1YMHE 1K8RB 1KFYB 3PVLA 3N3KB 5CTRC 3W2DA 4MGKE 1ZGUB 2KJ6A 3L08A 3ECIA 4WJPA 2J53A 3IXSA 3CMMB 4FULA 3DBRI 3KYDD 1JRUA 1VD2A 3ZW3A 2C7MB 3KQ4A 2NMQA 1WH3A 1WYWB 3U7DA 2JQRB 2PTLA 1HZ5A 3P1MA 3APFA 1BXTA 1J7CA 1WM3A 1F2RI 2M0AA 2KJRA 2W54A 1N63A 1A5RA 4HKQA 2MSED 1YJ1A 3WA0A 3TEZA 4NJ7A 4NAWA 3RNEC 1RAXA 1T0SC 1TYGB 4IM3A 1AARA 3OAWA 1H8CA 2Z8LA 1YN4A 2H89B 2V3SA 3Q3OC 3CF6E 1D6EC 3PO0A 1FIQA 4KV2A 3W1YA 4LNKA 4WJOA 3DBLB 1T0RC 2WX1A 2CU3A 1V1PA 1MJDA 2K25A 2MCNB 4HJKA 1QKZA 1VZ8A 2DBYA 4EEWA 5BYQA 1FEHA 2FCMA 2HE7A 1WM2A 2SAKA 1V6EA 1AYFA 5G5HA 3VDZA 2BWFA 3ZUNA 4LLGM 2D11A 4FJYA 3ZNID 4PYZA 1RWSA 1YX5B 2AEHA 3PZDA 1CK1A 3M3JA 4ANWA 3P2BA 1VZ6A 1STEA 4KDLB 3NVZA 2PE6B 4DHZB 2CJOA 3MJ5A 2AQ3B 3FKYA 3HUIA 1SB3C 2CS4A 2LD9A 5EE0A 4HKZE 2L05A 3DBLI 1M94A 3NZSA 1KF6B 1FCCC 1YJJA 3A4SC 2K22A 4X57B 4GDLA 4LJPB 1FXTB 4TQ1A 2LRUA 4OVUA 2J42A 2ZPNA 2MRPA 2O2VA 3C8YA 3QAQA 3WALA 1VDVA 3VTUA 3EFCA 3VR9B 1K53A 3OG5A 2BS2B 4RM9A 1DYQA 1WGRA 1R7SA 2AYOB 1T0YA 1WSPA 1V81A 2BS4B 1TY2A 4RNAA 1WR1A 1SE9A 2IO0B 2LMCA 1PFDA 3TMPB 4XYCA 5T8IA 2QHOA 3ZYYX 1OEYA 1H4RA 1KM7A 1N61A 2WQYB 3RT3B 2BT6A 3H6NA 3PLVA 4N59A 2KACA 2RGFA 1ZDVA 3V60A 2INNE 2GBKA 1R4MB 2KXJA 4JQWC 4HXDA 1TZ1A 1PGBA 2DZJA 2HDEA 3AE1B 4XWTA 1L4ZB 2LUEA 3Q69A 2IJ0A 4PT5A 1C76A 4MT5A 4YSYB 2EKEC 4JX1C 4II2B 2LVPA 1OFFA 3HIZA 1T3QA 1I4XA 1VRAB 4URKA 2YEPB 1GC6A 2WXQA 2GOWA 3P42A 1QOAA 3T9LA 2K8CA 2WXPA 4RM8A 4ICVA 4CQNA 2KVRA 1JALA 2L3ZA 2KDFB 3DWMA 4A20A 4JLCA 2L1AA 2SEBD 2KT7A 2ZVOA 4W9IA 3PSEB 5CHWA 2J0JA 2BB5A 5HHDG 5FR6A 3OWEB 4WAFA 1I4HA 3EFUA 2PKOA 3RNCC 5JHBA 3JYUA 4J3OD 1WXAA 2HTME 1SXTA 5DPWA 1WX9A 3DHGC 4HJGE 2FAZA 2BF8B 2V4LA 5GXGB 1FXAA 3MTNB 5D3IB 1TT5B 2HTHA 3VRAB 4IOIE 2M0XA 2FIFA 2E3TA 1R4NI 1TJEA 2NBWB 4BVUC 2AL6A 1YOVB 2WXFA 3A9KA 4P1CC 2JUOA 3CWIA 4GGQA 1SBBB 3QX1A 1ZXHA 4N9F4 4DXGA 3IHPC 3BWUD 3BYTB 3RFZB 3VQIA 1WGYA 3EUB2 2KC2A 1E90A 2KZRA 1NDDA 5TSSA 2WXGA 5L83A 4M00A 2C60A 3W9CB 3MP9A 4GLSC 1EF5A 4BBNF 2N7JA 3TL5A 4DHZE 1C9FA 3DPDA 2QIEB 2MP2A 3ZLZA 1J0GA 3VUYA 1KRHA 3GE8C 1S1QB 2CKHB 2LJIA 4XWWA 1ACCA 2KN4A 4E3CA 1EWCA 3HM3A 2G4SA 4MGYE 2AX5A 2C5LC 3AE8B 4NQKE 1NBFC 3AXCA 2J4XA 3GZNI 2DAFA 1MHXA 2V1YA 5J2RA 5DPTA 4ACFA 1LQBA 4IM0A 3I5JC 3RD2A 4JPSA 5E6NA 3ZJTA 2WU5B 2PVOD 1SGHA 2QC8A 1E7PB 4KKJA 3WCQA 4BKSD 3ML8A 1D5ZC 4YL8A 3AECB 3LDZE 3JVZX 3PS6A 3LJ3A 4ZOHC 1YQ3B 4O1NA 1QF6A 3RUIB 1I35A 2WXIA 3SEBA 5L95C 1P7FA 2PLPA 3VR8B 2A5UA 1E5WA 3SHQA 1VZ7A 3QARA 4ZHPA 1Z5SB 1NYRA 5DCNA 1FRDA 1N6ZA 2EMTA 3Q8CA 1WR6E 3AEDB 1ZDXA 3ABVB 1KLVA 3PRMB 2KJHB 3Q8EA 3N1XC 1IUEA 1K52A 3ZGZA 4ASWC 4TMAB 5AZHA 2QMTA 4I6PA 2C7HA 3B08A 2WDVB 4WWMA 4ZRQA 2KWUB 2H88B 2IO3B 1C4CA 2FCNA 2MJDA 3AEAB 4ZRJA 1WX7A 1FXIA 3VTVA 3DOWA 2DYMA 1DOXA 1YD8U 2LXCA 3AU5A 4W9JA 4RH6A 2RDBC 1VJKA 2JZZA 2X38A 2GMIC 4K3CA 3JSVA 1HQRD 1Q0WB 3B2GA 4IKGA 3SU8X 1B9RA 4HCPB 4HDQA 1LXDA 4RGTA 4AOFA 4FXCA 1M4VA 1WE6A 1ZPSA 3KW5B 1E9MA 3UIPB 2M4NA 1KTKA 3AV8A 2JXTA 4M8MA 2OJWA 2KN5A 2ZPYA 2JXXA 2J52A 2JYTA 2MX2A 2WXKA 1F0ZA 3NRZA 2W55A 2K8HA 3UIOB 3Q8BA 3Q3MC 3R66C 4FADA 4IG7B 1WIAA 3APDA 3NHEB 3L10B 4N6EB 3NS1A 2YLMA 3AI5A 2DENB 1XT9B 4MH0E 2MQJA 3R7RA 1I4QA 3SFDB 5LNK1 4WWOA 3JW0X 2ZVNA 4JIOU 1WE7A 1B1ZA 3I63C 5D3DA 3TSSA 1GOZA 3QJZA 2MA9B 1BUIC 5J17A 3N30A 5BMIA 4NY0A 3PPAA 2N9KA 2IBIB 3ONSA 2INPE 3U8ZA 3MFGA 5BMHA 4W9CA 1ZP0B 3P4RB 3TEYA 3ZRFA 4HROA 3BINA 4XDDA 3AN1A 2KFKA 3FILB 3Q8FA 3P4SB 5EDSA 2BW2A 3IAM1 2K1FA 4K7WA 1R4MI 2IZVB 1RM6C 1V5OA 4D2KA 3U52E 3SD5A 4A3PA 3Q3JA 1WJ6A 4EZLA 4FBJB 3Q3FA 2MBEA 4GU2A 1L7YA 2VRRB 1E7VA 1WF9A 4HDOA 2BWES 4EOYA 3DWGC 1GUAB 1TS4A 1UGJA 2KKCA 2W3RA 1ET9A 1UBQA 1EO6A 3NVVA 4M0WB 4ANUA 1SIFA 3W1SC 2WP9B 1SEBD 4MJSA 2EELA 4A8XC 1L0YB 2ICIA 1YJIA 2JZPA 2KQ4X 2BGFA 4WWPA 3Q2AC 3ZIMA 1EWYC 4JL9A 4US9A 1PYWD 2PPHA 3A1QA 3K9PB 1WWTA 2IO1B 1ZOYB 2O6VD 4RGNA 4ZRPA 5EE9A 4BFRA 4AUQC 3EA6A 3EECA 1LFDA 4ICUA 2KLGA 3X23A 2ZJDA 5HG2A 1MPEA 1HA5A 2R61A 1V5TA 2IGHA 2XK5B 1MI0A 2FCSA 2RR9A 2Y5BB 4HPLB 2WYQA 2LXAA 2KMCA 5AUIA 2BQQA 2MEKA 4WURA 1P98A 4TUUA 3GP7A 4PK1A 2BPSA 4JWUC 4HWIB 3U30A 2MW5A 1FFUA 4AJWA 2BKRB 1E8YA 5DPSA 1J8CA 3RPFC 4KIKB 4CYEA 1UWMA 1T5XD 4US8A 3AE5B 3ZQ4A 1VR9A 1FCLA 2GBRA 1QZEA 1PDXA 2KNBA 2DLBA 3PZ7A 3RNFC 2MH7A 3DBHB 2ACZB 3HRDD 4MSMB 1TBEA 1TS5A 1NEKB 4G11A 3Q6BA 4B0EA 4P1BC 3AE9B 2ZCCA 1XO3A 2WU2B 4C56C 1NYQA 1XLNA 3L54A 4A3OA 3QA8A 1NVID 1YNTE 4ZDVA 1BMLC 2BYTA 5IA7A 1L0VB 5BYRA 5D6JB 4B0MA 3N1YC 3RN9C 4XGAB 2JRIB 4WJQA 2NBUA 2R2OA 3MC8A 1YIWA 5H92C 4MGIE 2ASQA 3DBRB 4E74A 4YXDB 1XXGA 2KDBA 4Q2JA 2LFIA 4KGSA 4WQOB 3FILA 2VZKB 2KDMA 3DHIC 2K3UA 1LGRA 1F77A 2L52A 2ZNVC 4A9AA 2BYFA 3NY5A 5G2NA 1SE3A 2YEPF 2WDRB 4WQMA 3M62B 3QC8B 2MP2B 3BVMA 4HVBA 2UWQA 2WS3B 4LDTD 3B0AA 5E6OA 3B2FA 1N60A 4GDKB 3T3NA 1QILA 1V1OA 4S0RA 2AQ2B 3I57A 1WI0A 5JHAA 4C00A 4MEMA 1JWAD 3ETRA 3L13A 2JSVX 4JE3B 2KANA 1UELA 3I9V1 5HKHA 1FM0D 3W5VB 3DVGX 1IGCA 3DVGY 3RMKC 2QCZA 1E6EB 1HEZE 2OHFA 2L00B 4XC2A 3PLUA 2QSDA 4J6IA 3NOBA 1WMHB 3ZKJC 1WGDA 2J0KA 4L23A 2WXOA 3QK0A 4BKGA 5BO4B 1I42A 3KUCB 1F2RC 1GNUA 2NPTB 2O6VA 2LI5A 2L0TA 3NUHB 5DPRA 1WGGA 2TSSA 4DDID 3A9KB 5FKAC 3IAS1 1NI2A 3NVWA 2KTRA 3QIJA 1K51A 2LVOA 1JRPA 4BZAA 1Z2MA 1WYGA 4MJSB 2WGSA 4PS3A 5IP4D 3BYYB 4B95A 1I4GA 4USAA 4P16A 2KTFA 4M01A 1F1HA 1SJED 2G3QB 4TSSA 1TIFA 4ZHOA 4GB9A 4ZRIA 4KZ0A 2OEDA 1KJTA 5IAAC 4C80A 4ARIA 3UINB 4G0NB 1T0QC 4II3B 2VH1A 3QHTA 4EE2A 3UI3A 3PHWB 3L4PA 2DWQA 2E6XA 4LTUA 3V6EB 4ARCA 2LVQA 2RPVA 3NJTA 1AWDA 1FMAD 1JW9D 3P4QB 4YSXB 3C19A 2L32A 3ZDMC 2MBOA 1TKYA 1XD3B 1BT0A 1KH0A 2X8XX 2KO3A 3DDCB 4GDKA 4A6QA 2KWVB 2PIAA 3EGRA 3WAMA 1G6JA 2I38A 5D7GA 1DOYA 1UF0A 3SR6A 1WJ4A 1ET6A 4IWPA 4BKTA 3LB8C 2UYZB 1QLBB 2ON8A 3BY4B 2RMMA 4EKUA 3PTFC 5LLIA 2NS5A 2HJ1A 2N7DA 1Q5WB 3VHTC 1P3QU 2WDTB 1WX8A 4DXFA 2W82A 1P0RA 3RCZA 2ZW0A 1XCTL 3Q14C 4NQLB 5H8YE 4ZYNA 2LHDA 4OZBA 3NG0A 2N7EA 5G5GA 4NAMA 3M95A 2JPHA 2HD5B 1T6BX 1Y8RC 3ENEA 2V9HA 1N5XA 4XE0A 3AEFB 1XLPA 1RFAA 2GI9A 1EU3A 4HCNB 5C23A 2R2QA 4ANVA 1FNUA 1WMHA 2CR5A 4M02A 1ZUD2 4KDIC 3A4RA 3TIXA 2K0PA 3L17A 3WIMA 2JX5A 3KVFB 3VRBB 3PREA 1UNSA 4AWJA 1E10A 2WXJA 1WGKA 2I2YA 2KVZA 4CHKA 1R4NB 3RZFA 4H2AA 2L7RA 1I7HA 4L1BA 3SFEB 1GB4A 3ZVVA 4YTMB 3GE3C 2N4FA 3RI7C 2IGGA 3AE4B 1IBXA 2KHWB 1QT9A 2IDYA 1TGZB 1WZ0A 2JRHA 5LXIB 3JSVB 3NS8A 2ZZPB 2K8BA 3E9SA 2GLSA 1EUVB 1CZPA 4W9GA 4C7YA 3S2AA 1N5WA 2V4IB 3V62A 5IOIA 3V61A 3ZXRA 4BOSC 2YVCA 2N9LA 2PEAA 1U4AA 1OQYA 2LZ6A 3HM6X 2N1WA 1SJHD 3Q8AA 1HE8A 2DHZA 2ZEQA 3BIID 1WY8A 1WZ3A 2ZCBA 3OJ3A 3VH3B 1QOFA 1J7AA 3ZNGC 4R3DA 2KDEB 3H7PB 2AL3A 3NZUA 2Y3AA 3RNAC 2KD0A 1QQRA 3AE3B 4OHJA 3X0WA 5AEKB 2XBBC 1ZE3D 1EF1A 1XLOA 2MJEA 3N1ZC 4G50A 2RDHA 2A4ZA 2NTTA 4DHJB 1JMLA 1MG4A 1IYFA 1S3SG 1YQ4B 4B6WA 4QAYA 4F8CB 4PS8A 5TR5A 3KLSX 4NZLB 4LNOA 1ZXIA 1SE4A 4DK5A 3NZ3A 2IY0B 5IN7A 4MACA 4HLEA 2KFJA 4F7ZA 2KX3A 3PHXB 1UD7A 4NAWB 2VH2A 3H9DA 1HZ6A 3EHVA 3TEXA 4JGHB 2FNJB 1PGXA 2JU6X 3ZDTA 4IWQA 3DVNU 3AEBB 3PRZA 4I6LB 3LYYA 1HXYD 2WDQB 4M8NA 3A33B 4IDIA 4KVGB 1ISNA 2INDC 4DHJD 1L4DB 1K50A 2DNFA 4C7ZA 2N9PC 4OZAA 2BVCA 5HI1A 1D3ZA 3DHHC 2C7NB 4S17A 4KSLC 1V49A 4RGMA 1MG8A 4ITKA 4RF0A 5EE3A 1VCBA 4XZ4A 5IKCM 3HHMA 2GBJA 4KSKC 4NJ6A 3AULA 1Q10A 4RF1A 4W9HA 3PT2B 4PS7A 1A70A 4EFOA 5BYSA 2EKIA 1SE2A 2KOXA 4LNNA 5JXVA 1TZOA 1TS3A 2LWPA 3M63B
chains in the Genus database with same CATH topology
4W9KA 4FLHA 4BOZB 2KFKB 4GGQA 4FHKA 1UGMA 2NVUI 4TKNA 3L54A 3QX1A 4E71A 2IYDB 4A3OA 4N9F4 3D32A 3KYCD 3QA8A 4LCDE 1WXSA 3UGBB 2NCNA 4ZDVA 2Z59B 5C1ZA 3IHPC 2KLCA 5IA7A 3CSFA 5D6JB 2BYEA 2GBNA 3VQIA 4AJYB 1WGYA 2JRIB 4WJQA 4K81A 2KC2A 2ZNVB 2NBUA 2R2OA 4DBGA 1E90A 2KZRA 1YIWA 2RSUA 2CHZA 3N32A 4HK2A 4MM3A 1NDDA 2LGXA 2ASQA 4MGIE 2BKFA 5L83A 2M17A 3DVNV 2KX0A 2PJHA 4E74A 1UH6A 1X1MA 2D3GA 2KDBA 4AP4C 2C60A 3A9JB 4GN1A 4WWNA 4LDTB 4WQOB 2G45B 3UF8A 5KHOA 1EF5A 4BBNF 4GSWA 3TL5A 4DHZE 2M8SA 2ZNVC 1V86A 3DPDA 4MELA 2C9WB 2BYFA 2MP2A 3ZLZA 3NY5A 1J0GA 3VUYA 5G2NA 2CU1A 3ZO5B 2Z0DB 1S1QB 2CKHB 4TQ0A 4FN2A 1GC7A 3DBHI 3M62B 3QC8B 2MP2B 4E3CA 4HVBA 3HM3A 2G4SA 4DDGD 2KC1A 2UWQA 5CX3A 4MGYE 5CHFA 4LDTD 2DZMA 2MBHA 3B0AA 2C5LC 5E6OA 2KDIA 4GDKB 3VUWA 1GG3A 2W9NA 4BKSA 4NQKE 1NBFC 4KZCA 3AXCA 4K7SA 2I1JA 3GZNI 5JH5C 2DAFA 2MBBB 3H1UA 2V1YA 1KOTA 2PE9A 5CHVC 5J2RA 2KWCA 5DPTA 1WI0A 2JZ3B 5JHAA 3SDLC 2AWTA 4MEMA 1LQBA 2FIDA 3DCGA 3L13A 4IM0A 2KANA 1UELA 3ZRCA 3HK0A 3RD2A 4ZRKA 5E6NA 2N9EB 4MSQB 3GOEA 5HKHA 4DWFA 4LJOB 3DVGX 1SGHA 3DVGY 4B9KA 4BKSD 3ML8A 2LGYA 2MLBA 4YL8A 3UQAA 2L00B 4XC2A 1XQQA 3PLUA 3L16A 2NPTA 3LDZE 4FHJA 3NOBA 3JVZX 1WMHB 2KK8A 2LRWA 3LJ3A 3PS6A 4J6IA 1WGDA 2J0KA 3ZKJC 3IFWB 3QK0A 4MGZE 4BKGA 3APCA 3ALBA 2RPQA 2JT4B 1E8ZA 3H7SA 3KUCB 2D10A 3MHSD 5BO4B 3RUIB 1I42A 1GNUA 1I35A 2MBQA 2NPTB 2O6VA 1WFYA 2LI5A 2L0TA 2Z0EB 5DPRA 4EZKA 3WAOA 5L95C 1P1AA 1WGGA 1P9DU 3VUXA 2OOBB 4DDID 3A9KB 4K1RB 2A5UA 1E5WA 1WXMA 2N1VA 3MJWA 3SHQA 1NI2A 1UBIA 3QARA 1Z5SB 5DCNA 4RMAA 5G55A 4IC7B 2EMTA 2KTRA 4P7IA 1WR6E 3QIJA 2RD0A 4NPNA 2LVOA 3H7PA 1V80A 1Z2MA 3KUZA 1KLVA 3PRMB 2KJHB 4MJSB 4K7UA 4PS3A 2D07B 4B95A 3PV1A 4ASWC 2KTFA 4KIKA 5AZHA 2G3QB 1UZXB 2LJ5A 4I6PA 2C7HA 3V6CB 3B08A 3VXWA 2WX0A 1WJNA 4I6NB 4GB9A 4GMVA 4ZRIA 3TCAA 1F9JA 1E7UA 2CHXA 2KWUB 4KZ0A 4HPMB 1LM8B 5IAAC 1KJTA 2IO3B 2KMAA 2FCNA 2K6DB 4ZRJA 3O65B 4G0NB 2LGDA 1WX7A 3UINB 3R7QA 4ANXA 1K8RB 3VTVA 2KTRB 2DYMA 3DOWA 3PVLA 1YD8U 2B3AA 3QHTA 4II3B 3N3KB 5CTRC 2LXCA 3AU5A 3PHWB 3QCAA 4MGKE 1ZGUB 2JVCA 2KJ6A 3VH4B 3V6EB 3L08A 3ECIA 2LVQA 4WJPA 4W9JA 5D94A 3CMMB 4FULA 3DBRI 3KYDD 1JRUA 4GDLB 1VD2A 3ZW3A 2REXA 2KQ7A 3WAPA 2JZZA 2HJ8A 2C7MB 2L8JA 4GXBA 3ZDMC 2MBOA 2GMIC 1WH3A 2D2QA 3DQVA 3JSVA 1XD3B 1Q0WB 1TTNA 1WYWB 1BT0A 4W9EA 3U7DA 3SU8X 2IY1B 3APFA 2KO3A 2XK5A 3DDCB 4GDKA 4HCPB 2KWVB 1PQSA 1LXDA 4HDQA 3WAMA 1WM3A 1G6JA 2O2VB 5D7GA 2KJRA 4AOFA 1A5RA 4PYUA 3VTWA 1WJ4A 1WE6A 2MSED 4IWPA 4BKTA 1YJ1A 3WA0A 3I3TB 2UYZB 4NJ7A 5E6PA 3BY4B 3OJ4B 3KW5B 1RAXA 3CSTA 2M4NA 4IM3A 4NAWA 3UIPB 3WANA 1AARA 1GJZA 3PRPB 3OAWA 4M8MA 4EKUA 2KN5A 1H8CA 3PTFC 2ZPYA 2JXXA 2MX2A 5LLIA 2NS5A 2V3SA 3L0WB 2N7DA 1Q5WB 3CF6E 4GIVA 2K6QA 1P3QU 4GOCA 3VHTC 1Q1OA 2NBVB 4KV2A 2WDTB 1WX8A 3W1YA 2K8HA 3UIOB 4WJOA 3UQBA 1OTRB 2WX1A 3R66C 3RULA 4FADA 1RRBA 1P0RA 3AU4A 3RCZA 4IG7B 4NNJB 4OVVA 4NQLB 3ZTCA 1WIAA 4ZYNA 2K25A 3APDA 2MCNB 4F1SA 3NHEB 3L10B 1WXVA 2N7EA 4HJKA 2YLMA 3AI5A 4EEWA 2DENB 3T8MA 1XT9B 4MH0E 2MQJA 3R7RA 2FCMA 3M95A 5D2MB 1YX6B 2JPHA 4IM2A 2HE7A 1WM2A 2FCQA 4WWOA 2HD5B 3JW0X 1Y8RC 3ENEA 2ZVNA 1V6EA 3VDZA 2BWFA 3ZUNA 4JIOU 2D11A 1WE7A 4FJYA 3ZNID 3R3MA 4PYZA 1E8WA 1YX5B 1RFAA 2I1KA 3ZTDA 4HCNB 5C23A 2R2QA 3QJZA 2AEHA 2MA9B 3PZDA 4ANVA 1WMHA 2NR2A 2CR5A 2LASA 3M3JA 3N30A 3P2BA 4NY0A 4ANWA 2FUHB 5J17A 3PPAA 2IBIB 4KDLB 2G4DB 4KDIC 2PE6B 2KQSA 3A4RA 3K9OB 4DHZB 3ONSA 3TIXA 3U8ZA 3L17A 3WIMA 1OEYJ 3KVFB 2EMSA 2DZIA 3PREA 2L76A 1IP9A 4AWJA 4W9CA 3QWZB 4CHKA 2CS4A 2LD9A 3RZFA 2L7RA 3ZRFA 2L05A 3BINA 1L2NA 3DBLI 1CMXB 1M94A 3NZSA 3ZVVA 2N4FA 2K39A 2KFKA 2KHWB 1WGHA 3A4SC 4X57B 1TGZB 2N9XA 3VFKA 1WZ0A 2JRHA 5LXIB 1C1YB 5EDSA 3IBEA 4GDLA 4LJPB 3VVWB 3JSVB 2K1FA 1FXTB 4TQ1A 4K7WA 3NS8A 2WWZA 2LRUA 4OVUA 2ZZPB 1R4MI 2IZVB 3W1SA 3KH0A 2K8BA 1V5OA 2ZPNA 3SD5A 4A3PA 3Q3JA 1WJ6A 2MRPA 4IUMB 2O2VA 3QAQA 1EUVB 4W9GA 3WALA 4FBJB 4EZLA 3VTUA 2J7QB 3Q3FA 3S2AA 3B1LX 2CHWA 2MBEA 4W9FA 3DBSA 4GU2A 1L7YA 2VRRB 3V62A 4DXAB 4RM9A 1E7VA 1WF9A 4G3XB 3V61A 1WGRA 3VAWA 4HDOA 4BOSC 2AYOB 1T0YA 2BWES 4EOYA 2YVCA 1V81A 2PEAA 1U4AA 2OJRA 4EZJA 2DX5B 2IO2B 4BBNC 2JWZA 4FA6A 1OQYA 1GUAB 2LZ6A 1WR1A 2KKCA 3HM6X 2N1WA 1SE9A 1UBQA 2IO0B 1EO6A 1HE8A 2DHZA 2ZEQA 2L0FA 4M0WB 1WY8A 1WZ3A 2ZCBA 4ANUA 1SIFA 3OJ3A 3VH3B 3W1SC 3TMPB 2J0MA 1WJUA 4MJSA 3ZNGC 3ZNZB 2QHOA 1YQBA 2KDEB 3H7PB 3IVFA 2AL3A 1OEYA 1H4RA 3NZUA 1KM7A 2DAJA 1WRDB 3RT3B 2KD0A 3H6NA 3PLVA 4XX5A 2RGFA 3OLMD 2BGFA 4WWPA 3X0WA 2XBBC 5AEKB 2MWSB 3V60A 3ZIMA 4JL9A 1EF1A 2PPHA 3A1QA 2GBKA 3K9PB 4G50A 4FJVB 2A4ZA 2KXJA 4DHJB 4WAAA 2IO1B 4JQWC 1IYFA 4HXDA 1S3SG 2O6VD 1TZ1A 2JY6A 2DZJA 2DZKA 4B6WA 4BFRA 4F8CB 1C3TA 4PS8A 5TR5A 4AUQC 2LUEA 3EECA 1LFDA 2XEWA 4ICUA 2KLGA 3X23A 2EKEC 2ZJDA 4DK5A 4II2B 2IY0B 5LXHA 2LVPA 1V5TA 3IG3A 3ML9A 3TJPA 3HIZA 5AZFA 2XK5B 4HLEA 2FCSA 4URKA 2JF5A 2KFJA 2RR9A 2Y5BB 3RZWC 2KX3A 4HPLB 3ZNHB 3PHXB 2GBMA 2WYQA 4F7ZA 2O6VB 1GC6A 1UD7A 2LXAA 2KMCA 2GOWA 4IWOA 4NAWB 3T9LA 2K8CA 3H9DA 1IPGA 3EHVA 4RM8A 4ICVA 4JGHB 3C0RB 2KVRA 1ZKHA 2FNJB 1P98A 4TUUA 3ZDTA 4IWQA 3DVNU 4W9DA 4IW0A 5GMVA 2BPSA 2L3ZA 2KDFB 3PRZA 4I6LB 2BYVE 4HWIB 4W9LA 3U30A 3QQ8B 4JLCA 4A20A 2MW5A 4M8NA 3A33B 4KVGB 1ISNA 2ZVOA 4W9IA 3PSEB 5CHWA 3TBLD 2J0JA 4AJWA 4DHJD 4WJNA 5FR6A 2BKRB 1E8YA 1E8XA 3EFUA 5DPSA 1J8CA 4KIKB 3A1QB 1V2YA 3JYUA 5JHBA 1WXAA 4CYEA 5DPWA 5JZEB 4CO7A 2N9PC 1RLFA 1WX9A 3A9JA 2DYOA 5J18A 3PGEA 1D3ZA 2C7NB 2GBRA 4KSLC 1V49A 2M1MA 1QZEA 2KNBA 2FAZA 1MG8A 2BF8B 4TV3A 4EUTA 1VCBA 2V4LA 5KHQA 3KUDB 4XZ4A 3HHMA 1OGWA 2GBJA 4KSKC 1J19A 3MTNB 4NJ6A 2HTHA 3AULA 4FJZA 4MDKE 4MSMB 1TBEA 4G11A 4W9HA 3PT2B 2M0XA 4PS7A 3RYTA 4EFOA 2FIFA 1ZW7A 2KOXA 1R4NI 2LWPA 2NBWB 3M63B 1V9JA 4BVUC 2ZCCA 2AL6A 2DYBA 3EC8A 3A9KA 2JUOA 5AZGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4W9K A;  4FLH A;  4BOZ B;  2KFK B;  4GGQ A;  4FHK A;  1UGM A;  2NVU I;  4TKN A;  3L54 A;  3QX1 A;  4E71 A;  2IYD B;  4A3O A;  4N9F 4;  3D32 A;  3KYC D;  3QA8 A;  4LCD E;  1WXS A;  3UGB B;  2NCN A;  4ZDV A;  2Z59 B;  5C1Z A;  3IHP C;  2KLC A;  5IA7 A;  3CSF A;  5D6J B;  2BYE A;  2GBN A;  3VQI A;  4AJY B;  1WGY A;  2JRI B;  4WJQ A;  4K81 A;  2KC2 A;  2ZNV B;  2NBU A;  2R2O A;  4DBG A;  1E90 A;  2KZR A;  1YIW A;  2RSU A;  2CHZ A;  3N32 A;  4HK2 A;  4MM3 A;  1NDD A;  2LGX A;  2ASQ A;  4MGI E;  2BKF A;  5L83 A;  2M17 A;  3DVN V;  2KX0 A;  2PJH A;  4E74 A;  1UH6 A;  1X1M A;  2D3G A;  2KDB A;  4AP4 C;  2C60 A;  3A9J B;  4GN1 A;  4WWN A;  4LDT B;  4WQO B;  2G45 B;  3UF8 A;  5KHO A;  1EF5 A;  4BBN F;  4GSW A;  3TL5 A;  4DHZ E;  2M8S A;  2ZNV C;  1V86 A;  3DPD A;  4MEL A;  2C9W B;  2BYF A;  2MP2 A;  3ZLZ A;  3NY5 A;  1J0G A;  3VUY A;  5G2N A;  2CU1 A;  3ZO5 B;  2Z0D B;  1S1Q B;  2CKH B;  4TQ0 A;  4FN2 A;  1GC7 A;  3DBH I;  3M62 B;  3QC8 B;  2MP2 B;  4E3C A;  4HVB A;  3HM3 A;  2G4S A;  4DDG D;  2KC1 A;  2UWQ A;  5CX3 A;  4MGY E;  5CHF A;  4LDT D;  2DZM A;  2MBH A;  3B0A A;  2C5L C;  5E6O A;  2KDI A;  4GDK B;  3VUW A;  1GG3 A;  2W9N A;  4BKS A;  4NQK E;  1NBF C;  4KZC A;  3AXC A;  4K7S A;  2I1J A;  3GZN I;  5JH5 C;  2DAF A;  2MBB B;  3H1U A;  2V1Y A;  1KOT A;  2PE9 A;  5CHV C;  5J2R A;  2KWC A;  5DPT A;  1WI0 A;  2JZ3 B;  5JHA A;  3SDL C;  2AWT A;  4MEM A;  1LQB A;  2FID A;  3DCG A;  3L13 A;  4IM0 A;  2KAN A;  1UEL A;  3ZRC A;  3HK0 A;  3RD2 A;  4ZRK A;  5E6N A;  2N9E B;  4MSQ B;  3GOE A;  5HKH A;  4DWF A;  4LJO B;  3DVG X;  1SGH A;  3DVG Y;  4B9K A;  4BKS D;  3ML8 A;  2LGY A;  2MLB A;  4YL8 A;  3UQA A;  2L00 B;  4XC2 A;  1XQQ A;  3PLU A;  3L16 A;  2NPT A;  3LDZ E;  4FHJ A;  3NOB A;  3JVZ X;  1WMH B;  2KK8 A;  2LRW A;  3LJ3 A;  3PS6 A;  4J6I A;  1WGD A;  2J0K A;  3ZKJ C;  3IFW B;  3QK0 A;  4MGZ E;  4BKG A;  3APC A;  3ALB A;  2RPQ A;  2JT4 B;  1E8Z A;  3H7S A;  3KUC B;  2D10 A;  3MHS D;  5BO4 B;  3RUI B;  1I42 A;  1GNU A;  1I35 A;  2MBQ A;  2NPT B;  2O6V A;  1WFY A;  2LI5 A;  2L0T A;  2Z0E B;  5DPR A;  4EZK A;  3WAO A;  5L95 C;  1P1A A;  1WGG A;  1P9D U;  3VUX A;  2OOB B;  4DDI D;  3A9K B;  4K1R B;  2A5U A;  1E5W A;  1WXM A;  2N1V A;  3MJW A;  3SHQ A;  1NI2 A;  1UBI A;  3QAR A;  1Z5S B;  5DCN A;  4RMA A;  5G55 A;  4IC7 B;  2EMT A;  2KTR A;  4P7I A;  1WR6 E;  3QIJ A;  2RD0 A;  4NPN A;  2LVO A;  3H7P A;  1V80 A;  1Z2M A;  3KUZ A;  1KLV A;  3PRM B;  2KJH B;  4MJS B;  4K7U A;  4PS3 A;  2D07 B;  4B95 A;  3PV1 A;  4ASW C;  2KTF A;  4KIK A;  5AZH A;  2G3Q B;  1UZX B;  2LJ5 A;  4I6P A;  2C7H A;  3V6C B;  3B08 A;  3VXW A;  2WX0 A;  1WJN A;  4I6N B;  4GB9 A;  4GMV A;  4ZRI A;  3TCA A;  1F9J A;  1E7U A;  2CHX A;  2KWU B;  4KZ0 A;  4HPM B;  1LM8 B;  5IAA C;  1KJT A;  2IO3 B;  2KMA A;  2FCN A;  2K6D B;  4ZRJ A;  3O65 B;  4G0N B;  2LGD A;  1WX7 A;  3UIN B;  3R7Q A;  4ANX A;  1K8R B;  3VTV A;  2KTR B;  2DYM A;  3DOW A;  3PVL A;  1YD8 U;  2B3A A;  3QHT A;  4II3 B;  3N3K B;  5CTR C;  2LXC A;  3AU5 A;  3PHW B;  3QCA A;  4MGK E;  1ZGU B;  2JVC A;  2KJ6 A;  3VH4 B;  3V6E B;  3L08 A;  3ECI A;  2LVQ A;  4WJP A;  4W9J A;  5D94 A;  3CMM B;  4FUL A;  3DBR I;  3KYD D;  1JRU A;  4GDL B;  1VD2 A;  3ZW3 A;  2REX A;  2KQ7 A;  3WAP A;  2JZZ A;  2HJ8 A;  2C7M B;  2L8J A;  4GXB A;  3ZDM C;  2MBO A;  2GMI C;  1WH3 A;  2D2Q A;  3DQV A;  3JSV A;  1XD3 B;  1Q0W B;  1TTN A;  1WYW B;  1BT0 A;  4W9E A;  3U7D A;  3SU8 X;  2IY1 B;  3APF A;  2KO3 A;  2XK5 A;  3DDC B;  4GDK A;  4HCP B;  2KWV B;  1PQS A;  1LXD A;  4HDQ A;  3WAM A;  1WM3 A;  1G6J A;  2O2V B;  5D7G A;  2KJR A;  4AOF A;  1A5R A;  4PYU A;  3VTW A;  1WJ4 A;  1WE6 A;  2MSE D;  4IWP A;  4BKT A;  1YJ1 A;  3WA0 A;  3I3T B;  2UYZ B;  4NJ7 A;  5E6P A;  3BY4 B;  3OJ4 B;  3KW5 B;  1RAX A;  3CST A;  2M4N A;  4IM3 A;  4NAW A;  3UIP B;  3WAN A;  1AAR A;  1GJZ A;  3PRP B;  3OAW A;  4M8M A;  4EKU A;  2KN5 A;  1H8C A;  3PTF C;  2ZPY A;  2JXX A;  2MX2 A;  5LLI A;  2NS5 A;  2V3S A;  3L0W B;  2N7D A;  1Q5W B;  3CF6 E;  4GIV A;  2K6Q A;  1P3Q U;  4GOC A;  3VHT C;  1Q1O A;  2NBV B;  4KV2 A;  2WDT B;  1WX8 A;  3W1Y A;  2K8H A;  3UIO B;  4WJO A;  3UQB A;  1OTR B;  2WX1 A;  3R66 C;  3RUL A;  4FAD A;  1RRB A;  1P0R A;  3AU4 A;  3RCZ A;  4IG7 B;  4NNJ B;  4OVV A;  4NQL B;  3ZTC A;  1WIA A;  4ZYN A;  2K25 A;  3APD A;  2MCN B;  4F1S A;  3NHE B;  3L10 B;  1WXV A;  2N7E A;  4HJK A;  2YLM A;  3AI5 A;  4EEW A;  2DEN B;  3T8M A;  1XT9 B;  4MH0 E;  2MQJ A;  3R7R A;  2FCM A;  3M95 A;  5D2M B;  1YX6 B;  2JPH A;  4IM2 A;  2HE7 A;  1WM2 A;  2FCQ A;  4WWO A;  2HD5 B;  3JW0 X;  1Y8R C;  3ENE A;  2ZVN A;  1V6E A;  3VDZ A;  2BWF A;  3ZUN A;  4JIO U;  2D11 A;  1WE7 A;  4FJY A;  3ZNI D;  3R3M A;  4PYZ A;  1E8W A;  1YX5 B;  1RFA A;  2I1K A;  3ZTD A;  4HCN B;  5C23 A;  2R2Q A;  3QJZ A;  2AEH A;  2MA9 B;  3PZD A;  4ANV A;  1WMH A;  2NR2 A;  2CR5 A;  2LAS A;  3M3J A;  3N30 A;  3P2B A;  4NY0 A;  4ANW A;  2FUH B;  5J17 A;  3PPA A;  2IBI B;  4KDL B;  2G4D B;  4KDI C;  2PE6 B;  2KQS A;  3A4R A;  3K9O B;  4DHZ B;  3ONS A;  3TIX A;  3U8Z A;  3L17 A;  3WIM A;  1OEY J;  3KVF B;  2EMS A;  2DZI A;  3PRE A;  2L76 A;  1IP9 A;  4AWJ A;  4W9C A;  3QWZ B;  4CHK A;  2CS4 A;  2LD9 A;  3RZF A;  2L7R A;  3ZRF A;  2L05 A;  3BIN A;  1L2N A;  3DBL I;  1CMX B;  1M94 A;  3NZS A;  3ZVV A;  2N4F A;  2K39 A;  2KFK A;  2KHW B;  1WGH A;  3A4S C;  4X57 B;  1TGZ B;  2N9X A;  3VFK A;  1WZ0 A;  2JRH A;  5LXI B;  1C1Y B;  5EDS A;  3IBE A;  4GDL A;  4LJP B;  3VVW B;  3JSV B;  2K1F A;  1FXT B;  4TQ1 A;  4K7W A;  3NS8 A;  2WWZ A;  2LRU A;  4OVU A;  2ZZP B;  1R4M I;  2IZV B;  3W1S A;  3KH0 A;  2K8B A;  1V5O A;  2ZPN A;  3SD5 A;  4A3P A;  3Q3J A;  1WJ6 A;  2MRP A;  4IUM B;  2O2V A;  3QAQ A;  1EUV B;  4W9G A;  3WAL A;  4FBJ B;  4EZL A;  3VTU A;  2J7Q B;  3Q3F A;  3S2A A;  3B1L X;  2CHW A;  2MBE A;  4W9F A;  3DBS A;  4GU2 A;  1L7Y A;  2VRR B;  3V62 A;  4DXA B;  4RM9 A;  1E7V A;  1WF9 A;  4G3X B;  3V61 A;  1WGR A;  3VAW A;  4HDO A;  4BOS C;  2AYO B;  1T0Y A;  2BWE S;  4EOY A;  2YVC A;  1V81 A;  2PEA A;  1U4A A;  2OJR A;  4EZJ A;  2DX5 B;  2IO2 B;  4BBN C;  2JWZ A;  4FA6 A;  1OQY A;  1GUA B;  2LZ6 A;  1WR1 A;  2KKC A;  3HM6 X;  2N1W A;  1SE9 A;  1UBQ A;  2IO0 B;  1EO6 A;  1HE8 A;  2DHZ A;  2ZEQ A;  2L0F A;  4M0W B;  1WY8 A;  1WZ3 A;  2ZCB A;  4ANU A;  1SIF A;  3OJ3 A;  3VH3 B;  3W1S C;  3TMP B;  2J0M A;  1WJU A;  4MJS A;  3ZNG C;  3ZNZ B;  2QHO A;  1YQB A;  2KDE B;  3H7P B;  3IVF A;  2AL3 A;  1OEY A;  1H4R A;  3NZU A;  1KM7 A;  2DAJ A;  1WRD B;  3RT3 B;  2KD0 A;  3H6N A;  3PLV A;  4XX5 A;  2RGF A;  3OLM D;  2BGF A;  4WWP A;  3X0W A;  2XBB C;  5AEK B;  2MWS B;  3V60 A;  3ZIM A;  4JL9 A;  1EF1 A;  2PPH A;  3A1Q A;  2GBK A;  3K9P B;  4G50 A;  4FJV B;  2A4Z A;  2KXJ A;  4DHJ B;  4WAA A;  2IO1 B;  4JQW C;  1IYF A;  4HXD A;  1S3S G;  2O6V D;  1TZ1 A;  2JY6 A;  2DZJ A;  2DZK A;  4B6W A;  4BFR A;  4F8C B;  1C3T A;  4PS8 A;  5TR5 A;  4AUQ C;  2LUE A;  3EEC A;  1LFD A;  2XEW A;  4ICU A;  2KLG A;  3X23 A;  2EKE C;  2ZJD A;  4DK5 A;  4II2 B;  2IY0 B;  5LXH A;  2LVP A;  1V5T A;  3IG3 A;  3ML9 A;  3TJP A;  3HIZ A;  5AZF A;  2XK5 B;  4HLE A;  2FCS A;  4URK A;  2JF5 A;  2KFJ A;  2RR9 A;  2Y5B B;  3RZW C;  2KX3 A;  4HPL B;  3ZNH B;  3PHX B;  2GBM A;  2WYQ A;  4F7Z A;  2O6V B;  1GC6 A;  1UD7 A;  2LXA A;  2KMC A;  2GOW A;  4IWO A;  4NAW B;  3T9L A;  2K8C A;  3H9D A;  1IPG A;  3EHV A;  4RM8 A;  4ICV A;  4JGH B;  3C0R B;  2KVR A;  1ZKH A;  2FNJ B;  1P98 A;  4TUU A;  3ZDT A;  4IWQ A;  3DVN U;  4W9D A;  4IW0 A;  5GMV A;  2BPS A;  2L3Z A;  2KDF B;  3PRZ A;  4I6L B;  2BYV E;  4HWI B;  4W9L A;  3U30 A;  3QQ8 B;  4JLC A;  4A20 A;  2MW5 A;  4M8N A;  3A33 B;  4KVG B;  1ISN A;  2ZVO A;  4W9I A;  3PSE B;  5CHW A;  3TBL D;  2J0J A;  4AJW A;  4DHJ D;  4WJN A;  5FR6 A;  2BKR B;  1E8Y A;  1E8X A;  3EFU A;  5DPS A;  1J8C A;  4KIK B;  3A1Q B;  1V2Y A;  3JYU A;  5JHB A;  1WXA A;  4CYE A;  5DPW A;  5JZE B;  4CO7 A;  2N9P C;  1RLF A;  1WX9 A;  3A9J A;  2DYO A;  5J18 A;  3PGE A;  1D3Z A;  2C7N B;  2GBR A;  4KSL C;  1V49 A;  2M1M A;  1QZE A;  2KNB A;  2FAZ A;  1MG8 A;  2BF8 B;  4TV3 A;  4EUT A;  1VCB A;  2V4L A;  5KHQ A;  3KUD B;  4XZ4 A;  3HHM A;  1OGW A;  2GBJ A;  4KSK C;  1J19 A;  3MTN B;  4NJ6 A;  2HTH A;  3AUL A;  4FJZ A;  4MDK E;  4MSM B;  1TBE A;  4G11 A;  4W9H A;  3PT2 B;  2M0X A;  4PS7 A;  3RYT A;  4EFO A;  2FIF A;  1ZW7 A;  2KOX A;  1R4N I;  2LWP A;  2NBW B;  3M63 B;  1V9J A;  4BVU C;  2ZCC A;  2AL6 A;  2DYB A;  3EC8 A;  3A9K A;  2JUO A;  5AZG A; 
#chains in the Genus database with same CATH topology
 4FLH A;  2NVU I;  4E71 A;  3NVY A;  1WXS A;  5C1Z A;  2KLC A;  3CSF A;  2GBN A;  5FR3 A;  4AJY B;  2ZNV B;  2WNM A;  4DBG A;  1L0X B;  4HK2 A;  1JWB D;  4C4V B;  1KLG D;  4AQ7 A;  2D3G A;  4AP4 C;  3PZ8 A;  1FFV A;  5KHO A;  3GZN B;  2FE8 A;  1JWU D;  2KYW A;  2XNA C;  3N9Y C;  4LNF A;  2K5P A;  3J9C A;  2QDF A;  2BTE A;  3ZO5 B;  4N58 A;  2VZK D;  3BZD B;  1GC7 A;  3DBH I;  1EM7 A;  4LNI A;  4DDG D;  2Y5P A;  2KC1 A;  2N0S B;  5CX3 A;  2UU7 A;  2IPK D;  3VUW A;  1GG3 A;  4BKS A;  1DGJ A;  2GRI A;  1MHH E;  4KKI A;  5JH5 C;  1KOT A;  3H1U A;  3H8H A;  2D3B A;  2PE9 A;  2KWC A;  4JWS C;  3SDL C;  2AWT A;  3DCG A;  2FID A;  3HK0 A;  1JQ4 A;  1TS2 A;  1ESF A;  2N9E B;  3GOE A;  4B9K A;  2LGY A;  2MLB A;  1V8C A;  3TUO A;  1MVK A;  2M56 B;  1XQQ A;  2IGD A;  2KK8 A;  1D5M C;  2LRW A;  4YTN B;  3IFW B;  4MGZ E;  3ALB A;  2RPQ A;  2JT4 B;  2D10 A;  1HTQ A;  2G9H D;  4EZK A;  3WAO A;  1TY0 A;  1P1A A;  3VUX A;  1FD6 A;  2OOB B;  4K1R B;  2N1V A;  1WXM A;  1UBI A;  2V3N A;  4IC7 B;  3H7P A;  1V80 A;  4K7U A;  3U2S C;  2ZW1 A;  2D07 B;  4KIK A;  4REZ A;  4UDU C;  2LJ5 A;  4P6V F;  4I6N B;  1IGD A;  4GMV A;  3T3O A;  1F9J A;  2CHX A;  5I4D A;  2KMA A;  2K6D B;  3O65 B;  2LGD A;  2LEK A;  4ANX A;  1JCK B;  2Y5C A;  2KTR B;  1OQR A;  2B3A A;  3QCA A;  2JVC A;  3VH4 B;  5D94 A;  4WIP A;  4GDL B;  3URY A;  2REX A;  4KGR A;  2XN9 C;  1WRI A;  2KQ7 A;  3WAP A;  4YT0 B;  1XCQ L;  2L8J A;  2HJ8 A;  4GXB A;  1QOB A;  3AEE B;  3DQV A;  2D2Q A;  1VLB A;  1TTN A;  4C4V A;  4W9E A;  1CQV A;  2IY1 B;  3IT4 B;  2XK5 A;  2QJL A;  1PQS A;  2GB1 A;  2M19 A;  2CJN A;  2O2V B;  3ZJV A;  3V05 A;  3IT6 B;  4PYU A;  3VTW A;  3I3T B;  2D5G A;  5E6P A;  3OJ4 B;  3CST A;  3WAN A;  3V3X A;  2G1E A;  2QEJ C;  3FAH A;  3U4E G;  1GJZ A;  3PRP B;  1NI3 A;  3MHZ A;  3L0W B;  4GIV A;  2K6Q A;  4GOC A;  1Q1O A;  2NBV B;  1JWM D;  1HTO A;  2B76 B;  3UQB A;  1OTR B;  3AH7 A;  3RUL A;  1RRB A;  1Y56 A;  3AU4 A;  4NNJ B;  4OVV A;  3ZTC A;  1N62 A;  4KX6 B;  1C4P A;  4F1S A;  1FNW A;  1WXV A;  4YTP B;  5FK9 C;  3T8M A;  1JWS D;  5D2M B;  1YX6 B;  4IM2 A;  2FCQ A;  4LK0 M;  1OQQ A;  1V1P B;  3R3M A;  1E8W A;  1GAQ B;  2I1K A;  2AQ1 B;  3ZTD A;  1L6V A;  3Q3N C;  2WLB A;  2NR2 A;  2LAS A;  1AW7 A;  2FUH B;  3AE6 B;  2G4D B;  2KQS A;  1UWX A;  3K9O B;  4WH4 A;  1OEY J;  2EMS A;  2DZI A;  2L76 A;  1FRR A;  1IP9 A;  2WXR A;  3BK2 A;  3QWZ B;  3LXF A;  2WHI A;  4RFB A;  1L2N A;  1CMX B;  2K39 A;  5AUK A;  1EU4 A;  3N20 C;  1WGH A;  1L6U A;  3VFK A;  2N9X A;  1C1Y B;  1QOG A;  3IBE A;  3VVW B;  1ROE A;  3BVG A;  2WWZ A;  1MFW A;  1D4B A;  3GB1 A;  3W1S A;  3KH0 A;  4IUM B;  3HVD A;  3P4P B;  2J7Q B;  3B1L X;  2CHW A;  3AB5 A;  4W9F A;  1P7E A;  4OZC A;  3DBS A;  3O13 A;  3R2T A;  3RNB C;  4DXA B;  4G3X B;  3VAW A;  5C2T B;  2OJR A;  3GS2 A;  4EZJ A;  2DX5 B;  2IO2 B;  1FO4 A;  4BBN C;  1ENF A;  2JWZ A;  4FA6 A;  2QIL A;  3MC9 A;  2L0F A;  2WXN A;  2J0M A;  1WJU A;  4A90 A;  5C3J B;  5BMG A;  3ZNZ B;  1YQB A;  3IVF A;  4HRS A;  1C4A A;  1PGA A;  2KWD A;  2DAJ A;  4K3B A;  1WRD B;  1SSN A;  4XX5 A;  3OLM D;  1D5X C;  3AE2 B;  2MWS B;  5E6J A;  1I4R A;  1SIJ A;  1J7B A;  2JYE A;  1FPY A;  4FJV B;  4WAA A;  2RDG A;  1PUT A;  3AMZ A;  2JY6 A;  4KGT A;  3W5U B;  2DZK A;  1C3T A;  2MHJ A;  2XEW A;  1TKG A;  3ZXV A;  2BB6 A;  1AN8 A;  5LXH A;  3IG3 A;  3TJP A;  3ML9 A;  5AZF A;  2JF5 A;  3RZW C;  3ZNH B;  2GBM A;  1IBX B;  1FNV A;  2O6V B;  3R2I A;  1F52 A;  4IWO A;  4YSZ B;  2WXM A;  1IPG A;  1NEN B;  3C0R B;  1ZKH A;  4NJC A;  1I4P A;  4W9D A;  4IW0 A;  5GMV A;  3B9J A;  2BYV E;  3KWL A;  4W9L A;  3QQ8 B;  4A55 A;  3TBL D;  4WJN A;  5HFY A;  2INC C;  1E8X A;  3A1Q B;  1V2Y A;  3RNG C;  2BS3 B;  5JZE B;  4CO7 A;  1RLF A;  3A9J A;  5J18 A;  2DYO A;  3PGE A;  4TV3 A;  2M1M A;  4EUT A;  4DQO C;  3KWV A;  4BAX A;  5KHQ A;  3KUD B;  1OGW A;  1J19 A;  4YWG G;  4FJZ A;  4MDK E;  4MM3 B;  3RYT A;  2L83 A;  2PW9 A;  1E0Z A;  1ZW7 A;  3AE7 B;  4M0W A;  1V9J A;  2DYB A;  3EC8 A;  5AZG A;  4W9K A;  4BOZ B;  2KFK B;  2BBC A;  4FHK A;  1UGM A;  1DOI A;  4TKN A;  2WXH A;  2IYD B;  3BVZ A;  4MH8 A;  3D32 A;  3KYC D;  4LCD E;  3UGB B;  2NCN A;  1GB1 A;  2Z59 B;  3E56 A;  2BYE A;  2Q5W D;  1RFK A;  4K81 A;  3P63 A;  2ONQ A;  1SF0 A;  2W3S A;  2RSU A;  2CHZ A;  3N32 A;  4MM3 A;  3CIR B;  2LGX A;  2BKF A;  2MJ3 A;  5IO9 A;  2M17 A;  1JRO A;  2KX0 A;  2PJH A;  3DVN V;  1UH6 A;  1X1M A;  3A9J B;  4GN1 A;  4HEA 1;  4WWN A;  4LDT B;  2V0G A;  2G45 B;  1TKE A;  3UF8 A;  2JWU A;  4GSW A;  2M8S A;  1V86 A;  4MEL A;  2C9W B;  5MPO A;  1L5P A;  4OW0 A;  1XEE A;  2CU1 A;  3TEW A;  2Z0D B;  4TQ0 A;  4FN2 A;  1C77 A;  1C78 A;  5CHF A;  2DZM A;  2MBH A;  2KDI A;  2W9N A;  1C79 A;  3U7Z A;  4OVZ A;  4KZC A;  4K7S A;  2I1J A;  3HVZ A;  2MBB B;  2K9X A;  5CHV C;  2JZ3 B;  4ZYS A;  3ZRC A;  3AEG B;  4ZRK A;  4MSQ B;  4DWF A;  4LJO B;  2D3C A;  1WXQ A;  1CJE A;  1YN5 A;  3UQA A;  2V3P A;  3L16 A;  2NPT A;  4FHJ A;  2LUM A;  2LGS A;  3APC A;  4RCO A;  1V97 A;  3H7S A;  1E8Z A;  3MHS D;  2MBQ A;  1WFY A;  2Z0E B;  3AM9 A;  3ZJU A;  3R8B A;  5EE1 A;  1P9D U;  1KLU D;  4L2Y A;  4XDC A;  3MJW A;  1GPX A;  2PVG C;  4RMA A;  5G55 A;  2FUG 1;  1LO5 D;  4P7I A;  2PMV A;  2RD0 A;  1XF5 L;  4NPN A;  2LGI A;  3KUZ A;  1UUP A;  3PV1 A;  2D3A A;  3MC0 B;  4AS1 A;  3BK1 A;  1YN3 A;  2NTS A;  1UZX B;  2LHE A;  3V6C B;  3VXW A;  2WX0 A;  1XLQ A;  1WJN A;  2KAJ A;  3TCA A;  1E7U A;  4HPP A;  1RYJ A;  4HPM B;  2FBW B;  1LM8 B;  2WXL A;  3FC4 A;  4RGO S;  3R7Q A;  2KMM A;  1YMH E;  1K8R B;  1KFY B;  3PVL A;  3N3K B;  5CTR C;  3W2D A;  4MGK E;  1ZGU B;  2KJ6 A;  3L08 A;  3ECI A;  4WJP A;  2J53 A;  3IXS A;  3CMM B;  4FUL A;  3DBR I;  3KYD D;  1JRU A;  1VD2 A;  3ZW3 A;  2C7M B;  3KQ4 A;  2NMQ A;  1WH3 A;  1WYW B;  3U7D A;  2JQR B;  2PTL A;  1HZ5 A;  3P1M A;  3APF A;  1BXT A;  1J7C A;  1WM3 A;  1F2R I;  2M0A A;  2KJR A;  2W54 A;  1N63 A;  1A5R A;  4HKQ A;  2MSE D;  1YJ1 A;  3WA0 A;  3TEZ A;  4NJ7 A;  4NAW A;  3RNE C;  1RAX A;  1T0S C;  1TYG B;  4IM3 A;  1AAR A;  3OAW A;  1H8C A;  2Z8L A;  1YN4 A;  2H89 B;  2V3S A;  3Q3O C;  3CF6 E;  1D6E C;  3PO0 A;  1FIQ A;  4KV2 A;  3W1Y A;  4LNK A;  4WJO A;  3DBL B;  1T0R C;  2WX1 A;  2CU3 A;  1V1P A;  1MJD A;  2K25 A;  2MCN B;  4HJK A;  1QKZ A;  1VZ8 A;  2DBY A;  4EEW A;  5BYQ A;  1FEH A;  2FCM A;  2HE7 A;  1WM2 A;  2SAK A;  1V6E A;  1AYF A;  5G5H A;  3VDZ A;  2BWF A;  3ZUN A;  4LLG M;  2D11 A;  4FJY A;  3ZNI D;  4PYZ A;  1RWS A;  1YX5 B;  2AEH A;  3PZD A;  1CK1 A;  3M3J A;  4ANW A;  3P2B A;  1VZ6 A;  1STE A;  4KDL B;  3NVZ A;  2PE6 B;  4DHZ B;  2CJO A;  3MJ5 A;  2AQ3 B;  3FKY A;  3HUI A;  1SB3 C;  2CS4 A;  2LD9 A;  5EE0 A;  4HKZ E;  2L05 A;  3DBL I;  1M94 A;  3NZS A;  1KF6 B;  1FCC C;  1YJJ A;  3A4S C;  2K22 A;  4X57 B;  4GDL A;  4LJP B;  1FXT B;  4TQ1 A;  2LRU A;  4OVU A;  2J42 A;  2ZPN A;  2MRP A;  2O2V A;  3C8Y A;  3QAQ A;  3WAL A;  1VDV A;  3VTU A;  3EFC A;  3VR9 B;  1K53 A;  3OG5 A;  2BS2 B;  4RM9 A;  1DYQ A;  1WGR A;  1R7S A;  2AYO B;  1T0Y A;  1WSP A;  1V81 A;  2BS4 B;  1TY2 A;  4RNA A;  1WR1 A;  1SE9 A;  2IO0 B;  2LMC A;  1PFD A;  3TMP B;  4XYC A;  5T8I A;  2QHO A;  3ZYY X;  1OEY A;  1H4R A;  1KM7 A;  1N61 A;  2WQY B;  3RT3 B;  2BT6 A;  3H6N A;  3PLV A;  4N59 A;  2KAC A;  2RGF A;  1ZDV A;  3V60 A;  2INN E;  2GBK A;  1R4M B;  2KXJ A;  4JQW C;  4HXD A;  1TZ1 A;  1PGB A;  2DZJ A;  2HDE A;  3AE1 B;  4XWT A;  1L4Z B;  2LUE A;  3Q69 A;  2IJ0 A;  4PT5 A;  1C76 A;  4MT5 A;  4YSY B;  2EKE C;  4JX1 C;  4II2 B;  2LVP A;  1OFF A;  3HIZ A;  1T3Q A;  1I4X A;  1VRA B;  4URK A;  2YEP B;  1GC6 A;  2WXQ A;  2GOW A;  3P42 A;  1QOA A;  3T9L A;  2K8C A;  2WXP A;  4RM8 A;  4ICV A;  4CQN A;  2KVR A;  1JAL A;  2L3Z A;  2KDF B;  3DWM A;  4A20 A;  4JLC A;  2L1A A;  2SEB D;  2KT7 A;  2ZVO A;  4W9I A;  3PSE B;  5CHW A;  2J0J A;  2BB5 A;  5HHD G;  5FR6 A;  3OWE B;  4WAF A;  1I4H A;  3EFU A;  2PKO A;  3RNC C;  5JHB A;  3JYU A;  4J3O D;  1WXA A;  2HTM E;  1SXT A;  5DPW A;  1WX9 A;  3DHG C;  4HJG E;  2FAZ A;  2BF8 B;  2V4L A;  5GXG B;  1FXA A;  3MTN B;  5D3I B;  1TT5 B;  2HTH A;  3VRA B;  4IOI E;  2M0X A;  2FIF A;  2E3T A;  1R4N I;  1TJE A;  2NBW B;  4BVU C;  2AL6 A;  1YOV B;  2WXF A;  3A9K A;  4P1C C;  2JUO A;  3CWI A;  4GGQ A;  1SBB B;  3QX1 A;  1ZXH A;  4N9F 4;  4DXG A;  3IHP C;  3BWU D;  3BYT B;  3RFZ B;  3VQI A;  1WGY A;  3EUB 2;  2KC2 A;  1E90 A;  2KZR A;  1NDD A;  5TSS A;  2WXG A;  5L83 A;  4M00 A;  2C60 A;  3W9C B;  3MP9 A;  4GLS C;  1EF5 A;  4BBN F;  2N7J A;  3TL5 A;  4DHZ E;  1C9F A;  3DPD A;  2QIE B;  2MP2 A;  3ZLZ A;  1J0G A;  3VUY A;  1KRH A;  3GE8 C;  1S1Q B;  2CKH B;  2LJI A;  4XWW A;  1ACC A;  2KN4 A;  4E3C A;  1EWC A;  3HM3 A;  2G4S A;  4MGY E;  2AX5 A;  2C5L C;  3AE8 B;  4NQK E;  1NBF C;  3AXC A;  2J4X A;  3GZN I;  2DAF A;  1MHX A;  2V1Y A;  5J2R A;  5DPT A;  4ACF A;  1LQB A;  4IM0 A;  3I5J C;  3RD2 A;  4JPS A;  5E6N A;  3ZJT A;  2WU5 B;  2PVO D;  1SGH A;  2QC8 A;  1E7P B;  4KKJ A;  3WCQ A;  4BKS D;  3ML8 A;  1D5Z C;  4YL8 A;  3AEC B;  3LDZ E;  3JVZ X;  3PS6 A;  3LJ3 A;  4ZOH C;  1YQ3 B;  4O1N A;  1QF6 A;  3RUI B;  1I35 A;  2WXI A;  3SEB A;  5L95 C;  1P7F A;  2PLP A;  3VR8 B;  2A5U A;  1E5W A;  3SHQ A;  1VZ7 A;  3QAR A;  4ZHP A;  1Z5S B;  1NYR A;  5DCN A;  1FRD A;  1N6Z A;  2EMT A;  3Q8C A;  1WR6 E;  3AED B;  1ZDX A;  3ABV B;  1KLV A;  3PRM B;  2KJH B;  3Q8E A;  3N1X C;  1IUE A;  1K52 A;  3ZGZ A;  4ASW C;  4TMA B;  5AZH A;  2QMT A;  4I6P A;  2C7H A;  3B08 A;  2WDV B;  4WWM A;  4ZRQ A;  2KWU B;  2H88 B;  2IO3 B;  1C4C A;  2FCN A;  2MJD A;  3AEA B;  4ZRJ A;  1WX7 A;  1FXI A;  3VTV A;  3DOW A;  2DYM A;  1DOX A;  1YD8 U;  2LXC A;  3AU5 A;  4W9J A;  4RH6 A;  2RDB C;  1VJK A;  2JZZ A;  2X38 A;  2GMI C;  4K3C A;  3JSV A;  1HQR D;  1Q0W B;  3B2G A;  4IKG A;  3SU8 X;  1B9R A;  4HCP B;  4HDQ A;  1LXD A;  4RGT A;  4AOF A;  4FXC A;  1M4V A;  1WE6 A;  1ZPS A;  3KW5 B;  1E9M A;  3UIP B;  2M4N A;  1KTK A;  3AV8 A;  2JXT A;  4M8M A;  2OJW A;  2KN5 A;  2ZPY A;  2JXX A;  2J52 A;  2JYT A;  2MX2 A;  2WXK A;  1F0Z A;  3NRZ A;  2W55 A;  2K8H A;  3UIO B;  3Q8B A;  3Q3M C;  3R66 C;  4FAD A;  4IG7 B;  1WIA A;  3APD A;  3NHE B;  3L10 B;  4N6E B;  3NS1 A;  2YLM A;  3AI5 A;  2DEN B;  1XT9 B;  4MH0 E;  2MQJ A;  3R7R A;  1I4Q A;  3SFD B;  5LNK 1;  4WWO A;  3JW0 X;  2ZVN A;  4JIO U;  1WE7 A;  1B1Z A;  3I63 C;  5D3D A;  3TSS A;  1GOZ A;  3QJZ A;  2MA9 B;  1BUI C;  5J17 A;  3N30 A;  5BMI A;  4NY0 A;  3PPA A;  2N9K A;  2IBI B;  3ONS A;  2INP E;  3U8Z A;  3MFG A;  5BMH A;  4W9C A;  1ZP0 B;  3P4R B;  3TEY A;  3ZRF A;  4HRO A;  3BIN A;  4XDD A;  3AN1 A;  2KFK A;  3FIL B;  3Q8F A;  3P4S B;  5EDS A;  2BW2 A;  3IAM 1;  2K1F A;  4K7W A;  1R4M I;  2IZV B;  1RM6 C;  1V5O A;  4D2K A;  3U52 E;  3SD5 A;  4A3P A;  3Q3J A;  1WJ6 A;  4EZL A;  4FBJ B;  3Q3F A;  2MBE A;  4GU2 A;  1L7Y A;  2VRR B;  1E7V A;  1WF9 A;  4HDO A;  2BWE S;  4EOY A;  3DWG C;  1GUA B;  1TS4 A;  1UGJ A;  2KKC A;  2W3R A;  1ET9 A;  1UBQ A;  1EO6 A;  3NVV A;  4M0W B;  4ANU A;  1SIF A;  3W1S C;  2WP9 B;  1SEB D;  4MJS A;  2EEL A;  4A8X C;  1L0Y B;  2ICI A;  1YJI A;  2JZP A;  2KQ4 X;  2BGF A;  4WWP A;  3Q2A C;  3ZIM A;  1EWY C;  4JL9 A;  4US9 A;  1PYW D;  2PPH A;  3A1Q A;  3K9P B;  1WWT A;  2IO1 B;  1ZOY B;  2O6V D;  4RGN A;  4ZRP A;  5EE9 A;  4BFR A;  4AUQ C;  3EA6 A;  3EEC A;  1LFD A;  4ICU A;  2KLG A;  3X23 A;  2ZJD A;  5HG2 A;  1MPE A;  1HA5 A;  2R61 A;  1V5T A;  2IGH A;  2XK5 B;  1MI0 A;  2FCS A;  2RR9 A;  2Y5B B;  4HPL B;  2WYQ A;  2LXA A;  2KMC A;  5AUI A;  2BQQ A;  2MEK A;  4WUR A;  1P98 A;  4TUU A;  3GP7 A;  4PK1 A;  2BPS A;  4JWU C;  4HWI B;  3U30 A;  2MW5 A;  1FFU A;  4AJW A;  2BKR B;  1E8Y A;  5DPS A;  1J8C A;  3RPF C;  4KIK B;  4CYE A;  1UWM A;  1T5X D;  4US8 A;  3AE5 B;  3ZQ4 A;  1VR9 A;  1FCL A;  2GBR A;  1QZE A;  1PDX A;  2KNB A;  2DLB A;  3PZ7 A;  3RNF C;  2MH7 A;  3DBH B;  2ACZ B;  3HRD D;  4MSM B;  1TBE A;  1TS5 A;  1NEK B;  4G11 A;  3Q6B A;  4B0E A;  4P1B C;  3AE9 B;  2ZCC A;  1XO3 A;  2WU2 B;  4C56 C;  1NYQ A;  1XLN A;  3L54 A;  4A3O A;  3QA8 A;  1NVI D;  1YNT E;  4ZDV A;  1BML C;  2BYT A;  5IA7 A;  1L0V B;  5BYR A;  5D6J B;  4B0M A;  3N1Y C;  3RN9 C;  4XGA B;  2JRI B;  4WJQ A;  2NBU A;  2R2O A;  3MC8 A;  1YIW A;  5H92 C;  4MGI E;  2ASQ A;  3DBR B;  4E74 A;  4YXD B;  1XXG A;  2KDB A;  4Q2J A;  2LFI A;  4KGS A;  4WQO B;  3FIL A;  2VZK B;  2KDM A;  3DHI C;  2K3U A;  1LGR A;  1F77 A;  2L52 A;  2ZNV C;  4A9A A;  2BYF A;  3NY5 A;  5G2N A;  1SE3 A;  2YEP F;  2WDR B;  4WQM A;  3M62 B;  3QC8 B;  2MP2 B;  3BVM A;  4HVB A;  2UWQ A;  2WS3 B;  4LDT D;  3B0A A;  5E6O A;  3B2F A;  1N60 A;  4GDK B;  3T3N A;  1QIL A;  1V1O A;  4S0R A;  2AQ2 B;  3I57 A;  1WI0 A;  5JHA A;  4C00 A;  4MEM A;  1JWA D;  3ETR A;  3L13 A;  2JSV X;  4JE3 B;  2KAN A;  1UEL A;  3I9V 1;  5HKH A;  1FM0 D;  3W5V B;  3DVG X;  1IGC A;  3DVG Y;  3RMK C;  2QCZ A;  1E6E B;  1HEZ E;  2OHF A;  2L00 B;  4XC2 A;  3PLU A;  2QSD A;  4J6I A;  3NOB A;  1WMH B;  3ZKJ C;  1WGD A;  2J0K A;  4L23 A;  2WXO A;  3QK0 A;  4BKG A;  5BO4 B;  1I42 A;  3KUC B;  1F2R C;  1GNU A;  2NPT B;  2O6V A;  2LI5 A;  2L0T A;  3NUH B;  5DPR A;  1WGG A;  2TSS A;  4DDI D;  3A9K B;  5FKA C;  3IAS 1;  1NI2 A;  3NVW A;  2KTR A;  3QIJ A;  1K51 A;  2LVO A;  1JRP A;  4BZA A;  1Z2M A;  1WYG A;  4MJS B;  2WGS A;  4PS3 A;  5IP4 D;  3BYY B;  4B95 A;  1I4G A;  4USA A;  4P16 A;  2KTF A;  4M01 A;  1F1H A;  1SJE D;  2G3Q B;  4TSS A;  1TIF A;  4ZHO A;  4GB9 A;  4ZRI A;  4KZ0 A;  2OED A;  1KJT A;  5IAA C;  4C80 A;  4ARI A;  3UIN B;  4G0N B;  1T0Q C;  4II3 B;  2VH1 A;  3QHT A;  4EE2 A;  3UI3 A;  3PHW B;  3L4P A;  2DWQ A;  2E6X A;  4LTU A;  3V6E B;  4ARC A;  2LVQ A;  2RPV A;  3NJT A;  1AWD A;  1FMA D;  1JW9 D;  3P4Q B;  4YSX B;  3C19 A;  2L32 A;  3ZDM C;  2MBO A;  1TKY A;  1XD3 B;  1BT0 A;  1KH0 A;  2X8X X;  2KO3 A;  3DDC B;  4GDK A;  4A6Q A;  2KWV B;  2PIA A;  3EGR A;  3WAM A;  1G6J A;  2I38 A;  5D7G A;  1DOY A;  1UF0 A;  3SR6 A;  1WJ4 A;  1ET6 A;  4IWP A;  4BKT A;  3LB8 C;  2UYZ B;  1QLB B;  2ON8 A;  3BY4 B;  2RMM A;  4EKU A;  3PTF C;  5LLI A;  2NS5 A;  2HJ1 A;  2N7D A;  1Q5W B;  3VHT C;  1P3Q U;  2WDT B;  1WX8 A;  4DXF A;  2W82 A;  1P0R A;  3RCZ A;  2ZW0 A;  1XCT L;  3Q14 C;  4NQL B;  5H8Y E;  4ZYN A;  2LHD A;  4OZB A;  3NG0 A;  2N7E A;  5G5G A;  4NAM A;  3M95 A;  2JPH A;  2HD5 B;  1T6B X;  1Y8R C;  3ENE A;  2V9H A;  1N5X A;  4XE0 A;  3AEF B;  1XLP A;  1RFA A;  2GI9 A;  1EU3 A;  4HCN B;  5C23 A;  2R2Q A;  4ANV A;  1FNU A;  1WMH A;  2CR5 A;  4M02 A;  1ZUD 2;  4KDI C;  3A4R A;  3TIX A;  2K0P A;  3L17 A;  3WIM A;  2JX5 A;  3KVF B;  3VRB B;  3PRE A;  1UNS A;  4AWJ A;  1E10 A;  2WXJ A;  1WGK A;  2I2Y A;  2KVZ A;  4CHK A;  1R4N B;  3RZF A;  4H2A A;  2L7R A;  1I7H A;  4L1B A;  3SFE B;  1GB4 A;  3ZVV A;  4YTM B;  3GE3 C;  2N4F A;  3RI7 C;  2IGG A;  3AE4 B;  1IBX A;  2KHW B;  1QT9 A;  2IDY A;  1TGZ B;  1WZ0 A;  2JRH A;  5LXI B;  3JSV B;  3NS8 A;  2ZZP B;  2K8B A;  3E9S A;  2GLS A;  1EUV B;  1CZP A;  4W9G A;  4C7Y A;  3S2A A;  1N5W A;  2V4I B;  3V62 A;  5IOI A;  3V61 A;  3ZXR A;  4BOS C;  2YVC A;  2N9L A;  2PEA A;  1U4A A;  1OQY A;  2LZ6 A;  3HM6 X;  2N1W A;  1SJH D;  3Q8A A;  1HE8 A;  2DHZ A;  2ZEQ A;  3BII D;  1WY8 A;  1WZ3 A;  2ZCB A;  3OJ3 A;  3VH3 B;  1QOF A;  1J7A A;  3ZNG C;  4R3D A;  2KDE B;  3H7P B;  2AL3 A;  3NZU A;  2Y3A A;  3RNA C;  2KD0 A;  1QQR A;  3AE3 B;  4OHJ A;  3X0W A;  5AEK B;  2XBB C;  1ZE3 D;  1EF1 A;  1XLO A;  2MJE A;  3N1Z C;  4G50 A;  2RDH A;  2A4Z A;  2NTT A;  4DHJ B;  1JML A;  1MG4 A;  1IYF A;  1S3S G;  1YQ4 B;  4B6W A;  4QAY A;  4F8C B;  4PS8 A;  5TR5 A;  3KLS X;  4NZL B;  4LNO A;  1ZXI A;  1SE4 A;  4DK5 A;  3NZ3 A;  2IY0 B;  5IN7 A;  4MAC A;  4HLE A;  2KFJ A;  4F7Z A;  2KX3 A;  3PHX B;  1UD7 A;  4NAW B;  2VH2 A;  3H9D A;  1HZ6 A;  3EHV A;  3TEX A;  4JGH B;  2FNJ B;  1PGX A;  2JU6 X;  3ZDT A;  4IWQ A;  3DVN U;  3AEB B;  3PRZ A;  4I6L B;  3LYY A;  1HXY D;  2WDQ B;  4M8N A;  3A33 B;  4IDI A;  4KVG B;  1ISN A;  2IND C;  4DHJ D;  1L4D B;  1K50 A;  2DNF A;  4C7Z A;  2N9P C;  4OZA A;  2BVC A;  5HI1 A;  1D3Z A;  3DHH C;  2C7N B;  4S17 A;  4KSL C;  1V49 A;  4RGM A;  1MG8 A;  4ITK A;  4RF0 A;  5EE3 A;  1VCB A;  4XZ4 A;  5IKC M;  3HHM A;  2GBJ A;  4KSK C;  4NJ6 A;  3AUL A;  1Q10 A;  4RF1 A;  4W9H A;  3PT2 B;  4PS7 A;  1A70 A;  4EFO A;  5BYS A;  2EKI A;  1SE2 A;  2KOX A;  4LNN A;  5JXV A;  1TZO A;  1TS3 A;  2LWP A;  3M63 B; 
#chains in the Genus database with same CATH homology
 4W9K A;  4FLH A;  4BOZ B;  2KFK B;  4GGQ A;  4FHK A;  1UGM A;  2NVU I;  4TKN A;  3L54 A;  3QX1 A;  4E71 A;  2IYD B;  4A3O A;  4N9F 4;  3D32 A;  3KYC D;  3QA8 A;  4LCD E;  1WXS A;  3UGB B;  2NCN A;  4ZDV A;  2Z59 B;  5C1Z A;  3IHP C;  2KLC A;  5IA7 A;  3CSF A;  5D6J B;  2BYE A;  2GBN A;  3VQI A;  4AJY B;  1WGY A;  2JRI B;  4WJQ A;  4K81 A;  2KC2 A;  2ZNV B;  2NBU A;  2R2O A;  4DBG A;  1E90 A;  2KZR A;  1YIW A;  2RSU A;  2CHZ A;  3N32 A;  4HK2 A;  4MM3 A;  1NDD A;  2LGX A;  2ASQ A;  4MGI E;  2BKF A;  5L83 A;  2M17 A;  3DVN V;  2KX0 A;  2PJH A;  4E74 A;  1UH6 A;  1X1M A;  2D3G A;  2KDB A;  4AP4 C;  2C60 A;  3A9J B;  4GN1 A;  4WWN A;  4LDT B;  4WQO B;  2G45 B;  3UF8 A;  5KHO A;  1EF5 A;  4BBN F;  4GSW A;  3TL5 A;  4DHZ E;  2M8S A;  2ZNV C;  1V86 A;  3DPD A;  4MEL A;  2C9W B;  2BYF A;  2MP2 A;  3ZLZ A;  3NY5 A;  1J0G A;  3VUY A;  5G2N A;  2CU1 A;  3ZO5 B;  2Z0D B;  1S1Q B;  2CKH B;  4TQ0 A;  4FN2 A;  1GC7 A;  3DBH I;  3M62 B;  3QC8 B;  2MP2 B;  4E3C A;  4HVB A;  3HM3 A;  2G4S A;  4DDG D;  2KC1 A;  2UWQ A;  5CX3 A;  4MGY E;  5CHF A;  4LDT D;  2DZM A;  2MBH A;  3B0A A;  2C5L C;  5E6O A;  2KDI A;  4GDK B;  3VUW A;  1GG3 A;  2W9N A;  4BKS A;  4NQK E;  1NBF C;  4KZC A;  3AXC A;  4K7S A;  2I1J A;  3GZN I;  5JH5 C;  2DAF A;  2MBB B;  3H1U A;  2V1Y A;  1KOT A;  2PE9 A;  5CHV C;  5J2R A;  2KWC A;  5DPT A;  1WI0 A;  2JZ3 B;  5JHA A;  3SDL C;  2AWT A;  4MEM A;  1LQB A;  2FID A;  3DCG A;  3L13 A;  4IM0 A;  2KAN A;  1UEL A;  3ZRC A;  3HK0 A;  3RD2 A;  4ZRK A;  5E6N A;  2N9E B;  4MSQ B;  3GOE A;  5HKH A;  4DWF A;  4LJO B;  3DVG X;  1SGH A;  3DVG Y;  4B9K A;  4BKS D;  3ML8 A;  2LGY A;  2MLB A;  4YL8 A;  3UQA A;  2L00 B;  4XC2 A;  1XQQ A;  3PLU A;  3L16 A;  2NPT A;  3LDZ E;  4FHJ A;  3NOB A;  3JVZ X;  1WMH B;  2KK8 A;  2LRW A;  3LJ3 A;  3PS6 A;  4J6I A;  1WGD A;  2J0K A;  3ZKJ C;  3IFW B;  3QK0 A;  4MGZ E;  4BKG A;  3APC A;  3ALB A;  2RPQ A;  2JT4 B;  1E8Z A;  3H7S A;  3KUC B;  2D10 A;  3MHS D;  5BO4 B;  3RUI B;  1I42 A;  1GNU A;  1I35 A;  2MBQ A;  2NPT B;  2O6V A;  1WFY A;  2LI5 A;  2L0T A;  2Z0E B;  5DPR A;  4EZK A;  3WAO A;  5L95 C;  1P1A A;  1WGG A;  1P9D U;  3VUX A;  2OOB B;  4DDI D;  3A9K B;  4K1R B;  2A5U A;  1E5W A;  1WXM A;  2N1V A;  3MJW A;  3SHQ A;  1NI2 A;  1UBI A;  3QAR A;  1Z5S B;  5DCN A;  4RMA A;  5G55 A;  4IC7 B;  2EMT A;  2KTR A;  4P7I A;  1WR6 E;  3QIJ A;  2RD0 A;  4NPN A;  2LVO A;  3H7P A;  1V80 A;  1Z2M A;  3KUZ A;  1KLV A;  3PRM B;  2KJH B;  4MJS B;  4K7U A;  4PS3 A;  2D07 B;  4B95 A;  3PV1 A;  4ASW C;  2KTF A;  4KIK A;  5AZH A;  2G3Q B;  1UZX B;  2LJ5 A;  4I6P A;  2C7H A;  3V6C B;  3B08 A;  3VXW A;  2WX0 A;  1WJN A;  4I6N B;  4GB9 A;  4GMV A;  4ZRI A;  3TCA A;  1F9J A;  1E7U A;  2CHX A;  2KWU B;  4KZ0 A;  4HPM B;  1LM8 B;  5IAA C;  1KJT A;  2IO3 B;  2KMA A;  2FCN A;  2K6D B;  4ZRJ A;  3O65 B;  4G0N B;  2LGD A;  1WX7 A;  3UIN B;  3R7Q A;  4ANX A;  1K8R B;  3VTV A;  2KTR B;  2DYM A;  3DOW A;  3PVL A;  1YD8 U;  2B3A A;  3QHT A;  4II3 B;  3N3K B;  5CTR C;  2LXC A;  3AU5 A;  3PHW B;  3QCA A;  4MGK E;  1ZGU B;  2JVC A;  2KJ6 A;  3VH4 B;  3V6E B;  3L08 A;  3ECI A;  2LVQ A;  4WJP A;  4W9J A;  5D94 A;  3CMM B;  4FUL A;  3DBR I;  3KYD D;  1JRU A;  4GDL B;  1VD2 A;  3ZW3 A;  2REX A;  2KQ7 A;  3WAP A;  2JZZ A;  2HJ8 A;  2C7M B;  2L8J A;  4GXB A;  3ZDM C;  2MBO A;  2GMI C;  1WH3 A;  2D2Q A;  3DQV A;  3JSV A;  1XD3 B;  1Q0W B;  1TTN A;  1WYW B;  1BT0 A;  4W9E A;  3U7D A;  3SU8 X;  2IY1 B;  3APF A;  2KO3 A;  2XK5 A;  3DDC B;  4GDK A;  4HCP B;  2KWV B;  1PQS A;  1LXD A;  4HDQ A;  3WAM A;  1WM3 A;  1G6J A;  2O2V B;  5D7G A;  2KJR A;  4AOF A;  1A5R A;  4PYU A;  3VTW A;  1WJ4 A;  1WE6 A;  2MSE D;  4IWP A;  4BKT A;  1YJ1 A;  3WA0 A;  3I3T B;  2UYZ B;  4NJ7 A;  5E6P A;  3BY4 B;  3OJ4 B;  3KW5 B;  1RAX A;  3CST A;  2M4N A;  4IM3 A;  4NAW A;  3UIP B;  3WAN A;  1AAR A;  1GJZ A;  3PRP B;  3OAW A;  4M8M A;  4EKU A;  2KN5 A;  1H8C A;  3PTF C;  2ZPY A;  2JXX A;  2MX2 A;  5LLI A;  2NS5 A;  2V3S A;  3L0W B;  2N7D A;  1Q5W B;  3CF6 E;  4GIV A;  2K6Q A;  1P3Q U;  4GOC A;  3VHT C;  1Q1O A;  2NBV B;  4KV2 A;  2WDT B;  1WX8 A;  3W1Y A;  2K8H A;  3UIO B;  4WJO A;  3UQB A;  1OTR B;  2WX1 A;  3R66 C;  3RUL A;  4FAD A;  1RRB A;  1P0R A;  3AU4 A;  3RCZ A;  4IG7 B;  4NNJ B;  4OVV A;  4NQL B;  3ZTC A;  1WIA A;  4ZYN A;  2K25 A;  3APD A;  2MCN B;  4F1S A;  3NHE B;  3L10 B;  1WXV A;  2N7E A;  4HJK A;  2YLM A;  3AI5 A;  4EEW A;  2DEN B;  3T8M A;  1XT9 B;  4MH0 E;  2MQJ A;  3R7R A;  2FCM A;  3M95 A;  5D2M B;  1YX6 B;  2JPH A;  4IM2 A;  2HE7 A;  1WM2 A;  2FCQ A;  4WWO A;  2HD5 B;  3JW0 X;  1Y8R C;  3ENE A;  2ZVN A;  1V6E A;  3VDZ A;  2BWF A;  3ZUN A;  4JIO U;  2D11 A;  1WE7 A;  4FJY A;  3ZNI D;  3R3M A;  4PYZ A;  1E8W A;  1YX5 B;  1RFA A;  2I1K A;  3ZTD A;  4HCN B;  5C23 A;  2R2Q A;  3QJZ A;  2AEH A;  2MA9 B;  3PZD A;  4ANV A;  1WMH A;  2NR2 A;  2CR5 A;  2LAS A;  3M3J A;  3N30 A;  3P2B A;  4NY0 A;  4ANW A;  2FUH B;  5J17 A;  3PPA A;  2IBI B;  4KDL B;  2G4D B;  4KDI C;  2PE6 B;  2KQS A;  3A4R A;  3K9O B;  4DHZ B;  3ONS A;  3TIX A;  3U8Z A;  3L17 A;  3WIM A;  1OEY J;  3KVF B;  2EMS A;  2DZI A;  3PRE A;  2L76 A;  1IP9 A;  4AWJ A;  4W9C A;  3QWZ B;  4CHK A;  2CS4 A;  2LD9 A;  3RZF A;  2L7R A;  3ZRF A;  2L05 A;  3BIN A;  1L2N A;  3DBL I;  1CMX B;  1M94 A;  3NZS A;  3ZVV A;  2N4F A;  2K39 A;  2KFK A;  2KHW B;  1WGH A;  3A4S C;  4X57 B;  1TGZ B;  2N9X A;  3VFK A;  1WZ0 A;  2JRH A;  5LXI B;  1C1Y B;  5EDS A;  3IBE A;  4GDL A;  4LJP B;  3VVW B;  3JSV B;  2K1F A;  1FXT B;  4TQ1 A;  4K7W A;  3NS8 A;  2WWZ A;  2LRU A;  4OVU A;  2ZZP B;  1R4M I;  2IZV B;  3W1S A;  3KH0 A;  2K8B A;  1V5O A;  2ZPN A;  3SD5 A;  4A3P A;  3Q3J A;  1WJ6 A;  2MRP A;  4IUM B;  2O2V A;  3QAQ A;  1EUV B;  4W9G A;  3WAL A;  4FBJ B;  4EZL A;  3VTU A;  2J7Q B;  3Q3F A;  3S2A A;  3B1L X;  2CHW A;  2MBE A;  4W9F A;  3DBS A;  4GU2 A;  1L7Y A;  2VRR B;  3V62 A;  4DXA B;  4RM9 A;  1E7V A;  1WF9 A;  4G3X B;  3V61 A;  1WGR A;  3VAW A;  4HDO A;  4BOS C;  2AYO B;  1T0Y A;  2BWE S;  4EOY A;  2YVC A;  1V81 A;  2PEA A;  1U4A A;  2OJR A;  4EZJ A;  2DX5 B;  2IO2 B;  4BBN C;  2JWZ A;  4FA6 A;  1OQY A;  1GUA B;  2LZ6 A;  1WR1 A;  2KKC A;  3HM6 X;  2N1W A;  1SE9 A;  1UBQ A;  2IO0 B;  1EO6 A;  1HE8 A;  2DHZ A;  2ZEQ A;  2L0F A;  4M0W B;  1WY8 A;  1WZ3 A;  2ZCB A;  4ANU A;  1SIF A;  3OJ3 A;  3VH3 B;  3W1S C;  3TMP B;  2J0M A;  1WJU A;  4MJS A;  3ZNG C;  3ZNZ B;  2QHO A;  1YQB A;  2KDE B;  3H7P B;  3IVF A;  2AL3 A;  1OEY A;  1H4R A;  3NZU A;  1KM7 A;  2DAJ A;  1WRD B;  3RT3 B;  2KD0 A;  3H6N A;  3PLV A;  4XX5 A;  2RGF A;  3OLM D;  2BGF A;  4WWP A;  3X0W A;  2XBB C;  5AEK B;  2MWS B;  3V60 A;  3ZIM A;  4JL9 A;  1EF1 A;  2PPH A;  3A1Q A;  2GBK A;  3K9P B;  4G50 A;  4FJV B;  2A4Z A;  2KXJ A;  4DHJ B;  4WAA A;  2IO1 B;  4JQW C;  1IYF A;  4HXD A;  1S3S G;  2O6V D;  1TZ1 A;  2JY6 A;  2DZJ A;  2DZK A;  4B6W A;  4BFR A;  4F8C B;  1C3T A;  4PS8 A;  5TR5 A;  4AUQ C;  2LUE A;  3EEC A;  1LFD A;  2XEW A;  4ICU A;  2KLG A;  3X23 A;  2EKE C;  2ZJD A;  4DK5 A;  4II2 B;  2IY0 B;  5LXH A;  2LVP A;  1V5T A;  3IG3 A;  3ML9 A;  3TJP A;  3HIZ A;  5AZF A;  2XK5 B;  4HLE A;  2FCS A;  4URK A;  2JF5 A;  2KFJ A;  2RR9 A;  2Y5B B;  3RZW C;  2KX3 A;  4HPL B;  3ZNH B;  3PHX B;  2GBM A;  2WYQ A;  4F7Z A;  2O6V B;  1GC6 A;  1UD7 A;  2LXA A;  2KMC A;  2GOW A;  4IWO A;  4NAW B;  3T9L A;  2K8C A;  3H9D A;  1IPG A;  3EHV A;  4RM8 A;  4ICV A;  4JGH B;  3C0R B;  2KVR A;  1ZKH A;  2FNJ B;  1P98 A;  4TUU A;  3ZDT A;  4IWQ A;  3DVN U;  4W9D A;  4IW0 A;  5GMV A;  2BPS A;  2L3Z A;  2KDF B;  3PRZ A;  4I6L B;  2BYV E;  4HWI B;  4W9L A;  3U30 A;  3QQ8 B;  4JLC A;  4A20 A;  2MW5 A;  4M8N A;  3A33 B;  4KVG B;  1ISN A;  2ZVO A;  4W9I A;  3PSE B;  5CHW A;  3TBL D;  2J0J A;  4AJW A;  4DHJ D;  4WJN A;  5FR6 A;  2BKR B;  1E8Y A;  1E8X A;  3EFU A;  5DPS A;  1J8C A;  4KIK B;  3A1Q B;  1V2Y A;  3JYU A;  5JHB A;  1WXA A;  4CYE A;  5DPW A;  5JZE B;  4CO7 A;  2N9P C;  1RLF A;  1WX9 A;  3A9J A;  2DYO A;  5J18 A;  3PGE A;  1D3Z A;  2C7N B;  2GBR A;  4KSL C;  1V49 A;  2M1M A;  1QZE A;  2KNB A;  2FAZ A;  1MG8 A;  2BF8 B;  4TV3 A;  4EUT A;  1VCB A;  2V4L A;  5KHQ A;  3KUD B;  4XZ4 A;  3HHM A;  1OGW A;  2GBJ A;  4KSK C;  1J19 A;  3MTN B;  4NJ6 A;  2HTH A;  3AUL A;  4FJZ A;  4MDK E;  4MSM B;  1TBE A;  4G11 A;  4W9H A;  3PT2 B;  2M0X A;  4PS7 A;  3RYT A;  4EFO A;  2FIF A;  1ZW7 A;  2KOX A;  1R4N I;  2LWP A;  2NBW B;  3M63 B;  1V9J A;  4BVU C;  2ZCC A;  2AL6 A;  2DYB A;  3EC8 A;  3A9K A;  2JUO A;  5AZG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...