4I6PA

Crystal structure of par3-ntd domain
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
84
structure length
84
Chain Sequence
SEFKVTVCFGRTRVVVPCGDGRMKVFSLIQQAVTRYRKAVAKDPNYWIQVHRLEHGDGGILDLDDILCDVADDKDRLVAVFDEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into the intrinsic self-assembly of par-3 N-terminal domain.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
molecule keywords Partitioning defective 3 homolog
total genus 19
structure length 84
sequence length 84
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4i6pA00
3N3KB 4E71A 4W9CA 3HM6X 3ZIMA 1Z2MA 4B9KA 4G3XB 1WE7A 3EFUA 5IA7A 2Z0DB 3AXCA 4WWPA 2O6VB 2DYBA 3PSEB 4P7IA 3M63B 4KV2A 3RZFA 4K7WA 1V6EA 2MCNB 1WJ6A 1WF9A 2O2VB 2KX0A 1KLVA 4GIVA 3VQIA 2GBKA 2GBRA 3UIOB 2LRUA 4KIKB 4M8MA 4ANXA 1UH6A 2GBMA 3QAQA 2A4ZA 3VUXA 1HE8A 4DXAB 2W9NA 4BKGA 2KLGA 3ZTDA 2N7EA 1Q0WB 2AL3A 4BBNC 3RT3B 1VCBA 1WMHA 3VXWA 4WJOA 2XK5A 3TIXA 1WE6A 4W9FA 2ZCCA 2JWZA 2LVQA 4PYZA 5DPRA 5IAAC 1WXMA 4II3B 3VFKA 3A9KA 3APFA 1P3QU 1V5OA 2DZMA 4GDKA 4MEMA 5DPWA 2LGXA 4IM2A 5CHVC 1E90A 3HIZA 4HPLB 5LXIB 2HE7A 3CSFA 2KO3A 2DENB 2IO3B 2C7MB 2MW5A 2K25A 4W9IA 1WXAA 3CSTA 4DHZB 4KSLC 4K7SA 2KC1A 4FULA 3ENEA 4KDIC 2C7NB 4MJSA 3VTVA 3RD2A 4KVGB 3OJ3A 2MQJA 3PHWB 2KN5A 3DBHI 4FHJA 4IWPA 4GB9A 5AEKB 2D2QA 3APCA 4XX5A 2RSUA 1SE9A 4G50A 1D3ZA 2HD5B 4FBJB 2NBUA 2MWSB 4ZRKA 1FXTB 1XT9B 2C60A 2NBWB 2Z0EB 2ZNVB 2KDIA 2DAFA 2K39A 4MELA 3IFWB 2JPHA 3DDCB 3RYTA 4HPMB 3EHVA 3IBEA 4EZLA 4F7ZA 4OVVA 2KJHB 5E6OA 3ZDTA 4RMAA 3DCGA 4HDQA 2D10A 2DYOA 1UZXB 4EEWA 1R4NI 4MJSB 2DZKA 4HLEA 1E8YA 2J0KA 2JZZA 3PV1A 5D94A 3U7DA 4AJYB 3L17A 1OGWA 2IO0B 4RM8A 2N4FA 2LXCA 1TZ1A 3VUYA 3QQ8B 3MTNB 1AARA 2JUOA 1ZKHA 4EKUA 2IBIB 2R2OA 2BF8B 1YQBA 2BKRB 4JIOU 4ZRJA 1WZ0A 1E7VA 3PGEA 3SD5A 1Y8RC 2B3AA 3KH0A 4KDLB 2M8SA 3L10B 2Y5BB 2ZNVC 4NAWB 4ZRIA 5DPSA 1EUVB 1E8ZA 2KX3A 2ASQA 3R7RA 3VTWA 4IW0A 2GBJA 1P98A 3VTUA 2YLMA 4IUMB 1QZEA 4XC2A 4IG7B 3A33B 1Q1OA 2OOBB 2LI5A 1V9JA 1WGRA 3L54A 1WH3A 1EO6A 1WX8A 2N9PC 2KMCA 2KQSA 4PS8A 3Q3JA 1GC7A 4A20A 4F1SA 1C3TA 2BYEA 4AUQC 4DHJB 2LWPA 3D32A 1IYFA 2JRIB 2MA9B 1P9DU 4LJOB 2HTHA 2KC2A 2ZEQA 3JYUA 4W9KA 3WAOA 4CYEA 1WR6E 4DK5A 2LASA 2BYFA 3JSVB 2K6QA 4MM3A 3ZUNA 4NJ7A 2NCNA 1WJ4A 2LGDA 4NNJB 1YJ1A 2DX5B 3UIPB 2KANA 2BYVE 5L83A 2IY0B 2D11A 4BKSD 4MGKE 2KD0A 1UGMA 3W1YA 1GNUA 3X0WA 3ZNGC 4KZCA 4M0WB 3ZRFA 1NBFC 3GOEA 4WWOA 2L7RA 1S3SG 2KNBA 1OEYA 4YL8A 2FCQA 4HCPB 3H6NA 5AZFA 4TQ0A 4ZDVA 1WZ3A 3DBLI 3W1SA 3OAWA 1WJUA 4FJVB 4W9HA 1VD2A 4WJPA 5JHAA 1EF5A 5J17A 3PVLA 4K81A 1WXVA 1J0GA 2PPHA 3R66C 3ZLZA 2PEAA 2KTRB 1NDDA 1E8WA 1ISNA 2DYMA 2KXJA 3IVFA 3TJPA 3LJ3A 4NQKE 5FR6A 2KWCA 2V4LA 1M94A 5DCNA 4BKSA 1RAXA 4LJPB 4MH0E 2Z59B 2MX2A 5AZGA 3NY5A 1L2NA 2RPQA 4HVBA 5CTRC 3BINA 3WAPA 4CHKA 3JW0X 4MGYE 5JHBA 4GDLB 2NBVB 3H9DA 4JLCA 1OTRB 2CHZA 1WGGA 2ZVNA 2FIFA 3A9KB 4PS3A 4KSKC 1UD7A 1SIFA 3EC8A 3NZUA 4A3OA 3ECIA 4NY0A 3PS6A 1LM8B 3ZTCA 2CR5A 5KHOA 2MLBA 3A4RA 2UWQA 4ZYNA 4AOFA 2N9EB 4GDLA 4I6LB 4IM0A 3ZRCA 1RFAA 1IPGA 4GGQA 2PE9A 2JF5A 3QWZB 1ZGUB 2WWZA 5E6PA 1V80A 3SHQA 2WYQA 1WGHA 3I3TB 5JH5C 2IZVB 4WAAA 3ZW3A 2GBNA 2K8BA 4AWJA 3OJ4B 2EMSA 4TV3A 2I1KA 4EOYA 1EF1A 1XD3B 2MBHA 4JL9A 4DWFA 5HKHA 2JRHA 4BKTA 4BOSC 2LVPA 4WWNA 2FCSA 2BWFA 3SU8X 3PPAA 3H7PA 2C9WB 3L0WB 5G2NA 1LFDA 1WM2A 3AU4A 3EECA 3R3MA 3ZNZB 4BVUC 2DZIA 3NS8A 3P2BA 2L00B 4RM9A 4J6IA 4DDGD 3KYDD 2FUHB 4NAWA 3A9JA 2XK5B 1RLFA 2KWVB 2WX1A 3R7QA 4ANUA 2L76A 4DHZE 2L0TA 3PRMB 1NI2A 3A1QA 4HDOA 3VDZA 2KKCA 4WQOB 2KHWB 3OLMD 3ONSA 2OJRA 3QJZA 4BOZB 5D6JB 1RRBA 3IG3A 3ALBA 2KWUB 4HK2A 3WIMA 3ZNID 1G6JA 1Z5SB 2LRWA 5AZHA 4B6WA 5D2MB 5J2RA 2G3QB 2FNJB 4IWQA 2WX0A 2EMTA 2CU1A 4GU2A 3KVFB 2K6DB 1I35A 3K9PB 2JZ3B 2KJRA 3QCAA 1WIAA 3O65B 4K1RB 2KOXA 3AULA 2FCNA 2D07B 3WALA 3W1SC 4HJKA 1YIWA 4XZ4A 4JGHB 2REXA 3H1UA 2R2QA 2ZCBA 3SDLC 3B08A 2KDBA 3B0AA 2A5UA 3MHSD 4M8NA 4ASWC 3S2AA 2KFKB 3L08A 2GOWA 1F9JA 3QA8A 2XEWA 2JT4B 3M62B 2MBEA 3KYCD 4N9F4 3WAMA 1WJNA 3C0RB 3PZDA 4TQ1A 1OQYA 1CMXB 2AWTA 3GZNI 2RGFA 2NPTA 1UBIA 2ZZPB 4FN2A 4E3CA 4NJ6A 1GUAB 1XQQA 4DDID 1V86A 3QARA 2G4DB 5DPTA 2KZRA 3PTFC 4CO7A 4EFOA 5EDSA 2IYDB 2DZJA 1X1MA 4KIKA 3KUCB 3VVWB 4WJQA 1WXSA 3M95A 4IM3A 3V6EB 2AEHA 4ANVA 4ANWA 3ZKJC 1E8XA 3KW5B 2M17A 2KJ6A 2I1JA 2M0XA 2KLCA 2K1FA 3N32A 4ICUA 3KUDB 2MBOA 4KZ0A 2LUEA 2MBBB 1KJTA 2DHZA 4II2B 1TBEA 3ZVVA 3NOBA 4K7UA 2N1VA 3WA0A 3PRZA 1K8RB 1GG3A 5C23A 5BO4B 1H4RA 3V61A 4TUUA 5G55A 2BPSA 1WX9A 2UYZB 4FLHA 1E5WA 3T8MA 3PLUA 1WRDB 3VAWA 4HXDA 3VH4B 4PYUA 3IHPC 3V62A 3ML9A 3B1LX 3VH3B 2K8HA 1U4AA 3MJWA 3T9LA 2N9XA 3DPDA 2BKFA 1WFYA 2CHXA 3L13A 3NZSA 4W9DA 2KFKA 5CX3A 1S1QB 1I42A 4G0NB 3DVGX 2M1MA 3DBSA 1V49A 3JSVA 1BT0A 1SGHA 1WY8A 3DBRI 2CHWA 3DVGY 1UBQA 3QIJA 2CS4A 3JVZX 2MSED 2D3GA 1WM3A 2K8CA 3RULA 3ZNHB 4LCDE 2IO1B 3NHEB 1LXDA 4G11A 2LJ5A 2NS5A 3M3JA 2O2VA 4W9JA 3UQBA 2N7DA 3H7SA 2FAZA 3A9JB 4FADA 1JRUA 1LQBA 4GDKB 1T0YA 4BFRA 3QK0A 3V6CB 1J8CA 4FHKA 1YX6B 4JQWC 5TR5A 3ZO5B 5L95C 1WX7A 4WJNA 3RUIB 4DBGA 1MG8A 1UELA 2KDEB 3ML8A 3PREA 4LDTD 1WMHB 1OEYJ 1Q5WB 4X57B 2N1WA 1WI0A 3APDA 4B95A 2LXAA 2LGYA 4EZKA 2AL6A 2G4SA 4LDTB 3L16A 3A1QB 2NR2A 1V2YA 4NQLB 2MRPA 3VHTC 1GC6A 2J0MA 5KHQA 5GMVA 1J19A 2QHOA 3QX1A 4MGZE 4W9LA 3PLVA 4MSMB 2LZ6A 3BY4B 3TL5A 1TGZB 2J0JA 4URKA 1KM7A 2C7HA 4MDKE 2KK8A 4DHJD 3U8ZA 2KDFB 1P1AA 4OVUA 1P0RA 2KQ7A 3QC8B 1A5RA 2IY1B 2NPTB 4MSQB 4W9EA 3RCZA 4GXBA 1YX5B 1PQSA 2ZPNA 4W9GA 4EZJA 2LD9A 2O6VD 3H7PB 4HWIB 3UF8A 1KOTA 1YD8U 3DVNV 4FJZA 3K9OB 5CHFA 3TBLD 3AU5A 4IC7B 4MGIE 3DOWA 3PT2B 3ZDMC 4GN1A 4BBNF 2RD0A 3WANA 3X23A 1V81A 2XBBC 3Q3FA 2WDTB 2L0FA 3RZWC 2PE6B 4AJWA 2FIDA 2RR9A 4EUTA 1C1YB 2KTRA 1ZW7A 2ZPYA 2ZVOA 5E6NA 3CMMB 4FJYA 3PRPB 5LLIA 3KUZA 4GOCA 5J18A 1GJZA 4F8CB 2MP2A 2NVUI 2AYOB 4E74A 4AP4C 2BGFA 4TKNA 1IP9A 4HCNB 4A3PA 3UGBB 2M4NA 2KTFA 1TTNA 4GSWA 2EKEC 2DAJA 4FA6A 2YVCA 5JZEB 5D7GA 2L05A 2J7QB 4I6NB 1V5TA 2FCMA 2KVRA 2GMIC 2LVOA 3TCAA 2MP2B 2BWES 2ZJDA 4IWOA 1WGYA 2IO2B 5C1ZA 3TMPB 1E7UA 3AI5A 3U30A 3HM3A 1H8CA 5CHWA 3V60A 1R4MI 3LDZE 2V3SA 4PS7A 3UINB 2V1YA 3CF6E 1WYWB 2PJHA 3PHXB 2L8JA 3UQAA 2G45B 2C5LC 3N30A 3QHTA 1WGDA 3DVNU 3VUWA 3A4SC 2CKHB 4NPNA 1L7YA 1WR1A 2JY6A 2KFJA 2JVCA 2O6VA 4ICVA 2L3ZA 3HK0A 2JXXA 3HHMA 4I6PA 3DQVA 2VRRB 5LXHA 4GMVA 2MBQA 2HJ8A 2KMAA
chains in the Genus database with same CATH superfamily
3GB1A 1KFYB 5IA7A 4KV2A 4RF0A 1WF9A 5FK9C 2WXOA 3E56A 1TS2A 3VQIA 2QIEB 4ANXA 2ON8A 2A4ZA 2WXNA 1HE8A 2W9NA 2WXMA 3ZTDA 2N7EA 1NYRA 1UNSA 1WMHA 3VXWA 4WJOA 1WE6A 2ZCCA 3MJ5A 5DPRA 1DOXA 4II3B 3VFKA 1QOFA 1P3QU 2DZMA 4LNOA 4HPLB 3CSFA 5HI1A 4L1BA 3P4RB 3ENEA 1FEHA 4CQNA 3Q8BA 3SFEB 2D2QA 3ZXRA 3APCA 4XX5A 1SE9A 4A6QA 2M19A 1XT9B 4WIPA 4RNAA 4GLSC 1NVID 2JPHA 3DDCB 4HPMB 3IBEA 2CJOA 4OVVA 2KJHB 3ZDTA 4RMAA 3DCGA 2DYOA 4HLEA 2J0KA 4LNIA 3L17A 2LXCA 3N1YC 3FC4A 4J3OD 2W55A 2IBIB 2R2OA 1YQBA 1WZ0A 3PGEA 3KH0A 4KDLB 2Y5BB 2J52A 1E8ZA 2KX3A 4P6VF 1I4XA 5EE1A 2W82A 1R4MB 4MT5A 1P98A 4IUMB 4XC2A 2J4XA 4KX6B 4PS8A 3Q3JA 1PGAA 4AUQC 4K3CA 1IYFA 1ESFA 2JRIB 2MA9B 1P9DU 3SFDB 3WAOA 1WR6E 2LHDA 2BYFA 3JSVB 3FAHA 2NCNA 4NNJB 2LGDA 3RN9C 2IY0B 1BXTA 4KZCA 1NBFC 2K9XA 2KNBA 1OEYA 2FCQA 3H6NA 2RDGA 5AZFA 4ZDVA 3OAWA 5BMGA 1EF5A 3PVLA 2HTME 2PPHA 2PEAA 1E8WA 2KXJA 4NQKE 2I38A 1V8CA 3B9JA 1VZ7A 3DHHC 2X8XX 5AZGA 5E6JA 4HVBA 5CTRC 4CHKA 4MGYE 5GXGB 1C4AA 2CHZA 4XE0A 2FIFA 1SIFA 3Q3OC 1C4PA 2LMCA 5KHOA 2MLBA 3NVWA 2N9EB 4GDLA 4IM0A 1QOAA 2SEBD 3QWZB 2WYQA 1WGHA 4IKGA 2IZVB 1NEKB 2K8BA 2WP9B 3NVZA 2WXLA 1XLPA 4BOSC 4WWNA 1TKEA 2FCSA 2TSSA 2INCC 2BBCA 3R3MA 2N9KA 2DZIA 3NS8A 2FBWB 4J6IA 2FUHB 3IAM1 2KWVB 2DNFA 2WX1A 3AB5A 2PMVA 2H88B 2RPVA 1SBBB 2JYTA 3T3OA 3NS1A 1ACCA 4L2YA 5D6JB 1RRBA 2KWUB 1V1OA 1N62A 5AZHA 4JWSC 4ZOHC 2WX0A 3V05A 1XLQA 2KJRA 2WQYB 2BB6A 3AULA 1FRRA 2LGSA 3LXFA 2REXA 1Y56A 3B0AA 2A5UA 4UDUC 1JRPA 2MBEA 3KYCD 1KF6B 3C0RB 3PZDA 2D3AA 1CMXB 2MJ3A 3GZNI 2RGFA 2ZZPB 1HA5A 3DBLB 1TYGB 4KIKA 4TMAB 3BVZA 1FPYA 5H92C 2NTSA 2KT7A 3DHIC 3J9CA 3ZKJC 3R2TA 2IGHA 2MBBB 2DHZA 3MC0B 3ZVVA 1FO4A 3NOBA 4K7UA 3PRZA 1K8RB 1JMLA 3DWMA 1H4RA 3V61A 2IDYA 1E10A 3I9V1 4OZCA 4PYUA 2VZKB 1ZXIA 1TZOA 3EA6A 1U4AA 5FR3A 3DPDA 1WFYA 2CHXA 3BK2A 5CX3A 4JX1C 1QILA 3DBSA 2ZW0A 1BT0A 1SGHA 2CHWA 3JVZX 2MSED 1J7BA 1RWSA 3A9JB 1WSPA 4BZAA 1J8CA 1KRHA 1I4RA 4FHKA 4RGMA 5TR5A 2AX5A 2PW9A 1D5MC 1ENFA 5MPOA 2WU5B 1YJJA 3APDA 4B95A 2LXAA 2RMMA 4LDTB 4N58A 3L16A 1PGBA 1K52A 2NR2A 2J0MA 2DWQA 3ZQ4A 4W9LA 3PLVA 2LZ6A 2RDBC 5C3JB 3NJTA 2C7HA 4YTNB 1AWDA 4DHJD 5IN7A 4OVUA 2KQ7A 3QC8B 3FILA 2LUMA 1FCCC 4MSQB 5EE0A 3RCZA 3H7PB 4YTMB 1TT5B 3TBLD 4IOIE 4MGIE 2D3CA 2V0GA 3DOWA 5D3IB 2LHEA 1N61A 3N1ZC 3RZWC 3VRAB 2RR9A 4EUTA 2KTRA 4RGOS 3PRPB 3P4PB 1GJZA 4JE3B 2NVUI 3W9CB 3I5JC 4AP4C 3UGBB 4GSWA 4FA6A 5D7GA 4I6NB 3TCAA 4WQMA 1CZPA 1HXYD 5C1ZA 1H8CA 1HEZE 3NRZA 1R4MI 5BMIA 1WYWB 1R4NB 2PJHA 2L8JA 3UQAA 2UU7A 3VUWA 1N6ZA 3A4SC 3CWIA 2JY6A 2KFJA 3RNGC 4ZHOA 2L3ZA 2JXXA 4GMVA 1ZP0B 3ZIMA 4B9KA 4G3XB 1YOVB 3EFUA 3AXCA 2O6VB 3AE8B 3RZFA 4K7WA 2MCNB 4BAXA 4YTPB 4HKZE 2IJ0A 1C9FA 2GBKA 2GBRA 2JZPA 4M8MA 3AE3B 3R8BA 4AQ7A 2KLGA 2Y5CA 1WGKA 3BK1A 2XK5A 4K3BA 3TIXA 4W9FA 2WXRA 1FFUA 1WXMA 3A9KA 2OHFA 3CIRB 2HDEA 1K50A 3ABVB 3DHGC 2K25A 4OZBA 1D5ZC 2BT6A 2N7JA 3VTVA 4XWWA 4OZAA 3DBHI 4P1BC 4IWPA 1SB3C 3U52E 5D3DA 2RSUA 4G50A 2HD5B 3BYTB 4FBJB 2L83A 2MWSB 1JWUD 2C60A 2Z0EB 2NBWB 2KDIA 2DAFA 4MELA 3IXSA 4F7ZA 4DQOC 3HUIA 4HDQA 1UZXB 4EEWA 2DZKA 5D94A 2JZZA 4AJYB 2PTLA 3DBHB 1AARA 2BKRB 4JIOU 1E7VA 2ZNVC 4NAWB 5DPSA 1EUVB 2EELA 2ASQA 3R7RA 2FE8A 2GB1A 4A90A 4IG7B 4YSYB 2YEPB 3A33B 3DWGC 1WGRA 2LI5A 1WX8A 2N9PC 3ZJVA 2KQSA 4A20A 1GC7A 3P4SB 3NZ3A 1BUIC 2BYEA 3JYUA 2KC2A 2ZEQA 2WHIA 4KKIA 4C4VB 1JALA 1YJ1A 2KWDA 3UIPB 2WXIA 1I4HA 1E9MA 5L83A 4BKSD 4MGKE 2KD0A 4REZA 3W1YA 2NTTA 1S3SG 4PK1A 1T6BX 2KN4A 5BMHA 3DBLI 3KLSX 2AQ3B 2M0AA 1WXVA 1YNTE 3ZLZA 1KH0A 2DYMA 2V4LA 1E6EB 4BKSA 1AW7A 2MX2A 3NY5A 3BINA 3WAPA 1V1PA 4GDLB 2NBVB 3NUHB 4PS3A 4KSKC 1UD7A 3EC8A 4RH6A 4A9AA 2R61A 4ARIA 1LM8B 3FKYA 3U4EG 2UWQA 2M56B 4I6LB 1RFAA 3Q14C 5E6PA 4M00A 3Q8EA 3I3TB 4WAAA 3MHZA 2QMTA 1L4DB 2I1KA 1EF1A 1XD3B 5TSSA 5HKHA 2JRHA 2KDMA 4IDIA 3SU8X 3PPAA 3GP7A 3L0WB 5IKCM 3PZ7A 1WM2A 3ZXVA 3PO0A 3EGRA 2WLBA 4NAWA 2L76A 1CQVA 3PRMB 1NI2A 4LLGM 4M02A 4WQOB 3RMKC 3QJZA 2Z8LA 3WIMA 2MH7A 2LRWA 4LNFA 3Q3MC 1VRAB 5J2RA 3TUOA 2FNJB 2EMTA 1JQ4A 3AEBB 4GU2A 3KVFB 1I35A 3NG0A 1FNVA 3QCAA 1WIAA 2EKIA 4K1RB 3NVVA 4HJKA 1TS5A 2R2QA 2ZCBA 4RCOA 1D5XC 3B08A 3L08A 4A8XC 2XEWA 3M62B 4ITKA 1WJNA 1MHXA 1N5XA 3AMZA 1L6UA 4TQ1A 1P7FA 5EE9A 4LK0M 4NJ6A 1GUAB 5DPTA 4EFOA 5EDSA 2DZJA 3KUCB 1UGJA 2ONQA 1YQ3B 1V1PB 3TEWA 3V6EB 2AEHA 4ANWA 2VH2A 3EUB2 3KW5B 2M0XA 2KLCA 3KUDB 2MBOA 4NAMA 4KZ0A 2V4IB 4C4VA 1TBEA 2N1VA 3WA0A 2KVZA 1YN5A 2DBYA 4TUUA 1RYJA 3IHPC 3ML9A 3VH3B 4D2KA 3T9LA 3NZSA 3L13A 4W9DA 1S1QB 1I42A 4G0NB 1YN4A 3DBRI 2GRIA 3QIJA 2CS4A 3RULA 3Q69A 1PGXA 2LJ5A 3M3JA 3H7SA 3AEGB 4FADA 1JRUA 1T0YA 3RUIB 3AEFB 4XDDA 3ML8A 3PREA 4H2AA 1WMHB 1OEYJ 2LFIA 1L6VA 2IGDA 2AL6A 3O13A 3A1QB 4NQLB 2QEJC 3VHTC 5GMVA 3RNEC 1J19A 3QX1A 3BY4B 1VJKA 1TGZB 4MM3B 2H89B 1EU3A 2KK8A 4HJGE 2KDFB 1IGDA 3BIID 3PZ8A 1STEA 2QILA 2LD9A 4YWGG 4HWIB 3UF8A 2WNMA 4FJZA 2J53A 1SXTA 3AU5A 3I63C 4MACA 3ZDMC 3X23A 4XWTA 2BQQA 2WDTB 1FRDA 2N0SB 2L0FA 4AJWA 2INNE 5AUKA 3ZJUA 1GPXA 2ICIA 1C1YB 2ZVOA 3BZDB 4F8CB 1CK1A 2MP2A 2L52A 4C56C 4E74A 2BGFA 1M4VA 3U2SC 3E9SA 4A3PA 3LYYA 2J7QB 4C00A 1V5TA 2FCMA 2I2YA 3RNBC 1F0ZA 2BWES 2ZJDA 4IWOA 4S0RA 1TKGA 1DOYA 1JWMD 1EM7A 1IUEA 3PHXB 1YN3A 2C5LC 1EWYC 3QHTA 3W2DA 3DVNU 1T5XD 4NPNA 3UI3A 2JVCA 4ICVA 3IAS1 4MH8A 1RM6C 5BYQA 4I6PA 3AE7B 3DQVA 5LXHA 3ZYYX 2MBQA 2HJ8A 3BVMA 3N3KB 3BWUD 4W9CA 3OG5A 1XXGA 2DYBA 4P7IA 1SF0A 1GB4A 3GE3C 1V6EA 4US8A 2KX0A 4GIVA 3UIOB 2LRUA 4KIKB 1C79A 2WXPA 1UH6A 2GBMA 3QAQA 2GI9A 4DXAB 2PVGC 2IGGA 3AE6B 5HG2A 1Q0WB 2AL3A 4BBNC 3IT6B 4R3DA 1VCBA 2VH1A 2WDQB 1AYFA 2JWZA 2LVQA 4PYZA 3SR6A 2N9LA 5IAAC 3TEXA 1GOZA 3APFA 1V5OA 5DPWA 2LGXA 4IM2A 5CHVC 1E90A 1XLOA 2HE7A 5LXIB 1P7EA 2DENB 1FCLA 2C7MB 2PIAA 2MW5A 4W9IA 4DXGA 4DHZB 4KSLC 4K7SA 2KC1A 1TIFA 4KDIC 2C7NB 2KMMA 4MJSA 3RD2A 3OJ3A 3PHWB 4XDCA 4RFBA 2AQ1B 2JU6X 4FHJA 4NZLB 4GB9A 2LJIA 3MC8A 2MEKA 3HVDA 2INPE 4PT5A 1I4GA 2ZNVB 2K39A 3IFWB 2WXHA 4EZLA 2KYWA 4AS1A 4MJSB 3U7DA 4B0EA 3BVGA 2L1AA 3MTNB 5LNK1 2JUOA 4EKUA 2WS3B 3P4QB 4ZRJA 2KAJA 3SD5A 1Y8RC 2M8SA 3L10B 4HRSA 1MVKA 3VTWA 4IW0A 1GAQB 2YLMA 5HHDG 1XEEA 1Q1OA 2OOBB 1V9JA 1WH3A 1EO6A 4ZRQA 4F1SA 1C3TA 4DHJB 2LWPA 1GB1A 4LTUA 1OQRA 4LJOB 2HTHA 4W9KA 4DK5A 1TKYA 3LB8C 2K6QA 1WJ4A 2MHJA 2DX5B 1CJEA 2BYVE 1QKZA 2D11A 1DOIA 1UGMA 3X0WA 3ZNGC 1D6EC 4Q2JA 4M0WB 5G5GA 2WU2B 3ZRFA 4C7YA 5BYRA 3GOEA 4WWOA 1MI0A 4KKJA 3W5UB 4HCPB 4TQ0A 1WZ3A 3W1SA 1JWAD 4FJVB 1VD2A 1QQRA 4TSSA 1TY0A 2BB5A 3R66C 1ISNA 3IVFA 3TJPA 3LJ3A 5FR6A 3AE4B 1M94A 1RAXA 4LJPB 4MH0E 2K5PA 2Z59B 2RPQA 1L0YB 2BYTA 3JW0X 4LNNA 1YQ4B 4JLCA 1WGGA 2ZVNA 3P1MA 3A9KB 3NZUA 4A3OA 3ECIA 4M0WA 3PS6A 3EFCA 1L0VB 2Y3AA 3T3NA 1TS4A 3A4RA 4AOFA 3ZRCA 1FFVA 4GGQA 2PE9A 2JF5A 3DBRB 1ZGUB 2WWZA 3SHQA 1V80A 5JH5C 3ZW3A 4RF1A 3ZJTA 1I4PA 3OJ4B 4EOYA 4EE2A 2MBHA 4NJCA 4BKTA 2BWFA 2KACA 1LFDA 3EECA 4BVUC 4DDGD 1FD6A 4RM9A 3B2FA 2XK5B 2B76B 1RLFA 1T0QC 4ANUA 2WXJA 1SSNA 4DHZE 1NI3A 1IBXA 3A1QA 4WH4A 3AH7A 3ONSA 1PDXA 1F2RI 1SE2A 2D5GA 2QJLA 1Q10A 3ZNID 4KGRA 2G3QB 2ZW1A 2OJWA 1YJIA 4ZRPA 3FILB 2JZ3B 2KOXA 1F2RC 2FCNA 1L4ZB 1QT9A 2D07B 1YIWA 4XZ4A 3H1UA 1ZDVA 1ZPSA 4KGSA 3U7ZA 2KDBA 3MHSD 4HEA1 3H8HA 2E6XA 2KFKB 2GOWA 1F9JA 3QA8A 2JT4B 2BVCA 3AM9A 2ACZB 4N9F4 3WAMA 1OQYA 4M01A 1R7SA 1F1HA 1UBIA 4FN2A 3TSSA 1XQQA 4DDID 3QARA 1E0ZA 2KZRA 4CO7A 1NYQA 3VVWB 1WXSA 2KQ4X 2V3PA 1QLBB 1J7CA 4P1CC 2M17A 2KJ6A 2K1FA 1T0SC 1KJTA 4II2B 3Q2AC 1HTOA 2PLPA 5C23A 2BPSA 1WX9A 1XO3A 2BS3B 1E5WA 1PFDA 1WRDB 4HXDA 3VH4B 2OEDA 2QCZA 2K8HA 1ET6A 3MJWA 2N9XA 2KFKA 3KWLA 1LGRA 3DVGX 2BTEA 1V49A 1WY8A 3VR8B 3DVGY 1UBQA 3ZNHB 4LCDE 2IO1B 2O2VA 2HJ1A 2FAZA 3C8YA 1LQBA 4GDKB 3V6CB 1ZE3D 4JQWC 3ZO5B 5L95C 2WXQA 1XLNA 2QDFA 1ZXHA 4DBGA 1N60A 1MG8A 1UELA 2KDEB 1WI0A 1SEBD 2Q5WD 2LGYA 2JWUA 2D3BA 4EZKA 4A55A 4OW0A 5KHQA 2G9HD 2W54A 4MGZE 2QHOA 1OQQA 3TL5A 4O1NA 1C78A 2J0JA 1EU4A 1KTKA 1KM7A 3AV8A 1P1AA 1P0RA 1A5RA 5G5HA 4W9EA 1PQSA 4EZJA 1YD8U 3DVNV 4ZYSA 3Q8AA 4IC7B 2YEPF 1VR9A 4GN1A 4BBNF 1HQRD 2RD0A 2MJDA 4N59A 2JX5A 1WRIA 3MC9A 1ZW7A 2ZPYA 1T3QA 4FJYA 1IBXB 5J18A 4ARCA 3HRDD 4YSXB 1KLGD 2AYOB 1OFFA 4RGNA 5HFYA 3MFGA 3RFZB 4HCNB 5IO9A 1J7AA 2EKEC 2DAJA 2YVCA 1JWSD 2L05A 1I4QA 2KVRA 2LVOA 2GMIC 3RNFC 4XGAB 2IO2B 1JW9D 3TMPB 1E7UA 3AI5A 3U30A 3HM3A 1SJED 5CHWA 3V60A 2K0PA 4PS7A 3UINB 2V1YA 4YSZB 1L7YA 1WR1A 2O6VA 4N6EB 1WWTA 2AQ2B 3HHMA 3WALA 1FXIA 2KMAA 4E71A 3AE9B 3HM6X 1HZ6A 1Z2MA 3P42A 1WE7A 2JXTA 2Z0DB 1QOGA 4WWPA 3PSEB 3V3XA 3HVZA 3M63B 1WJ6A 1B1ZA 2O2VB 1DGJA 1KLVA 5BYSA 1FNWA 5IP4D 2VZKD 5C2TB 3AEDB 3VUXA 1VZ6A 4BKGA 1F77A 3RT3B 1K53A 2LEKA 1E7PB 4GDKA 4MEMA 4P16A 3HIZA 1TS3A 2KO3A 2IO3B 4ZHPA 1N63A 1VDVA 5T8IA 1WXAA 3CSTA 2CU3A 2PVOD 4FULA 2Y5PA 4KVGB 2MQJA 2KN5A 1SIJA 5AEKB 1UWXA 3I57A 1D3ZA 2NBUA 4ZRKA 1FXTB 1NENB 3RYTA 2J42A 3EHVA 5E6OA 3TEYA 4HKQA 2D10A 1R4NI 1QOBA 2L32A 1E8YA 3PV1A 4LNKA 1OGWA 1B9RA 2IO0B 4RM8A 3R2IA 2N4FA 3AECB 1TZ1A 4OHJA 3VUYA 3VR9B 2WDVB 3QQ8B 1MG4A 3N1XC 1ZKHA 1ZUD2 4DXFA 2BF8B 3UQBA 3NVYA 2X38A 2B3AA 1TJEA 5H8YE 4ZRIA 1WXQA 1JWBD 3KWVA 4C80A 4S17A 1PYWD 2GBJA 3GS2A 3VTUA 1QZEA 1L5PA 1SE4A 3L54A 1HZ5A 2KMCA 3D32A 3RNAC 1L0XB 4CYEA 3AE2B 2LASA 3N9YC 1FM0D 4MM3A 3ZUNA 4NJ7A 1I7HA 1F52A 2KANA 1SE3A 1GNUA 4XYCA 2L7RA 3N20C 4YL8A 3Q3NC 2FUG1 1WJUA 4W9HA 3VRBB 4WJPA 5JHAA 5J17A 4K81A 1J0GA 1UF0A 4YXDB 2DLBA 2KTRB 1NDDA 2INDC 2KWCA 1XCTL 5DCNA 4OVZA 1L2NA 3IT4B 1FNUA 5JHBA 3H9DA 1OTRB 5IOIA 4HPPA 2E3TA 3ZGZA 1ROEA 1YMHE 4NY0A 3ZTCA 2CR5A 1FXAA 4ZYNA 1IPGA 1ZOYB 2RDHA 4RGTA 2NMQA 1DYQA 2GBNA 2BW2A 4AWJA 2EMSA 4TV3A 4YT0B 4JL9A 3GE8C 4DWFA 3OWEB 2LVPA 1TY2A 3H7PA 2C9WB 5G2NA 3AU4A 3ZNZB 1MHHE 3P2BA 2L00B 3KYDD 2MJEA 3A9JA 3R7QA 1RFKA 3AE1B 2WGSA 2L0TA 3AE5B 3B2GA 4HDOA 3VDZA 2KKCA 1UWMA 2KHWB 3OLMD 2OJRA 5JXVA 4BOZB 3IG3A 3L4PA 3GZNB 3ALBA 4HK2A 1FMAD 1G6JA 2V3NA 1Z5SB 4US9A 1IGCA 4B6WA 5D2MB 4WAFA 4IWQA 2CU1A 1MPEA 2K6DB 2SAKA 3K9PB 1ET9A 2BS2B 1N5WA 2JSVX 2WXGA 2GLSA 1XF5L 3O65B 2WXKA 2K22A 3W1SC 1V97A 4JGHB 3WCQA 3SDLC 1XCQL 4M8NA 4ASWC 3S2AA 1C76A 4C7ZA 3Q6BA 2XN9C 2AWTA 4KGTA 2NPTA 5FKAC 4E3CA 3C19A 1V86A 2G4DB 1EWCA 3PTFC 2IYDB 1X1MA 4WJQA 3M95A 4IM3A 4ANVA 4JWUC 2LGIA 1A70A 1E8XA 2I1JA 4ICUA 1UUPA 3N32A 3Q8CA 2LUEA 4B0MA 4ACFA 1FIQA 1GG3A 5BO4B 3ETRA 5G55A 3Q8FA 2UYZB 4FLHA 3T8MA 3PLUA 1C4CA 4QAYA 3RNCC 3VAWA 3V62A 2IPKD 3B1LX 1C77A 2QC8A 2BKFA 2M1MA 3JSVA 2V9HA 1PUTA 2D3GA 1WM3A 2K8CA 3AEAB 3RI7C 3NHEB 1LXDA 4G11A 4W9JA 2NS5A 2N7DA 2K3UA 4BFRA 3QK0A 2JYEA 1YX6B 1WX7A 4WJNA 1KLUD 4LDTD 1Q5WB 2PKOA 4X57B 2N1WA 5EE3A 1AN8A 2G4SA 3P63A 3RPFC 2JQRB 1VLBA 1V2YA 2MRPA 1GC6A 4WURA 1WYGA 1ZDXA 3BYYB 4MSMB 2G1EA 4URKA 5I4DA 4MDKE 1JROA 1LO5D 3U8ZA 1VZ8A 4WWMA 2IY1B 3AN1A 2NPTB 4GXBA 1YX5B 2ZPNA 4W9GA 4L23A 2O6VD 1KOTA 1QF6A 2W3SA 5CHFA 3K9OB 3URYA 4FXCA 1MJDA 2QSDA 3PT2B 3WANA 1V81A 1BMLC 2XBBC 3Q3FA 3TEZA 1MFWA 2PE6B 2FIDA 3SEBA 5E6NA 3CMMB 5LLIA 3KUZA 4GOCA 3KQ4A 2CJNA 2W3RA 5AUIA 2WXFA 4TKNA 1IP9A 1T0RC 4USAA 2M4NA 3MP9A 2KTFA 1TTNA 5JZEB 4HROA 1K51A 2MP2B 1JCKB 1WGYA 4JPSA 3LDZE 2V3SA 3CF6E 1SJHD 2G45B 3N30A 1WGDA 2BS4B 2CKHB 1HTQA 2WDRB 3W5VB 3HK0A 2XNAC 2VRRB 1D4BA 3AEEB
chains in the Genus database with same CATH topology
3N3KB 4E71A 4W9CA 3HM6X 3ZIMA 1Z2MA 4B9KA 4G3XB 1WE7A 3EFUA 5IA7A 2Z0DB 3AXCA 4WWPA 2O6VB 2DYBA 3PSEB 4P7IA 3M63B 4KV2A 3RZFA 4K7WA 1V6EA 2MCNB 1WJ6A 1WF9A 2O2VB 2KX0A 1KLVA 4GIVA 3VQIA 2GBKA 2GBRA 3UIOB 2LRUA 4KIKB 4M8MA 4ANXA 1UH6A 2GBMA 3QAQA 2A4ZA 3VUXA 1HE8A 4DXAB 2W9NA 4BKGA 2KLGA 3ZTDA 2N7EA 1Q0WB 2AL3A 4BBNC 3RT3B 1VCBA 1WMHA 3VXWA 4WJOA 2XK5A 3TIXA 1WE6A 4W9FA 2ZCCA 2JWZA 2LVQA 4PYZA 5DPRA 5IAAC 1WXMA 4II3B 3VFKA 3A9KA 3APFA 1P3QU 1V5OA 2DZMA 4GDKA 4MEMA 5DPWA 2LGXA 4IM2A 5CHVC 1E90A 3HIZA 4HPLB 5LXIB 2HE7A 3CSFA 2KO3A 2DENB 2IO3B 2C7MB 2MW5A 2K25A 4W9IA 1WXAA 3CSTA 4DHZB 4KSLC 4K7SA 2KC1A 4FULA 3ENEA 4KDIC 2C7NB 4MJSA 3VTVA 3RD2A 4KVGB 3OJ3A 2MQJA 3PHWB 2KN5A 3DBHI 4FHJA 4IWPA 4GB9A 5AEKB 2D2QA 3APCA 4XX5A 2RSUA 1SE9A 4G50A 1D3ZA 2HD5B 4FBJB 2NBUA 2MWSB 4ZRKA 1FXTB 1XT9B 2C60A 2NBWB 2Z0EB 2ZNVB 2KDIA 2DAFA 2K39A 4MELA 3IFWB 2JPHA 3DDCB 3RYTA 4HPMB 3EHVA 3IBEA 4EZLA 4F7ZA 4OVVA 2KJHB 5E6OA 3ZDTA 4RMAA 3DCGA 4HDQA 2D10A 2DYOA 1UZXB 4EEWA 1R4NI 4MJSB 2DZKA 4HLEA 1E8YA 2J0KA 2JZZA 3PV1A 5D94A 3U7DA 4AJYB 3L17A 1OGWA 2IO0B 4RM8A 2N4FA 2LXCA 1TZ1A 3VUYA 3QQ8B 3MTNB 1AARA 2JUOA 1ZKHA 4EKUA 2IBIB 2R2OA 2BF8B 1YQBA 2BKRB 4JIOU 4ZRJA 1WZ0A 1E7VA 3PGEA 3SD5A 1Y8RC 2B3AA 3KH0A 4KDLB 2M8SA 3L10B 2Y5BB 2ZNVC 4NAWB 4ZRIA 5DPSA 1EUVB 1E8ZA 2KX3A 2ASQA 3R7RA 3VTWA 4IW0A 2GBJA 1P98A 3VTUA 2YLMA 4IUMB 1QZEA 4XC2A 4IG7B 3A33B 1Q1OA 2OOBB 2LI5A 1V9JA 1WGRA 3L54A 1WH3A 1EO6A 1WX8A 2N9PC 2KMCA 2KQSA 4PS8A 3Q3JA 1GC7A 4A20A 4F1SA 1C3TA 2BYEA 4AUQC 4DHJB 2LWPA 3D32A 1IYFA 2JRIB 2MA9B 1P9DU 4LJOB 2HTHA 2KC2A 2ZEQA 3JYUA 4W9KA 3WAOA 4CYEA 1WR6E 4DK5A 2LASA 2BYFA 3JSVB 2K6QA 4MM3A 3ZUNA 4NJ7A 2NCNA 1WJ4A 2LGDA 4NNJB 1YJ1A 2DX5B 3UIPB 2KANA 2BYVE 5L83A 2IY0B 2D11A 4BKSD 4MGKE 2KD0A 1UGMA 3W1YA 1GNUA 3X0WA 3ZNGC 4KZCA 4M0WB 3ZRFA 1NBFC 3GOEA 4WWOA 2L7RA 1S3SG 2KNBA 1OEYA 4YL8A 2FCQA 4HCPB 3H6NA 5AZFA 4TQ0A 4ZDVA 1WZ3A 3DBLI 3W1SA 3OAWA 1WJUA 4FJVB 4W9HA 1VD2A 4WJPA 5JHAA 1EF5A 5J17A 3PVLA 4K81A 1WXVA 1J0GA 2PPHA 3R66C 3ZLZA 2PEAA 2KTRB 1NDDA 1E8WA 1ISNA 2DYMA 2KXJA 3IVFA 3TJPA 3LJ3A 4NQKE 5FR6A 2KWCA 2V4LA 1M94A 5DCNA 4BKSA 1RAXA 4LJPB 4MH0E 2Z59B 2MX2A 5AZGA 3NY5A 1L2NA 2RPQA 4HVBA 5CTRC 3BINA 3WAPA 4CHKA 3JW0X 4MGYE 5JHBA 4GDLB 2NBVB 3H9DA 4JLCA 1OTRB 2CHZA 1WGGA 2ZVNA 2FIFA 3A9KB 4PS3A 4KSKC 1UD7A 1SIFA 3EC8A 3NZUA 4A3OA 3ECIA 4NY0A 3PS6A 1LM8B 3ZTCA 2CR5A 5KHOA 2MLBA 3A4RA 2UWQA 4ZYNA 4AOFA 2N9EB 4GDLA 4I6LB 4IM0A 3ZRCA 1RFAA 1IPGA 4GGQA 2PE9A 2JF5A 3QWZB 1ZGUB 2WWZA 5E6PA 1V80A 3SHQA 2WYQA 1WGHA 3I3TB 5JH5C 2IZVB 4WAAA 3ZW3A 2GBNA 2K8BA 4AWJA 3OJ4B 2EMSA 4TV3A 2I1KA 4EOYA 1EF1A 1XD3B 2MBHA 4JL9A 4DWFA 5HKHA 2JRHA 4BKTA 4BOSC 2LVPA 4WWNA 2FCSA 2BWFA 3SU8X 3PPAA 3H7PA 2C9WB 3L0WB 5G2NA 1LFDA 1WM2A 3AU4A 3EECA 3R3MA 3ZNZB 4BVUC 2DZIA 3NS8A 3P2BA 2L00B 4RM9A 4J6IA 4DDGD 3KYDD 2FUHB 4NAWA 3A9JA 2XK5B 1RLFA 2KWVB 2WX1A 3R7QA 4ANUA 2L76A 4DHZE 2L0TA 3PRMB 1NI2A 3A1QA 4HDOA 3VDZA 2KKCA 4WQOB 2KHWB 3OLMD 3ONSA 2OJRA 3QJZA 4BOZB 5D6JB 1RRBA 3IG3A 3ALBA 2KWUB 4HK2A 3WIMA 3ZNID 1G6JA 1Z5SB 2LRWA 5AZHA 4B6WA 5D2MB 5J2RA 2G3QB 2FNJB 4IWQA 2WX0A 2EMTA 2CU1A 4GU2A 3KVFB 2K6DB 1I35A 3K9PB 2JZ3B 2KJRA 3QCAA 1WIAA 3O65B 4K1RB 2KOXA 3AULA 2FCNA 2D07B 3WALA 3W1SC 4HJKA 1YIWA 4XZ4A 4JGHB 2REXA 3H1UA 2R2QA 2ZCBA 3SDLC 3B08A 2KDBA 3B0AA 2A5UA 3MHSD 4M8NA 4ASWC 3S2AA 2KFKB 3L08A 2GOWA 1F9JA 3QA8A 2XEWA 2JT4B 3M62B 2MBEA 3KYCD 4N9F4 3WAMA 1WJNA 3C0RB 3PZDA 4TQ1A 1OQYA 1CMXB 2AWTA 3GZNI 2RGFA 2NPTA 1UBIA 2ZZPB 4FN2A 4E3CA 4NJ6A 1GUAB 1XQQA 4DDID 1V86A 3QARA 2G4DB 5DPTA 2KZRA 3PTFC 4CO7A 4EFOA 5EDSA 2IYDB 2DZJA 1X1MA 4KIKA 3KUCB 3VVWB 4WJQA 1WXSA 3M95A 4IM3A 3V6EB 2AEHA 4ANVA 4ANWA 3ZKJC 1E8XA 3KW5B 2M17A 2KJ6A 2I1JA 2M0XA 2KLCA 2K1FA 3N32A 4ICUA 3KUDB 2MBOA 4KZ0A 2LUEA 2MBBB 1KJTA 2DHZA 4II2B 1TBEA 3ZVVA 3NOBA 4K7UA 2N1VA 3WA0A 3PRZA 1K8RB 1GG3A 5C23A 5BO4B 1H4RA 3V61A 4TUUA 5G55A 2BPSA 1WX9A 2UYZB 4FLHA 1E5WA 3T8MA 3PLUA 1WRDB 3VAWA 4HXDA 3VH4B 4PYUA 3IHPC 3V62A 3ML9A 3B1LX 3VH3B 2K8HA 1U4AA 3MJWA 3T9LA 2N9XA 3DPDA 2BKFA 1WFYA 2CHXA 3L13A 3NZSA 4W9DA 2KFKA 5CX3A 1S1QB 1I42A 4G0NB 3DVGX 2M1MA 3DBSA 1V49A 3JSVA 1BT0A 1SGHA 1WY8A 3DBRI 2CHWA 3DVGY 1UBQA 3QIJA 2CS4A 3JVZX 2MSED 2D3GA 1WM3A 2K8CA 3RULA 3ZNHB 4LCDE 2IO1B 3NHEB 1LXDA 4G11A 2LJ5A 2NS5A 3M3JA 2O2VA 4W9JA 3UQBA 2N7DA 3H7SA 2FAZA 3A9JB 4FADA 1JRUA 1LQBA 4GDKB 1T0YA 4BFRA 3QK0A 3V6CB 1J8CA 4FHKA 1YX6B 4JQWC 5TR5A 3ZO5B 5L95C 1WX7A 4WJNA 3RUIB 4DBGA 1MG8A 1UELA 2KDEB 3ML8A 3PREA 4LDTD 1WMHB 1OEYJ 1Q5WB 4X57B 2N1WA 1WI0A 3APDA 4B95A 2LXAA 2LGYA 4EZKA 2AL6A 2G4SA 4LDTB 3L16A 3A1QB 2NR2A 1V2YA 4NQLB 2MRPA 3VHTC 1GC6A 2J0MA 5KHQA 5GMVA 1J19A 2QHOA 3QX1A 4MGZE 4W9LA 3PLVA 4MSMB 2LZ6A 3BY4B 3TL5A 1TGZB 2J0JA 4URKA 1KM7A 2C7HA 4MDKE 2KK8A 4DHJD 3U8ZA 2KDFB 1P1AA 4OVUA 1P0RA 2KQ7A 3QC8B 1A5RA 2IY1B 2NPTB 4MSQB 4W9EA 3RCZA 4GXBA 1YX5B 1PQSA 2ZPNA 4W9GA 4EZJA 2LD9A 2O6VD 3H7PB 4HWIB 3UF8A 1KOTA 1YD8U 3DVNV 4FJZA 3K9OB 5CHFA 3TBLD 3AU5A 4IC7B 4MGIE 3DOWA 3PT2B 3ZDMC 4GN1A 4BBNF 2RD0A 3WANA 3X23A 1V81A 2XBBC 3Q3FA 2WDTB 2L0FA 3RZWC 2PE6B 4AJWA 2FIDA 2RR9A 4EUTA 1C1YB 2KTRA 1ZW7A 2ZPYA 2ZVOA 5E6NA 3CMMB 4FJYA 3PRPB 5LLIA 3KUZA 4GOCA 5J18A 1GJZA 4F8CB 2MP2A 2NVUI 2AYOB 4E74A 4AP4C 2BGFA 4TKNA 1IP9A 4HCNB 4A3PA 3UGBB 2M4NA 2KTFA 1TTNA 4GSWA 2EKEC 2DAJA 4FA6A 2YVCA 5JZEB 5D7GA 2L05A 2J7QB 4I6NB 1V5TA 2FCMA 2KVRA 2GMIC 2LVOA 3TCAA 2MP2B 2BWES 2ZJDA 4IWOA 1WGYA 2IO2B 5C1ZA 3TMPB 1E7UA 3AI5A 3U30A 3HM3A 1H8CA 5CHWA 3V60A 1R4MI 3LDZE 2V3SA 4PS7A 3UINB 2V1YA 3CF6E 1WYWB 2PJHA 3PHXB 2L8JA 3UQAA 2G45B 2C5LC 3N30A 3QHTA 1WGDA 3DVNU 3VUWA 3A4SC 2CKHB 4NPNA 1L7YA 1WR1A 2JY6A 2KFJA 2JVCA 2O6VA 4ICVA 2L3ZA 3HK0A 2JXXA 3HHMA 4I6PA 3DQVA 2VRRB 5LXHA 4GMVA 2MBQA 2HJ8A 2KMAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N3K B;  4E71 A;  4W9C A;  3HM6 X;  3ZIM A;  1Z2M A;  4B9K A;  4G3X B;  1WE7 A;  3EFU A;  5IA7 A;  2Z0D B;  3AXC A;  4WWP A;  2O6V B;  2DYB A;  3PSE B;  4P7I A;  3M63 B;  4KV2 A;  3RZF A;  4K7W A;  1V6E A;  2MCN B;  1WJ6 A;  1WF9 A;  2O2V B;  2KX0 A;  1KLV A;  4GIV A;  3VQI A;  2GBK A;  2GBR A;  3UIO B;  2LRU A;  4KIK B;  4M8M A;  4ANX A;  1UH6 A;  2GBM A;  3QAQ A;  2A4Z A;  3VUX A;  1HE8 A;  4DXA B;  2W9N A;  4BKG A;  2KLG A;  3ZTD A;  2N7E A;  1Q0W B;  2AL3 A;  4BBN C;  3RT3 B;  1VCB A;  1WMH A;  3VXW A;  4WJO A;  2XK5 A;  3TIX A;  1WE6 A;  4W9F A;  2ZCC A;  2JWZ A;  2LVQ A;  4PYZ A;  5DPR A;  5IAA C;  1WXM A;  4II3 B;  3VFK A;  3A9K A;  3APF A;  1P3Q U;  1V5O A;  2DZM A;  4GDK A;  4MEM A;  5DPW A;  2LGX A;  4IM2 A;  5CHV C;  1E90 A;  3HIZ A;  4HPL B;  5LXI B;  2HE7 A;  3CSF A;  2KO3 A;  2DEN B;  2IO3 B;  2C7M B;  2MW5 A;  2K25 A;  4W9I A;  1WXA A;  3CST A;  4DHZ B;  4KSL C;  4K7S A;  2KC1 A;  4FUL A;  3ENE A;  4KDI C;  2C7N B;  4MJS A;  3VTV A;  3RD2 A;  4KVG B;  3OJ3 A;  2MQJ A;  3PHW B;  2KN5 A;  3DBH I;  4FHJ A;  4IWP A;  4GB9 A;  5AEK B;  2D2Q A;  3APC A;  4XX5 A;  2RSU A;  1SE9 A;  4G50 A;  1D3Z A;  2HD5 B;  4FBJ B;  2NBU A;  2MWS B;  4ZRK A;  1FXT B;  1XT9 B;  2C60 A;  2NBW B;  2Z0E B;  2ZNV B;  2KDI A;  2DAF A;  2K39 A;  4MEL A;  3IFW B;  2JPH A;  3DDC B;  3RYT A;  4HPM B;  3EHV A;  3IBE A;  4EZL A;  4F7Z A;  4OVV A;  2KJH B;  5E6O A;  3ZDT A;  4RMA A;  3DCG A;  4HDQ A;  2D10 A;  2DYO A;  1UZX B;  4EEW A;  1R4N I;  4MJS B;  2DZK A;  4HLE A;  1E8Y A;  2J0K A;  2JZZ A;  3PV1 A;  5D94 A;  3U7D A;  4AJY B;  3L17 A;  1OGW A;  2IO0 B;  4RM8 A;  2N4F A;  2LXC A;  1TZ1 A;  3VUY A;  3QQ8 B;  3MTN B;  1AAR A;  2JUO A;  1ZKH A;  4EKU A;  2IBI B;  2R2O A;  2BF8 B;  1YQB A;  2BKR B;  4JIO U;  4ZRJ A;  1WZ0 A;  1E7V A;  3PGE A;  3SD5 A;  1Y8R C;  2B3A A;  3KH0 A;  4KDL B;  2M8S A;  3L10 B;  2Y5B B;  2ZNV C;  4NAW B;  4ZRI A;  5DPS A;  1EUV B;  1E8Z A;  2KX3 A;  2ASQ A;  3R7R A;  3VTW A;  4IW0 A;  2GBJ A;  1P98 A;  3VTU A;  2YLM A;  4IUM B;  1QZE A;  4XC2 A;  4IG7 B;  3A33 B;  1Q1O A;  2OOB B;  2LI5 A;  1V9J A;  1WGR A;  3L54 A;  1WH3 A;  1EO6 A;  1WX8 A;  2N9P C;  2KMC A;  2KQS A;  4PS8 A;  3Q3J A;  1GC7 A;  4A20 A;  4F1S A;  1C3T A;  2BYE A;  4AUQ C;  4DHJ B;  2LWP A;  3D32 A;  1IYF A;  2JRI B;  2MA9 B;  1P9D U;  4LJO B;  2HTH A;  2KC2 A;  2ZEQ A;  3JYU A;  4W9K A;  3WAO A;  4CYE A;  1WR6 E;  4DK5 A;  2LAS A;  2BYF A;  3JSV B;  2K6Q A;  4MM3 A;  3ZUN A;  4NJ7 A;  2NCN A;  1WJ4 A;  2LGD A;  4NNJ B;  1YJ1 A;  2DX5 B;  3UIP B;  2KAN A;  2BYV E;  5L83 A;  2IY0 B;  2D11 A;  4BKS D;  4MGK E;  2KD0 A;  1UGM A;  3W1Y A;  1GNU A;  3X0W A;  3ZNG C;  4KZC A;  4M0W B;  3ZRF A;  1NBF C;  3GOE A;  4WWO A;  2L7R A;  1S3S G;  2KNB A;  1OEY A;  4YL8 A;  2FCQ A;  4HCP B;  3H6N A;  5AZF A;  4TQ0 A;  4ZDV A;  1WZ3 A;  3DBL I;  3W1S A;  3OAW A;  1WJU A;  4FJV B;  4W9H A;  1VD2 A;  4WJP A;  5JHA A;  1EF5 A;  5J17 A;  3PVL A;  4K81 A;  1WXV A;  1J0G A;  2PPH A;  3R66 C;  3ZLZ A;  2PEA A;  2KTR B;  1NDD A;  1E8W A;  1ISN A;  2DYM A;  2KXJ A;  3IVF A;  3TJP A;  3LJ3 A;  4NQK E;  5FR6 A;  2KWC A;  2V4L A;  1M94 A;  5DCN A;  4BKS A;  1RAX A;  4LJP B;  4MH0 E;  2Z59 B;  2MX2 A;  5AZG A;  3NY5 A;  1L2N A;  2RPQ A;  4HVB A;  5CTR C;  3BIN A;  3WAP A;  4CHK A;  3JW0 X;  4MGY E;  5JHB A;  4GDL B;  2NBV B;  3H9D A;  4JLC A;  1OTR B;  2CHZ A;  1WGG A;  2ZVN A;  2FIF A;  3A9K B;  4PS3 A;  4KSK C;  1UD7 A;  1SIF A;  3EC8 A;  3NZU A;  4A3O A;  3ECI A;  4NY0 A;  3PS6 A;  1LM8 B;  3ZTC A;  2CR5 A;  5KHO A;  2MLB A;  3A4R A;  2UWQ A;  4ZYN A;  4AOF A;  2N9E B;  4GDL A;  4I6L B;  4IM0 A;  3ZRC A;  1RFA A;  1IPG A;  4GGQ A;  2PE9 A;  2JF5 A;  3QWZ B;  1ZGU B;  2WWZ A;  5E6P A;  1V80 A;  3SHQ A;  2WYQ A;  1WGH A;  3I3T B;  5JH5 C;  2IZV B;  4WAA A;  3ZW3 A;  2GBN A;  2K8B A;  4AWJ A;  3OJ4 B;  2EMS A;  4TV3 A;  2I1K A;  4EOY A;  1EF1 A;  1XD3 B;  2MBH A;  4JL9 A;  4DWF A;  5HKH A;  2JRH A;  4BKT A;  4BOS C;  2LVP A;  4WWN A;  2FCS A;  2BWF A;  3SU8 X;  3PPA A;  3H7P A;  2C9W B;  3L0W B;  5G2N A;  1LFD A;  1WM2 A;  3AU4 A;  3EEC A;  3R3M A;  3ZNZ B;  4BVU C;  2DZI A;  3NS8 A;  3P2B A;  2L00 B;  4RM9 A;  4J6I A;  4DDG D;  3KYD D;  2FUH B;  4NAW A;  3A9J A;  2XK5 B;  1RLF A;  2KWV B;  2WX1 A;  3R7Q A;  4ANU A;  2L76 A;  4DHZ E;  2L0T A;  3PRM B;  1NI2 A;  3A1Q A;  4HDO A;  3VDZ A;  2KKC A;  4WQO B;  2KHW B;  3OLM D;  3ONS A;  2OJR A;  3QJZ A;  4BOZ B;  5D6J B;  1RRB A;  3IG3 A;  3ALB A;  2KWU B;  4HK2 A;  3WIM A;  3ZNI D;  1G6J A;  1Z5S B;  2LRW A;  5AZH A;  4B6W A;  5D2M B;  5J2R A;  2G3Q B;  2FNJ B;  4IWQ A;  2WX0 A;  2EMT A;  2CU1 A;  4GU2 A;  3KVF B;  2K6D B;  1I35 A;  3K9P B;  2JZ3 B;  2KJR A;  3QCA A;  1WIA A;  3O65 B;  4K1R B;  2KOX A;  3AUL A;  2FCN A;  2D07 B;  3WAL A;  3W1S C;  4HJK A;  1YIW A;  4XZ4 A;  4JGH B;  2REX A;  3H1U A;  2R2Q A;  2ZCB A;  3SDL C;  3B08 A;  2KDB A;  3B0A A;  2A5U A;  3MHS D;  4M8N A;  4ASW C;  3S2A A;  2KFK B;  3L08 A;  2GOW A;  1F9J A;  3QA8 A;  2XEW A;  2JT4 B;  3M62 B;  2MBE A;  3KYC D;  4N9F 4;  3WAM A;  1WJN A;  3C0R B;  3PZD A;  4TQ1 A;  1OQY A;  1CMX B;  2AWT A;  3GZN I;  2RGF A;  2NPT A;  1UBI A;  2ZZP B;  4FN2 A;  4E3C A;  4NJ6 A;  1GUA B;  1XQQ A;  4DDI D;  1V86 A;  3QAR A;  2G4D B;  5DPT A;  2KZR A;  3PTF C;  4CO7 A;  4EFO A;  5EDS A;  2IYD B;  2DZJ A;  1X1M A;  4KIK A;  3KUC B;  3VVW B;  4WJQ A;  1WXS A;  3M95 A;  4IM3 A;  3V6E B;  2AEH A;  4ANV A;  4ANW A;  3ZKJ C;  1E8X A;  3KW5 B;  2M17 A;  2KJ6 A;  2I1J A;  2M0X A;  2KLC A;  2K1F A;  3N32 A;  4ICU A;  3KUD B;  2MBO A;  4KZ0 A;  2LUE A;  2MBB B;  1KJT A;  2DHZ A;  4II2 B;  1TBE A;  3ZVV A;  3NOB A;  4K7U A;  2N1V A;  3WA0 A;  3PRZ A;  1K8R B;  1GG3 A;  5C23 A;  5BO4 B;  1H4R A;  3V61 A;  4TUU A;  5G55 A;  2BPS A;  1WX9 A;  2UYZ B;  4FLH A;  1E5W A;  3T8M A;  3PLU A;  1WRD B;  3VAW A;  4HXD A;  3VH4 B;  4PYU A;  3IHP C;  3V62 A;  3ML9 A;  3B1L X;  3VH3 B;  2K8H A;  1U4A A;  3MJW A;  3T9L A;  2N9X A;  3DPD A;  2BKF A;  1WFY A;  2CHX A;  3L13 A;  3NZS A;  4W9D A;  2KFK A;  5CX3 A;  1S1Q B;  1I42 A;  4G0N B;  3DVG X;  2M1M A;  3DBS A;  1V49 A;  3JSV A;  1BT0 A;  1SGH A;  1WY8 A;  3DBR I;  2CHW A;  3DVG Y;  1UBQ A;  3QIJ A;  2CS4 A;  3JVZ X;  2MSE D;  2D3G A;  1WM3 A;  2K8C A;  3RUL A;  3ZNH B;  4LCD E;  2IO1 B;  3NHE B;  1LXD A;  4G11 A;  2LJ5 A;  2NS5 A;  3M3J A;  2O2V A;  4W9J A;  3UQB A;  2N7D A;  3H7S A;  2FAZ A;  3A9J B;  4FAD A;  1JRU A;  1LQB A;  4GDK B;  1T0Y A;  4BFR A;  3QK0 A;  3V6C B;  1J8C A;  4FHK A;  1YX6 B;  4JQW C;  5TR5 A;  3ZO5 B;  5L95 C;  1WX7 A;  4WJN A;  3RUI B;  4DBG A;  1MG8 A;  1UEL A;  2KDE B;  3ML8 A;  3PRE A;  4LDT D;  1WMH B;  1OEY J;  1Q5W B;  4X57 B;  2N1W A;  1WI0 A;  3APD A;  4B95 A;  2LXA A;  2LGY A;  4EZK A;  2AL6 A;  2G4S A;  4LDT B;  3L16 A;  3A1Q B;  2NR2 A;  1V2Y A;  4NQL B;  2MRP A;  3VHT C;  1GC6 A;  2J0M A;  5KHQ A;  5GMV A;  1J19 A;  2QHO A;  3QX1 A;  4MGZ E;  4W9L A;  3PLV A;  4MSM B;  2LZ6 A;  3BY4 B;  3TL5 A;  1TGZ B;  2J0J A;  4URK A;  1KM7 A;  2C7H A;  4MDK E;  2KK8 A;  4DHJ D;  3U8Z A;  2KDF B;  1P1A A;  4OVU A;  1P0R A;  2KQ7 A;  3QC8 B;  1A5R A;  2IY1 B;  2NPT B;  4MSQ B;  4W9E A;  3RCZ A;  4GXB A;  1YX5 B;  1PQS A;  2ZPN A;  4W9G A;  4EZJ A;  2LD9 A;  2O6V D;  3H7P B;  4HWI B;  3UF8 A;  1KOT A;  1YD8 U;  3DVN V;  4FJZ A;  3K9O B;  5CHF A;  3TBL D;  3AU5 A;  4IC7 B;  4MGI E;  3DOW A;  3PT2 B;  3ZDM C;  4GN1 A;  4BBN F;  2RD0 A;  3WAN A;  3X23 A;  1V81 A;  2XBB C;  3Q3F A;  2WDT B;  2L0F A;  3RZW C;  2PE6 B;  4AJW A;  2FID A;  2RR9 A;  4EUT A;  1C1Y B;  2KTR A;  1ZW7 A;  2ZPY A;  2ZVO A;  5E6N A;  3CMM B;  4FJY A;  3PRP B;  5LLI A;  3KUZ A;  4GOC A;  5J18 A;  1GJZ A;  4F8C B;  2MP2 A;  2NVU I;  2AYO B;  4E74 A;  4AP4 C;  2BGF A;  4TKN A;  1IP9 A;  4HCN B;  4A3P A;  3UGB B;  2M4N A;  2KTF A;  1TTN A;  4GSW A;  2EKE C;  2DAJ A;  4FA6 A;  2YVC A;  5JZE B;  5D7G A;  2L05 A;  2J7Q B;  4I6N B;  1V5T A;  2FCM A;  2KVR A;  2GMI C;  2LVO A;  3TCA A;  2MP2 B;  2BWE S;  2ZJD A;  4IWO A;  1WGY A;  2IO2 B;  5C1Z A;  3TMP B;  1E7U A;  3AI5 A;  3U30 A;  3HM3 A;  1H8C A;  5CHW A;  3V60 A;  1R4M I;  3LDZ E;  2V3S A;  4PS7 A;  3UIN B;  2V1Y A;  3CF6 E;  1WYW B;  2PJH A;  3PHX B;  2L8J A;  3UQA A;  2G45 B;  2C5L C;  3N30 A;  3QHT A;  1WGD A;  3DVN U;  3VUW A;  3A4S C;  2CKH B;  4NPN A;  1L7Y A;  1WR1 A;  2JY6 A;  2KFJ A;  2JVC A;  2O6V A;  4ICV A;  2L3Z A;  3HK0 A;  2JXX A;  3HHM A;  4I6P A;  3DQV A;  2VRR B;  5LXH A;  4GMV A;  2MBQ A;  2HJ8 A;  2KMA A; 
#chains in the Genus database with same CATH topology
 3GB1 A;  1KFY B;  5IA7 A;  4KV2 A;  4RF0 A;  1WF9 A;  5FK9 C;  2WXO A;  3E56 A;  1TS2 A;  3VQI A;  2QIE B;  4ANX A;  2ON8 A;  2A4Z A;  2WXN A;  1HE8 A;  2W9N A;  2WXM A;  3ZTD A;  2N7E A;  1NYR A;  1UNS A;  1WMH A;  3VXW A;  4WJO A;  1WE6 A;  2ZCC A;  3MJ5 A;  5DPR A;  1DOX A;  4II3 B;  3VFK A;  1QOF A;  1P3Q U;  2DZM A;  4LNO A;  4HPL B;  3CSF A;  5HI1 A;  4L1B A;  3P4R B;  3ENE A;  1FEH A;  4CQN A;  3Q8B A;  3SFE B;  2D2Q A;  3ZXR A;  3APC A;  4XX5 A;  1SE9 A;  4A6Q A;  2M19 A;  1XT9 B;  4WIP A;  4RNA A;  4GLS C;  1NVI D;  2JPH A;  3DDC B;  4HPM B;  3IBE A;  2CJO A;  4OVV A;  2KJH B;  3ZDT A;  4RMA A;  3DCG A;  2DYO A;  4HLE A;  2J0K A;  4LNI A;  3L17 A;  2LXC A;  3N1Y C;  3FC4 A;  4J3O D;  2W55 A;  2IBI B;  2R2O A;  1YQB A;  1WZ0 A;  3PGE A;  3KH0 A;  4KDL B;  2Y5B B;  2J52 A;  1E8Z A;  2KX3 A;  4P6V F;  1I4X A;  5EE1 A;  2W82 A;  1R4M B;  4MT5 A;  1P98 A;  4IUM B;  4XC2 A;  2J4X A;  4KX6 B;  4PS8 A;  3Q3J A;  1PGA A;  4AUQ C;  4K3C A;  1IYF A;  1ESF A;  2JRI B;  2MA9 B;  1P9D U;  3SFD B;  3WAO A;  1WR6 E;  2LHD A;  2BYF A;  3JSV B;  3FAH A;  2NCN A;  4NNJ B;  2LGD A;  3RN9 C;  2IY0 B;  1BXT A;  4KZC A;  1NBF C;  2K9X A;  2KNB A;  1OEY A;  2FCQ A;  3H6N A;  2RDG A;  5AZF A;  4ZDV A;  3OAW A;  5BMG A;  1EF5 A;  3PVL A;  2HTM E;  2PPH A;  2PEA A;  1E8W A;  2KXJ A;  4NQK E;  2I38 A;  1V8C A;  3B9J A;  1VZ7 A;  3DHH C;  2X8X X;  5AZG A;  5E6J A;  4HVB A;  5CTR C;  4CHK A;  4MGY E;  5GXG B;  1C4A A;  2CHZ A;  4XE0 A;  2FIF A;  1SIF A;  3Q3O C;  1C4P A;  2LMC A;  5KHO A;  2MLB A;  3NVW A;  2N9E B;  4GDL A;  4IM0 A;  1QOA A;  2SEB D;  3QWZ B;  2WYQ A;  1WGH A;  4IKG A;  2IZV B;  1NEK B;  2K8B A;  2WP9 B;  3NVZ A;  2WXL A;  1XLP A;  4BOS C;  4WWN A;  1TKE A;  2FCS A;  2TSS A;  2INC C;  2BBC A;  3R3M A;  2N9K A;  2DZI A;  3NS8 A;  2FBW B;  4J6I A;  2FUH B;  3IAM 1;  2KWV B;  2DNF A;  2WX1 A;  3AB5 A;  2PMV A;  2H88 B;  2RPV A;  1SBB B;  2JYT A;  3T3O A;  3NS1 A;  1ACC A;  4L2Y A;  5D6J B;  1RRB A;  2KWU B;  1V1O A;  1N62 A;  5AZH A;  4JWS C;  4ZOH C;  2WX0 A;  3V05 A;  1XLQ A;  2KJR A;  2WQY B;  2BB6 A;  3AUL A;  1FRR A;  2LGS A;  3LXF A;  2REX A;  1Y56 A;  3B0A A;  2A5U A;  4UDU C;  1JRP A;  2MBE A;  3KYC D;  1KF6 B;  3C0R B;  3PZD A;  2D3A A;  1CMX B;  2MJ3 A;  3GZN I;  2RGF A;  2ZZP B;  1HA5 A;  3DBL B;  1TYG B;  4KIK A;  4TMA B;  3BVZ A;  1FPY A;  5H92 C;  2NTS A;  2KT7 A;  3DHI C;  3J9C A;  3ZKJ C;  3R2T A;  2IGH A;  2MBB B;  2DHZ A;  3MC0 B;  3ZVV A;  1FO4 A;  3NOB A;  4K7U A;  3PRZ A;  1K8R B;  1JML A;  3DWM A;  1H4R A;  3V61 A;  2IDY A;  1E10 A;  3I9V 1;  4OZC A;  4PYU A;  2VZK B;  1ZXI A;  1TZO A;  3EA6 A;  1U4A A;  5FR3 A;  3DPD A;  1WFY A;  2CHX A;  3BK2 A;  5CX3 A;  4JX1 C;  1QIL A;  3DBS A;  2ZW0 A;  1BT0 A;  1SGH A;  2CHW A;  3JVZ X;  2MSE D;  1J7B A;  1RWS A;  3A9J B;  1WSP A;  4BZA A;  1J8C A;  1KRH A;  1I4R A;  4FHK A;  4RGM A;  5TR5 A;  2AX5 A;  2PW9 A;  1D5M C;  1ENF A;  5MPO A;  2WU5 B;  1YJJ A;  3APD A;  4B95 A;  2LXA A;  2RMM A;  4LDT B;  4N58 A;  3L16 A;  1PGB A;  1K52 A;  2NR2 A;  2J0M A;  2DWQ A;  3ZQ4 A;  4W9L A;  3PLV A;  2LZ6 A;  2RDB C;  5C3J B;  3NJT A;  2C7H A;  4YTN B;  1AWD A;  4DHJ D;  5IN7 A;  4OVU A;  2KQ7 A;  3QC8 B;  3FIL A;  2LUM A;  1FCC C;  4MSQ B;  5EE0 A;  3RCZ A;  3H7P B;  4YTM B;  1TT5 B;  3TBL D;  4IOI E;  4MGI E;  2D3C A;  2V0G A;  3DOW A;  5D3I B;  2LHE A;  1N61 A;  3N1Z C;  3RZW C;  3VRA B;  2RR9 A;  4EUT A;  2KTR A;  4RGO S;  3PRP B;  3P4P B;  1GJZ A;  4JE3 B;  2NVU I;  3W9C B;  3I5J C;  4AP4 C;  3UGB B;  4GSW A;  4FA6 A;  5D7G A;  4I6N B;  3TCA A;  4WQM A;  1CZP A;  1HXY D;  5C1Z A;  1H8C A;  1HEZ E;  3NRZ A;  1R4M I;  5BMI A;  1WYW B;  1R4N B;  2PJH A;  2L8J A;  3UQA A;  2UU7 A;  3VUW A;  1N6Z A;  3A4S C;  3CWI A;  2JY6 A;  2KFJ A;  3RNG C;  4ZHO A;  2L3Z A;  2JXX A;  4GMV A;  1ZP0 B;  3ZIM A;  4B9K A;  4G3X B;  1YOV B;  3EFU A;  3AXC A;  2O6V B;  3AE8 B;  3RZF A;  4K7W A;  2MCN B;  4BAX A;  4YTP B;  4HKZ E;  2IJ0 A;  1C9F A;  2GBK A;  2GBR A;  2JZP A;  4M8M A;  3AE3 B;  3R8B A;  4AQ7 A;  2KLG A;  2Y5C A;  1WGK A;  3BK1 A;  2XK5 A;  4K3B A;  3TIX A;  4W9F A;  2WXR A;  1FFU A;  1WXM A;  3A9K A;  2OHF A;  3CIR B;  2HDE A;  1K50 A;  3ABV B;  3DHG C;  2K25 A;  4OZB A;  1D5Z C;  2BT6 A;  2N7J A;  3VTV A;  4XWW A;  4OZA A;  3DBH I;  4P1B C;  4IWP A;  1SB3 C;  3U52 E;  5D3D A;  2RSU A;  4G50 A;  2HD5 B;  3BYT B;  4FBJ B;  2L83 A;  2MWS B;  1JWU D;  2C60 A;  2Z0E B;  2NBW B;  2KDI A;  2DAF A;  4MEL A;  3IXS A;  4F7Z A;  4DQO C;  3HUI A;  4HDQ A;  1UZX B;  4EEW A;  2DZK A;  5D94 A;  2JZZ A;  4AJY B;  2PTL A;  3DBH B;  1AAR A;  2BKR B;  4JIO U;  1E7V A;  2ZNV C;  4NAW B;  5DPS A;  1EUV B;  2EEL A;  2ASQ A;  3R7R A;  2FE8 A;  2GB1 A;  4A90 A;  4IG7 B;  4YSY B;  2YEP B;  3A33 B;  3DWG C;  1WGR A;  2LI5 A;  1WX8 A;  2N9P C;  3ZJV A;  2KQS A;  4A20 A;  1GC7 A;  3P4S B;  3NZ3 A;  1BUI C;  2BYE A;  3JYU A;  2KC2 A;  2ZEQ A;  2WHI A;  4KKI A;  4C4V B;  1JAL A;  1YJ1 A;  2KWD A;  3UIP B;  2WXI A;  1I4H A;  1E9M A;  5L83 A;  4BKS D;  4MGK E;  2KD0 A;  4REZ A;  3W1Y A;  2NTT A;  1S3S G;  4PK1 A;  1T6B X;  2KN4 A;  5BMH A;  3DBL I;  3KLS X;  2AQ3 B;  2M0A A;  1WXV A;  1YNT E;  3ZLZ A;  1KH0 A;  2DYM A;  2V4L A;  1E6E B;  4BKS A;  1AW7 A;  2MX2 A;  3NY5 A;  3BIN A;  3WAP A;  1V1P A;  4GDL B;  2NBV B;  3NUH B;  4PS3 A;  4KSK C;  1UD7 A;  3EC8 A;  4RH6 A;  4A9A A;  2R61 A;  4ARI A;  1LM8 B;  3FKY A;  3U4E G;  2UWQ A;  2M56 B;  4I6L B;  1RFA A;  3Q14 C;  5E6P A;  4M00 A;  3Q8E A;  3I3T B;  4WAA A;  3MHZ A;  2QMT A;  1L4D B;  2I1K A;  1EF1 A;  1XD3 B;  5TSS A;  5HKH A;  2JRH A;  2KDM A;  4IDI A;  3SU8 X;  3PPA A;  3GP7 A;  3L0W B;  5IKC M;  3PZ7 A;  1WM2 A;  3ZXV A;  3PO0 A;  3EGR A;  2WLB A;  4NAW A;  2L76 A;  1CQV A;  3PRM B;  1NI2 A;  4LLG M;  4M02 A;  4WQO B;  3RMK C;  3QJZ A;  2Z8L A;  3WIM A;  2MH7 A;  2LRW A;  4LNF A;  3Q3M C;  1VRA B;  5J2R A;  3TUO A;  2FNJ B;  2EMT A;  1JQ4 A;  3AEB B;  4GU2 A;  3KVF B;  1I35 A;  3NG0 A;  1FNV A;  3QCA A;  1WIA A;  2EKI A;  4K1R B;  3NVV A;  4HJK A;  1TS5 A;  2R2Q A;  2ZCB A;  4RCO A;  1D5X C;  3B08 A;  3L08 A;  4A8X C;  2XEW A;  3M62 B;  4ITK A;  1WJN A;  1MHX A;  1N5X A;  3AMZ A;  1L6U A;  4TQ1 A;  1P7F A;  5EE9 A;  4LK0 M;  4NJ6 A;  1GUA B;  5DPT A;  4EFO A;  5EDS A;  2DZJ A;  3KUC B;  1UGJ A;  2ONQ A;  1YQ3 B;  1V1P B;  3TEW A;  3V6E B;  2AEH A;  4ANW A;  2VH2 A;  3EUB 2;  3KW5 B;  2M0X A;  2KLC A;  3KUD B;  2MBO A;  4NAM A;  4KZ0 A;  2V4I B;  4C4V A;  1TBE A;  2N1V A;  3WA0 A;  2KVZ A;  1YN5 A;  2DBY A;  4TUU A;  1RYJ A;  3IHP C;  3ML9 A;  3VH3 B;  4D2K A;  3T9L A;  3NZS A;  3L13 A;  4W9D A;  1S1Q B;  1I42 A;  4G0N B;  1YN4 A;  3DBR I;  2GRI A;  3QIJ A;  2CS4 A;  3RUL A;  3Q69 A;  1PGX A;  2LJ5 A;  3M3J A;  3H7S A;  3AEG B;  4FAD A;  1JRU A;  1T0Y A;  3RUI B;  3AEF B;  4XDD A;  3ML8 A;  3PRE A;  4H2A A;  1WMH B;  1OEY J;  2LFI A;  1L6V A;  2IGD A;  2AL6 A;  3O13 A;  3A1Q B;  4NQL B;  2QEJ C;  3VHT C;  5GMV A;  3RNE C;  1J19 A;  3QX1 A;  3BY4 B;  1VJK A;  1TGZ B;  4MM3 B;  2H89 B;  1EU3 A;  2KK8 A;  4HJG E;  2KDF B;  1IGD A;  3BII D;  3PZ8 A;  1STE A;  2QIL A;  2LD9 A;  4YWG G;  4HWI B;  3UF8 A;  2WNM A;  4FJZ A;  2J53 A;  1SXT A;  3AU5 A;  3I63 C;  4MAC A;  3ZDM C;  3X23 A;  4XWT A;  2BQQ A;  2WDT B;  1FRD A;  2N0S B;  2L0F A;  4AJW A;  2INN E;  5AUK A;  3ZJU A;  1GPX A;  2ICI A;  1C1Y B;  2ZVO A;  3BZD B;  4F8C B;  1CK1 A;  2MP2 A;  2L52 A;  4C56 C;  4E74 A;  2BGF A;  1M4V A;  3U2S C;  3E9S A;  4A3P A;  3LYY A;  2J7Q B;  4C00 A;  1V5T A;  2FCM A;  2I2Y A;  3RNB C;  1F0Z A;  2BWE S;  2ZJD A;  4IWO A;  4S0R A;  1TKG A;  1DOY A;  1JWM D;  1EM7 A;  1IUE A;  3PHX B;  1YN3 A;  2C5L C;  1EWY C;  3QHT A;  3W2D A;  3DVN U;  1T5X D;  4NPN A;  3UI3 A;  2JVC A;  4ICV A;  3IAS 1;  4MH8 A;  1RM6 C;  5BYQ A;  4I6P A;  3AE7 B;  3DQV A;  5LXH A;  3ZYY X;  2MBQ A;  2HJ8 A;  3BVM A;  3N3K B;  3BWU D;  4W9C A;  3OG5 A;  1XXG A;  2DYB A;  4P7I A;  1SF0 A;  1GB4 A;  3GE3 C;  1V6E A;  4US8 A;  2KX0 A;  4GIV A;  3UIO B;  2LRU A;  4KIK B;  1C79 A;  2WXP A;  1UH6 A;  2GBM A;  3QAQ A;  2GI9 A;  4DXA B;  2PVG C;  2IGG A;  3AE6 B;  5HG2 A;  1Q0W B;  2AL3 A;  4BBN C;  3IT6 B;  4R3D A;  1VCB A;  2VH1 A;  2WDQ B;  1AYF A;  2JWZ A;  2LVQ A;  4PYZ A;  3SR6 A;  2N9L A;  5IAA C;  3TEX A;  1GOZ A;  3APF A;  1V5O A;  5DPW A;  2LGX A;  4IM2 A;  5CHV C;  1E90 A;  1XLO A;  2HE7 A;  5LXI B;  1P7E A;  2DEN B;  1FCL A;  2C7M B;  2PIA A;  2MW5 A;  4W9I A;  4DXG A;  4DHZ B;  4KSL C;  4K7S A;  2KC1 A;  1TIF A;  4KDI C;  2C7N B;  2KMM A;  4MJS A;  3RD2 A;  3OJ3 A;  3PHW B;  4XDC A;  4RFB A;  2AQ1 B;  2JU6 X;  4FHJ A;  4NZL B;  4GB9 A;  2LJI A;  3MC8 A;  2MEK A;  3HVD A;  2INP E;  4PT5 A;  1I4G A;  2ZNV B;  2K39 A;  3IFW B;  2WXH A;  4EZL A;  2KYW A;  4AS1 A;  4MJS B;  3U7D A;  4B0E A;  3BVG A;  2L1A A;  3MTN B;  5LNK 1;  2JUO A;  4EKU A;  2WS3 B;  3P4Q B;  4ZRJ A;  2KAJ A;  3SD5 A;  1Y8R C;  2M8S A;  3L10 B;  4HRS A;  1MVK A;  3VTW A;  4IW0 A;  1GAQ B;  2YLM A;  5HHD G;  1XEE A;  1Q1O A;  2OOB B;  1V9J A;  1WH3 A;  1EO6 A;  4ZRQ A;  4F1S A;  1C3T A;  4DHJ B;  2LWP A;  1GB1 A;  4LTU A;  1OQR A;  4LJO B;  2HTH A;  4W9K A;  4DK5 A;  1TKY A;  3LB8 C;  2K6Q A;  1WJ4 A;  2MHJ A;  2DX5 B;  1CJE A;  2BYV E;  1QKZ A;  2D11 A;  1DOI A;  1UGM A;  3X0W A;  3ZNG C;  1D6E C;  4Q2J A;  4M0W B;  5G5G A;  2WU2 B;  3ZRF A;  4C7Y A;  5BYR A;  3GOE A;  4WWO A;  1MI0 A;  4KKJ A;  3W5U B;  4HCP B;  4TQ0 A;  1WZ3 A;  3W1S A;  1JWA D;  4FJV B;  1VD2 A;  1QQR A;  4TSS A;  1TY0 A;  2BB5 A;  3R66 C;  1ISN A;  3IVF A;  3TJP A;  3LJ3 A;  5FR6 A;  3AE4 B;  1M94 A;  1RAX A;  4LJP B;  4MH0 E;  2K5P A;  2Z59 B;  2RPQ A;  1L0Y B;  2BYT A;  3JW0 X;  4LNN A;  1YQ4 B;  4JLC A;  1WGG A;  2ZVN A;  3P1M A;  3A9K B;  3NZU A;  4A3O A;  3ECI A;  4M0W A;  3PS6 A;  3EFC A;  1L0V B;  2Y3A A;  3T3N A;  1TS4 A;  3A4R A;  4AOF A;  3ZRC A;  1FFV A;  4GGQ A;  2PE9 A;  2JF5 A;  3DBR B;  1ZGU B;  2WWZ A;  3SHQ A;  1V80 A;  5JH5 C;  3ZW3 A;  4RF1 A;  3ZJT A;  1I4P A;  3OJ4 B;  4EOY A;  4EE2 A;  2MBH A;  4NJC A;  4BKT A;  2BWF A;  2KAC A;  1LFD A;  3EEC A;  4BVU C;  4DDG D;  1FD6 A;  4RM9 A;  3B2F A;  2XK5 B;  2B76 B;  1RLF A;  1T0Q C;  4ANU A;  2WXJ A;  1SSN A;  4DHZ E;  1NI3 A;  1IBX A;  3A1Q A;  4WH4 A;  3AH7 A;  3ONS A;  1PDX A;  1F2R I;  1SE2 A;  2D5G A;  2QJL A;  1Q10 A;  3ZNI D;  4KGR A;  2G3Q B;  2ZW1 A;  2OJW A;  1YJI A;  4ZRP A;  3FIL B;  2JZ3 B;  2KOX A;  1F2R C;  2FCN A;  1L4Z B;  1QT9 A;  2D07 B;  1YIW A;  4XZ4 A;  3H1U A;  1ZDV A;  1ZPS A;  4KGS A;  3U7Z A;  2KDB A;  3MHS D;  4HEA 1;  3H8H A;  2E6X A;  2KFK B;  2GOW A;  1F9J A;  3QA8 A;  2JT4 B;  2BVC A;  3AM9 A;  2ACZ B;  4N9F 4;  3WAM A;  1OQY A;  4M01 A;  1R7S A;  1F1H A;  1UBI A;  4FN2 A;  3TSS A;  1XQQ A;  4DDI D;  3QAR A;  1E0Z A;  2KZR A;  4CO7 A;  1NYQ A;  3VVW B;  1WXS A;  2KQ4 X;  2V3P A;  1QLB B;  1J7C A;  4P1C C;  2M17 A;  2KJ6 A;  2K1F A;  1T0S C;  1KJT A;  4II2 B;  3Q2A C;  1HTO A;  2PLP A;  5C23 A;  2BPS A;  1WX9 A;  1XO3 A;  2BS3 B;  1E5W A;  1PFD A;  1WRD B;  4HXD A;  3VH4 B;  2OED A;  2QCZ A;  2K8H A;  1ET6 A;  3MJW A;  2N9X A;  2KFK A;  3KWL A;  1LGR A;  3DVG X;  2BTE A;  1V49 A;  1WY8 A;  3VR8 B;  3DVG Y;  1UBQ A;  3ZNH B;  4LCD E;  2IO1 B;  2O2V A;  2HJ1 A;  2FAZ A;  3C8Y A;  1LQB A;  4GDK B;  3V6C B;  1ZE3 D;  4JQW C;  3ZO5 B;  5L95 C;  2WXQ A;  1XLN A;  2QDF A;  1ZXH A;  4DBG A;  1N60 A;  1MG8 A;  1UEL A;  2KDE B;  1WI0 A;  1SEB D;  2Q5W D;  2LGY A;  2JWU A;  2D3B A;  4EZK A;  4A55 A;  4OW0 A;  5KHQ A;  2G9H D;  2W54 A;  4MGZ E;  2QHO A;  1OQQ A;  3TL5 A;  4O1N A;  1C78 A;  2J0J A;  1EU4 A;  1KTK A;  1KM7 A;  3AV8 A;  1P1A A;  1P0R A;  1A5R A;  5G5H A;  4W9E A;  1PQS A;  4EZJ A;  1YD8 U;  3DVN V;  4ZYS A;  3Q8A A;  4IC7 B;  2YEP F;  1VR9 A;  4GN1 A;  4BBN F;  1HQR D;  2RD0 A;  2MJD A;  4N59 A;  2JX5 A;  1WRI A;  3MC9 A;  1ZW7 A;  2ZPY A;  1T3Q A;  4FJY A;  1IBX B;  5J18 A;  4ARC A;  3HRD D;  4YSX B;  1KLG D;  2AYO B;  1OFF A;  4RGN A;  5HFY A;  3MFG A;  3RFZ B;  4HCN B;  5IO9 A;  1J7A A;  2EKE C;  2DAJ A;  2YVC A;  1JWS D;  2L05 A;  1I4Q A;  2KVR A;  2LVO A;  2GMI C;  3RNF C;  4XGA B;  2IO2 B;  1JW9 D;  3TMP B;  1E7U A;  3AI5 A;  3U30 A;  3HM3 A;  1SJE D;  5CHW A;  3V60 A;  2K0P A;  4PS7 A;  3UIN B;  2V1Y A;  4YSZ B;  1L7Y A;  1WR1 A;  2O6V A;  4N6E B;  1WWT A;  2AQ2 B;  3HHM A;  3WAL A;  1FXI A;  2KMA A;  4E71 A;  3AE9 B;  3HM6 X;  1HZ6 A;  1Z2M A;  3P42 A;  1WE7 A;  2JXT A;  2Z0D B;  1QOG A;  4WWP A;  3PSE B;  3V3X A;  3HVZ A;  3M63 B;  1WJ6 A;  1B1Z A;  2O2V B;  1DGJ A;  1KLV A;  5BYS A;  1FNW A;  5IP4 D;  2VZK D;  5C2T B;  3AED B;  3VUX A;  1VZ6 A;  4BKG A;  1F77 A;  3RT3 B;  1K53 A;  2LEK A;  1E7P B;  4GDK A;  4MEM A;  4P16 A;  3HIZ A;  1TS3 A;  2KO3 A;  2IO3 B;  4ZHP A;  1N63 A;  1VDV A;  5T8I A;  1WXA A;  3CST A;  2CU3 A;  2PVO D;  4FUL A;  2Y5P A;  4KVG B;  2MQJ A;  2KN5 A;  1SIJ A;  5AEK B;  1UWX A;  3I57 A;  1D3Z A;  2NBU A;  4ZRK A;  1FXT B;  1NEN B;  3RYT A;  2J42 A;  3EHV A;  5E6O A;  3TEY A;  4HKQ A;  2D10 A;  1R4N I;  1QOB A;  2L32 A;  1E8Y A;  3PV1 A;  4LNK A;  1OGW A;  1B9R A;  2IO0 B;  4RM8 A;  3R2I A;  2N4F A;  3AEC B;  1TZ1 A;  4OHJ A;  3VUY A;  3VR9 B;  2WDV B;  3QQ8 B;  1MG4 A;  3N1X C;  1ZKH A;  1ZUD 2;  4DXF A;  2BF8 B;  3UQB A;  3NVY A;  2X38 A;  2B3A A;  1TJE A;  5H8Y E;  4ZRI A;  1WXQ A;  1JWB D;  3KWV A;  4C80 A;  4S17 A;  1PYW D;  2GBJ A;  3GS2 A;  3VTU A;  1QZE A;  1L5P A;  1SE4 A;  3L54 A;  1HZ5 A;  2KMC A;  3D32 A;  3RNA C;  1L0X B;  4CYE A;  3AE2 B;  2LAS A;  3N9Y C;  1FM0 D;  4MM3 A;  3ZUN A;  4NJ7 A;  1I7H A;  1F52 A;  2KAN A;  1SE3 A;  1GNU A;  4XYC A;  2L7R A;  3N20 C;  4YL8 A;  3Q3N C;  2FUG 1;  1WJU A;  4W9H A;  3VRB B;  4WJP A;  5JHA A;  5J17 A;  4K81 A;  1J0G A;  1UF0 A;  4YXD B;  2DLB A;  2KTR B;  1NDD A;  2IND C;  2KWC A;  1XCT L;  5DCN A;  4OVZ A;  1L2N A;  3IT4 B;  1FNU A;  5JHB A;  3H9D A;  1OTR B;  5IOI A;  4HPP A;  2E3T A;  3ZGZ A;  1ROE A;  1YMH E;  4NY0 A;  3ZTC A;  2CR5 A;  1FXA A;  4ZYN A;  1IPG A;  1ZOY B;  2RDH A;  4RGT A;  2NMQ A;  1DYQ A;  2GBN A;  2BW2 A;  4AWJ A;  2EMS A;  4TV3 A;  4YT0 B;  4JL9 A;  3GE8 C;  4DWF A;  3OWE B;  2LVP A;  1TY2 A;  3H7P A;  2C9W B;  5G2N A;  3AU4 A;  3ZNZ B;  1MHH E;  3P2B A;  2L00 B;  3KYD D;  2MJE A;  3A9J A;  3R7Q A;  1RFK A;  3AE1 B;  2WGS A;  2L0T A;  3AE5 B;  3B2G A;  4HDO A;  3VDZ A;  2KKC A;  1UWM A;  2KHW B;  3OLM D;  2OJR A;  5JXV A;  4BOZ B;  3IG3 A;  3L4P A;  3GZN B;  3ALB A;  4HK2 A;  1FMA D;  1G6J A;  2V3N A;  1Z5S B;  4US9 A;  1IGC A;  4B6W A;  5D2M B;  4WAF A;  4IWQ A;  2CU1 A;  1MPE A;  2K6D B;  2SAK A;  3K9P B;  1ET9 A;  2BS2 B;  1N5W A;  2JSV X;  2WXG A;  2GLS A;  1XF5 L;  3O65 B;  2WXK A;  2K22 A;  3W1S C;  1V97 A;  4JGH B;  3WCQ A;  3SDL C;  1XCQ L;  4M8N A;  4ASW C;  3S2A A;  1C76 A;  4C7Z A;  3Q6B A;  2XN9 C;  2AWT A;  4KGT A;  2NPT A;  5FKA C;  4E3C A;  3C19 A;  1V86 A;  2G4D B;  1EWC A;  3PTF C;  2IYD B;  1X1M A;  4WJQ A;  3M95 A;  4IM3 A;  4ANV A;  4JWU C;  2LGI A;  1A70 A;  1E8X A;  2I1J A;  4ICU A;  1UUP A;  3N32 A;  3Q8C A;  2LUE A;  4B0M A;  4ACF A;  1FIQ A;  1GG3 A;  5BO4 B;  3ETR A;  5G55 A;  3Q8F A;  2UYZ B;  4FLH A;  3T8M A;  3PLU A;  1C4C A;  4QAY A;  3RNC C;  3VAW A;  3V62 A;  2IPK D;  3B1L X;  1C77 A;  2QC8 A;  2BKF A;  2M1M A;  3JSV A;  2V9H A;  1PUT A;  2D3G A;  1WM3 A;  2K8C A;  3AEA B;  3RI7 C;  3NHE B;  1LXD A;  4G11 A;  4W9J A;  2NS5 A;  2N7D A;  2K3U A;  4BFR A;  3QK0 A;  2JYE A;  1YX6 B;  1WX7 A;  4WJN A;  1KLU D;  4LDT D;  1Q5W B;  2PKO A;  4X57 B;  2N1W A;  5EE3 A;  1AN8 A;  2G4S A;  3P63 A;  3RPF C;  2JQR B;  1VLB A;  1V2Y A;  2MRP A;  1GC6 A;  4WUR A;  1WYG A;  1ZDX A;  3BYY B;  4MSM B;  2G1E A;  4URK A;  5I4D A;  4MDK E;  1JRO A;  1LO5 D;  3U8Z A;  1VZ8 A;  4WWM A;  2IY1 B;  3AN1 A;  2NPT B;  4GXB A;  1YX5 B;  2ZPN A;  4W9G A;  4L23 A;  2O6V D;  1KOT A;  1QF6 A;  2W3S A;  5CHF A;  3K9O B;  3URY A;  4FXC A;  1MJD A;  2QSD A;  3PT2 B;  3WAN A;  1V81 A;  1BML C;  2XBB C;  3Q3F A;  3TEZ A;  1MFW A;  2PE6 B;  2FID A;  3SEB A;  5E6N A;  3CMM B;  5LLI A;  3KUZ A;  4GOC A;  3KQ4 A;  2CJN A;  2W3R A;  5AUI A;  2WXF A;  4TKN A;  1IP9 A;  1T0R C;  4USA A;  2M4N A;  3MP9 A;  2KTF A;  1TTN A;  5JZE B;  4HRO A;  1K51 A;  2MP2 B;  1JCK B;  1WGY A;  4JPS A;  3LDZ E;  2V3S A;  3CF6 E;  1SJH D;  2G45 B;  3N30 A;  1WGD A;  2BS4 B;  2CKH B;  1HTQ A;  2WDR B;  3W5V B;  3HK0 A;  2XNA C;  2VRR B;  1D4B A;  3AEE B; 
#chains in the Genus database with same CATH homology
 3N3K B;  4E71 A;  4W9C A;  3HM6 X;  3ZIM A;  1Z2M A;  4B9K A;  4G3X B;  1WE7 A;  3EFU A;  5IA7 A;  2Z0D B;  3AXC A;  4WWP A;  2O6V B;  2DYB A;  3PSE B;  4P7I A;  3M63 B;  4KV2 A;  3RZF A;  4K7W A;  1V6E A;  2MCN B;  1WJ6 A;  1WF9 A;  2O2V B;  2KX0 A;  1KLV A;  4GIV A;  3VQI A;  2GBK A;  2GBR A;  3UIO B;  2LRU A;  4KIK B;  4M8M A;  4ANX A;  1UH6 A;  2GBM A;  3QAQ A;  2A4Z A;  3VUX A;  1HE8 A;  4DXA B;  2W9N A;  4BKG A;  2KLG A;  3ZTD A;  2N7E A;  1Q0W B;  2AL3 A;  4BBN C;  3RT3 B;  1VCB A;  1WMH A;  3VXW A;  4WJO A;  2XK5 A;  3TIX A;  1WE6 A;  4W9F A;  2ZCC A;  2JWZ A;  2LVQ A;  4PYZ A;  5DPR A;  5IAA C;  1WXM A;  4II3 B;  3VFK A;  3A9K A;  3APF A;  1P3Q U;  1V5O A;  2DZM A;  4GDK A;  4MEM A;  5DPW A;  2LGX A;  4IM2 A;  5CHV C;  1E90 A;  3HIZ A;  4HPL B;  5LXI B;  2HE7 A;  3CSF A;  2KO3 A;  2DEN B;  2IO3 B;  2C7M B;  2MW5 A;  2K25 A;  4W9I A;  1WXA A;  3CST A;  4DHZ B;  4KSL C;  4K7S A;  2KC1 A;  4FUL A;  3ENE A;  4KDI C;  2C7N B;  4MJS A;  3VTV A;  3RD2 A;  4KVG B;  3OJ3 A;  2MQJ A;  3PHW B;  2KN5 A;  3DBH I;  4FHJ A;  4IWP A;  4GB9 A;  5AEK B;  2D2Q A;  3APC A;  4XX5 A;  2RSU A;  1SE9 A;  4G50 A;  1D3Z A;  2HD5 B;  4FBJ B;  2NBU A;  2MWS B;  4ZRK A;  1FXT B;  1XT9 B;  2C60 A;  2NBW B;  2Z0E B;  2ZNV B;  2KDI A;  2DAF A;  2K39 A;  4MEL A;  3IFW B;  2JPH A;  3DDC B;  3RYT A;  4HPM B;  3EHV A;  3IBE A;  4EZL A;  4F7Z A;  4OVV A;  2KJH B;  5E6O A;  3ZDT A;  4RMA A;  3DCG A;  4HDQ A;  2D10 A;  2DYO A;  1UZX B;  4EEW A;  1R4N I;  4MJS B;  2DZK A;  4HLE A;  1E8Y A;  2J0K A;  2JZZ A;  3PV1 A;  5D94 A;  3U7D A;  4AJY B;  3L17 A;  1OGW A;  2IO0 B;  4RM8 A;  2N4F A;  2LXC A;  1TZ1 A;  3VUY A;  3QQ8 B;  3MTN B;  1AAR A;  2JUO A;  1ZKH A;  4EKU A;  2IBI B;  2R2O A;  2BF8 B;  1YQB A;  2BKR B;  4JIO U;  4ZRJ A;  1WZ0 A;  1E7V A;  3PGE A;  3SD5 A;  1Y8R C;  2B3A A;  3KH0 A;  4KDL B;  2M8S A;  3L10 B;  2Y5B B;  2ZNV C;  4NAW B;  4ZRI A;  5DPS A;  1EUV B;  1E8Z A;  2KX3 A;  2ASQ A;  3R7R A;  3VTW A;  4IW0 A;  2GBJ A;  1P98 A;  3VTU A;  2YLM A;  4IUM B;  1QZE A;  4XC2 A;  4IG7 B;  3A33 B;  1Q1O A;  2OOB B;  2LI5 A;  1V9J A;  1WGR A;  3L54 A;  1WH3 A;  1EO6 A;  1WX8 A;  2N9P C;  2KMC A;  2KQS A;  4PS8 A;  3Q3J A;  1GC7 A;  4A20 A;  4F1S A;  1C3T A;  2BYE A;  4AUQ C;  4DHJ B;  2LWP A;  3D32 A;  1IYF A;  2JRI B;  2MA9 B;  1P9D U;  4LJO B;  2HTH A;  2KC2 A;  2ZEQ A;  3JYU A;  4W9K A;  3WAO A;  4CYE A;  1WR6 E;  4DK5 A;  2LAS A;  2BYF A;  3JSV B;  2K6Q A;  4MM3 A;  3ZUN A;  4NJ7 A;  2NCN A;  1WJ4 A;  2LGD A;  4NNJ B;  1YJ1 A;  2DX5 B;  3UIP B;  2KAN A;  2BYV E;  5L83 A;  2IY0 B;  2D11 A;  4BKS D;  4MGK E;  2KD0 A;  1UGM A;  3W1Y A;  1GNU A;  3X0W A;  3ZNG C;  4KZC A;  4M0W B;  3ZRF A;  1NBF C;  3GOE A;  4WWO A;  2L7R A;  1S3S G;  2KNB A;  1OEY A;  4YL8 A;  2FCQ A;  4HCP B;  3H6N A;  5AZF A;  4TQ0 A;  4ZDV A;  1WZ3 A;  3DBL I;  3W1S A;  3OAW A;  1WJU A;  4FJV B;  4W9H A;  1VD2 A;  4WJP A;  5JHA A;  1EF5 A;  5J17 A;  3PVL A;  4K81 A;  1WXV A;  1J0G A;  2PPH A;  3R66 C;  3ZLZ A;  2PEA A;  2KTR B;  1NDD A;  1E8W A;  1ISN A;  2DYM A;  2KXJ A;  3IVF A;  3TJP A;  3LJ3 A;  4NQK E;  5FR6 A;  2KWC A;  2V4L A;  1M94 A;  5DCN A;  4BKS A;  1RAX A;  4LJP B;  4MH0 E;  2Z59 B;  2MX2 A;  5AZG A;  3NY5 A;  1L2N A;  2RPQ A;  4HVB A;  5CTR C;  3BIN A;  3WAP A;  4CHK A;  3JW0 X;  4MGY E;  5JHB A;  4GDL B;  2NBV B;  3H9D A;  4JLC A;  1OTR B;  2CHZ A;  1WGG A;  2ZVN A;  2FIF A;  3A9K B;  4PS3 A;  4KSK C;  1UD7 A;  1SIF A;  3EC8 A;  3NZU A;  4A3O A;  3ECI A;  4NY0 A;  3PS6 A;  1LM8 B;  3ZTC A;  2CR5 A;  5KHO A;  2MLB A;  3A4R A;  2UWQ A;  4ZYN A;  4AOF A;  2N9E B;  4GDL A;  4I6L B;  4IM0 A;  3ZRC A;  1RFA A;  1IPG A;  4GGQ A;  2PE9 A;  2JF5 A;  3QWZ B;  1ZGU B;  2WWZ A;  5E6P A;  1V80 A;  3SHQ A;  2WYQ A;  1WGH A;  3I3T B;  5JH5 C;  2IZV B;  4WAA A;  3ZW3 A;  2GBN A;  2K8B A;  4AWJ A;  3OJ4 B;  2EMS A;  4TV3 A;  2I1K A;  4EOY A;  1EF1 A;  1XD3 B;  2MBH A;  4JL9 A;  4DWF A;  5HKH A;  2JRH A;  4BKT A;  4BOS C;  2LVP A;  4WWN A;  2FCS A;  2BWF A;  3SU8 X;  3PPA A;  3H7P A;  2C9W B;  3L0W B;  5G2N A;  1LFD A;  1WM2 A;  3AU4 A;  3EEC A;  3R3M A;  3ZNZ B;  4BVU C;  2DZI A;  3NS8 A;  3P2B A;  2L00 B;  4RM9 A;  4J6I A;  4DDG D;  3KYD D;  2FUH B;  4NAW A;  3A9J A;  2XK5 B;  1RLF A;  2KWV B;  2WX1 A;  3R7Q A;  4ANU A;  2L76 A;  4DHZ E;  2L0T A;  3PRM B;  1NI2 A;  3A1Q A;  4HDO A;  3VDZ A;  2KKC A;  4WQO B;  2KHW B;  3OLM D;  3ONS A;  2OJR A;  3QJZ A;  4BOZ B;  5D6J B;  1RRB A;  3IG3 A;  3ALB A;  2KWU B;  4HK2 A;  3WIM A;  3ZNI D;  1G6J A;  1Z5S B;  2LRW A;  5AZH A;  4B6W A;  5D2M B;  5J2R A;  2G3Q B;  2FNJ B;  4IWQ A;  2WX0 A;  2EMT A;  2CU1 A;  4GU2 A;  3KVF B;  2K6D B;  1I35 A;  3K9P B;  2JZ3 B;  2KJR A;  3QCA A;  1WIA A;  3O65 B;  4K1R B;  2KOX A;  3AUL A;  2FCN A;  2D07 B;  3WAL A;  3W1S C;  4HJK A;  1YIW A;  4XZ4 A;  4JGH B;  2REX A;  3H1U A;  2R2Q A;  2ZCB A;  3SDL C;  3B08 A;  2KDB A;  3B0A A;  2A5U A;  3MHS D;  4M8N A;  4ASW C;  3S2A A;  2KFK B;  3L08 A;  2GOW A;  1F9J A;  3QA8 A;  2XEW A;  2JT4 B;  3M62 B;  2MBE A;  3KYC D;  4N9F 4;  3WAM A;  1WJN A;  3C0R B;  3PZD A;  4TQ1 A;  1OQY A;  1CMX B;  2AWT A;  3GZN I;  2RGF A;  2NPT A;  1UBI A;  2ZZP B;  4FN2 A;  4E3C A;  4NJ6 A;  1GUA B;  1XQQ A;  4DDI D;  1V86 A;  3QAR A;  2G4D B;  5DPT A;  2KZR A;  3PTF C;  4CO7 A;  4EFO A;  5EDS A;  2IYD B;  2DZJ A;  1X1M A;  4KIK A;  3KUC B;  3VVW B;  4WJQ A;  1WXS A;  3M95 A;  4IM3 A;  3V6E B;  2AEH A;  4ANV A;  4ANW A;  3ZKJ C;  1E8X A;  3KW5 B;  2M17 A;  2KJ6 A;  2I1J A;  2M0X A;  2KLC A;  2K1F A;  3N32 A;  4ICU A;  3KUD B;  2MBO A;  4KZ0 A;  2LUE A;  2MBB B;  1KJT A;  2DHZ A;  4II2 B;  1TBE A;  3ZVV A;  3NOB A;  4K7U A;  2N1V A;  3WA0 A;  3PRZ A;  1K8R B;  1GG3 A;  5C23 A;  5BO4 B;  1H4R A;  3V61 A;  4TUU A;  5G55 A;  2BPS A;  1WX9 A;  2UYZ B;  4FLH A;  1E5W A;  3T8M A;  3PLU A;  1WRD B;  3VAW A;  4HXD A;  3VH4 B;  4PYU A;  3IHP C;  3V62 A;  3ML9 A;  3B1L X;  3VH3 B;  2K8H A;  1U4A A;  3MJW A;  3T9L A;  2N9X A;  3DPD A;  2BKF A;  1WFY A;  2CHX A;  3L13 A;  3NZS A;  4W9D A;  2KFK A;  5CX3 A;  1S1Q B;  1I42 A;  4G0N B;  3DVG X;  2M1M A;  3DBS A;  1V49 A;  3JSV A;  1BT0 A;  1SGH A;  1WY8 A;  3DBR I;  2CHW A;  3DVG Y;  1UBQ A;  3QIJ A;  2CS4 A;  3JVZ X;  2MSE D;  2D3G A;  1WM3 A;  2K8C A;  3RUL A;  3ZNH B;  4LCD E;  2IO1 B;  3NHE B;  1LXD A;  4G11 A;  2LJ5 A;  2NS5 A;  3M3J A;  2O2V A;  4W9J A;  3UQB A;  2N7D A;  3H7S A;  2FAZ A;  3A9J B;  4FAD A;  1JRU A;  1LQB A;  4GDK B;  1T0Y A;  4BFR A;  3QK0 A;  3V6C B;  1J8C A;  4FHK A;  1YX6 B;  4JQW C;  5TR5 A;  3ZO5 B;  5L95 C;  1WX7 A;  4WJN A;  3RUI B;  4DBG A;  1MG8 A;  1UEL A;  2KDE B;  3ML8 A;  3PRE A;  4LDT D;  1WMH B;  1OEY J;  1Q5W B;  4X57 B;  2N1W A;  1WI0 A;  3APD A;  4B95 A;  2LXA A;  2LGY A;  4EZK A;  2AL6 A;  2G4S A;  4LDT B;  3L16 A;  3A1Q B;  2NR2 A;  1V2Y A;  4NQL B;  2MRP A;  3VHT C;  1GC6 A;  2J0M A;  5KHQ A;  5GMV A;  1J19 A;  2QHO A;  3QX1 A;  4MGZ E;  4W9L A;  3PLV A;  4MSM B;  2LZ6 A;  3BY4 B;  3TL5 A;  1TGZ B;  2J0J A;  4URK A;  1KM7 A;  2C7H A;  4MDK E;  2KK8 A;  4DHJ D;  3U8Z A;  2KDF B;  1P1A A;  4OVU A;  1P0R A;  2KQ7 A;  3QC8 B;  1A5R A;  2IY1 B;  2NPT B;  4MSQ B;  4W9E A;  3RCZ A;  4GXB A;  1YX5 B;  1PQS A;  2ZPN A;  4W9G A;  4EZJ A;  2LD9 A;  2O6V D;  3H7P B;  4HWI B;  3UF8 A;  1KOT A;  1YD8 U;  3DVN V;  4FJZ A;  3K9O B;  5CHF A;  3TBL D;  3AU5 A;  4IC7 B;  4MGI E;  3DOW A;  3PT2 B;  3ZDM C;  4GN1 A;  4BBN F;  2RD0 A;  3WAN A;  3X23 A;  1V81 A;  2XBB C;  3Q3F A;  2WDT B;  2L0F A;  3RZW C;  2PE6 B;  4AJW A;  2FID A;  2RR9 A;  4EUT A;  1C1Y B;  2KTR A;  1ZW7 A;  2ZPY A;  2ZVO A;  5E6N A;  3CMM B;  4FJY A;  3PRP B;  5LLI A;  3KUZ A;  4GOC A;  5J18 A;  1GJZ A;  4F8C B;  2MP2 A;  2NVU I;  2AYO B;  4E74 A;  4AP4 C;  2BGF A;  4TKN A;  1IP9 A;  4HCN B;  4A3P A;  3UGB B;  2M4N A;  2KTF A;  1TTN A;  4GSW A;  2EKE C;  2DAJ A;  4FA6 A;  2YVC A;  5JZE B;  5D7G A;  2L05 A;  2J7Q B;  4I6N B;  1V5T A;  2FCM A;  2KVR A;  2GMI C;  2LVO A;  3TCA A;  2MP2 B;  2BWE S;  2ZJD A;  4IWO A;  1WGY A;  2IO2 B;  5C1Z A;  3TMP B;  1E7U A;  3AI5 A;  3U30 A;  3HM3 A;  1H8C A;  5CHW A;  3V60 A;  1R4M I;  3LDZ E;  2V3S A;  4PS7 A;  3UIN B;  2V1Y A;  3CF6 E;  1WYW B;  2PJH A;  3PHX B;  2L8J A;  3UQA A;  2G45 B;  2C5L C;  3N30 A;  3QHT A;  1WGD A;  3DVN U;  3VUW A;  3A4S C;  2CKH B;  4NPN A;  1L7Y A;  1WR1 A;  2JY6 A;  2KFJ A;  2JVC A;  2O6V A;  4ICV A;  2L3Z A;  3HK0 A;  2JXX A;  3HHM A;  4I6P A;  3DQV A;  2VRR B;  5LXH A;  4GMV A;  2MBQ A;  2HJ8 A;  2KMA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...