4I6PA

Crystal structure of par3-ntd domain
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
84
structure length
84
Chain Sequence
SEFKVTVCFGRTRVVVPCGDGRMKVFSLIQQAVTRYRKAVAKDPNYWIQVHRLEHGDGGILDLDDILCDVADDKDRLVAVFDEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Partitioning defective 3 homolog
publication title Structural insights into the intrinsic self-assembly of par-3 N-terminal domain.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
total genus 19
structure length 84
sequence length 84
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4i6pA00
3WAPA 2CR5A 2UYZB 3R7QA 1E7UA 3HK0A 2JF5A 2PPHA 3KW5B 4HPLB 3ZVVA 1I35A 1WIAA 1GG3A 2CHWA 5LLIA 4DHZE 2D11A 2DYBA 3K9PB 3PS6A 2O2VA 2MP2B 2MSED 3MJWA 2LVOA 3ZUNA 3RCZA 4DWFA 3PPAA 4XZ4A 4YL8A 3VDZA 4ASWC 3JVZX 4AOFA 3RT3B 1YJ1A 4BOSC 2A5UA 3JSVA 4I6NB 1Q1OA 3PHXB 2LD9A 3R66C 4IM0A 4KSLC 4NQKE 4K1RB 2KC2A 3DDCB 1WXVA 2IO2B 4ICUA 3L54A 2NCNA 2CKHB 2KOXA 4K7UA 1WM3A 1KLVA 3DVNU 4MJSB 4FADA 2JY6A 2WX0A 1WXAA 2KN5A 3TCAA 2L76A 2FAZA 3V6CB 2BKFA 4A20A 1D3ZA 2D3GA 2AYOB 5AZGA 4GXBA 3S2AA 2LASA 2MBHA 3W1SC 4AJYB 4WQOB 4HXDA 3D32A 3QQ8B 2OOBB 3H9DA 1S3SG 1UBQA 3L10B 2CS4A 4MGYE 4DHJD 1UH6A 4IUMB 4EZJA 2G45B 3VTVA 3A9KB 2FCNA 2NVUI 4MGZE 5GMVA 1CMXB 4II3B 1E5WA 5G55A 4ANUA 4OVUA 4DHZB 5L95C 2JRHA 4II2B 4GU2A 2CU1A 2AEHA 2LGDA 3A9JA 4I6PA 4K81A 3VQIA 2N9PC 2LRUA 3DOWA 2KDBA 4FN2A 4IM3A 4B9KA 4DK5A 4ZDVA 2NBVB 2DZJA 3QHTA 5IAAC 2C7HA 3ZNID 4DDGD 3ECIA 4IC7B 3L16A 3ZRFA 2GBNA 3DPDA 3WA0A 2KVRA 2LVQA 1V86A 4HCPB 1WXSA 4G50A 3V62A 4PYZA 5AZHA 2ZNVC 4ANWA 3OJ4B 3AU5A 4GGQA 3PHWB 3L0WB 5HKHA 3EHVA 2NBUA 3PRMB 4CYEA 3KUDB 5J18A 3VHTC 5C1ZA 1GNUA 4GN1A 2JT4B 4GSWA 3W1YA 1E8XA 1V81A 3A33B 4WWPA 3A1QA 2LVPA 3RYTA 3DVGY 4E3CA 2AWTA 1C1YB 3VUXA 4LDTD 3CF6E 4PS7A 2WYQA 4KIKA 2EKEC 1NDDA 2A4ZA 2KTFA 4NAWB 2KJHB 2DZIA 3GOEA 2G4DB 1L7YA 1WJNA 2BPSA 1E7VA 4F8CB 3H7PA 3PZDA 1P1AA 3ENEA 5CTRC 1WH3A 3QX1A 2UWQA 1WRDB 4MSMB 2ASQA 3WAOA 2I1JA 3AU4A 3U30A 1YD8U 5IA7A 2N9XA 4M8MA 2ZJDA 3APCA 2L0TA 4W9EA 5G2NA 1NBFC 3QAQA 3ZTDA 2MW5A 1RFAA 1GC7A 3CSTA 2KDEB 2BWFA 2OJRA 4N9F4 1H8CA 3KUZA 4CHKA 5L83A 4IWQA 1MG8A 4TQ0A 2KWCA 1WMHA 4J6IA 4BKGA 3UIOB 4EUTA 2O6VD 4A3PA 2M4NA 3NZSA 4HWIB 2KC1A 1J8CA 4W9IA 2KD0A 2BWES 5J17A 3M95A 4FJVB 2V1YA 3IVFA 3DQVA 2KLCA 2IO3B 2CHXA 2VRRB 1WFYA 2MBBB 3IBEA 1GC6A 1EF5A 1WJ6A 3UQAA 2KFJA 3RZFA 2FIFA 2MX2A 3QIJA 2KX0A 4ZYNA 3ZO5B 1X1MA 3ZNZB 3ZIMA 3UINB 4HDOA 1WE6A 2XBBC 2FIDA 3APFA 5E6OA 4GDKA 3V60A 1Q0WB 2RGFA 2HTHA 4HPMB 5J2RA 1WR1A 2K6QA 2QHOA 2N7DA 1C3TA 3PGEA 2DYOA 4OVVA 5D6JB 2LJ5A 3EFUA 4W9JA 3Q3JA 3JYUA 3DVGX 1K8RB 3EECA 3EC8A 3H6NA 4JGHB 3HHMA 2ZNVB 2XK5A 3GZNI 5CHVC 2IY0B 4W9CA 2MBEA 1S1QB 1SIFA 2BYFA 2L00B 1SE9A 2JRIB 2O6VA 5CX3A 2I1KA 2K6DB 2LZ6A 2LRWA 3PRZA 4MSQB 2DAJA 5AEKB 2LI5A 2RSUA 2CHZA 3K9OB 3PT2B 5AZFA 3HM3A 1WGYA 2HE7A 1L2NA 2J0JA 1WZ3A 1TGZB 2MCNB 2GBMA 3O65B 3PSEB 1V6EA 4G0NB 1YQBA 2DZMA 4HJKA 1E90A 3R7RA 4GDLB 3ZNGC 3Q3FA 1J0GA 4IWPA 2V3SA 1M94A 3KYDD 4BKSD 2ZZPB 4HLEA 2D10A 2GMIC 2KJRA 4W9DA 2FCSA 2PE9A 1P98A 2KTRA 4RMAA 3JW0X 3MHSD 3TL5A 4KZCA 4K7WA 4HCNB 2ZCCA 2JVCA 3SU8X 1FXTB 3M63B 3TMPB 3OAWA 3DBSA 1WGHA 4JQWC 4MGKE 3PREA 4KDIC 3ZNHB 4M8NA 2C60A 1YX5B 2WX1A 2J0MA 4HDQA 4PS3A 4FA6A 2N1VA 1E8ZA 2KFKB 3M3JA 3L17A 2N4FA 2XEWA 4LJOB 2LWPA 2ZEQA 2AL3A 4GIVA 4AP4C 3ZW3A 3WALA 4HVBA 5JH5C 1IYFA 4WJQA 4WJOA 2KANA 1E8YA 4P7IA 3VAWA 3KVFB 2Y5BB 4FHJA 5KHOA 4GOCA 4MEMA 3UQBA 3QCAA 2NS5A 1WX9A 3ONSA 3V6EB 4BKSA 1Z5SB 2O2VB 3T8MA 4F1SA 4B6WA 1A5RA 2D2QA 2MRPA 1TBEA 3UGBB 4JIOU 2IY1B 2C7MB 2C9WB 1WX7A 2Z0EB 3WIMA 3JSVB 2G3QB 4LJPB 2IO0B 3CMMB 4NQLB 2C5LC 4NJ7A 1KOTA 2KMCA 2KXJA 2ZPNA 4GB9A 2FCQA 3CSFA 4MDKE 2MBQA 3N32A 4X57B 5JZEB 1PQSA 2L8JA 1WXMA 3QWZB 2PE6B 1WGGA 1WGDA 4RM8A 1WYWB 1V5TA 3M62B 3NOBA 1RLFA 3TJPA 5D7GA 1V5OA 2EMTA 4IW0A 5DCNA 3RULA 3NY5A 4WWNA 5C23A 1RRBA 2MP2A 4FJZA 1WM2A 1EF1A 2WWZA 3VTWA 4BBNC 3DCGA 2DYMA 2KK8A 1ISNA 3V61A 2ZVNA 1J19A 4FULA 1ZW7A 1WI0A 4AJWA 2BYEA 2K1FA 2BF8B 3A9JB 1EUVB 2RD0A 2RR9A 2JXXA 2DAFA 5EDSA 4URKA 1WJUA 4MJSA 2L05A 5DPTA 4WJNA 3HM6X 4E71A 4KDLB 4BOZB 2K8HA 4M0WB 1WJ4A 3PLUA 1G6JA 4HK2A 1GJZA 4F7ZA 2KQ7A 3VUYA 5DPSA 1LQBA 2GBJA 2M0XA 4NY0A 1WF9A 5D2MB 1EO6A 5LXHA 1XD3B 2C7NB 2LUEA 2J0KA 2JUOA 2KHWB 1OGWA 2Z59B 4K7SA 2KLGA 5E6NA 2N7EA 1UELA 2NPTB 3A9KA 4IG7B 3VFKA 3KYCD 2IYDB 2BGFA 3PVLA 2ZVOA 3AI5A 3P2BA 4WAAA 5LXIB 3ZDMC 2JWZA 3A1QB 4G11A 3TIXA 4DHJB 4DBGA 3NS8A 4BFRA 3B1LX 2L7RA 4EFOA 4EEWA 4ZRIA 4KIKB 3C0RB 4XX5A 2IZVB 1ZKHA 4ANVA 1WX8A 1BT0A 2V4LA 2KWVB 3LJ3A 1UBIA 3LDZE 1UGMA 2PEAA 2JZZA 3VH4B 1TZ1A 3QA8A 4DXAB 4KZ0A 3H7PB 3UIPB 1OEYJ 2Z0DB 3RD2A 2KDIA 1ZGUB 4EOYA 2LXCA 2K39A 2MLBA 4IWOA 3NZUA 3VVWB 5D94A 3A4RA 2MBOA 1OQYA 1U4AA 5E6PA 3N3KB 2B3AA 1WR6E 2BYVE 2JZ3B 1H4RA 2HJ8A 1KJTA 5BO4B 4PYUA 2ZPYA 3L08A 4W9HA 2KKCA 4PS8A 5KHQA 1WGRA 3SD5A 1WMHB 1UD7A 3VXWA 2KMAA 1XQQA 3R3MA 1P9DU 4FJYA 4NAWA 3ML9A 3KUCB 3QC8B 4KSKC 2FCMA 4BBNF 2DENB 2GBRA 2EMSA 2L3ZA 2KDFB 1QZEA 4LDTB 4E74A 3QJZA 2D07B 2YVCA 4TQ1A 5DPRA 2N9EB 4AWJA 4DDID 3VH3B 3RZWC 2DHZA 4RM9A 4EZLA 4W9LA 4GDKB 2FUHB 4FLHA 4B95A 1Y8RC 2M1MA 2MQJA 3HIZA 3SHQA 2WDTB 5CHFA 3H1UA 2LGXA 4AUQC 3DBRI 3W1SA 5DPWA 1AARA 2KJ6A 2MA9B 3IG3A 2JPHA 2M17A 1OTRB 2XK5B 3KH0A 4W9GA 3NHEB 1UZXB 1WY8A 4BKTA 2O6VB 4IM2A 4TUUA 1WZ0A 3ML8A 4KV2A 1V49A 2LGYA 4JLCA 4LCDE 3SDLC 2DZKA 2MWSB 1WE7A 4WJPA 3X23A 3PV1A 1SGHA 3DBHI 2IO1B 4TV3A 1T0YA 1P3QU 2LXAA 3VUWA 1V2YA 3IFWB 3BY4B 1KM7A 2NPTA 1Q5WB 3APDA 3ZTCA 2FNJB 2KX3A 2KQSA 3MTNB 1HE8A 1NI2A 2N1WA 3TBLD 4ZRKA 4XC2A 3ZDTA 2J7QB 3IHPC 4EZKA 3QARA 3WAMA 3X0WA 4ZRJA 1I42A 4FHKA 2REXA 1XT9B 2R2OA 2W9NA 2BKRB 3A4SC 1R4MI 2KO3A 2G4SA 2KWUB 2RPQA 1TTNA 2KTRB 3B0AA 1P0RA 3I3TB 3UF8A 3N30A 2DX5B 2KNBA 2R2QA 2HD5B 2GBKA 4W9KA 3B08A 1LFDA 1LM8B 1OEYA 3PTFC 4JL9A 2ZCBA 3AXCA 4KVGB 4NJ6A 1IPGA 1RAXA 3PRPB 2NR2A 2NBWB 3QK0A 5JHAA 4MGIE 4MH0E 4WWOA 4BVUC 2PJHA 3DBLI 3T9LA 5FR6A 1V9JA 2AL6A 3OJ3A 4GDLA 3ZLZA 3U7DA 2KZRA 4G3XB 4I6LB 1IP9A 3VTUA 1LXDA 2K8BA 4ANXA 4NNJB 3WANA 2YLMA 5TR5A 1GUAB 4W9FA 4A3OA 4FBJB 1R4NI 4CO7A 3ZRCA 1V80A 1VD2A 3H7SA 2K25A 3U8ZA 1YX6B 4TKNA 4ICVA 4NPNA 3PLVA 2IBIB 3ZKJC 5JHBA 3RUIB 5CHWA 2M8SA 3BINA 3AULA 2L0FA 3OLMD 1E8WA 4EKUA 2K8CA 1F9JA 1YIWA 3L13A 1JRUA 2GOWA 1VCBA 2KFKA 3DVNV 4MELA 1Z2MA 3ALBA 4MM3A 4GMVA
chains in the Genus database with same CATH superfamily
2K22A 3WAPA 2UYZB 3U4EG 2JF5A 1I35A 3VRBB 5LLIA 1GG3A 1R4NB 1TKGA 3K9PB 4OHJA 4XWWA 3ETRA 3IT6B 2LVOA 4XZ4A 4BOSC 2A5UA 2LD9A 1WXVA 2IO2B 2ON8A 4ICUA 3BVGA 2KOXA 4K7UA 1WYGA 1FCCC 4MJSB 1OQQA 2JY6A 2WX0A 4DXFA 2L76A 2FAZA 1XO3A 2WXGA 3V6CB 1D3ZA 2D3GA 4GXBA 3S2AA 4AJYB 3W1SC 2N7JA 4WQOB 2K0PA 4HXDA 3Q8AA 5G5GA 1FCLA 4IUMB 3A9KB 2FCNA 3Q14C 3AM9A 3Q8EA 4YSXB 1KF6B 4M01A 5G55A 4OVUA 4II2B 3BYTB 1YMHE 2LRUA 1PGBA 2V3NA 3RNEC 2NBVB 5C3JB 3AV8A 3ECIA 3ZRFA 4HROA 3DPDA 2WS3B 3Q8CA 3WA0A 1WXSA 4ARCA 1E0ZA 2ZNVC 3Q2AC 5HG2A 4GGQA 3L0WB 5J18A 3KUDB 1GNUA 3AB5A 4GSWA 1HQRD 3W1YA 1E8XA 1V81A 3A1QA 2H88B 3NVZA 1C79A 1A70A 2WYQA 3FAHA 1NDDA 2A4ZA 4J3OD 2BPSA 5FR3A 3H7PA 4ZYSA 3ENEA 3W9CB 5CTRC 2XN9C 2UWQA 4MSMB 2NMQA 3TEZA 1YD8U 2QEJC 1E7PB 1BXTA 5G2NA 2MW5A 1GC7A 2BWFA 2OJRA 4N9F4 1H8CA 2W82A 1CJEA 1MG8A 1WMHA 3C8YA 3P4PB 4HWIB 4W9IA 3P4QB 2KD0A 2VH1A 3NS1A 2IO3B 1L4DB 3IBEA 1GC6A 1EF5A 2MX2A 4ZYNA 1JMLA 5EE9A 5G5HA 3C19A 4Q2JA 3APFA 5E6OA 4GDKA 1Q0WB 2HTHA 3U7ZA 4RGMA 2K6QA 1C3TA 3PGEA 4OVVA 5D6JB 1ENFA 2LJ5A 2QILA 4JGHB 3HHMA 5T8IA 4D2KA 3GZNI 2YEPF 5TSSA 4W9CA 2YEPB 1XLQA 1SIFA 2K6DB 3Q3NC 3PRZA 2CJNA 2LI5A 3K9OB 1WGYA 2J52A 2J0JA 2MEKA 4L2YA 1TGZB 1YQBA 2DZMA 5BYRA 2Y5PA 2WXQA 4WH4A 4WIPA 3Q6BA 4C56C 2GMIC 2KJRA 3GZNB 1P98A 4KGSA 1NENB 4RMAA 1VJKA 4K7WA 1VRAB 5C2TB 2LEKA 4HKQA 4JQWC 1WGHA 3HVZA 4MGKE 1JCKB 1JROA 2C60A 2WX1A 1N61A 1GOZA 4YXDB 2N1VA 1E8ZA 1Y56A 4K3BA 4LJOB 5JH5C 1YNTE 2KANA 4P7IA 1UNSA 4PK1A 3GE3C 4FHJA 5KHOA 4MEMA 4RGNA 3AECB 1Z5SB 2O2VB 4B6WA 4NAMA 4JIOU 4LJPB 2D5GA 3CMMB 5IOIA 2KXJA 2ZPNA 2FCQA 4X57B 1JWBD 1AWDA 2PLPA 1MHHE 2IGHA 4RM8A 1V5TA 1DOXA 3M62B 3NOBA 2V4IB 1V5OA 5DCNA 1RM6C 5C23A 1RRBA 3U52E 4FJZA 1QOGA 3I9V1 4FULA 2Z8LA 1LO5D 2RR9A 2JXXA 1HZ5A 4MJSA 2L05A 3HM6X 4HK2A 1L4ZB 2WXNA 1LQBA 5LXHA 5E6NA 1OGWA 2VZKD 3MC0B 3A9KA 4IG7B 1F0ZA 2ONQA 3P2BA 3P4RB 2MJEA 1TY2A 4RH6A 4G11A 4DHJB 2B76B 5EE3A 4REZA 3KWVA 2OHFA 2PVGC 2KWVB 1UGMA 2JZZA 4KZ0A 3UIPB 3RD2A 1L6UA 1MVKA 4EOYA 5D94A 4YSYB 1P7FA 4WAFA 2GLSA 2LHEA 1H4RA 2HJ8A 1I7HA 2INDC 4W9HA 3TSSA 1PUTA 4LLGM 1XQQA 1STEA 4FJYA 3KUCB 2FCMA 3SEBA 2PVOD 1L5PA 2YVCA 4TQ1A 2EELA 1T0RC 5AUIA 1OFFA 4AWJA 4DDID 3RZWC 4FLHA 1WXQA 2WDTB 5H92C 1JWAD 1AARA 1N63A 1OTRB 2O6VB 2ZW0A 5E6JA 3RI7C 4JLCA 2MWSB 3PV1A 2IO1B 2N0SB 4TV3A 1RWSA 1AW7A 2FE8A 3ZTCA 2KX3A 4XE0A 1XF5L 2LJIA 2DNFA 3TBLD 4RFBA 3IHPC 3QARA 3AE9B 4XDCA 4FHKA 1XT9B 2BKRB 4WJPA 2KO3A 2KTRB 3N30A 2KNBA 4YTNB 4W9KA 1WRIA 4JL9A 4NJ6A 3PRPB 1C4PA 1HEZE 4MH0E 4BVUC 3T9LA 1N60A 1V9JA 3ZLZA 2KACA 3U2SC 4YWGG 1IP9A 1UGJA 3VTUA 1LXDA 5TR5A 1GUAB 4W9FA 4FBJB 2D3BA 5BMHA 2QCZA 4C4VB 4N59A 2EKIA 3P1MA 2L0FA 1E8WA 4EKUA 2K8CA 2RMMA 3KWLA 4JX1C 2MHJA 4AS1A 1JRUA 2GOWA 1Z2MA 1EU4A 2BS4B 1B1ZA 2CR5A 1E7UA 1P7EA 4KX6B 1WIAA 1YN5A 2D11A 5EE1A 1YQ4B 2O2VA 3ZUNA 3VDZA 3AE1B 4ASWC 3JVZX 3AMZA 4K3CA 1Q1OA 1T5XD 2IJ0A 4KSLC 3DDCB 2NCNA 1WM3A 1KLVA 1XLPA 4YTPB 1MPEA 4A20A 4YT0B 2AYOB 1GAQB 2LASA 5FK9C 5D3DA 3D32A 1B9RA 4MGYE 2CS4A 1UH6A 1TS3A 3VTVA 4MGZE 5GMVA 4II3B 1E5WA 3Q3MC 2JRHA 2AEHA 2LGDA 4K81A 3VQIA 2KYWA 1SBBB 1I4HA 3DOWA 1SF0A 2BW2A 4DK5A 1UWXA 2C7HA 2RPVA 4IC7B 3L16A 1TIFA 4RNAA 1V86A 3V62A 2GRIA 2HDEA 4ANWA 1FO4A 3OJ4B 2KQ4X 3PHWB 3EHVA 4JE3B 3RNCC 2JT4B 3A33B 4P6VF 3RYTA 4WWMA 2AWTA 3VUXA 2FBWB 1JALA 4PS7A 2KTFA 4NAWB 3GOEA 4F8CB 1E7VA 2OEDA 2J53A 2KAJA 3I57A 1ZUD2 1T0QC 1WRDB 2ASQA 1FIQA 4XWTA 2ICIA 3AU4A 4LNFA 2ZJDA 3APCA 5IO9A 2WDQB 1UUPA 3CSTA 1MI0A 1BMLC 2BB5A 5L83A 4KKIA 1IUEA 2KWCA 4BKGA 4ZHOA 2M4NA 3NZSA 2WU2B 3MJ5A 2JX5A 4L23A 2BWES 3TEXA 4FJVB 1SB3C 2KLCA 1WFYA 1WJ6A 3UQAA 1XCTL 3RZFA 3H8HA 2GI9A 2TSSA 4HPPA 4PT5A 1IBXB 3ZNZB 1TKEA 3ZIMA 3UINB 4HDOA 1ZP0B 3AEDB 2XBBC 1ESFA 2RGFA 4HPMB 4S0RA 3LYYA 2I38A 1WR1A 2N7DA 3BK2A 1WWTA 3NVYA 4W9JA 2M0AA 1K8RB 4N58A 1FEHA 2J4XA 1S1QB 2BYFA 2O6VA 1QF6A 4MSQB 4YTMB 2MCNB 2GBMA 3O65B 4G0NB 1V6EA 3RFZB 3AE7B 1M94A 1ZOYB 2ZZPB 3CIRB 2D10A 4W9DA 3UI3A 2FCSA 2PE9A 2KTRA 4WURA 3SU8X 1ZPSA 4P16A 2G1EA 3M63B 2SAKA 3TMPB 2WXMA 4KDIC 1AN8A 4M8NA 1N5XA 2PW9A 4PS3A 4ACFA 5I4DA 3P42A 2XEWA 2QIEB 2LWPA 4IKGA 4HVBA 3VAWA 3QCAA 1WX9A 4BKSA 4LNIA 1NEKB 3DHHC 3T8MA 4C4VA 1F52A 2D2QA 4KGRA 2WLBA 1TJEA 3UGBB 2IY1B 3WIMA 3JSVB 4NQLB 4NJ7A 4MDKE 3N32A 2WHIA 3R2TA 1HA5A 3TUOA 1HZ6A 4IW0A 2WDRB 3KLSX 4A55A 3SFDB 2IGGA 1QT9A 1WSPA 3VTWA 1ISNA 1IGDA 3T3OA 1J19A 1TKYA 1WI0A 2RDHA 2K1FA 4ZRQA 2WXPA 2LFIA 5EDSA 4URKA 4KDLB 4A8XC 3ZJUA 1G6JA 4F7ZA 3VUYA 2M0XA 4NY0A 1WF9A 2NTSA 1EO6A 2MH7A 1XD3B 2LUEA 3AE4B 2Z59B 3ABVB 4DXGA 3VFKA 1TT5B 2BGFA 4WAAA 3AI5A 1AYFA 3ZDMC 2JWZA 3TIXA 1YOVB 3NS8A 4BFRA 3MP9A 5H8YE 2HJ1A 4EEWA 4ZRIA 2JU6X 4KIKB 2INCC 2RDBC 2IZVB 2QSDA 3DBLB 3NVWA 3AN1A 4DXAB 1ZXHA 2W55A 5GXGB 2KDIA 1ZGUB 2K39A 4IWOA 4FXCA 3SFEB 1I4XA 1SE2A 3A4RA 2MBOA 2LGIA 2BYVE 3BWUD 1KJTA 3CWIA 4PYUA 3L08A 5KHQA 2KKCA 3SD5A 3VXWA 1KRHA 3R3MA 2JZPA 4NAWA 2SEBD 3QC8B 4BBNF 2DENB 2L3ZA 2KDFB 3V3XA 1QZEA 4LDTB 4E74A 2Y5CA 2H89B 4HJGE 2N9EB 2BS2B 3W5UB 4EZLA 1KLGD 2L52A 1T6BX 3SHQA 5CHFA 1I4RA 3H1UA 4OVZA 2KJ6A 3URYA 2JPHA 2M17A 1KFYB 1MHXA 1UZXB 4IOIE 4KV2A 1TS4A 1IBXA 4HEA1 1ROEA 3IFWB 3BY4B 4ZRPA 1I4GA 2FNJB 3MTNB 5EE0A 1FNWA 3Q69A 3WCQA 3VR8B 2AQ2B 1SJED 2ZW1A 3I63C 2W9NA 1R4MI 3HUIA 2R2QA 1C9FA 1NI3A 4MGIE 4LTUA 2UU7A 3N9YC 4I6LB 2K8BA 4NNJB 4XGAB 2KN4A 2KMMA 3GS2A 1R4MB 1VD2A 3U8ZA 1YX6B 1YJIA 4NPNA 3BVMA 5CHWA 4ITKA 3BINA 3OLMD 2K5PA 3L13A 4MELA 3DVNV 1I4PA 3RNGC 3AEGB 3R7QA 3HK0A 3KW5B 2VH2A 3ZVVA 2DYBA 3P63A 3PS6A 2MP2B 1R7SA 4AOFA 4TQ0A 4GLSC 4N6EB 3RT3B 1YJ1A 3JSVA 4I6NB 3PHXB 3DHGC 1N6ZA 3R66C 1KTKA 4IM0A 1C77A 3EA6A 3L54A 1DYQA 2WDVB 3DVNU 4FADA 2IGDA 2KN5A 1F77A 4CQNA 1PGAA 1OQRA 2MBHA 3RPFC 2OJWA 4HRSA 3FILB 3QQ8B 2OOBB 1IGCA 3H9DA 1UBQA 3L10B 4DHJD 2G45B 5IP4D 2L1AA 2M56B 5L95C 1CZPA 1C78A 3VR9B 2KDBA 4FN2A 4IM3A 4B9KA 4QAYA 2DZJA 4DDGD 2WXHA 2MJ3A 2GBNA 4M00A 2KVRA 1FRDA 4HCPB 4PYZA 5AZHA 1RFKA 1YN4A 3MC8A 3VHTC 3AH7A 4WWPA 5LNK1 3DVGY 1C1YB 1MFWA 4C00A 4KIKA 2KJHB 2DZIA 2WGSA 3PZDA 1CK1A 2QJLA 3WAOA 3U30A 4MH8A 4M8MA 4RF0A 2L0TA 3NRZA 1NBFC 1RFAA 1J7CA 2KDEB 1JWMD 4CHKA 4R3DA 4J6IA 1V8CA 3EGRA 3W5VB 2O6VD 4EUTA 4B0EA 3M95A 2V1YA 2VRRB 2MBBB 1SIJA 3QIJA 1X1MA 3N1YC 2WP9B 2AQ3B 2W3RA 1WE6A 2E3TA 1PYWD 2V3PA 2I2YA 1JWSD 3V60A 2QHOA 1M4VA 2DYOA 2INNE 3BYYB 3Q3JA 4KKJA 3JYUA 3EECA 2N9LA 3H6NA 4KGTA 3N20C 2IY0B 3E56A 2L00B 5CX3A 1SE9A 2JRIB 1FFUA 2LZ6A 4USAA 5AEKB 2RSUA 5AZFA 1JQ4A 1L2NA 1WZ3A 4HJKA 1E90A 3BIID 3ZNGC 4M02A 3P4SB 1J0GA 2D3AA 2V3SA 3E9SA 3DWGC 4BKSD 3I5JC 4HLEA 3AE6B 1VZ6A 4KZCA 3ZQ4A 3OAWA 3DBSA 1FMAD 1FNUA 2CJOA 4MT5A 2J0MA 4FA6A 1ZE3D 2KFKB 3MHZA 3M3JA 3L17A 2ZEQA 4GIVA 4WJQA 3KVFB 4C80A 3UQBA 2LUMA 2NS5A 3ONSA 3V6EB 1A5RA 4B0MA 2MRPA 1TBEA 3B9JA 2C7MB 2C9WB 1WX7A 2G3QB 1VR9A 3ZYYX 1KOTA 2KMCA 4GB9A 4WWOA 2MBQA 2AQ1B 1PQSA 1WXMA 3QWZB 1NYQA 1WGGA 1WGDA 1DGJA 1WYWB 3TJPA 2BS3B 3PZ8A 5D7GA 3NY5A 4WWNA 2X38A 2MP2A 4OZBA 2BTEA 1EF1A 1SEBD 4BBNC 2V0GA 3DCGA 1XEEA 3V61A 1L0YB 2BF8B 1NVID 3A9JB 1EUVB 3AE8B 3SR6A 3DBHB 5JXVA 2W3SA 5DPTA 4E71A 4M0WB 1WJ4A 5BMGA 2QMTA 2BT6A 5D2MB 2C7NB 3FILA 2J0KA 2AX5A 2N7EA 4RF1A 3ZXVA 3AEAB 3IAM1 3KYCD 2IYDB 2ZVOA 5LXIB 4DBGA 2Q5WD 1ET6A 1RYJA 2L7RA 4EFOA 2BVCA 3C0RB 4ANVA 1BT0A 2PEAA 3VH4B 1OEYJ 2LXCA 5HHDG 2XNAC 3NZUA 1XLNA 3VVWB 4OZCA 1OQYA 1U4AA 5E6PA 2B3AA 1WR6E 1ZDXA 2JZ3B 5BO4B 1SXTA 4PS8A 1WGRA 1K52A 1ZDVA 2KMAA 4RGOS 3Q8BA 5IKCM 2GBRA 2KVZA 3PZ7A 3RNAC 2NTTA 5DPRA 3VH3B 2DHZA 1GPXA 1K50A 4W9LA 1CQVA 2FUHB 2M1MA 1C4AA 3HIZA 3EFCA 5BYSA 1QQRA 4AUQC 3DBRI 5DPWA 2WNMA 1C4CA 2MA9B 2XK5B 3KH0A 4TSSA 3NHEB 3TEYA 1WY8A 4L1BA 4BKTA 3ZJTA 2WXLA 3SDLC 2WU5B 2DZKA 1KH0A 1T0YA 3B2GA 1P3QU 2LXAA 3VUWA 1V2YA 3FC4A 1KM7A 2NPTA 4A9AA 4YSZB 3GE8C 1Q5WB 1FNVA 4TMAB 2N1WA 3DBRB 4JWUC 3NJTA 4XC2A 3ZDTA 1VZ8A 1D4BA 3WAMA 3R8BA 4ZRJA 2REXA 3UF8A 3I3TB 2DX5B 2BB6A 1LM8B 1OEYA 3PTFC 2ZCBA 3AXCA 4KVGB 1IPGA 3NVVA 2JXTA 2NR2A 2NBWB 1FXIA 3QK0A 5JHAA 2PJHA 3DBLI 4OW0A 2WXJA 4ANXA 3WANA 2YLMA 4P1CC 4CO7A 3MFGA 4RCOA 3ZRCA 1V80A 1JWUD 2K25A 4TKNA 2WXFA 4ICVA 3PLVA 3RUIB 2M8SA 3AULA 4LNNA 1F9JA 5BYQA 1YIWA 3V05A 4LNKA 4XYCA 2KFKA 1VCBA 4BAXA 1F2RC 2K9XA 1V1OA 2PPHA 4HPLB 4DHZE 2CHWA 2HTME 1YQ3B 2INPE 2MSED 3MJWA 4DWFA 3FKYA 3RCZA 2JYTA 3PPAA 4YL8A 1E6EB 4NQKE 4K1RB 2KC2A 2CKHB 4XDDA 1YN3A 1WXAA 3TCAA 2BKFA 1TYGB 3B2FA 1XXGA 1QOBA 5AZGA 1YJJA 1S3SG 1V97A 4EZJA 3EUB2 1PGXA 2NVUI 1CMXB 4ANUA 4DHZB 4IDIA 4GU2A 2CU1A 4I6PA 3A9JA 3BK1A 1KLUD 2N9PC 3IAS1 4ZDVA 2IDYA 3ZJVA 4M0WA 3QHTA 5IAAC 3ZNID 2PKOA 3PO0A 2LVQA 3LB8C 2ACZB 4G50A 5IN7A 1L0VB 2N9KA 2J42A 1HTQA 3O13A 3AU5A 5HKHA 2BQQA 2GB1A 2NBUA 3PRMB 4CYEA 3DWMA 4GN1A 5C1ZA 1GB1A 2VZKB 2LVPA 4E3CA 1SE3A 1PFDA 4LDTD 1VZ7A 3CF6E 2EKEC 2W54A 2D3CA 1HTOA 3RN9C 1TY0A 2G4DB 4RGTA 1L7YA 1EU3A 1WJNA 1P1AA 1JW9D 3RNFC 1WH3A 3QX1A 2FUG1 2I1JA 2WXIA 5IA7A 2N9XA 4W9EA 3ZTDA 3QAQA 3BZDB 3KUZA 3RMKC 5D3IB 4IWQA 1FM0D 3UIOB 4A3PA 1J8CA 2KC1A 3T3NA 2WXKA 4UDUC 5J17A 3GP7A 4HKZE 1XCQL 3IVFA 3DQVA 1SSNA 1E10A 2CHXA 2KFJA 1T3QA 2FIFA 1Q10A 2KX0A 3ZO5B 2FIDA 5J2RA 3EFUA 3IXSA 4NZLB 3AE3B 3DVGX 3EC8A 2ZNVB 2XK5A 5CHVC 3NUHB 1QLBB 2MBEA 1ET9A 2I1KA 2R61A 2LRWA 1EWCA 2DAJA 1XLOA 1V1PB 1N5WA 2CHZA 3PT2B 3HM3A 2HE7A 3GB1A 3PSEB 3AEFB 3R7RA 4GDLB 2BBCA 1K51A 3Q3FA 4IWPA 3KYDD 4OZAA 1DOYA 1DOIA 1QKZA 1VLBA 2G9HD 4JWSC 3JW0X 3MHSD 3TL5A 1F2RI 1GB4A 4HCNB 1L6VA 2JVCA 2ZCCA 1FXTB 3OG5A 5BMIA 1ACCA 3PREA 2JWUA 3ZNHB 1PDXA 1C76A 1YX5B 4HDQA 1TS5A 4ARIA 2N4FA 4MM3B 3ZXRA 1D5ZC 2AL3A 4AP4C 3ZW3A 2WXOA 3WALA 2LHDA 1IYFA 4WJOA 1E8YA 4EE2A 2Y5BB 4DQOC 4GOCA 2QC8A 3L4PA 2CU3A 1UWMA 3MC9A 4F1SA 1EWYC 2E6XA 1QOFA 1TZOA 4C7ZA 1MJDA 2Z0EB 2IO0B 2C5LC 1K53A 3AE2B 5JZEB 3CSFA 1D5XC 2L83A 3BVZA 3ZGZA 2L8JA 4A90A 2PE6B 4A6QA 4NJCA 1RLFA 3AEEB 1HXYD 5AUKA 2EMTA 2JQRB 1FFVA 3RULA 1D5MC 1J7AA 4H2AA 1WM2A 2WWZA 2M19A 2DYMA 2KK8A 2ZVNA 1ZW7A 4AJWA 2BYEA 2RD0A 2DAFA 1J7BA 1WJUA 3N1ZC 2K3UA 4WJNA 3LXFA 4BOZB 3J9CA 1VDVA 2K8HA 3PLUA 2LMCA 1GJZA 2KQ7A 5DPSA 2GBJA 2RDGA 2JUOA 2KHWB 4K7SA 2KLGA 3HRDD 1UELA 2NPTB 3PVLA 4P1BC 2L32A 3IT4B 3A1QB 3KQ4A 3DHIC 3B1LX 4AQ7A 4XX5A 1ZKHA 1WX8A 1ZXIA 2V4LA 3LJ3A 3AEBB 1UBIA 3LDZE 1TZ1A 3QA8A 3H7PB 2Z0DB 2PMVA 2MLBA 1T0SC 3N3KB 2WXRA 1WGKA 4C7YA 2ZPYA 1UF0A 1WMHB 1N62A 1UD7A 1FRRA 5MPOA 2V9HA 1P9DU 3ML9A 4KSKC 2EMSA 3HVDA 3W2DA 3QJZA 2D07B 1E9MA 1EM7A 1D6EC 1F1HA 3N1XC 2BYTA 4RM9A 1MG4A 2PTLA 4GDKB 4B95A 1SJHD 1Y8RC 2MQJA 5FKAC 4S17A 5HFYA 2DLBA 1L0XB 2MJDA 2LGXA 4ZOHC 3W1SA 3IG3A 3NG0A 4W9GA 4IM2A 4TUUA 1BUIC 1WZ0A 3ML8A 1QILA 1V49A 4LK0M 4O1NA 2LGYA 2LGSA 4LCDE 2Y3AA 1WE7A 3X23A 1SGHA 3DBHI 2JSVX 1FXAA 2WQYB 3APDA 4JPSA 2KQSA 2QDFA 1FPYA 1HE8A 1NI2A 3AE5B 5HI1A 4ZRKA 1TS2A 2J7QB 4EZKA 3X0WA 1I42A 2X8XX 4ZHPA 2R2OA 3A4SC 2RPQA 2G4SA 2KWUB 4WQMA 1TTNA 3B0AA 1P0RA 1LGRA 1V1PA 2GBKA 2HD5B 3Q8FA 3B08A 1LFDA 4MACA 4US8A 1RAXA 1SE4A 1NYRA 3OWEB 2DBYA 5FR6A 2IPKD 2AL6A 4GDLA 3OJ3A 3R2IA 3U7DA 2KZRA 4G3XB 2DWQA 2KT7A 1QOAA 4A3OA 1R4NI 3VRAB 3H7SA 2KWDA 4US9A 3Q3OC 2IBIB 3ZKJC 2PIAA 5JHBA 3NZ3A 2KDMA 3TEWA 1FD6A 4BZAA 4LNOA 1I4QA 2JYEA 3ALBA 4MM3A 4GMVA 1JRPA 3RNBC
chains in the Genus database with same CATH topology
3WAPA 2CR5A 2UYZB 3R7QA 1E7UA 3HK0A 2JF5A 2PPHA 3KW5B 4HPLB 3ZVVA 1I35A 1WIAA 1GG3A 2CHWA 5LLIA 4DHZE 2D11A 2DYBA 3K9PB 3PS6A 2O2VA 2MP2B 2MSED 3MJWA 2LVOA 3ZUNA 3RCZA 4DWFA 3PPAA 4XZ4A 4YL8A 3VDZA 4ASWC 3JVZX 4AOFA 3RT3B 1YJ1A 4BOSC 2A5UA 3JSVA 4I6NB 1Q1OA 3PHXB 2LD9A 3R66C 4IM0A 4KSLC 4NQKE 4K1RB 2KC2A 3DDCB 1WXVA 2IO2B 4ICUA 3L54A 2NCNA 2CKHB 2KOXA 4K7UA 1WM3A 1KLVA 3DVNU 4MJSB 4FADA 2JY6A 2WX0A 1WXAA 2KN5A 3TCAA 2L76A 2FAZA 3V6CB 2BKFA 4A20A 1D3ZA 2D3GA 2AYOB 5AZGA 4GXBA 3S2AA 2LASA 2MBHA 3W1SC 4AJYB 4WQOB 4HXDA 3D32A 3QQ8B 2OOBB 3H9DA 1S3SG 1UBQA 3L10B 2CS4A 4MGYE 4DHJD 1UH6A 4IUMB 4EZJA 2G45B 3VTVA 3A9KB 2FCNA 2NVUI 4MGZE 5GMVA 1CMXB 4II3B 1E5WA 5G55A 4ANUA 4OVUA 4DHZB 5L95C 2JRHA 4II2B 4GU2A 2CU1A 2AEHA 2LGDA 3A9JA 4I6PA 4K81A 3VQIA 2N9PC 2LRUA 3DOWA 2KDBA 4FN2A 4IM3A 4B9KA 4DK5A 4ZDVA 2NBVB 2DZJA 3QHTA 5IAAC 2C7HA 3ZNID 4DDGD 3ECIA 4IC7B 3L16A 3ZRFA 2GBNA 3DPDA 3WA0A 2KVRA 2LVQA 1V86A 4HCPB 1WXSA 4G50A 3V62A 4PYZA 5AZHA 2ZNVC 4ANWA 3OJ4B 3AU5A 4GGQA 3PHWB 3L0WB 5HKHA 3EHVA 2NBUA 3PRMB 4CYEA 3KUDB 5J18A 3VHTC 5C1ZA 1GNUA 4GN1A 2JT4B 4GSWA 3W1YA 1E8XA 1V81A 3A33B 4WWPA 3A1QA 2LVPA 3RYTA 3DVGY 4E3CA 2AWTA 1C1YB 3VUXA 4LDTD 3CF6E 4PS7A 2WYQA 4KIKA 2EKEC 1NDDA 2A4ZA 2KTFA 4NAWB 2KJHB 2DZIA 3GOEA 2G4DB 1L7YA 1WJNA 2BPSA 1E7VA 4F8CB 3H7PA 3PZDA 1P1AA 3ENEA 5CTRC 1WH3A 3QX1A 2UWQA 1WRDB 4MSMB 2ASQA 3WAOA 2I1JA 3AU4A 3U30A 1YD8U 5IA7A 2N9XA 4M8MA 2ZJDA 3APCA 2L0TA 4W9EA 5G2NA 1NBFC 3QAQA 3ZTDA 2MW5A 1RFAA 1GC7A 3CSTA 2KDEB 2BWFA 2OJRA 4N9F4 1H8CA 3KUZA 4CHKA 5L83A 4IWQA 1MG8A 4TQ0A 2KWCA 1WMHA 4J6IA 4BKGA 3UIOB 4EUTA 2O6VD 4A3PA 2M4NA 3NZSA 4HWIB 2KC1A 1J8CA 4W9IA 2KD0A 2BWES 5J17A 3M95A 4FJVB 2V1YA 3IVFA 3DQVA 2KLCA 2IO3B 2CHXA 2VRRB 1WFYA 2MBBB 3IBEA 1GC6A 1EF5A 1WJ6A 3UQAA 2KFJA 3RZFA 2FIFA 2MX2A 3QIJA 2KX0A 4ZYNA 3ZO5B 1X1MA 3ZNZB 3ZIMA 3UINB 4HDOA 1WE6A 2XBBC 2FIDA 3APFA 5E6OA 4GDKA 3V60A 1Q0WB 2RGFA 2HTHA 4HPMB 5J2RA 1WR1A 2K6QA 2QHOA 2N7DA 1C3TA 3PGEA 2DYOA 4OVVA 5D6JB 2LJ5A 3EFUA 4W9JA 3Q3JA 3JYUA 3DVGX 1K8RB 3EECA 3EC8A 3H6NA 4JGHB 3HHMA 2ZNVB 2XK5A 3GZNI 5CHVC 2IY0B 4W9CA 2MBEA 1S1QB 1SIFA 2BYFA 2L00B 1SE9A 2JRIB 2O6VA 5CX3A 2I1KA 2K6DB 2LZ6A 2LRWA 3PRZA 4MSQB 2DAJA 5AEKB 2LI5A 2RSUA 2CHZA 3K9OB 3PT2B 5AZFA 3HM3A 1WGYA 2HE7A 1L2NA 2J0JA 1WZ3A 1TGZB 2MCNB 2GBMA 3O65B 3PSEB 1V6EA 4G0NB 1YQBA 2DZMA 4HJKA 1E90A 3R7RA 4GDLB 3ZNGC 3Q3FA 1J0GA 4IWPA 2V3SA 1M94A 3KYDD 4BKSD 2ZZPB 4HLEA 2D10A 2GMIC 2KJRA 4W9DA 2FCSA 2PE9A 1P98A 2KTRA 4RMAA 3JW0X 3MHSD 3TL5A 4KZCA 4K7WA 4HCNB 2ZCCA 2JVCA 3SU8X 1FXTB 3M63B 3TMPB 3OAWA 3DBSA 1WGHA 4JQWC 4MGKE 3PREA 4KDIC 3ZNHB 4M8NA 2C60A 1YX5B 2WX1A 2J0MA 4HDQA 4PS3A 4FA6A 2N1VA 1E8ZA 2KFKB 3M3JA 3L17A 2N4FA 2XEWA 4LJOB 2LWPA 2ZEQA 2AL3A 4GIVA 4AP4C 3ZW3A 3WALA 4HVBA 5JH5C 1IYFA 4WJQA 4WJOA 2KANA 1E8YA 4P7IA 3VAWA 3KVFB 2Y5BB 4FHJA 5KHOA 4GOCA 4MEMA 3UQBA 3QCAA 2NS5A 1WX9A 3ONSA 3V6EB 4BKSA 1Z5SB 2O2VB 3T8MA 4F1SA 4B6WA 1A5RA 2D2QA 2MRPA 1TBEA 3UGBB 4JIOU 2IY1B 2C7MB 2C9WB 1WX7A 2Z0EB 3WIMA 3JSVB 2G3QB 4LJPB 2IO0B 3CMMB 4NQLB 2C5LC 4NJ7A 1KOTA 2KMCA 2KXJA 2ZPNA 4GB9A 2FCQA 3CSFA 4MDKE 2MBQA 3N32A 4X57B 5JZEB 1PQSA 2L8JA 1WXMA 3QWZB 2PE6B 1WGGA 1WGDA 4RM8A 1WYWB 1V5TA 3M62B 3NOBA 1RLFA 3TJPA 5D7GA 1V5OA 2EMTA 4IW0A 5DCNA 3RULA 3NY5A 4WWNA 5C23A 1RRBA 2MP2A 4FJZA 1WM2A 1EF1A 2WWZA 3VTWA 4BBNC 3DCGA 2DYMA 2KK8A 1ISNA 3V61A 2ZVNA 1J19A 4FULA 1ZW7A 1WI0A 4AJWA 2BYEA 2K1FA 2BF8B 3A9JB 1EUVB 2RD0A 2RR9A 2JXXA 2DAFA 5EDSA 4URKA 1WJUA 4MJSA 2L05A 5DPTA 4WJNA 3HM6X 4E71A 4KDLB 4BOZB 2K8HA 4M0WB 1WJ4A 3PLUA 1G6JA 4HK2A 1GJZA 4F7ZA 2KQ7A 3VUYA 5DPSA 1LQBA 2GBJA 2M0XA 4NY0A 1WF9A 5D2MB 1EO6A 5LXHA 1XD3B 2C7NB 2LUEA 2J0KA 2JUOA 2KHWB 1OGWA 2Z59B 4K7SA 2KLGA 5E6NA 2N7EA 1UELA 2NPTB 3A9KA 4IG7B 3VFKA 3KYCD 2IYDB 2BGFA 3PVLA 2ZVOA 3AI5A 3P2BA 4WAAA 5LXIB 3ZDMC 2JWZA 3A1QB 4G11A 3TIXA 4DHJB 4DBGA 3NS8A 4BFRA 3B1LX 2L7RA 4EFOA 4EEWA 4ZRIA 4KIKB 3C0RB 4XX5A 2IZVB 1ZKHA 4ANVA 1WX8A 1BT0A 2V4LA 2KWVB 3LJ3A 1UBIA 3LDZE 1UGMA 2PEAA 2JZZA 3VH4B 1TZ1A 3QA8A 4DXAB 4KZ0A 3H7PB 3UIPB 1OEYJ 2Z0DB 3RD2A 2KDIA 1ZGUB 4EOYA 2LXCA 2K39A 2MLBA 4IWOA 3NZUA 3VVWB 5D94A 3A4RA 2MBOA 1OQYA 1U4AA 5E6PA 3N3KB 2B3AA 1WR6E 2BYVE 2JZ3B 1H4RA 2HJ8A 1KJTA 5BO4B 4PYUA 2ZPYA 3L08A 4W9HA 2KKCA 4PS8A 5KHQA 1WGRA 3SD5A 1WMHB 1UD7A 3VXWA 2KMAA 1XQQA 3R3MA 1P9DU 4FJYA 4NAWA 3ML9A 3KUCB 3QC8B 4KSKC 2FCMA 4BBNF 2DENB 2GBRA 2EMSA 2L3ZA 2KDFB 1QZEA 4LDTB 4E74A 3QJZA 2D07B 2YVCA 4TQ1A 5DPRA 2N9EB 4AWJA 4DDID 3VH3B 3RZWC 2DHZA 4RM9A 4EZLA 4W9LA 4GDKB 2FUHB 4FLHA 4B95A 1Y8RC 2M1MA 2MQJA 3HIZA 3SHQA 2WDTB 5CHFA 3H1UA 2LGXA 4AUQC 3DBRI 3W1SA 5DPWA 1AARA 2KJ6A 2MA9B 3IG3A 2JPHA 2M17A 1OTRB 2XK5B 3KH0A 4W9GA 3NHEB 1UZXB 1WY8A 4BKTA 2O6VB 4IM2A 4TUUA 1WZ0A 3ML8A 4KV2A 1V49A 2LGYA 4JLCA 4LCDE 3SDLC 2DZKA 2MWSB 1WE7A 4WJPA 3X23A 3PV1A 1SGHA 3DBHI 2IO1B 4TV3A 1T0YA 1P3QU 2LXAA 3VUWA 1V2YA 3IFWB 3BY4B 1KM7A 2NPTA 1Q5WB 3APDA 3ZTCA 2FNJB 2KX3A 2KQSA 3MTNB 1HE8A 1NI2A 2N1WA 3TBLD 4ZRKA 4XC2A 3ZDTA 2J7QB 3IHPC 4EZKA 3QARA 3WAMA 3X0WA 4ZRJA 1I42A 4FHKA 2REXA 1XT9B 2R2OA 2W9NA 2BKRB 3A4SC 1R4MI 2KO3A 2G4SA 2KWUB 2RPQA 1TTNA 2KTRB 3B0AA 1P0RA 3I3TB 3UF8A 3N30A 2DX5B 2KNBA 2R2QA 2HD5B 2GBKA 4W9KA 3B08A 1LFDA 1LM8B 1OEYA 3PTFC 4JL9A 2ZCBA 3AXCA 4KVGB 4NJ6A 1IPGA 1RAXA 3PRPB 2NR2A 2NBWB 3QK0A 5JHAA 4MGIE 4MH0E 4WWOA 4BVUC 2PJHA 3DBLI 3T9LA 5FR6A 1V9JA 2AL6A 3OJ3A 4GDLA 3ZLZA 3U7DA 2KZRA 4G3XB 4I6LB 1IP9A 3VTUA 1LXDA 2K8BA 4ANXA 4NNJB 3WANA 2YLMA 5TR5A 1GUAB 4W9FA 4A3OA 4FBJB 1R4NI 4CO7A 3ZRCA 1V80A 1VD2A 3H7SA 2K25A 3U8ZA 1YX6B 4TKNA 4ICVA 4NPNA 3PLVA 2IBIB 3ZKJC 5JHBA 3RUIB 5CHWA 2M8SA 3BINA 3AULA 2L0FA 3OLMD 1E8WA 4EKUA 2K8CA 1F9JA 1YIWA 3L13A 1JRUA 2GOWA 1VCBA 2KFKA 3DVNV 4MELA 1Z2MA 3ALBA 4MM3A 4GMVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WAP A;  2CR5 A;  2UYZ B;  3R7Q A;  1E7U A;  3HK0 A;  2JF5 A;  2PPH A;  3KW5 B;  4HPL B;  3ZVV A;  1I35 A;  1WIA A;  1GG3 A;  2CHW A;  5LLI A;  4DHZ E;  2D11 A;  2DYB A;  3K9P B;  3PS6 A;  2O2V A;  2MP2 B;  2MSE D;  3MJW A;  2LVO A;  3ZUN A;  3RCZ A;  4DWF A;  3PPA A;  4XZ4 A;  4YL8 A;  3VDZ A;  4ASW C;  3JVZ X;  4AOF A;  3RT3 B;  1YJ1 A;  4BOS C;  2A5U A;  3JSV A;  4I6N B;  1Q1O A;  3PHX B;  2LD9 A;  3R66 C;  4IM0 A;  4KSL C;  4NQK E;  4K1R B;  2KC2 A;  3DDC B;  1WXV A;  2IO2 B;  4ICU A;  3L54 A;  2NCN A;  2CKH B;  2KOX A;  4K7U A;  1WM3 A;  1KLV A;  3DVN U;  4MJS B;  4FAD A;  2JY6 A;  2WX0 A;  1WXA A;  2KN5 A;  3TCA A;  2L76 A;  2FAZ A;  3V6C B;  2BKF A;  4A20 A;  1D3Z A;  2D3G A;  2AYO B;  5AZG A;  4GXB A;  3S2A A;  2LAS A;  2MBH A;  3W1S C;  4AJY B;  4WQO B;  4HXD A;  3D32 A;  3QQ8 B;  2OOB B;  3H9D A;  1S3S G;  1UBQ A;  3L10 B;  2CS4 A;  4MGY E;  4DHJ D;  1UH6 A;  4IUM B;  4EZJ A;  2G45 B;  3VTV A;  3A9K B;  2FCN A;  2NVU I;  4MGZ E;  5GMV A;  1CMX B;  4II3 B;  1E5W A;  5G55 A;  4ANU A;  4OVU A;  4DHZ B;  5L95 C;  2JRH A;  4II2 B;  4GU2 A;  2CU1 A;  2AEH A;  2LGD A;  3A9J A;  4I6P A;  4K81 A;  3VQI A;  2N9P C;  2LRU A;  3DOW A;  2KDB A;  4FN2 A;  4IM3 A;  4B9K A;  4DK5 A;  4ZDV A;  2NBV B;  2DZJ A;  3QHT A;  5IAA C;  2C7H A;  3ZNI D;  4DDG D;  3ECI A;  4IC7 B;  3L16 A;  3ZRF A;  2GBN A;  3DPD A;  3WA0 A;  2KVR A;  2LVQ A;  1V86 A;  4HCP B;  1WXS A;  4G50 A;  3V62 A;  4PYZ A;  5AZH A;  2ZNV C;  4ANW A;  3OJ4 B;  3AU5 A;  4GGQ A;  3PHW B;  3L0W B;  5HKH A;  3EHV A;  2NBU A;  3PRM B;  4CYE A;  3KUD B;  5J18 A;  3VHT C;  5C1Z A;  1GNU A;  4GN1 A;  2JT4 B;  4GSW A;  3W1Y A;  1E8X A;  1V81 A;  3A33 B;  4WWP A;  3A1Q A;  2LVP A;  3RYT A;  3DVG Y;  4E3C A;  2AWT A;  1C1Y B;  3VUX A;  4LDT D;  3CF6 E;  4PS7 A;  2WYQ A;  4KIK A;  2EKE C;  1NDD A;  2A4Z A;  2KTF A;  4NAW B;  2KJH B;  2DZI A;  3GOE A;  2G4D B;  1L7Y A;  1WJN A;  2BPS A;  1E7V A;  4F8C B;  3H7P A;  3PZD A;  1P1A A;  3ENE A;  5CTR C;  1WH3 A;  3QX1 A;  2UWQ A;  1WRD B;  4MSM B;  2ASQ A;  3WAO A;  2I1J A;  3AU4 A;  3U30 A;  1YD8 U;  5IA7 A;  2N9X A;  4M8M A;  2ZJD A;  3APC A;  2L0T A;  4W9E A;  5G2N A;  1NBF C;  3QAQ A;  3ZTD A;  2MW5 A;  1RFA A;  1GC7 A;  3CST A;  2KDE B;  2BWF A;  2OJR A;  4N9F 4;  1H8C A;  3KUZ A;  4CHK A;  5L83 A;  4IWQ A;  1MG8 A;  4TQ0 A;  2KWC A;  1WMH A;  4J6I A;  4BKG A;  3UIO B;  4EUT A;  2O6V D;  4A3P A;  2M4N A;  3NZS A;  4HWI B;  2KC1 A;  1J8C A;  4W9I A;  2KD0 A;  2BWE S;  5J17 A;  3M95 A;  4FJV B;  2V1Y A;  3IVF A;  3DQV A;  2KLC A;  2IO3 B;  2CHX A;  2VRR B;  1WFY A;  2MBB B;  3IBE A;  1GC6 A;  1EF5 A;  1WJ6 A;  3UQA A;  2KFJ A;  3RZF A;  2FIF A;  2MX2 A;  3QIJ A;  2KX0 A;  4ZYN A;  3ZO5 B;  1X1M A;  3ZNZ B;  3ZIM A;  3UIN B;  4HDO A;  1WE6 A;  2XBB C;  2FID A;  3APF A;  5E6O A;  4GDK A;  3V60 A;  1Q0W B;  2RGF A;  2HTH A;  4HPM B;  5J2R A;  1WR1 A;  2K6Q A;  2QHO A;  2N7D A;  1C3T A;  3PGE A;  2DYO A;  4OVV A;  5D6J B;  2LJ5 A;  3EFU A;  4W9J A;  3Q3J A;  3JYU A;  3DVG X;  1K8R B;  3EEC A;  3EC8 A;  3H6N A;  4JGH B;  3HHM A;  2ZNV B;  2XK5 A;  3GZN I;  5CHV C;  2IY0 B;  4W9C A;  2MBE A;  1S1Q B;  1SIF A;  2BYF A;  2L00 B;  1SE9 A;  2JRI B;  2O6V A;  5CX3 A;  2I1K A;  2K6D B;  2LZ6 A;  2LRW A;  3PRZ A;  4MSQ B;  2DAJ A;  5AEK B;  2LI5 A;  2RSU A;  2CHZ A;  3K9O B;  3PT2 B;  5AZF A;  3HM3 A;  1WGY A;  2HE7 A;  1L2N A;  2J0J A;  1WZ3 A;  1TGZ B;  2MCN B;  2GBM A;  3O65 B;  3PSE B;  1V6E A;  4G0N B;  1YQB A;  2DZM A;  4HJK A;  1E90 A;  3R7R A;  4GDL B;  3ZNG C;  3Q3F A;  1J0G A;  4IWP A;  2V3S A;  1M94 A;  3KYD D;  4BKS D;  2ZZP B;  4HLE A;  2D10 A;  2GMI C;  2KJR A;  4W9D A;  2FCS A;  2PE9 A;  1P98 A;  2KTR A;  4RMA A;  3JW0 X;  3MHS D;  3TL5 A;  4KZC A;  4K7W A;  4HCN B;  2ZCC A;  2JVC A;  3SU8 X;  1FXT B;  3M63 B;  3TMP B;  3OAW A;  3DBS A;  1WGH A;  4JQW C;  4MGK E;  3PRE A;  4KDI C;  3ZNH B;  4M8N A;  2C60 A;  1YX5 B;  2WX1 A;  2J0M A;  4HDQ A;  4PS3 A;  4FA6 A;  2N1V A;  1E8Z A;  2KFK B;  3M3J A;  3L17 A;  2N4F A;  2XEW A;  4LJO B;  2LWP A;  2ZEQ A;  2AL3 A;  4GIV A;  4AP4 C;  3ZW3 A;  3WAL A;  4HVB A;  5JH5 C;  1IYF A;  4WJQ A;  4WJO A;  2KAN A;  1E8Y A;  4P7I A;  3VAW A;  3KVF B;  2Y5B B;  4FHJ A;  5KHO A;  4GOC A;  4MEM A;  3UQB A;  3QCA A;  2NS5 A;  1WX9 A;  3ONS A;  3V6E B;  4BKS A;  1Z5S B;  2O2V B;  3T8M A;  4F1S A;  4B6W A;  1A5R A;  2D2Q A;  2MRP A;  1TBE A;  3UGB B;  4JIO U;  2IY1 B;  2C7M B;  2C9W B;  1WX7 A;  2Z0E B;  3WIM A;  3JSV B;  2G3Q B;  4LJP B;  2IO0 B;  3CMM B;  4NQL B;  2C5L C;  4NJ7 A;  1KOT A;  2KMC A;  2KXJ A;  2ZPN A;  4GB9 A;  2FCQ A;  3CSF A;  4MDK E;  2MBQ A;  3N32 A;  4X57 B;  5JZE B;  1PQS A;  2L8J A;  1WXM A;  3QWZ B;  2PE6 B;  1WGG A;  1WGD A;  4RM8 A;  1WYW B;  1V5T A;  3M62 B;  3NOB A;  1RLF A;  3TJP A;  5D7G A;  1V5O A;  2EMT A;  4IW0 A;  5DCN A;  3RUL A;  3NY5 A;  4WWN A;  5C23 A;  1RRB A;  2MP2 A;  4FJZ A;  1WM2 A;  1EF1 A;  2WWZ A;  3VTW A;  4BBN C;  3DCG A;  2DYM A;  2KK8 A;  1ISN A;  3V61 A;  2ZVN A;  1J19 A;  4FUL A;  1ZW7 A;  1WI0 A;  4AJW A;  2BYE A;  2K1F A;  2BF8 B;  3A9J B;  1EUV B;  2RD0 A;  2RR9 A;  2JXX A;  2DAF A;  5EDS A;  4URK A;  1WJU A;  4MJS A;  2L05 A;  5DPT A;  4WJN A;  3HM6 X;  4E71 A;  4KDL B;  4BOZ B;  2K8H A;  4M0W B;  1WJ4 A;  3PLU A;  1G6J A;  4HK2 A;  1GJZ A;  4F7Z A;  2KQ7 A;  3VUY A;  5DPS A;  1LQB A;  2GBJ A;  2M0X A;  4NY0 A;  1WF9 A;  5D2M B;  1EO6 A;  5LXH A;  1XD3 B;  2C7N B;  2LUE A;  2J0K A;  2JUO A;  2KHW B;  1OGW A;  2Z59 B;  4K7S A;  2KLG A;  5E6N A;  2N7E A;  1UEL A;  2NPT B;  3A9K A;  4IG7 B;  3VFK A;  3KYC D;  2IYD B;  2BGF A;  3PVL A;  2ZVO A;  3AI5 A;  3P2B A;  4WAA A;  5LXI B;  3ZDM C;  2JWZ A;  3A1Q B;  4G11 A;  3TIX A;  4DHJ B;  4DBG A;  3NS8 A;  4BFR A;  3B1L X;  2L7R A;  4EFO A;  4EEW A;  4ZRI A;  4KIK B;  3C0R B;  4XX5 A;  2IZV B;  1ZKH A;  4ANV A;  1WX8 A;  1BT0 A;  2V4L A;  2KWV B;  3LJ3 A;  1UBI A;  3LDZ E;  1UGM A;  2PEA A;  2JZZ A;  3VH4 B;  1TZ1 A;  3QA8 A;  4DXA B;  4KZ0 A;  3H7P B;  3UIP B;  1OEY J;  2Z0D B;  3RD2 A;  2KDI A;  1ZGU B;  4EOY A;  2LXC A;  2K39 A;  2MLB A;  4IWO A;  3NZU A;  3VVW B;  5D94 A;  3A4R A;  2MBO A;  1OQY A;  1U4A A;  5E6P A;  3N3K B;  2B3A A;  1WR6 E;  2BYV E;  2JZ3 B;  1H4R A;  2HJ8 A;  1KJT A;  5BO4 B;  4PYU A;  2ZPY A;  3L08 A;  4W9H A;  2KKC A;  4PS8 A;  5KHQ A;  1WGR A;  3SD5 A;  1WMH B;  1UD7 A;  3VXW A;  2KMA A;  1XQQ A;  3R3M A;  1P9D U;  4FJY A;  4NAW A;  3ML9 A;  3KUC B;  3QC8 B;  4KSK C;  2FCM A;  4BBN F;  2DEN B;  2GBR A;  2EMS A;  2L3Z A;  2KDF B;  1QZE A;  4LDT B;  4E74 A;  3QJZ A;  2D07 B;  2YVC A;  4TQ1 A;  5DPR A;  2N9E B;  4AWJ A;  4DDI D;  3VH3 B;  3RZW C;  2DHZ A;  4RM9 A;  4EZL A;  4W9L A;  4GDK B;  2FUH B;  4FLH A;  4B95 A;  1Y8R C;  2M1M A;  2MQJ A;  3HIZ A;  3SHQ A;  2WDT B;  5CHF A;  3H1U A;  2LGX A;  4AUQ C;  3DBR I;  3W1S A;  5DPW A;  1AAR A;  2KJ6 A;  2MA9 B;  3IG3 A;  2JPH A;  2M17 A;  1OTR B;  2XK5 B;  3KH0 A;  4W9G A;  3NHE B;  1UZX B;  1WY8 A;  4BKT A;  2O6V B;  4IM2 A;  4TUU A;  1WZ0 A;  3ML8 A;  4KV2 A;  1V49 A;  2LGY A;  4JLC A;  4LCD E;  3SDL C;  2DZK A;  2MWS B;  1WE7 A;  4WJP A;  3X23 A;  3PV1 A;  1SGH A;  3DBH I;  2IO1 B;  4TV3 A;  1T0Y A;  1P3Q U;  2LXA A;  3VUW A;  1V2Y A;  3IFW B;  3BY4 B;  1KM7 A;  2NPT A;  1Q5W B;  3APD A;  3ZTC A;  2FNJ B;  2KX3 A;  2KQS A;  3MTN B;  1HE8 A;  1NI2 A;  2N1W A;  3TBL D;  4ZRK A;  4XC2 A;  3ZDT A;  2J7Q B;  3IHP C;  4EZK A;  3QAR A;  3WAM A;  3X0W A;  4ZRJ A;  1I42 A;  4FHK A;  2REX A;  1XT9 B;  2R2O A;  2W9N A;  2BKR B;  3A4S C;  1R4M I;  2KO3 A;  2G4S A;  2KWU B;  2RPQ A;  1TTN A;  2KTR B;  3B0A A;  1P0R A;  3I3T B;  3UF8 A;  3N30 A;  2DX5 B;  2KNB A;  2R2Q A;  2HD5 B;  2GBK A;  4W9K A;  3B08 A;  1LFD A;  1LM8 B;  1OEY A;  3PTF C;  4JL9 A;  2ZCB A;  3AXC A;  4KVG B;  4NJ6 A;  1IPG A;  1RAX A;  3PRP B;  2NR2 A;  2NBW B;  3QK0 A;  5JHA A;  4MGI E;  4MH0 E;  4WWO A;  4BVU C;  2PJH A;  3DBL I;  3T9L A;  5FR6 A;  1V9J A;  2AL6 A;  3OJ3 A;  4GDL A;  3ZLZ A;  3U7D A;  2KZR A;  4G3X B;  4I6L B;  1IP9 A;  3VTU A;  1LXD A;  2K8B A;  4ANX A;  4NNJ B;  3WAN A;  2YLM A;  5TR5 A;  1GUA B;  4W9F A;  4A3O A;  4FBJ B;  1R4N I;  4CO7 A;  3ZRC A;  1V80 A;  1VD2 A;  3H7S A;  2K25 A;  3U8Z A;  1YX6 B;  4TKN A;  4ICV A;  4NPN A;  3PLV A;  2IBI B;  3ZKJ C;  5JHB A;  3RUI B;  5CHW A;  2M8S A;  3BIN A;  3AUL A;  2L0F A;  3OLM D;  1E8W A;  4EKU A;  2K8C A;  1F9J A;  1YIW A;  3L13 A;  1JRU A;  2GOW A;  1VCB A;  2KFK A;  3DVN V;  4MEL A;  1Z2M A;  3ALB A;  4MM3 A;  4GMV A; 
#chains in the Genus database with same CATH topology
 2K22 A;  3WAP A;  2UYZ B;  3U4E G;  2JF5 A;  1I35 A;  3VRB B;  5LLI A;  1GG3 A;  1R4N B;  1TKG A;  3K9P B;  4OHJ A;  4XWW A;  3ETR A;  3IT6 B;  2LVO A;  4XZ4 A;  4BOS C;  2A5U A;  2LD9 A;  1WXV A;  2IO2 B;  2ON8 A;  4ICU A;  3BVG A;  2KOX A;  4K7U A;  1WYG A;  1FCC C;  4MJS B;  1OQQ A;  2JY6 A;  2WX0 A;  4DXF A;  2L76 A;  2FAZ A;  1XO3 A;  2WXG A;  3V6C B;  1D3Z A;  2D3G A;  4GXB A;  3S2A A;  4AJY B;  3W1S C;  2N7J A;  4WQO B;  2K0P A;  4HXD A;  3Q8A A;  5G5G A;  1FCL A;  4IUM B;  3A9K B;  2FCN A;  3Q14 C;  3AM9 A;  3Q8E A;  4YSX B;  1KF6 B;  4M01 A;  5G55 A;  4OVU A;  4II2 B;  3BYT B;  1YMH E;  2LRU A;  1PGB A;  2V3N A;  3RNE C;  2NBV B;  5C3J B;  3AV8 A;  3ECI A;  3ZRF A;  4HRO A;  3DPD A;  2WS3 B;  3Q8C A;  3WA0 A;  1WXS A;  4ARC A;  1E0Z A;  2ZNV C;  3Q2A C;  5HG2 A;  4GGQ A;  3L0W B;  5J18 A;  3KUD B;  1GNU A;  3AB5 A;  4GSW A;  1HQR D;  3W1Y A;  1E8X A;  1V81 A;  3A1Q A;  2H88 B;  3NVZ A;  1C79 A;  1A70 A;  2WYQ A;  3FAH A;  1NDD A;  2A4Z A;  4J3O D;  2BPS A;  5FR3 A;  3H7P A;  4ZYS A;  3ENE A;  3W9C B;  5CTR C;  2XN9 C;  2UWQ A;  4MSM B;  2NMQ A;  3TEZ A;  1YD8 U;  2QEJ C;  1E7P B;  1BXT A;  5G2N A;  2MW5 A;  1GC7 A;  2BWF A;  2OJR A;  4N9F 4;  1H8C A;  2W82 A;  1CJE A;  1MG8 A;  1WMH A;  3C8Y A;  3P4P B;  4HWI B;  4W9I A;  3P4Q B;  2KD0 A;  2VH1 A;  3NS1 A;  2IO3 B;  1L4D B;  3IBE A;  1GC6 A;  1EF5 A;  2MX2 A;  4ZYN A;  1JML A;  5EE9 A;  5G5H A;  3C19 A;  4Q2J A;  3APF A;  5E6O A;  4GDK A;  1Q0W B;  2HTH A;  3U7Z A;  4RGM A;  2K6Q A;  1C3T A;  3PGE A;  4OVV A;  5D6J B;  1ENF A;  2LJ5 A;  2QIL A;  4JGH B;  3HHM A;  5T8I A;  4D2K A;  3GZN I;  2YEP F;  5TSS A;  4W9C A;  2YEP B;  1XLQ A;  1SIF A;  2K6D B;  3Q3N C;  3PRZ A;  2CJN A;  2LI5 A;  3K9O B;  1WGY A;  2J52 A;  2J0J A;  2MEK A;  4L2Y A;  1TGZ B;  1YQB A;  2DZM A;  5BYR A;  2Y5P A;  2WXQ A;  4WH4 A;  4WIP A;  3Q6B A;  4C56 C;  2GMI C;  2KJR A;  3GZN B;  1P98 A;  4KGS A;  1NEN B;  4RMA A;  1VJK A;  4K7W A;  1VRA B;  5C2T B;  2LEK A;  4HKQ A;  4JQW C;  1WGH A;  3HVZ A;  4MGK E;  1JCK B;  1JRO A;  2C60 A;  2WX1 A;  1N61 A;  1GOZ A;  4YXD B;  2N1V A;  1E8Z A;  1Y56 A;  4K3B A;  4LJO B;  5JH5 C;  1YNT E;  2KAN A;  4P7I A;  1UNS A;  4PK1 A;  3GE3 C;  4FHJ A;  5KHO A;  4MEM A;  4RGN A;  3AEC B;  1Z5S B;  2O2V B;  4B6W A;  4NAM A;  4JIO U;  4LJP B;  2D5G A;  3CMM B;  5IOI A;  2KXJ A;  2ZPN A;  2FCQ A;  4X57 B;  1JWB D;  1AWD A;  2PLP A;  1MHH E;  2IGH A;  4RM8 A;  1V5T A;  1DOX A;  3M62 B;  3NOB A;  2V4I B;  1V5O A;  5DCN A;  1RM6 C;  5C23 A;  1RRB A;  3U52 E;  4FJZ A;  1QOG A;  3I9V 1;  4FUL A;  2Z8L A;  1LO5 D;  2RR9 A;  2JXX A;  1HZ5 A;  4MJS A;  2L05 A;  3HM6 X;  4HK2 A;  1L4Z B;  2WXN A;  1LQB A;  5LXH A;  5E6N A;  1OGW A;  2VZK D;  3MC0 B;  3A9K A;  4IG7 B;  1F0Z A;  2ONQ A;  3P2B A;  3P4R B;  2MJE A;  1TY2 A;  4RH6 A;  4G11 A;  4DHJ B;  2B76 B;  5EE3 A;  4REZ A;  3KWV A;  2OHF A;  2PVG C;  2KWV B;  1UGM A;  2JZZ A;  4KZ0 A;  3UIP B;  3RD2 A;  1L6U A;  1MVK A;  4EOY A;  5D94 A;  4YSY B;  1P7F A;  4WAF A;  2GLS A;  2LHE A;  1H4R A;  2HJ8 A;  1I7H A;  2IND C;  4W9H A;  3TSS A;  1PUT A;  4LLG M;  1XQQ A;  1STE A;  4FJY A;  3KUC B;  2FCM A;  3SEB A;  2PVO D;  1L5P A;  2YVC A;  4TQ1 A;  2EEL A;  1T0R C;  5AUI A;  1OFF A;  4AWJ A;  4DDI D;  3RZW C;  4FLH A;  1WXQ A;  2WDT B;  5H92 C;  1JWA D;  1AAR A;  1N63 A;  1OTR B;  2O6V B;  2ZW0 A;  5E6J A;  3RI7 C;  4JLC A;  2MWS B;  3PV1 A;  2IO1 B;  2N0S B;  4TV3 A;  1RWS A;  1AW7 A;  2FE8 A;  3ZTC A;  2KX3 A;  4XE0 A;  1XF5 L;  2LJI A;  2DNF A;  3TBL D;  4RFB A;  3IHP C;  3QAR A;  3AE9 B;  4XDC A;  4FHK A;  1XT9 B;  2BKR B;  4WJP A;  2KO3 A;  2KTR B;  3N30 A;  2KNB A;  4YTN B;  4W9K A;  1WRI A;  4JL9 A;  4NJ6 A;  3PRP B;  1C4P A;  1HEZ E;  4MH0 E;  4BVU C;  3T9L A;  1N60 A;  1V9J A;  3ZLZ A;  2KAC A;  3U2S C;  4YWG G;  1IP9 A;  1UGJ A;  3VTU A;  1LXD A;  5TR5 A;  1GUA B;  4W9F A;  4FBJ B;  2D3B A;  5BMH A;  2QCZ A;  4C4V B;  4N59 A;  2EKI A;  3P1M A;  2L0F A;  1E8W A;  4EKU A;  2K8C A;  2RMM A;  3KWL A;  4JX1 C;  2MHJ A;  4AS1 A;  1JRU A;  2GOW A;  1Z2M A;  1EU4 A;  2BS4 B;  1B1Z A;  2CR5 A;  1E7U A;  1P7E A;  4KX6 B;  1WIA A;  1YN5 A;  2D11 A;  5EE1 A;  1YQ4 B;  2O2V A;  3ZUN A;  3VDZ A;  3AE1 B;  4ASW C;  3JVZ X;  3AMZ A;  4K3C A;  1Q1O A;  1T5X D;  2IJ0 A;  4KSL C;  3DDC B;  2NCN A;  1WM3 A;  1KLV A;  1XLP A;  4YTP B;  1MPE A;  4A20 A;  4YT0 B;  2AYO B;  1GAQ B;  2LAS A;  5FK9 C;  5D3D A;  3D32 A;  1B9R A;  4MGY E;  2CS4 A;  1UH6 A;  1TS3 A;  3VTV A;  4MGZ E;  5GMV A;  4II3 B;  1E5W A;  3Q3M C;  2JRH A;  2AEH A;  2LGD A;  4K81 A;  3VQI A;  2KYW A;  1SBB B;  1I4H A;  3DOW A;  1SF0 A;  2BW2 A;  4DK5 A;  1UWX A;  2C7H A;  2RPV A;  4IC7 B;  3L16 A;  1TIF A;  4RNA A;  1V86 A;  3V62 A;  2GRI A;  2HDE A;  4ANW A;  1FO4 A;  3OJ4 B;  2KQ4 X;  3PHW B;  3EHV A;  4JE3 B;  3RNC C;  2JT4 B;  3A33 B;  4P6V F;  3RYT A;  4WWM A;  2AWT A;  3VUX A;  2FBW B;  1JAL A;  4PS7 A;  2KTF A;  4NAW B;  3GOE A;  4F8C B;  1E7V A;  2OED A;  2J53 A;  2KAJ A;  3I57 A;  1ZUD 2;  1T0Q C;  1WRD B;  2ASQ A;  1FIQ A;  4XWT A;  2ICI A;  3AU4 A;  4LNF A;  2ZJD A;  3APC A;  5IO9 A;  2WDQ B;  1UUP A;  3CST A;  1MI0 A;  1BML C;  2BB5 A;  5L83 A;  4KKI A;  1IUE A;  2KWC A;  4BKG A;  4ZHO A;  2M4N A;  3NZS A;  2WU2 B;  3MJ5 A;  2JX5 A;  4L23 A;  2BWE S;  3TEX A;  4FJV B;  1SB3 C;  2KLC A;  1WFY A;  1WJ6 A;  3UQA A;  1XCT L;  3RZF A;  3H8H A;  2GI9 A;  2TSS A;  4HPP A;  4PT5 A;  1IBX B;  3ZNZ B;  1TKE A;  3ZIM A;  3UIN B;  4HDO A;  1ZP0 B;  3AED B;  2XBB C;  1ESF A;  2RGF A;  4HPM B;  4S0R A;  3LYY A;  2I38 A;  1WR1 A;  2N7D A;  3BK2 A;  1WWT A;  3NVY A;  4W9J A;  2M0A A;  1K8R B;  4N58 A;  1FEH A;  2J4X A;  1S1Q B;  2BYF A;  2O6V A;  1QF6 A;  4MSQ B;  4YTM B;  2MCN B;  2GBM A;  3O65 B;  4G0N B;  1V6E A;  3RFZ B;  3AE7 B;  1M94 A;  1ZOY B;  2ZZP B;  3CIR B;  2D10 A;  4W9D A;  3UI3 A;  2FCS A;  2PE9 A;  2KTR A;  4WUR A;  3SU8 X;  1ZPS A;  4P16 A;  2G1E A;  3M63 B;  2SAK A;  3TMP B;  2WXM A;  4KDI C;  1AN8 A;  4M8N A;  1N5X A;  2PW9 A;  4PS3 A;  4ACF A;  5I4D A;  3P42 A;  2XEW A;  2QIE B;  2LWP A;  4IKG A;  4HVB A;  3VAW A;  3QCA A;  1WX9 A;  4BKS A;  4LNI A;  1NEK B;  3DHH C;  3T8M A;  4C4V A;  1F52 A;  2D2Q A;  4KGR A;  2WLB A;  1TJE A;  3UGB B;  2IY1 B;  3WIM A;  3JSV B;  4NQL B;  4NJ7 A;  4MDK E;  3N32 A;  2WHI A;  3R2T A;  1HA5 A;  3TUO A;  1HZ6 A;  4IW0 A;  2WDR B;  3KLS X;  4A55 A;  3SFD B;  2IGG A;  1QT9 A;  1WSP A;  3VTW A;  1ISN A;  1IGD A;  3T3O A;  1J19 A;  1TKY A;  1WI0 A;  2RDH A;  2K1F A;  4ZRQ A;  2WXP A;  2LFI A;  5EDS A;  4URK A;  4KDL B;  4A8X C;  3ZJU A;  1G6J A;  4F7Z A;  3VUY A;  2M0X A;  4NY0 A;  1WF9 A;  2NTS A;  1EO6 A;  2MH7 A;  1XD3 B;  2LUE A;  3AE4 B;  2Z59 B;  3ABV B;  4DXG A;  3VFK A;  1TT5 B;  2BGF A;  4WAA A;  3AI5 A;  1AYF A;  3ZDM C;  2JWZ A;  3TIX A;  1YOV B;  3NS8 A;  4BFR A;  3MP9 A;  5H8Y E;  2HJ1 A;  4EEW A;  4ZRI A;  2JU6 X;  4KIK B;  2INC C;  2RDB C;  2IZV B;  2QSD A;  3DBL B;  3NVW A;  3AN1 A;  4DXA B;  1ZXH A;  2W55 A;  5GXG B;  2KDI A;  1ZGU B;  2K39 A;  4IWO A;  4FXC A;  3SFE B;  1I4X A;  1SE2 A;  3A4R A;  2MBO A;  2LGI A;  2BYV E;  3BWU D;  1KJT A;  3CWI A;  4PYU A;  3L08 A;  5KHQ A;  2KKC A;  3SD5 A;  3VXW A;  1KRH A;  3R3M A;  2JZP A;  4NAW A;  2SEB D;  3QC8 B;  4BBN F;  2DEN B;  2L3Z A;  2KDF B;  3V3X A;  1QZE A;  4LDT B;  4E74 A;  2Y5C A;  2H89 B;  4HJG E;  2N9E B;  2BS2 B;  3W5U B;  4EZL A;  1KLG D;  2L52 A;  1T6B X;  3SHQ A;  5CHF A;  1I4R A;  3H1U A;  4OVZ A;  2KJ6 A;  3URY A;  2JPH A;  2M17 A;  1KFY B;  1MHX A;  1UZX B;  4IOI E;  4KV2 A;  1TS4 A;  1IBX A;  4HEA 1;  1ROE A;  3IFW B;  3BY4 B;  4ZRP A;  1I4G A;  2FNJ B;  3MTN B;  5EE0 A;  1FNW A;  3Q69 A;  3WCQ A;  3VR8 B;  2AQ2 B;  1SJE D;  2ZW1 A;  3I63 C;  2W9N A;  1R4M I;  3HUI A;  2R2Q A;  1C9F A;  1NI3 A;  4MGI E;  4LTU A;  2UU7 A;  3N9Y C;  4I6L B;  2K8B A;  4NNJ B;  4XGA B;  2KN4 A;  2KMM A;  3GS2 A;  1R4M B;  1VD2 A;  3U8Z A;  1YX6 B;  1YJI A;  4NPN A;  3BVM A;  5CHW A;  4ITK A;  3BIN A;  3OLM D;  2K5P A;  3L13 A;  4MEL A;  3DVN V;  1I4P A;  3RNG C;  3AEG B;  3R7Q A;  3HK0 A;  3KW5 B;  2VH2 A;  3ZVV A;  2DYB A;  3P63 A;  3PS6 A;  2MP2 B;  1R7S A;  4AOF A;  4TQ0 A;  4GLS C;  4N6E B;  3RT3 B;  1YJ1 A;  3JSV A;  4I6N B;  3PHX B;  3DHG C;  1N6Z A;  3R66 C;  1KTK A;  4IM0 A;  1C77 A;  3EA6 A;  3L54 A;  1DYQ A;  2WDV B;  3DVN U;  4FAD A;  2IGD A;  2KN5 A;  1F77 A;  4CQN A;  1PGA A;  1OQR A;  2MBH A;  3RPF C;  2OJW A;  4HRS A;  3FIL B;  3QQ8 B;  2OOB B;  1IGC A;  3H9D A;  1UBQ A;  3L10 B;  4DHJ D;  2G45 B;  5IP4 D;  2L1A A;  2M56 B;  5L95 C;  1CZP A;  1C78 A;  3VR9 B;  2KDB A;  4FN2 A;  4IM3 A;  4B9K A;  4QAY A;  2DZJ A;  4DDG D;  2WXH A;  2MJ3 A;  2GBN A;  4M00 A;  2KVR A;  1FRD A;  4HCP B;  4PYZ A;  5AZH A;  1RFK A;  1YN4 A;  3MC8 A;  3VHT C;  3AH7 A;  4WWP A;  5LNK 1;  3DVG Y;  1C1Y B;  1MFW A;  4C00 A;  4KIK A;  2KJH B;  2DZI A;  2WGS A;  3PZD A;  1CK1 A;  2QJL A;  3WAO A;  3U30 A;  4MH8 A;  4M8M A;  4RF0 A;  2L0T A;  3NRZ A;  1NBF C;  1RFA A;  1J7C A;  2KDE B;  1JWM D;  4CHK A;  4R3D A;  4J6I A;  1V8C A;  3EGR A;  3W5V B;  2O6V D;  4EUT A;  4B0E A;  3M95 A;  2V1Y A;  2VRR B;  2MBB B;  1SIJ A;  3QIJ A;  1X1M A;  3N1Y C;  2WP9 B;  2AQ3 B;  2W3R A;  1WE6 A;  2E3T A;  1PYW D;  2V3P A;  2I2Y A;  1JWS D;  3V60 A;  2QHO A;  1M4V A;  2DYO A;  2INN E;  3BYY B;  3Q3J A;  4KKJ A;  3JYU A;  3EEC A;  2N9L A;  3H6N A;  4KGT A;  3N20 C;  2IY0 B;  3E56 A;  2L00 B;  5CX3 A;  1SE9 A;  2JRI B;  1FFU A;  2LZ6 A;  4USA A;  5AEK B;  2RSU A;  5AZF A;  1JQ4 A;  1L2N A;  1WZ3 A;  4HJK A;  1E90 A;  3BII D;  3ZNG C;  4M02 A;  3P4S B;  1J0G A;  2D3A A;  2V3S A;  3E9S A;  3DWG C;  4BKS D;  3I5J C;  4HLE A;  3AE6 B;  1VZ6 A;  4KZC A;  3ZQ4 A;  3OAW A;  3DBS A;  1FMA D;  1FNU A;  2CJO A;  4MT5 A;  2J0M A;  4FA6 A;  1ZE3 D;  2KFK B;  3MHZ A;  3M3J A;  3L17 A;  2ZEQ A;  4GIV A;  4WJQ A;  3KVF B;  4C80 A;  3UQB A;  2LUM A;  2NS5 A;  3ONS A;  3V6E B;  1A5R A;  4B0M A;  2MRP A;  1TBE A;  3B9J A;  2C7M B;  2C9W B;  1WX7 A;  2G3Q B;  1VR9 A;  3ZYY X;  1KOT A;  2KMC A;  4GB9 A;  4WWO A;  2MBQ A;  2AQ1 B;  1PQS A;  1WXM A;  3QWZ B;  1NYQ A;  1WGG A;  1WGD A;  1DGJ A;  1WYW B;  3TJP A;  2BS3 B;  3PZ8 A;  5D7G A;  3NY5 A;  4WWN A;  2X38 A;  2MP2 A;  4OZB A;  2BTE A;  1EF1 A;  1SEB D;  4BBN C;  2V0G A;  3DCG A;  1XEE A;  3V61 A;  1L0Y B;  2BF8 B;  1NVI D;  3A9J B;  1EUV B;  3AE8 B;  3SR6 A;  3DBH B;  5JXV A;  2W3S A;  5DPT A;  4E71 A;  4M0W B;  1WJ4 A;  5BMG A;  2QMT A;  2BT6 A;  5D2M B;  2C7N B;  3FIL A;  2J0K A;  2AX5 A;  2N7E A;  4RF1 A;  3ZXV A;  3AEA B;  3IAM 1;  3KYC D;  2IYD B;  2ZVO A;  5LXI B;  4DBG A;  2Q5W D;  1ET6 A;  1RYJ A;  2L7R A;  4EFO A;  2BVC A;  3C0R B;  4ANV A;  1BT0 A;  2PEA A;  3VH4 B;  1OEY J;  2LXC A;  5HHD G;  2XNA C;  3NZU A;  1XLN A;  3VVW B;  4OZC A;  1OQY A;  1U4A A;  5E6P A;  2B3A A;  1WR6 E;  1ZDX A;  2JZ3 B;  5BO4 B;  1SXT A;  4PS8 A;  1WGR A;  1K52 A;  1ZDV A;  2KMA A;  4RGO S;  3Q8B A;  5IKC M;  2GBR A;  2KVZ A;  3PZ7 A;  3RNA C;  2NTT A;  5DPR A;  3VH3 B;  2DHZ A;  1GPX A;  1K50 A;  4W9L A;  1CQV A;  2FUH B;  2M1M A;  1C4A A;  3HIZ A;  3EFC A;  5BYS A;  1QQR A;  4AUQ C;  3DBR I;  5DPW A;  2WNM A;  1C4C A;  2MA9 B;  2XK5 B;  3KH0 A;  4TSS A;  3NHE B;  3TEY A;  1WY8 A;  4L1B A;  4BKT A;  3ZJT A;  2WXL A;  3SDL C;  2WU5 B;  2DZK A;  1KH0 A;  1T0Y A;  3B2G A;  1P3Q U;  2LXA A;  3VUW A;  1V2Y A;  3FC4 A;  1KM7 A;  2NPT A;  4A9A A;  4YSZ B;  3GE8 C;  1Q5W B;  1FNV A;  4TMA B;  2N1W A;  3DBR B;  4JWU C;  3NJT A;  4XC2 A;  3ZDT A;  1VZ8 A;  1D4B A;  3WAM A;  3R8B A;  4ZRJ A;  2REX A;  3UF8 A;  3I3T B;  2DX5 B;  2BB6 A;  1LM8 B;  1OEY A;  3PTF C;  2ZCB A;  3AXC A;  4KVG B;  1IPG A;  3NVV A;  2JXT A;  2NR2 A;  2NBW B;  1FXI A;  3QK0 A;  5JHA A;  2PJH A;  3DBL I;  4OW0 A;  2WXJ A;  4ANX A;  3WAN A;  2YLM A;  4P1C C;  4CO7 A;  3MFG A;  4RCO A;  3ZRC A;  1V80 A;  1JWU D;  2K25 A;  4TKN A;  2WXF A;  4ICV A;  3PLV A;  3RUI B;  2M8S A;  3AUL A;  4LNN A;  1F9J A;  5BYQ A;  1YIW A;  3V05 A;  4LNK A;  4XYC A;  2KFK A;  1VCB A;  4BAX A;  1F2R C;  2K9X A;  1V1O A;  2PPH A;  4HPL B;  4DHZ E;  2CHW A;  2HTM E;  1YQ3 B;  2INP E;  2MSE D;  3MJW A;  4DWF A;  3FKY A;  3RCZ A;  2JYT A;  3PPA A;  4YL8 A;  1E6E B;  4NQK E;  4K1R B;  2KC2 A;  2CKH B;  4XDD A;  1YN3 A;  1WXA A;  3TCA A;  2BKF A;  1TYG B;  3B2F A;  1XXG A;  1QOB A;  5AZG A;  1YJJ A;  1S3S G;  1V97 A;  4EZJ A;  3EUB 2;  1PGX A;  2NVU I;  1CMX B;  4ANU A;  4DHZ B;  4IDI A;  4GU2 A;  2CU1 A;  4I6P A;  3A9J A;  3BK1 A;  1KLU D;  2N9P C;  3IAS 1;  4ZDV A;  2IDY A;  3ZJV A;  4M0W A;  3QHT A;  5IAA C;  3ZNI D;  2PKO A;  3PO0 A;  2LVQ A;  3LB8 C;  2ACZ B;  4G50 A;  5IN7 A;  1L0V B;  2N9K A;  2J42 A;  1HTQ A;  3O13 A;  3AU5 A;  5HKH A;  2BQQ A;  2GB1 A;  2NBU A;  3PRM B;  4CYE A;  3DWM A;  4GN1 A;  5C1Z A;  1GB1 A;  2VZK B;  2LVP A;  4E3C A;  1SE3 A;  1PFD A;  4LDT D;  1VZ7 A;  3CF6 E;  2EKE C;  2W54 A;  2D3C A;  1HTO A;  3RN9 C;  1TY0 A;  2G4D B;  4RGT A;  1L7Y A;  1EU3 A;  1WJN A;  1P1A A;  1JW9 D;  3RNF C;  1WH3 A;  3QX1 A;  2FUG 1;  2I1J A;  2WXI A;  5IA7 A;  2N9X A;  4W9E A;  3ZTD A;  3QAQ A;  3BZD B;  3KUZ A;  3RMK C;  5D3I B;  4IWQ A;  1FM0 D;  3UIO B;  4A3P A;  1J8C A;  2KC1 A;  3T3N A;  2WXK A;  4UDU C;  5J17 A;  3GP7 A;  4HKZ E;  1XCQ L;  3IVF A;  3DQV A;  1SSN A;  1E10 A;  2CHX A;  2KFJ A;  1T3Q A;  2FIF A;  1Q10 A;  2KX0 A;  3ZO5 B;  2FID A;  5J2R A;  3EFU A;  3IXS A;  4NZL B;  3AE3 B;  3DVG X;  3EC8 A;  2ZNV B;  2XK5 A;  5CHV C;  3NUH B;  1QLB B;  2MBE A;  1ET9 A;  2I1K A;  2R61 A;  2LRW A;  1EWC A;  2DAJ A;  1XLO A;  1V1P B;  1N5W A;  2CHZ A;  3PT2 B;  3HM3 A;  2HE7 A;  3GB1 A;  3PSE B;  3AEF B;  3R7R A;  4GDL B;  2BBC A;  1K51 A;  3Q3F A;  4IWP A;  3KYD D;  4OZA A;  1DOY A;  1DOI A;  1QKZ A;  1VLB A;  2G9H D;  4JWS C;  3JW0 X;  3MHS D;  3TL5 A;  1F2R I;  1GB4 A;  4HCN B;  1L6V A;  2JVC A;  2ZCC A;  1FXT B;  3OG5 A;  5BMI A;  1ACC A;  3PRE A;  2JWU A;  3ZNH B;  1PDX A;  1C76 A;  1YX5 B;  4HDQ A;  1TS5 A;  4ARI A;  2N4F A;  4MM3 B;  3ZXR A;  1D5Z C;  2AL3 A;  4AP4 C;  3ZW3 A;  2WXO A;  3WAL A;  2LHD A;  1IYF A;  4WJO A;  1E8Y A;  4EE2 A;  2Y5B B;  4DQO C;  4GOC A;  2QC8 A;  3L4P A;  2CU3 A;  1UWM A;  3MC9 A;  4F1S A;  1EWY C;  2E6X A;  1QOF A;  1TZO A;  4C7Z A;  1MJD A;  2Z0E B;  2IO0 B;  2C5L C;  1K53 A;  3AE2 B;  5JZE B;  3CSF A;  1D5X C;  2L83 A;  3BVZ A;  3ZGZ A;  2L8J A;  4A90 A;  2PE6 B;  4A6Q A;  4NJC A;  1RLF A;  3AEE B;  1HXY D;  5AUK A;  2EMT A;  2JQR B;  1FFV A;  3RUL A;  1D5M C;  1J7A A;  4H2A A;  1WM2 A;  2WWZ A;  2M19 A;  2DYM A;  2KK8 A;  2ZVN A;  1ZW7 A;  4AJW A;  2BYE A;  2RD0 A;  2DAF A;  1J7B A;  1WJU A;  3N1Z C;  2K3U A;  4WJN A;  3LXF A;  4BOZ B;  3J9C A;  1VDV A;  2K8H A;  3PLU A;  2LMC A;  1GJZ A;  2KQ7 A;  5DPS A;  2GBJ A;  2RDG A;  2JUO A;  2KHW B;  4K7S A;  2KLG A;  3HRD D;  1UEL A;  2NPT B;  3PVL A;  4P1B C;  2L32 A;  3IT4 B;  3A1Q B;  3KQ4 A;  3DHI C;  3B1L X;  4AQ7 A;  4XX5 A;  1ZKH A;  1WX8 A;  1ZXI A;  2V4L A;  3LJ3 A;  3AEB B;  1UBI A;  3LDZ E;  1TZ1 A;  3QA8 A;  3H7P B;  2Z0D B;  2PMV A;  2MLB A;  1T0S C;  3N3K B;  2WXR A;  1WGK A;  4C7Y A;  2ZPY A;  1UF0 A;  1WMH B;  1N62 A;  1UD7 A;  1FRR A;  5MPO A;  2V9H A;  1P9D U;  3ML9 A;  4KSK C;  2EMS A;  3HVD A;  3W2D A;  3QJZ A;  2D07 B;  1E9M A;  1EM7 A;  1D6E C;  1F1H A;  3N1X C;  2BYT A;  4RM9 A;  1MG4 A;  2PTL A;  4GDK B;  4B95 A;  1SJH D;  1Y8R C;  2MQJ A;  5FKA C;  4S17 A;  5HFY A;  2DLB A;  1L0X B;  2MJD A;  2LGX A;  4ZOH C;  3W1S A;  3IG3 A;  3NG0 A;  4W9G A;  4IM2 A;  4TUU A;  1BUI C;  1WZ0 A;  3ML8 A;  1QIL A;  1V49 A;  4LK0 M;  4O1N A;  2LGY A;  2LGS A;  4LCD E;  2Y3A A;  1WE7 A;  3X23 A;  1SGH A;  3DBH I;  2JSV X;  1FXA A;  2WQY B;  3APD A;  4JPS A;  2KQS A;  2QDF A;  1FPY A;  1HE8 A;  1NI2 A;  3AE5 B;  5HI1 A;  4ZRK A;  1TS2 A;  2J7Q B;  4EZK A;  3X0W A;  1I42 A;  2X8X X;  4ZHP A;  2R2O A;  3A4S C;  2RPQ A;  2G4S A;  2KWU B;  4WQM A;  1TTN A;  3B0A A;  1P0R A;  1LGR A;  1V1P A;  2GBK A;  2HD5 B;  3Q8F A;  3B08 A;  1LFD A;  4MAC A;  4US8 A;  1RAX A;  1SE4 A;  1NYR A;  3OWE B;  2DBY A;  5FR6 A;  2IPK D;  2AL6 A;  4GDL A;  3OJ3 A;  3R2I A;  3U7D A;  2KZR A;  4G3X B;  2DWQ A;  2KT7 A;  1QOA A;  4A3O A;  1R4N I;  3VRA B;  3H7S A;  2KWD A;  4US9 A;  3Q3O C;  2IBI B;  3ZKJ C;  2PIA A;  5JHB A;  3NZ3 A;  2KDM A;  3TEW A;  1FD6 A;  4BZA A;  4LNO A;  1I4Q A;  2JYE A;  3ALB A;  4MM3 A;  4GMV A;  1JRP A;  3RNB C; 
#chains in the Genus database with same CATH homology
 3WAP A;  2CR5 A;  2UYZ B;  3R7Q A;  1E7U A;  3HK0 A;  2JF5 A;  2PPH A;  3KW5 B;  4HPL B;  3ZVV A;  1I35 A;  1WIA A;  1GG3 A;  2CHW A;  5LLI A;  4DHZ E;  2D11 A;  2DYB A;  3K9P B;  3PS6 A;  2O2V A;  2MP2 B;  2MSE D;  3MJW A;  2LVO A;  3ZUN A;  3RCZ A;  4DWF A;  3PPA A;  4XZ4 A;  4YL8 A;  3VDZ A;  4ASW C;  3JVZ X;  4AOF A;  3RT3 B;  1YJ1 A;  4BOS C;  2A5U A;  3JSV A;  4I6N B;  1Q1O A;  3PHX B;  2LD9 A;  3R66 C;  4IM0 A;  4KSL C;  4NQK E;  4K1R B;  2KC2 A;  3DDC B;  1WXV A;  2IO2 B;  4ICU A;  3L54 A;  2NCN A;  2CKH B;  2KOX A;  4K7U A;  1WM3 A;  1KLV A;  3DVN U;  4MJS B;  4FAD A;  2JY6 A;  2WX0 A;  1WXA A;  2KN5 A;  3TCA A;  2L76 A;  2FAZ A;  3V6C B;  2BKF A;  4A20 A;  1D3Z A;  2D3G A;  2AYO B;  5AZG A;  4GXB A;  3S2A A;  2LAS A;  2MBH A;  3W1S C;  4AJY B;  4WQO B;  4HXD A;  3D32 A;  3QQ8 B;  2OOB B;  3H9D A;  1S3S G;  1UBQ A;  3L10 B;  2CS4 A;  4MGY E;  4DHJ D;  1UH6 A;  4IUM B;  4EZJ A;  2G45 B;  3VTV A;  3A9K B;  2FCN A;  2NVU I;  4MGZ E;  5GMV A;  1CMX B;  4II3 B;  1E5W A;  5G55 A;  4ANU A;  4OVU A;  4DHZ B;  5L95 C;  2JRH A;  4II2 B;  4GU2 A;  2CU1 A;  2AEH A;  2LGD A;  3A9J A;  4I6P A;  4K81 A;  3VQI A;  2N9P C;  2LRU A;  3DOW A;  2KDB A;  4FN2 A;  4IM3 A;  4B9K A;  4DK5 A;  4ZDV A;  2NBV B;  2DZJ A;  3QHT A;  5IAA C;  2C7H A;  3ZNI D;  4DDG D;  3ECI A;  4IC7 B;  3L16 A;  3ZRF A;  2GBN A;  3DPD A;  3WA0 A;  2KVR A;  2LVQ A;  1V86 A;  4HCP B;  1WXS A;  4G50 A;  3V62 A;  4PYZ A;  5AZH A;  2ZNV C;  4ANW A;  3OJ4 B;  3AU5 A;  4GGQ A;  3PHW B;  3L0W B;  5HKH A;  3EHV A;  2NBU A;  3PRM B;  4CYE A;  3KUD B;  5J18 A;  3VHT C;  5C1Z A;  1GNU A;  4GN1 A;  2JT4 B;  4GSW A;  3W1Y A;  1E8X A;  1V81 A;  3A33 B;  4WWP A;  3A1Q A;  2LVP A;  3RYT A;  3DVG Y;  4E3C A;  2AWT A;  1C1Y B;  3VUX A;  4LDT D;  3CF6 E;  4PS7 A;  2WYQ A;  4KIK A;  2EKE C;  1NDD A;  2A4Z A;  2KTF A;  4NAW B;  2KJH B;  2DZI A;  3GOE A;  2G4D B;  1L7Y A;  1WJN A;  2BPS A;  1E7V A;  4F8C B;  3H7P A;  3PZD A;  1P1A A;  3ENE A;  5CTR C;  1WH3 A;  3QX1 A;  2UWQ A;  1WRD B;  4MSM B;  2ASQ A;  3WAO A;  2I1J A;  3AU4 A;  3U30 A;  1YD8 U;  5IA7 A;  2N9X A;  4M8M A;  2ZJD A;  3APC A;  2L0T A;  4W9E A;  5G2N A;  1NBF C;  3QAQ A;  3ZTD A;  2MW5 A;  1RFA A;  1GC7 A;  3CST A;  2KDE B;  2BWF A;  2OJR A;  4N9F 4;  1H8C A;  3KUZ A;  4CHK A;  5L83 A;  4IWQ A;  1MG8 A;  4TQ0 A;  2KWC A;  1WMH A;  4J6I A;  4BKG A;  3UIO B;  4EUT A;  2O6V D;  4A3P A;  2M4N A;  3NZS A;  4HWI B;  2KC1 A;  1J8C A;  4W9I A;  2KD0 A;  2BWE S;  5J17 A;  3M95 A;  4FJV B;  2V1Y A;  3IVF A;  3DQV A;  2KLC A;  2IO3 B;  2CHX A;  2VRR B;  1WFY A;  2MBB B;  3IBE A;  1GC6 A;  1EF5 A;  1WJ6 A;  3UQA A;  2KFJ A;  3RZF A;  2FIF A;  2MX2 A;  3QIJ A;  2KX0 A;  4ZYN A;  3ZO5 B;  1X1M A;  3ZNZ B;  3ZIM A;  3UIN B;  4HDO A;  1WE6 A;  2XBB C;  2FID A;  3APF A;  5E6O A;  4GDK A;  3V60 A;  1Q0W B;  2RGF A;  2HTH A;  4HPM B;  5J2R A;  1WR1 A;  2K6Q A;  2QHO A;  2N7D A;  1C3T A;  3PGE A;  2DYO A;  4OVV A;  5D6J B;  2LJ5 A;  3EFU A;  4W9J A;  3Q3J A;  3JYU A;  3DVG X;  1K8R B;  3EEC A;  3EC8 A;  3H6N A;  4JGH B;  3HHM A;  2ZNV B;  2XK5 A;  3GZN I;  5CHV C;  2IY0 B;  4W9C A;  2MBE A;  1S1Q B;  1SIF A;  2BYF A;  2L00 B;  1SE9 A;  2JRI B;  2O6V A;  5CX3 A;  2I1K A;  2K6D B;  2LZ6 A;  2LRW A;  3PRZ A;  4MSQ B;  2DAJ A;  5AEK B;  2LI5 A;  2RSU A;  2CHZ A;  3K9O B;  3PT2 B;  5AZF A;  3HM3 A;  1WGY A;  2HE7 A;  1L2N A;  2J0J A;  1WZ3 A;  1TGZ B;  2MCN B;  2GBM A;  3O65 B;  3PSE B;  1V6E A;  4G0N B;  1YQB A;  2DZM A;  4HJK A;  1E90 A;  3R7R A;  4GDL B;  3ZNG C;  3Q3F A;  1J0G A;  4IWP A;  2V3S A;  1M94 A;  3KYD D;  4BKS D;  2ZZP B;  4HLE A;  2D10 A;  2GMI C;  2KJR A;  4W9D A;  2FCS A;  2PE9 A;  1P98 A;  2KTR A;  4RMA A;  3JW0 X;  3MHS D;  3TL5 A;  4KZC A;  4K7W A;  4HCN B;  2ZCC A;  2JVC A;  3SU8 X;  1FXT B;  3M63 B;  3TMP B;  3OAW A;  3DBS A;  1WGH A;  4JQW C;  4MGK E;  3PRE A;  4KDI C;  3ZNH B;  4M8N A;  2C60 A;  1YX5 B;  2WX1 A;  2J0M A;  4HDQ A;  4PS3 A;  4FA6 A;  2N1V A;  1E8Z A;  2KFK B;  3M3J A;  3L17 A;  2N4F A;  2XEW A;  4LJO B;  2LWP A;  2ZEQ A;  2AL3 A;  4GIV A;  4AP4 C;  3ZW3 A;  3WAL A;  4HVB A;  5JH5 C;  1IYF A;  4WJQ A;  4WJO A;  2KAN A;  1E8Y A;  4P7I A;  3VAW A;  3KVF B;  2Y5B B;  4FHJ A;  5KHO A;  4GOC A;  4MEM A;  3UQB A;  3QCA A;  2NS5 A;  1WX9 A;  3ONS A;  3V6E B;  4BKS A;  1Z5S B;  2O2V B;  3T8M A;  4F1S A;  4B6W A;  1A5R A;  2D2Q A;  2MRP A;  1TBE A;  3UGB B;  4JIO U;  2IY1 B;  2C7M B;  2C9W B;  1WX7 A;  2Z0E B;  3WIM A;  3JSV B;  2G3Q B;  4LJP B;  2IO0 B;  3CMM B;  4NQL B;  2C5L C;  4NJ7 A;  1KOT A;  2KMC A;  2KXJ A;  2ZPN A;  4GB9 A;  2FCQ A;  3CSF A;  4MDK E;  2MBQ A;  3N32 A;  4X57 B;  5JZE B;  1PQS A;  2L8J A;  1WXM A;  3QWZ B;  2PE6 B;  1WGG A;  1WGD A;  4RM8 A;  1WYW B;  1V5T A;  3M62 B;  3NOB A;  1RLF A;  3TJP A;  5D7G A;  1V5O A;  2EMT A;  4IW0 A;  5DCN A;  3RUL A;  3NY5 A;  4WWN A;  5C23 A;  1RRB A;  2MP2 A;  4FJZ A;  1WM2 A;  1EF1 A;  2WWZ A;  3VTW A;  4BBN C;  3DCG A;  2DYM A;  2KK8 A;  1ISN A;  3V61 A;  2ZVN A;  1J19 A;  4FUL A;  1ZW7 A;  1WI0 A;  4AJW A;  2BYE A;  2K1F A;  2BF8 B;  3A9J B;  1EUV B;  2RD0 A;  2RR9 A;  2JXX A;  2DAF A;  5EDS A;  4URK A;  1WJU A;  4MJS A;  2L05 A;  5DPT A;  4WJN A;  3HM6 X;  4E71 A;  4KDL B;  4BOZ B;  2K8H A;  4M0W B;  1WJ4 A;  3PLU A;  1G6J A;  4HK2 A;  1GJZ A;  4F7Z A;  2KQ7 A;  3VUY A;  5DPS A;  1LQB A;  2GBJ A;  2M0X A;  4NY0 A;  1WF9 A;  5D2M B;  1EO6 A;  5LXH A;  1XD3 B;  2C7N B;  2LUE A;  2J0K A;  2JUO A;  2KHW B;  1OGW A;  2Z59 B;  4K7S A;  2KLG A;  5E6N A;  2N7E A;  1UEL A;  2NPT B;  3A9K A;  4IG7 B;  3VFK A;  3KYC D;  2IYD B;  2BGF A;  3PVL A;  2ZVO A;  3AI5 A;  3P2B A;  4WAA A;  5LXI B;  3ZDM C;  2JWZ A;  3A1Q B;  4G11 A;  3TIX A;  4DHJ B;  4DBG A;  3NS8 A;  4BFR A;  3B1L X;  2L7R A;  4EFO A;  4EEW A;  4ZRI A;  4KIK B;  3C0R B;  4XX5 A;  2IZV B;  1ZKH A;  4ANV A;  1WX8 A;  1BT0 A;  2V4L A;  2KWV B;  3LJ3 A;  1UBI A;  3LDZ E;  1UGM A;  2PEA A;  2JZZ A;  3VH4 B;  1TZ1 A;  3QA8 A;  4DXA B;  4KZ0 A;  3H7P B;  3UIP B;  1OEY J;  2Z0D B;  3RD2 A;  2KDI A;  1ZGU B;  4EOY A;  2LXC A;  2K39 A;  2MLB A;  4IWO A;  3NZU A;  3VVW B;  5D94 A;  3A4R A;  2MBO A;  1OQY A;  1U4A A;  5E6P A;  3N3K B;  2B3A A;  1WR6 E;  2BYV E;  2JZ3 B;  1H4R A;  2HJ8 A;  1KJT A;  5BO4 B;  4PYU A;  2ZPY A;  3L08 A;  4W9H A;  2KKC A;  4PS8 A;  5KHQ A;  1WGR A;  3SD5 A;  1WMH B;  1UD7 A;  3VXW A;  2KMA A;  1XQQ A;  3R3M A;  1P9D U;  4FJY A;  4NAW A;  3ML9 A;  3KUC B;  3QC8 B;  4KSK C;  2FCM A;  4BBN F;  2DEN B;  2GBR A;  2EMS A;  2L3Z A;  2KDF B;  1QZE A;  4LDT B;  4E74 A;  3QJZ A;  2D07 B;  2YVC A;  4TQ1 A;  5DPR A;  2N9E B;  4AWJ A;  4DDI D;  3VH3 B;  3RZW C;  2DHZ A;  4RM9 A;  4EZL A;  4W9L A;  4GDK B;  2FUH B;  4FLH A;  4B95 A;  1Y8R C;  2M1M A;  2MQJ A;  3HIZ A;  3SHQ A;  2WDT B;  5CHF A;  3H1U A;  2LGX A;  4AUQ C;  3DBR I;  3W1S A;  5DPW A;  1AAR A;  2KJ6 A;  2MA9 B;  3IG3 A;  2JPH A;  2M17 A;  1OTR B;  2XK5 B;  3KH0 A;  4W9G A;  3NHE B;  1UZX B;  1WY8 A;  4BKT A;  2O6V B;  4IM2 A;  4TUU A;  1WZ0 A;  3ML8 A;  4KV2 A;  1V49 A;  2LGY A;  4JLC A;  4LCD E;  3SDL C;  2DZK A;  2MWS B;  1WE7 A;  4WJP A;  3X23 A;  3PV1 A;  1SGH A;  3DBH I;  2IO1 B;  4TV3 A;  1T0Y A;  1P3Q U;  2LXA A;  3VUW A;  1V2Y A;  3IFW B;  3BY4 B;  1KM7 A;  2NPT A;  1Q5W B;  3APD A;  3ZTC A;  2FNJ B;  2KX3 A;  2KQS A;  3MTN B;  1HE8 A;  1NI2 A;  2N1W A;  3TBL D;  4ZRK A;  4XC2 A;  3ZDT A;  2J7Q B;  3IHP C;  4EZK A;  3QAR A;  3WAM A;  3X0W A;  4ZRJ A;  1I42 A;  4FHK A;  2REX A;  1XT9 B;  2R2O A;  2W9N A;  2BKR B;  3A4S C;  1R4M I;  2KO3 A;  2G4S A;  2KWU B;  2RPQ A;  1TTN A;  2KTR B;  3B0A A;  1P0R A;  3I3T B;  3UF8 A;  3N30 A;  2DX5 B;  2KNB A;  2R2Q A;  2HD5 B;  2GBK A;  4W9K A;  3B08 A;  1LFD A;  1LM8 B;  1OEY A;  3PTF C;  4JL9 A;  2ZCB A;  3AXC A;  4KVG B;  4NJ6 A;  1IPG A;  1RAX A;  3PRP B;  2NR2 A;  2NBW B;  3QK0 A;  5JHA A;  4MGI E;  4MH0 E;  4WWO A;  4BVU C;  2PJH A;  3DBL I;  3T9L A;  5FR6 A;  1V9J A;  2AL6 A;  3OJ3 A;  4GDL A;  3ZLZ A;  3U7D A;  2KZR A;  4G3X B;  4I6L B;  1IP9 A;  3VTU A;  1LXD A;  2K8B A;  4ANX A;  4NNJ B;  3WAN A;  2YLM A;  5TR5 A;  1GUA B;  4W9F A;  4A3O A;  4FBJ B;  1R4N I;  4CO7 A;  3ZRC A;  1V80 A;  1VD2 A;  3H7S A;  2K25 A;  3U8Z A;  1YX6 B;  4TKN A;  4ICV A;  4NPN A;  3PLV A;  2IBI B;  3ZKJ C;  5JHB A;  3RUI B;  5CHW A;  2M8S A;  3BIN A;  3AUL A;  2L0F A;  3OLM D;  1E8W A;  4EKU A;  2K8C A;  1F9J A;  1YIW A;  3L13 A;  1JRU A;  2GOW A;  1VCB A;  2KFK A;  3DVN V;  4MEL A;  1Z2M A;  3ALB A;  4MM3 A;  4GMV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...