4I6SA

Structure of rsl mutant w76a in complex with l-fucose
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
88
structure length
88
Chain Sequence
SVQTAATSWGTVPSIRVYTANNGKITERCWDGKGWYTGAFNEPGDNVSVTSWLVGSAIHIRVYASTGTTTTEWCADGNGWTKGAYTAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative fucose-binding lectin protein
publication title Reduction of lectin valency drastically changes glycolipid dynamics in membranes but not surface avidity
pubmed doi rcsb
source organism Ralstonia solanacearum
molecule tags Sugar binding protein
total genus 11
structure length 88
sequence length 88
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07938 Fungal_lectin Fungal fucose-specific lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.190 Mainly Beta Beta Barrel Lipocalin Lipocalin 4i6sA01
3ZW1A 5AJCA 2BT9A 3ZI8A 5AJBA 2BS6A 2BS5A 3ZW2A 4I6SA 3ZZVA 3ZWEA 3ZW0B 3ZW1B 3ZW0A
chains in the Genus database with same CATH superfamily
4ZHDA 4PJ2A 3KZAA 1GT5A 1OPAA 1DZKA 1QQSA 1VWFB 3D9WA 1NP1A 1RSTB 2WUTA 3U9PC 2IZCB 2QM9A 3NP1A 3EW2A 2OY1O 2HZRA 5HCDC 3APWA 1AVEA 1LICA 4ZR2A 4EXZA 4TKJA 4BOEA 4MVEA 1G7NA 2C4IA 2FS6A 1JJXA 1LFOA 2OL7A 1OSPO 5LJHA 3PH6A 4GU8A 1JJUA 1R0UA 2Y3FA 4DCBA 4QQ1A 2FR3A 2G79A 1LNMA 2JN3A 4A1HA 1EI5A 1YWBA 3L4RA 1YP6A 1OBPA 5IRUA 2IZAA 3RDMA 2JGSA 2W2BA 5HTDA 5H9LA 3RZYA 3IA8A 3S60A 1W6FA 1LIFA 2ACOA 3BS2A 3ZW2A 5B5FA 2DJFA 2F01A 3HOEA 3NQ9A 4U9CA 4CDDA 2OVDA 5K06A 3C76X 2NP1A 1RSUB 1SXYA 2IZDB 1SWAA 5EZ2A 1ALBA 4JO6A 1OBQA 5L8NA 1XKIA 3GE2A 1VWMB 1SWTA 1GKAA 4KH8A 4DQ4A 1ZNKA 1VWQB 2Q2MA 3T6LA 3VU1A 3WXQA 2G78A 4AYHA 4YDBA 1STPA 3WJGA 4BBOA 4CDCA 4CPHA 4IMNA 1XCAA 2X56A 2CM9A 1SWQA 3LV4A 1JV4A 4CDEA 1VWAB 2RTLA 2X46A 5HAEA 3T2WA 4YCEA 1LCWA 3HWEA 5LJKA 1MUPA 5K68A 3TZSA 1GXAA 4QRLA 2YMSA 2OZQA 1ZNHA 1I05A 3B2JA 3PECA 2QOSC 4BCSA 4DQ3A 1EIOA 1I06A 3FA8A 4Z2PA 1VWKB 2NNEA 2MHDA 4QNIA 2GTLO 2JU3A 5IO7A 5L3YA 1CBQA 1SY3A 1TW4A 5F1EA 2X8FA 4ZHHA 1QFVA 1MOYA 4O3WA 1OBUA 2DM5A 1EW3A 3HWGA 4FBRA 2AL0X 3SZIA 4YFRA 1BSOA 2HZQA 2O62A 4UU2A 3I0AA 2Q4NA 3C78X 3OBLA 1SLDB 2W2AA 3TF6A 1KL4A 2OFBA 4I60A 3FMZA 3NR3A 1LUQA 4CPFA 1CJ5A 1TXLA 3EM0A 3UEXA 1E06A 3QKGA 2AH7X 1SY1A 1TOUA 1RLBE 1BRPA 3P02A 5D45A 5EEEA 2RTHB 3MM0A 4BVMA 1B8EA 4QGXA 2OY5O 2BT9A 4N7DA 3WJFA 4CSBA 4ZHFA 1ZNLA 3FIQA 5DPQA 3SZJA 1VWNB 4COTA 2LBVA 4TJZA 4YFPA 1L6MA 2E4JA 1UREA 2AF5A 1IJ8A 2JU7A 2Q39A 2R73A 3PP6A 5B27A 4A60A 1BRQA 3BX8A 1SWGA 2GC9A 2A2UA 3NX2A 2GTFX 2QCBA 3MG5A 4NYQA 1AELA 2OY7A 1SY2A 1SLFB 4O4OA 2JU8A 2KTSA 4O4SA 2UYWA 4KIIA 1SWPA 1JYJA 1A3YA 2LKKA 3D95A 4O4XA 2WPUA 1KT7A 2A0AA 3FA7A 4IB8A 5HZQA 4D6BA 1G5WA 1WUBA 3CBSA 4BQUA 4I3DA 1D2UA 2CM4A 2F09A 1H91A 1FJ1E 2NNQA 2VFBA 4Y5DA 1GKAB 4OMWA 3QQ2A 1SLGB 1T8VA 4LKPA 5IO5A 2AT3X 2K23A 1JYDA 1FE3A 4I9SA 4GGZA 3VHIA 4QYPA 4XMFA 2VDFA 3CMPA 3CR6A 3U03A 4ZHGA 4IAWA 2WR6A 2BC3A 2OFMX 3WZOA 1SWOA 2R56A 4YFQA 1T0VA 2UZ2A 2FT9A 3FYFA 3T1DA 1D3SA 3UAQA 4WFVA 5HCEC 4GD9A 3O2YA 1CBRA 1KZWA 1SMPI 1PBOA 4ZGFA 3VG6A 1JJJA 2FGSA 1DZMA 1I9HA 4N7CA 3UEVA 4YGGA 2HKDA 5IRAA 1YUPA 4BJ8A 4BGFA 4EEJA 1E2TA 1Y0GA 3ZQ3A 1SRFA 4UU3A 1YWDA 2AT0X 3STMX 1ML7A 1S44A 3HWFA 3BRNA 3DSZA 4BX6B 2Z4IA 1SWNA 4ORSA 3RDSA 1HQQA 1FELA 1KQXA 3MX7A 5FENA 1U17A 1I78A 2RTJA 3HK1A 4KC7A 4GK9A 2YG2A 1AVDA 2L67A 4M6SA 5CSEA 5D4AA 1VWEB 1BSYA 1YIVA 5BVSA 1BM5A 3GAQA 5F58A 4OMXA 5JR8A 2AT5X 1GX3A 5EEDA 5B10O 1WBIA 2MJIA 4GJSA 1OEEA 1YWCA 1RBPA 1ZNEA 2C1QA 3WZNA 1SWEA 1HN2A 1SWDA 2OL8O 1QABE 3FELA 5C0NA 3G7XA 4ZCBA 1MK5A 2GTLN 3RWXA 1YWAA 3TGAA 4ZGUA 2A3FX 2IZKA 2A2GA 2CAMA 4IMOA 3STNA 1G74A 4I6SA 4L3RA 3ZZVA 3NX1A 1LDQA 1SWKA 3EMMA 3P6GA 4ORUA 4WFUA 3RDXA 3RKGA 4I95A 2KTDA 5H9AA 3RSWA 3PDFA 4O4UA 1ZNGA 1VYGA 1ICMA 2Q2PA 4YKOA 1MVGA 1X71A 2HNXA 1O1UA 1UZ2X 1GT1A 2IFBA 3VG2A 2L9CA 3OJYC 4GNYA 4ORWA 3WZQA 1KZXA 4ALBA 2RTBB 3RE6A 1IKEA 4JNJA 2RTKA 1HXZA 2KT4B 3B2HA 5L8OA 4FBVA 4FQBB 3U0DA 5F6ZA 1SWFA 1SWUA 4M7MA 1KT3A 1EPBA 2FLJA 3FW4A 4BX5A 1GX8A 4CDFA 1ERXA 1MEPA 1LDOA 4GJVA 1X8OA 3KFGA 1I4UA 4AZMA 2OFRX 4AZNA 1SXUA 5HTEA 4U46A 2WSJA 5B5GA 1Y55X 4BX7B 2QMIA 3FA9A 1VWDB 2RTFB 3BDRA 1KOIA 2ASNX 1SWCA 3BLGA 1ICNA 1SWLA 2C1SA 4HPCA 5LKEA 1A57A 4L1NA 2AVIA 1NDJA 1JMZA 2MO5A 3ZW0A 1EQDA 2FKGA 3CQNA 4EFGA 1DF3A 4NLJA 5B3MO 2X32A 1Y9LA 3APUA 2QOMA 1HMSA 4ES7A 3VG7A 4O3ZA 1IW2A 3H3IA 3WYPA 1VWLB 4HFOA 3PQSA 1QY2A 1EIIA 2EU7X 3RE5A 4CV7A 2HLVA 1PEEA 3SOTA 2RTEB 4EQAC 1DZJA 1N9YA 3FEPA 4JGLA 4YVBA 3P6EA 5HZ6A 2IZEB 4KC8A 4U8UM 4OS8A 1KT4A 4INNA 1QFTA 1E00A 1HMTA 2POAA 1RXKA 2ZSCA 3FENA 3VE2A 5B2AO 2FWVA 2GJ5A 3S26A 1AVGI 1KL3A 1GT4A 1W4TA 2QO6A 1AB0A 1LIEA 2RD7C 3EW1A 3LHNA 3F8AA 1DFVA 1IFCA 1LPJA 1SWHA 3ZW1A 4Z2OA 5LJBA 4QGWA 4LZVA 5AQ6A 2ACPX 4PSQA 4Y0PA 3I17A 1X8QA 3WJBA 1EXSA 5H9NA 5IO6A 2G5LA 2X34A 1MDCA 2BS6A 4U3QA 3HWDA 1VWRB 2IZGB 3FW5A 3T2XA 4U8UN 1GM6A 1ZRYA 1VWBB 3FIDA 3NQKA 4ML7B 1VWGB 2BLGA 2IZIA 3ZUIA 4Z6JA 2FTBA 3NQ3A 1N7YA 1LF7A 3B2KA 1ACDA 2AKQA 3PEDA 1NQMA 4RUUA 1LKEA 2RCQA 4HWMA 5BYPA 1HBQA 1OEJA 5H9KA 4BX5B 4TKBA 1SWBA 4Z28A 2AT6X 1N0SA 1DC9A 1SXXA 2K62A 3APXA 1BSQA 2PY1A 3CKFA 1RXHA 1JIWI 3CKGA 4ON1A 5H8TA 2OVAA 2A13A 3RDQA 2RCTA 2RQ0A 4ZHCA 4ZJ0A 5BVTA 1CBSA 1VYOA 4NNSA 4NP1A 2X8TA 2FRSA 4QZTA 4IABA 1CRBA 4GGRA 4QZUA 4CPHB 1FTPA 4ODDA 4OS3A 3NBXX 4GETA 2I5ZO 4NLIA 5CYBA 5JD2A 1SXWA 4ZH6A 3RY2A 4CPEA 2X55A 3KFFA 2JW1A 1SREA 3WJEA 2G7BA 1KT6A 2WQAE 3CBCA 3SZHA 3ELZA 2FHLA 3WJCA 3BY0A 1A2DA 1LCZA 5HA0A 3D96A 1FENA 1TVQA 3C77X 4AZOA 3JS1A 1DV9A 2NNDA 4OELA 1KQWA 1STRB 2WEXA 3EYCA 3KFIA 3ZWEA 4AZRA 4GRJA 2GTLM 3NADA 3KQ0A 3P24A 4IRWA 3S5XA 5EDBA 2BS5A 1Y52X 4KT5A 5B29A 4YBUA 1SA8A 1X8NA 1AQBA 4TQ2A 1KGLA 1KT5A 1P6PA 4RUNA 4GUZA 2X8SA 1BBPA 5KHPA 5LJCA 1N9MA 1SWRA 1U18A 1X89A 4IBAA 1JQPA 5LKFA 1O8VA 2RTOB 4Z2VA 1JBHA 5HZ9A 2AMMX 1HXLA 1KL5A 2AT8X 5L8IA 1S7DA 1B0OA 4CK4A 2RTNB 3O22A 2LA7A 1LIBA 2OVSA 1S2PA 4XMGA 3ZI8A 1GX9A 1PMPA 4QGVA 3EBWA 1IIUA 2CBSA 2Z4HA 2A5CA 4O3XB 2OYBO 3STKA 2XKLA 4QYNA 4KCAA 3WZPA 2VFCA 2LBAA 5D47A 3HTYA 1O1VA 2R74A 4O9SA 5FQ7E 2F73A 2M4LA 1ZNDA 4YGHA 5LJEA 2QO4A 5AJCA 3UEUA 1BWYA 3JQOA 3VG5A 3FA6A 4XMEA 2RTIB 4HPDA 4I9RA 1MM9A 4MVLA 1SY0A 1EUOA 4HPBA 4Z27A 4ALOA 4D6AA 2KD2A 4AW8A 4YDAA 2LFOA 3AUMO 3F6ZB 4NYRA 4GH7A 4ID2A 1VWJB 3UEWA 5HZ5A 3KVNA 1EALA 3P6FA 3FDCA 3VHMA 3TGBA 4LKTA 3D97A 5D48A 2DJGA 3F9DA 3NPOA 2FHNX 3FR5A 3N91A 3VG4A 3WOVA 2RTDB 4QAEA 2Q9SA 1NP4A 4MVIA 2MF6A 4WBKA 5B11O 2CZTA 3P6HA 4EDEA 5DG4A 1IKJA 2KW1A 2RN4A 1PBYA 2CZUA 3HOLA 3JSQA 4GDZA 2MWHA 1X8PA 4IB7A 4ORRA 4JHQA 1TOWA 1KXOA 2IZLB 3CWKA 3WYQA 4C5PA 1OEKA 3Q34A 1G85A 1BLRA 3OD9A 4MIRA 1RXJA 5HA1A 3SLJA 1STSB 4HPAA 4XMDA 2GH7A 1SRJA 2RTMA 4CPIA 2OVEA 4YH0A 2XSTA 3K3LA 4GNWA 4AZPA 1PM1X 3ELXA 3VE1A 1HMRA 4GDAA 4IB9A 3WBGA 3FR2A 2OF8A 1UYNX 2IZFB 2OFAA 4NNTA 4ORXA 5LJGA 5HCCC 2G8CO 2RTGB 3RDUA 1JZUA 5KICA 3X00A 1VPRA 3EBKA 3V8UA 4Y0SA 2ALLX 3MBTA 3AKNA 4OS0A 3RDOA 1SWSA 5FFHA 4GZVA 4IAXA 3CQRA 3APVA 4Y59A 1Y9TA 3PPTA 4GE1A 3T6FA 2OF9A 3TGCA 1ERBA 2HYSA 4BX6A 3IFBA 3O19A 1LCVA 4TLJA 1QY1A 3PH5A 4YBPA 4ARHA 3VGWA 4A8ZA 5IXGA 1B4MA 3AEHA 1E5PA 1Y53X 5EDCA 4I3CA 1FDQA 1VWIB 4GKCA 4YGZA 3S5VA 5FQ8E 1DF8A 1QWDA 1QY0A 5F6BA 4R0BA 1T68X 1SRHA 3VPJE 2MM3A 4EKVA 2JMBA 1NGLA 2W2FA 5AJBA 2X4MA 2HMBA 3P6DA 4WHIA 3E3CA 4YKMA 5FAZA 2A5BA 1HQPA 2N93A 3FEKA 1NBXA 1B56A 1A18A 2RTRB 4TNNA 5CHKA 2A8GA 1SWJA 1JMXA 1IFBA 1GGLA 3PQUA 4O3YA 1KFFA 3RBYA 1FEMA 2L5PA 2QO5A 3B2LA 3FR4A 1HY2A 2IZJA 2LB6A 5LJDA 2WWPA 1LELA 1BJ7A 1N4JA 2PI3O 3AKMA 4Y0QA 3RY1A 1CBIA 4ZH9A 1SRGA 2FKJA 2CBRA 2I5VO 4FGIB 2RA6A 1NQNA 4OKAA 3ZUOA 2ZAGA 1K24A 1I04A 1N43A 4I3BA 4XMHA 1VWHB 2RTPB 3ZW0B 1OPBA 3B2IA 1MX8A 1RAVA 3FLLA 3MVFA 3WVMA 2X45A 1VWOB 1U0XA 3EC5A 2JOZA 2ANSA 1MX7A 5AEOA 4LZUA 4YCHA 1NC9A 1VWCB 4FBOA 2BSZA 2ZAIA 4NW4A 4ZFXA 1K3BA 4O49A 5D8JA 1LIDA 1W5RA 1QG5A 3D4RA 1ADLA 4K19A 5F7GA 4AZQA 1GT3A 2WQ9A 1BEBA 3SAOA 1UYOX 1Z24A 2RTCB 3VHHA 2RTQB 4YMYA 4Y0RA 3SLTA 1VYFA 2P8GA 4A1YA 4GGTA 4TKHA 4BX7A 2FR2A 3DTQA 5BVQA 2FS7A 2L68A 2IZBA 3HPEA 5EPQA 3BU1A 2OL6O 5KIDA 4LQZA 4OEMA 5HBSA 3WJDA 3ZW1B 1SRIA 4ORYA 5F2BA 5IRWA 1E02A 1HBPA 1YP7A 2IZHB 2Y3EA 3PK2A 3SLOA 2WEWA 4DNEA 3LTWA 3Q6LA 1VWPB 4MISA 1EPAA 1PTSA 4MVKA 3BX7A 1DZPA 4MEEA 1X8UA 3BSZE 3KFHA 4NV8A 4IB6A 5HZ8A 3OE3A 5HWZA 5K67A 2Y32A 3BU9A 4XMCA 5CE4A 1SLEB 2BHVA 2OY8A 3P6CA 4NV7A 3VG3A 4B55A 2RTAA 5FQ6E 4U8UO
chains in the Genus database with same CATH topology
4ZHDA 4PJ2A 3KZAA 1GT5A 1OPAA 1DZKA 1QQSA 3U9PC 1NP1A 2WUTA 2QM9A 3NP1A 2HZRA 5HCDC 3APWA 4ZR2A 1LICA 4TKJA 4BOEA 4MVEA 1G7NA 2FS6A 1JJXA 1LFOA 5LJHA 3PH6A 4GU8A 1R0UA 4QQ1A 2FR3A 2G79A 1LNMA 2JN3A 4A1HA 1EI5A 1YWBA 3L4RA 1YP6A 1OBPA 2W2BA 5HTDA 5H9LA 3RZYA 3IA8A 3S60A 3ZW2A 1LIFA 2ACOA 3BS2A 3HOEA 5K06A 3NQ9A 4U9CA 2OVDA 3C76X 2NP1A 1SXYA 5EZ2A 1ALBA 1OBQA 5L8NA 1XKIA 3GE2A 4KH8A 1GKAA 4DQ4A 1ZNKA 3WXQA 2Q2MA 4AYHA 3VU1A 4YBPA 2G78A 4YDBA 3WJGA 4IMNA 1XCAA 2CM9A 3LV4A 1JV4A 2X46A 5HAEA 4YCEA 3HWEA 5LJKA 1MUPA 3TZSA 1GXAA 4QRLA 2YMSA 2OZQA 1ZNHA 1I05A 3B2JA 3PECA 2QOSC 4DQ3A 1EIOA 1I06A 3FA8A 2NNEA 2MHDA 4QNIA 2GTLO 2JU3A 5IO7A 1CBQA 1SY3A 1TW4A 2X8FA 4ZHHA 1QFVA 4O3WA 1OBUA 2DM5A 1EW3A 3HWGA 4FBRA 2AL0X 4YFRA 1BSOA 2HZQA 2O62A 4UU2A 3I0AA 2Q4NA 3C78X 3OBLA 3TF6A 2W2AA 3FMZA 3NR3A 1CJ5A 1TXLA 3EM0A 3UEXA 1E06A 3QKGA 2AH7X 1SY1A 1TOUA 1RLBE 1BRPA 3P02A 5D45A 5EEEA 4BVMA 1B8EA 4QGXA 2BT9A 4N7DA 3WJFA 4CSBA 4ZHFA 1ZNLA 3FIQA 5DPQA 4COTA 2LBVA 4TJZA 4YFPA 1L6MA 2E4JA 1UREA 2JU7A 2Q39A 2R73A 3PP6A 5B27A 4A60A 1BRQA 3BX8A 3NX2A 2GC9A 2A2UA 2GTFX 4NYQA 1AELA 1SY2A 4O4OA 2JU8A 2KTSA 4O4SA 4KIIA 1JYJA 1A3YA 2LKKA 3D95A 4O4XA 1KT7A 2A0AA 3FA7A 4IB8A 5HZQA 4D6BA 1G5WA 3CBSA 4BQUA 4I3DA 1D2UA 2CM4A 2F09A 1H91A 2NNQA 1GKAB 4OMWA 1T8VA 4LKPA 5IO5A 2AT3X 2K23A 1JYDA 1FE3A 4I9SA 4QYPA 4XMFA 3CMPA 3CR6A 3U03A 4ZHGA 4IAWA 2WR6A 2OFMX 4YFQA 2R56A 3T1DA 1T0VA 3FYFA 2FT9A 3UAQA 1D3SA 4WFVA 5HCEC 1KZWA 3O2YA 1CBRA 1SMPI 1PBOA 4ZGFA 3VG6A 1JJJA 1DZMA 4N7CA 3UEVA 4YGGA 4EEJA 1YUPA 3ZQ3A 4UU3A 1YWDA 2AT0X 3STMX 1ML7A 1S44A 3HWFA 3BRNA 3DSZA 2Z4IA 4ORSA 1FELA 1KQXA 3MX7A 5FENA 1U17A 4KC7A 5F7GA 3HK1A 4M6SA 4GK9A 2YG2A 2L67A 3ZUIA 4EXZA 5D4AA 5HZ5A 5BVSA 1BSYA 1YIVA 1BM5A 3GAQA 5F58A 4OMXA 5JR8A 2AT5X 5EEDA 2MJIA 1OEEA 1YWCA 1RBPA 1ZNEA 1HN2A 3FELA 1QABE 5C0NA 3G7XA 4ZCBA 2GTLN 3RWXA 1YWAA 3TGAA 4ZGUA 2A3FX 2A2GA 3STNA 4IMOA 1G74A 4I6SA 4L3RA 3ZZVA 3NX1A 3EMMA 3P6GA 4ORUA 4WFUA 3RKGA 4I95A 2KTDA 5H9AA 3RSWA 4O4UA 1ZNGA 1VYGA 1ICMA 2Q2PA 4YKOA 1MVGA 2HNXA 1X71A 1O1UA 1UZ2X 1GT1A 2IFBA 3VG2A 2L9CA 3OJYC 4GNYA 4ORWA 1KZXA 4ALBA 1IKEA 3B2HA 2KT4B 5L8OA 4FBVA 4FQBB 3U0DA 5F6ZA 4M7MA 1KT3A 1EPBA 2FLJA 3FW4A 1GX8A 1ERXA 1X8OA 3KFGA 1I4UA 4AZMA 2OFRX 4AZNA 1SXUA 5HTEA 2WSJA 2QMIA 3FA9A 3BDRA 1KOIA 2ASNX 3BLGA 1ICNA 4HPCA 5LKEA 1A57A 4L1NA 2MO5A 3ZW0A 1EQDA 3CQNA 4EFGA 1DF3A 4NLJA 1Y9LA 3APUA 1HMSA 4ES7A 3VG7A 4O3ZA 1IW2A 3H3IA 4HFOA 3PQSA 1QY2A 1EIIA 2EU7X 4CV7A 2HLVA 1PEEA 3SOTA 4EQAC 1DZJA 3FEPA 4JGLA 3P6EA 5HZ6A 4U8UM 4KC8A 4OS8A 1KT4A 4INNA 1QFTA 1E00A 1HMTA 2POAA 3FENA 3VE2A 2FWVA 2GJ5A 3S26A 1AVGI 2QO6A 1GT4A 1AB0A 1LIEA 2RD7C 3LHNA 5F1EA 3F8AA 1DFVA 1IFCA 1LPJA 4AZQA 3ZW1A 5LJBA 4QGWA 4LZVA 5AQ6A 2ACPX 4PSQA 4Y0PA 3I17A 1X8QA 3WJBA 1EXSA 5H9NA 5IO6A 1MDCA 2BS6A 4U3QA 3HWDA 3FW5A 4U8UN 1GM6A 1ZRYA 3NQKA 4ML7B 2BLGA 2FTBA 3NQ3A 3PEDA 1LF7A 3B2KA 1ACDA 2AKQA 4RUUA 1LKEA 2RCQA 4HWMA 5BYPA 1HBQA 1OEJA 5H9KA 4TKBA 2AT6X 1N0SA 1DC9A 1SXXA 2K62A 3APXA 1BSQA 2PY1A 4XMHA 4ON1A 1JIWI 5H8TA 2OVAA 2A13A 2RCTA 2RQ0A 5BVTA 4ZJ0A 1CBSA 4NP1A 4NNSA 2X8TA 2FRSA 4QZTA 4IABA 1CRBA 4QZUA 1FTPA 4ODDA 4OS3A 3NBXX 4GETA 4NLIA 5CYBA 4ZH6A 1SXWA 3KFFA 3WJEA 2JW1A 2G7BA 1KT6A 2WQAE 3CBCA 3ELZA 3WJCA 3BY0A 1A2DA 5HA0A 3D96A 1FENA 1TVQA 3C77X 4AZOA 3JS1A 1DV9A 2NNDA 1KQWA 3ZWEA 2WEXA 3EYCA 3KFIA 4AZRA 4GRJA 2GTLM 3NADA 3KQ0A 3P24A 3S5XA 5EDBA 2BS5A 4KT5A 5B29A 4YBUA 1SA8A 1X8NA 1AQBA 4TQ2A 1KGLA 1KT5A 1P6PA 4RUNA 2X8SA 1BBPA 5KHPA 5LJCA 1U18A 1X89A 4IBAA 5LKFA 1O8VA 1JBHA 5HZ9A 2AMMX 2AT8X 5L8IA 1S7DA 1B0OA 4CK4A 3O22A 2LA7A 1LIBA 2OVSA 1S2PA 4XMGA 3ZI8A 1GX9A 1PMPA 4QGVA 3EBWA 1IIUA 2CBSA 2Z4HA 4O3XB 3STKA 2XKLA 4QYNA 4KCAA 2LBAA 5D47A 3HTYA 1O1VA 2R74A 4O9SA 5FQ7E 2F73A 2M4LA 1ZNDA 4YGHA 5LJEA 2QO4A 5AJCA 3UEUA 1BWYA 3JQOA 3VG5A 3FA6A 4XMEA 4HPDA 4I9RA 4MVLA 1SY0A 1EUOA 4HPBA 4ALOA 4D6AA 2KD2A 4AW8A 4YDAA 2LFOA 4NYRA 3F6ZB 4GH7A 4ID2A 3UEWA 1EALA 3P6FA 3TGBA 4LKTA 3D97A 5D48A 3F9DA 3NPOA 3FR5A 3N91A 3VG4A 3WOVA 4QAEA 2Q9SA 1NP4A 4MVIA 4WBKA 2CZTA 3P6HA 4EDEA 5DG4A 1IKJA 2KW1A 2RN4A 3HOLA 2CZUA 3JSQA 4GDZA 2MWHA 1X8PA 4IB7A 4ORRA 1TOWA 1KXOA 3CWKA 1OEKA 1G85A 1BLRA 3OD9A 4MIRA 5HA1A 4HPAA 4XMDA 2OVEA 4YH0A 2XSTA 3K3LA 4GNWA 4AZPA 1PM1X 3ELXA 3VE1A 1HMRA 4IB9A 3WBGA 3FR2A 4NNTA 4ORXA 5HCCC 1JZUA 5KICA 1VPRA 3EBKA 3V8UA 4Y0SA 2ALLX 3MBTA 3AKNA 4OS0A 5FFHA 4GZVA 4IAXA 3CQRA 3APVA 1Y9TA 3PPTA 4GE1A 3TGCA 1ERBA 2HYSA 3IFBA 3O19A 4TLJA 1QY1A 3PH5A 4ARHA 4A8ZA 1B4MA 1E5PA 5EDCA 4I3CA 1FDQA 4GKCA 4YGZA 3S5VA 5FQ8E 1QWDA 1QY0A 5F6BA 4R0BA 1T68X 3VPJE 2MM3A 2JMBA 1NGLA 2W2FA 5AJBA 2HMBA 3P6DA 4WHIA 3E3CA 4YKMA 5FAZA 1HQPA 2N93A 3FEKA 1B56A 1A18A 4TNNA 5LJGA 3PQUA 4O3YA 1IFBA 3RBYA 1GGLA 4ZHCA 1FEMA 2L5PA 2QO5A 3B2LA 3FR4A 5LJDA 2LB6A 2WWPA 4Y0QA 1BJ7A 3AKMA 1CBIA 4ZH9A 2CBRA 4FGIB 2RA6A 3ZUOA 2ZAGA 1I04A 4I3BA 3ZW0B 1OPBA 3B2IA 1MX8A 3FLLA 3MVFA 3WVMA 2X45A 1U0XA 2JOZA 2ANSA 1MX7A 5AEOA 4LZUA 4YCHA 4FBOA 2ZAIA 4NW4A 4ZFXA 4O49A 5D8JA 1LIDA 4K19A 1QG5A 3D4RA 1ADLA 1GT3A 2WQ9A 1BEBA 3SAOA 1Z24A 4YMYA 4Y0RA 1VYFA 2P8GA 4A1YA 4TKHA 2FR2A 3DTQA 5BVQA 2FS7A 2L68A 5EPQA 3BU1A 5KIDA 4LQZA 5HBSA 3WJDA 3ZW1B 4ORYA 1E02A 1HBPA 1YP7A 2WEWA 3Q6LA 4MISA 1EPAA 4MVKA 3BX7A 1DZPA 1X8UA 3BSZE 3KFHA 4IB6A 5HZ8A 3OE3A 5HWZA 3BU9A 4XMCA 5CE4A 2BHVA 3P6CA 3VG3A 5FQ6E 4U8UO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZW1 A;  5AJC A;  2BT9 A;  3ZI8 A;  5AJB A;  2BS6 A;  2BS5 A;  3ZW2 A;  4I6S A;  3ZZV A;  3ZWE A;  3ZW0 B;  3ZW1 B;  3ZW0 A; 
#chains in the Genus database with same CATH topology
 4ZHD A;  4PJ2 A;  3KZA A;  1GT5 A;  1OPA A;  1DZK A;  1QQS A;  1VWF B;  3D9W A;  1NP1 A;  1RST B;  2WUT A;  3U9P C;  2IZC B;  2QM9 A;  3NP1 A;  3EW2 A;  2OY1 O;  2HZR A;  5HCD C;  3APW A;  1AVE A;  1LIC A;  4ZR2 A;  4EXZ A;  4TKJ A;  4BOE A;  4MVE A;  1G7N A;  2C4I A;  2FS6 A;  1JJX A;  1LFO A;  2OL7 A;  1OSP O;  5LJH A;  3PH6 A;  4GU8 A;  1JJU A;  1R0U A;  2Y3F A;  4DCB A;  4QQ1 A;  2FR3 A;  2G79 A;  1LNM A;  2JN3 A;  4A1H A;  1EI5 A;  1YWB A;  3L4R A;  1YP6 A;  1OBP A;  5IRU A;  2IZA A;  3RDM A;  2JGS A;  2W2B A;  5HTD A;  5H9L A;  3RZY A;  3IA8 A;  3S60 A;  1W6F A;  1LIF A;  2ACO A;  3BS2 A;  3ZW2 A;  5B5F A;  2DJF A;  2F01 A;  3HOE A;  3NQ9 A;  4U9C A;  4CDD A;  2OVD A;  5K06 A;  3C76 X;  2NP1 A;  1RSU B;  1SXY A;  2IZD B;  1SWA A;  5EZ2 A;  1ALB A;  4JO6 A;  1OBQ A;  5L8N A;  1XKI A;  3GE2 A;  1VWM B;  1SWT A;  1GKA A;  4KH8 A;  4DQ4 A;  1ZNK A;  1VWQ B;  2Q2M A;  3T6L A;  3VU1 A;  3WXQ A;  2G78 A;  4AYH A;  4YDB A;  1STP A;  3WJG A;  4BBO A;  4CDC A;  4CPH A;  4IMN A;  1XCA A;  2X56 A;  2CM9 A;  1SWQ A;  3LV4 A;  1JV4 A;  4CDE A;  1VWA B;  2RTL A;  2X46 A;  5HAE A;  3T2W A;  4YCE A;  1LCW A;  3HWE A;  5LJK A;  1MUP A;  5K68 A;  3TZS A;  1GXA A;  4QRL A;  2YMS A;  2OZQ A;  1ZNH A;  1I05 A;  3B2J A;  3PEC A;  2QOS C;  4BCS A;  4DQ3 A;  1EIO A;  1I06 A;  3FA8 A;  4Z2P A;  1VWK B;  2NNE A;  2MHD A;  4QNI A;  2GTL O;  2JU3 A;  5IO7 A;  5L3Y A;  1CBQ A;  1SY3 A;  1TW4 A;  5F1E A;  2X8F A;  4ZHH A;  1QFV A;  1MOY A;  4O3W A;  1OBU A;  2DM5 A;  1EW3 A;  3HWG A;  4FBR A;  2AL0 X;  3SZI A;  4YFR A;  1BSO A;  2HZQ A;  2O62 A;  4UU2 A;  3I0A A;  2Q4N A;  3C78 X;  3OBL A;  1SLD B;  2W2A A;  3TF6 A;  1KL4 A;  2OFB A;  4I60 A;  3FMZ A;  3NR3 A;  1LUQ A;  4CPF A;  1CJ5 A;  1TXL A;  3EM0 A;  3UEX A;  1E06 A;  3QKG A;  2AH7 X;  1SY1 A;  1TOU A;  1RLB E;  1BRP A;  3P02 A;  5D45 A;  5EEE A;  2RTH B;  3MM0 A;  4BVM A;  1B8E A;  4QGX A;  2OY5 O;  2BT9 A;  4N7D A;  3WJF A;  4CSB A;  4ZHF A;  1ZNL A;  3FIQ A;  5DPQ A;  3SZJ A;  1VWN B;  4COT A;  2LBV A;  4TJZ A;  4YFP A;  1L6M A;  2E4J A;  1URE A;  2AF5 A;  1IJ8 A;  2JU7 A;  2Q39 A;  2R73 A;  3PP6 A;  5B27 A;  4A60 A;  1BRQ A;  3BX8 A;  1SWG A;  2GC9 A;  2A2U A;  3NX2 A;  2GTF X;  2QCB A;  3MG5 A;  4NYQ A;  1AEL A;  2OY7 A;  1SY2 A;  1SLF B;  4O4O A;  2JU8 A;  2KTS A;  4O4S A;  2UYW A;  4KII A;  1SWP A;  1JYJ A;  1A3Y A;  2LKK A;  3D95 A;  4O4X A;  2WPU A;  1KT7 A;  2A0A A;  3FA7 A;  4IB8 A;  5HZQ A;  4D6B A;  1G5W A;  1WUB A;  3CBS A;  4BQU A;  4I3D A;  1D2U A;  2CM4 A;  2F09 A;  1H91 A;  1FJ1 E;  2NNQ A;  2VFB A;  4Y5D A;  1GKA B;  4OMW A;  3QQ2 A;  1SLG B;  1T8V A;  4LKP A;  5IO5 A;  2AT3 X;  2K23 A;  1JYD A;  1FE3 A;  4I9S A;  4GGZ A;  3VHI A;  4QYP A;  4XMF A;  2VDF A;  3CMP A;  3CR6 A;  3U03 A;  4ZHG A;  4IAW A;  2WR6 A;  2BC3 A;  2OFM X;  3WZO A;  1SWO A;  2R56 A;  4YFQ A;  1T0V A;  2UZ2 A;  2FT9 A;  3FYF A;  3T1D A;  1D3S A;  3UAQ A;  4WFV A;  5HCE C;  4GD9 A;  3O2Y A;  1CBR A;  1KZW A;  1SMP I;  1PBO A;  4ZGF A;  3VG6 A;  1JJJ A;  2FGS A;  1DZM A;  1I9H A;  4N7C A;  3UEV A;  4YGG A;  2HKD A;  5IRA A;  1YUP A;  4BJ8 A;  4BGF A;  4EEJ A;  1E2T A;  1Y0G A;  3ZQ3 A;  1SRF A;  4UU3 A;  1YWD A;  2AT0 X;  3STM X;  1ML7 A;  1S44 A;  3HWF A;  3BRN A;  3DSZ A;  4BX6 B;  2Z4I A;  1SWN A;  4ORS A;  3RDS A;  1HQQ A;  1FEL A;  1KQX A;  3MX7 A;  5FEN A;  1U17 A;  1I78 A;  2RTJ A;  3HK1 A;  4KC7 A;  4GK9 A;  2YG2 A;  1AVD A;  2L67 A;  4M6S A;  5CSE A;  5D4A A;  1VWE B;  1BSY A;  1YIV A;  5BVS A;  1BM5 A;  3GAQ A;  5F58 A;  4OMX A;  5JR8 A;  2AT5 X;  1GX3 A;  5EED A;  5B10 O;  1WBI A;  2MJI A;  4GJS A;  1OEE A;  1YWC A;  1RBP A;  1ZNE A;  2C1Q A;  3WZN A;  1SWE A;  1HN2 A;  1SWD A;  2OL8 O;  1QAB E;  3FEL A;  5C0N A;  3G7X A;  4ZCB A;  1MK5 A;  2GTL N;  3RWX A;  1YWA A;  3TGA A;  4ZGU A;  2A3F X;  2IZK A;  2A2G A;  2CAM A;  4IMO A;  3STN A;  1G74 A;  4I6S A;  4L3R A;  3ZZV A;  3NX1 A;  1LDQ A;  1SWK A;  3EMM A;  3P6G A;  4ORU A;  4WFU A;  3RDX A;  3RKG A;  4I95 A;  2KTD A;  5H9A A;  3RSW A;  3PDF A;  4O4U A;  1ZNG A;  1VYG A;  1ICM A;  2Q2P A;  4YKO A;  1MVG A;  1X71 A;  2HNX A;  1O1U A;  1UZ2 X;  1GT1 A;  2IFB A;  3VG2 A;  2L9C A;  3OJY C;  4GNY A;  4ORW A;  3WZQ A;  1KZX A;  4ALB A;  2RTB B;  3RE6 A;  1IKE A;  4JNJ A;  2RTK A;  1HXZ A;  2KT4 B;  3B2H A;  5L8O A;  4FBV A;  4FQB B;  3U0D A;  5F6Z A;  1SWF A;  1SWU A;  4M7M A;  1KT3 A;  1EPB A;  2FLJ A;  3FW4 A;  4BX5 A;  1GX8 A;  4CDF A;  1ERX A;  1MEP A;  1LDO A;  4GJV A;  1X8O A;  3KFG A;  1I4U A;  4AZM A;  2OFR X;  4AZN A;  1SXU A;  5HTE A;  4U46 A;  2WSJ A;  5B5G A;  1Y55 X;  4BX7 B;  2QMI A;  3FA9 A;  1VWD B;  2RTF B;  3BDR A;  1KOI A;  2ASN X;  1SWC A;  3BLG A;  1ICN A;  1SWL A;  2C1S A;  4HPC A;  5LKE A;  1A57 A;  4L1N A;  2AVI A;  1NDJ A;  1JMZ A;  2MO5 A;  3ZW0 A;  1EQD A;  2FKG A;  3CQN A;  4EFG A;  1DF3 A;  4NLJ A;  5B3M O;  2X32 A;  1Y9L A;  3APU A;  2QOM A;  1HMS A;  4ES7 A;  3VG7 A;  4O3Z A;  1IW2 A;  3H3I A;  3WYP A;  1VWL B;  4HFO A;  3PQS A;  1QY2 A;  1EII A;  2EU7 X;  3RE5 A;  4CV7 A;  2HLV A;  1PEE A;  3SOT A;  2RTE B;  4EQA C;  1DZJ A;  1N9Y A;  3FEP A;  4JGL A;  4YVB A;  3P6E A;  5HZ6 A;  2IZE B;  4KC8 A;  4U8U M;  4OS8 A;  1KT4 A;  4INN A;  1QFT A;  1E00 A;  1HMT A;  2POA A;  1RXK A;  2ZSC A;  3FEN A;  3VE2 A;  5B2A O;  2FWV A;  2GJ5 A;  3S26 A;  1AVG I;  1KL3 A;  1GT4 A;  1W4T A;  2QO6 A;  1AB0 A;  1LIE A;  2RD7 C;  3EW1 A;  3LHN A;  3F8A A;  1DFV A;  1IFC A;  1LPJ A;  1SWH A;  3ZW1 A;  4Z2O A;  5LJB A;  4QGW A;  4LZV A;  5AQ6 A;  2ACP X;  4PSQ A;  4Y0P A;  3I17 A;  1X8Q A;  3WJB A;  1EXS A;  5H9N A;  5IO6 A;  2G5L A;  2X34 A;  1MDC A;  2BS6 A;  4U3Q A;  3HWD A;  1VWR B;  2IZG B;  3FW5 A;  3T2X A;  4U8U N;  1GM6 A;  1ZRY A;  1VWB B;  3FID A;  3NQK A;  4ML7 B;  1VWG B;  2BLG A;  2IZI A;  3ZUI A;  4Z6J A;  2FTB A;  3NQ3 A;  1N7Y A;  1LF7 A;  3B2K A;  1ACD A;  2AKQ A;  3PED A;  1NQM A;  4RUU A;  1LKE A;  2RCQ A;  4HWM A;  5BYP A;  1HBQ A;  1OEJ A;  5H9K A;  4BX5 B;  4TKB A;  1SWB A;  4Z28 A;  2AT6 X;  1N0S A;  1DC9 A;  1SXX A;  2K62 A;  3APX A;  1BSQ A;  2PY1 A;  3CKF A;  1RXH A;  1JIW I;  3CKG A;  4ON1 A;  5H8T A;  2OVA A;  2A13 A;  3RDQ A;  2RCT A;  2RQ0 A;  4ZHC A;  4ZJ0 A;  5BVT A;  1CBS A;  1VYO A;  4NNS A;  4NP1 A;  2X8T A;  2FRS A;  4QZT A;  4IAB A;  1CRB A;  4GGR A;  4QZU A;  4CPH B;  1FTP A;  4ODD A;  4OS3 A;  3NBX X;  4GET A;  2I5Z O;  4NLI A;  5CYB A;  5JD2 A;  1SXW A;  4ZH6 A;  3RY2 A;  4CPE A;  2X55 A;  3KFF A;  2JW1 A;  1SRE A;  3WJE A;  2G7B A;  1KT6 A;  2WQA E;  3CBC A;  3SZH A;  3ELZ A;  2FHL A;  3WJC A;  3BY0 A;  1A2D A;  1LCZ A;  5HA0 A;  3D96 A;  1FEN A;  1TVQ A;  3C77 X;  4AZO A;  3JS1 A;  1DV9 A;  2NND A;  4OEL A;  1KQW A;  1STR B;  2WEX A;  3EYC A;  3KFI A;  3ZWE A;  4AZR A;  4GRJ A;  2GTL M;  3NAD A;  3KQ0 A;  3P24 A;  4IRW A;  3S5X A;  5EDB A;  2BS5 A;  1Y52 X;  4KT5 A;  5B29 A;  4YBU A;  1SA8 A;  1X8N A;  1AQB A;  4TQ2 A;  1KGL A;  1KT5 A;  1P6P A;  4RUN A;  4GUZ A;  2X8S A;  1BBP A;  5KHP A;  5LJC A;  1N9M A;  1SWR A;  1U18 A;  1X89 A;  4IBA A;  1JQP A;  5LKF A;  1O8V A;  2RTO B;  4Z2V A;  1JBH A;  5HZ9 A;  2AMM X;  1HXL A;  1KL5 A;  2AT8 X;  5L8I A;  1S7D A;  1B0O A;  4CK4 A;  2RTN B;  3O22 A;  2LA7 A;  1LIB A;  2OVS A;  1S2P A;  4XMG A;  3ZI8 A;  1GX9 A;  1PMP A;  4QGV A;  3EBW A;  1IIU A;  2CBS A;  2Z4H A;  2A5C A;  4O3X B;  2OYB O;  3STK A;  2XKL A;  4QYN A;  4KCA A;  3WZP A;  2VFC A;  2LBA A;  5D47 A;  3HTY A;  1O1V A;  2R74 A;  4O9S A;  5FQ7 E;  2F73 A;  2M4L A;  1ZND A;  4YGH A;  5LJE A;  2QO4 A;  5AJC A;  3UEU A;  1BWY A;  3JQO A;  3VG5 A;  3FA6 A;  4XME A;  2RTI B;  4HPD A;  4I9R A;  1MM9 A;  4MVL A;  1SY0 A;  1EUO A;  4HPB A;  4Z27 A;  4ALO A;  4D6A A;  2KD2 A;  4AW8 A;  4YDA A;  2LFO A;  3AUM O;  3F6Z B;  4NYR A;  4GH7 A;  4ID2 A;  1VWJ B;  3UEW A;  5HZ5 A;  3KVN A;  1EAL A;  3P6F A;  3FDC A;  3VHM A;  3TGB A;  4LKT A;  3D97 A;  5D48 A;  2DJG A;  3F9D A;  3NPO A;  2FHN X;  3FR5 A;  3N91 A;  3VG4 A;  3WOV A;  2RTD B;  4QAE A;  2Q9S A;  1NP4 A;  4MVI A;  2MF6 A;  4WBK A;  5B11 O;  2CZT A;  3P6H A;  4EDE A;  5DG4 A;  1IKJ A;  2KW1 A;  2RN4 A;  1PBY A;  2CZU A;  3HOL A;  3JSQ A;  4GDZ A;  2MWH A;  1X8P A;  4IB7 A;  4ORR A;  4JHQ A;  1TOW A;  1KXO A;  2IZL B;  3CWK A;  3WYQ A;  4C5P A;  1OEK A;  3Q34 A;  1G85 A;  1BLR A;  3OD9 A;  4MIR A;  1RXJ A;  5HA1 A;  3SLJ A;  1STS B;  4HPA A;  4XMD A;  2GH7 A;  1SRJ A;  2RTM A;  4CPI A;  2OVE A;  4YH0 A;  2XST A;  3K3L A;  4GNW A;  4AZP A;  1PM1 X;  3ELX A;  3VE1 A;  1HMR A;  4GDA A;  4IB9 A;  3WBG A;  3FR2 A;  2OF8 A;  1UYN X;  2IZF B;  2OFA A;  4NNT A;  4ORX A;  5LJG A;  5HCC C;  2G8C O;  2RTG B;  3RDU A;  1JZU A;  5KIC A;  3X00 A;  1VPR A;  3EBK A;  3V8U A;  4Y0S A;  2ALL X;  3MBT A;  3AKN A;  4OS0 A;  3RDO A;  1SWS A;  5FFH A;  4GZV A;  4IAX A;  3CQR A;  3APV A;  4Y59 A;  1Y9T A;  3PPT A;  4GE1 A;  3T6F A;  2OF9 A;  3TGC A;  1ERB A;  2HYS A;  4BX6 A;  3IFB A;  3O19 A;  1LCV A;  4TLJ A;  1QY1 A;  3PH5 A;  4YBP A;  4ARH A;  3VGW A;  4A8Z A;  5IXG A;  1B4M A;  3AEH A;  1E5P A;  1Y53 X;  5EDC A;  4I3C A;  1FDQ A;  1VWI B;  4GKC A;  4YGZ A;  3S5V A;  5FQ8 E;  1DF8 A;  1QWD A;  1QY0 A;  5F6B A;  4R0B A;  1T68 X;  1SRH A;  3VPJ E;  2MM3 A;  4EKV A;  2JMB A;  1NGL A;  2W2F A;  5AJB A;  2X4M A;  2HMB A;  3P6D A;  4WHI A;  3E3C A;  4YKM A;  5FAZ A;  2A5B A;  1HQP A;  2N93 A;  3FEK A;  1NBX A;  1B56 A;  1A18 A;  2RTR B;  4TNN A;  5CHK A;  2A8G A;  1SWJ A;  1JMX A;  1IFB A;  1GGL A;  3PQU A;  4O3Y A;  1KFF A;  3RBY A;  1FEM A;  2L5P A;  2QO5 A;  3B2L A;  3FR4 A;  1HY2 A;  2IZJ A;  2LB6 A;  5LJD A;  2WWP A;  1LEL A;  1BJ7 A;  1N4J A;  2PI3 O;  3AKM A;  4Y0Q A;  3RY1 A;  1CBI A;  4ZH9 A;  1SRG A;  2FKJ A;  2CBR A;  2I5V O;  4FGI B;  2RA6 A;  1NQN A;  4OKA A;  3ZUO A;  2ZAG A;  1K24 A;  1I04 A;  1N43 A;  4I3B A;  4XMH A;  1VWH B;  2RTP B;  3ZW0 B;  1OPB A;  3B2I A;  1MX8 A;  1RAV A;  3FLL A;  3MVF A;  3WVM A;  2X45 A;  1VWO B;  1U0X A;  3EC5 A;  2JOZ A;  2ANS A;  1MX7 A;  5AEO A;  4LZU A;  4YCH A;  1NC9 A;  1VWC B;  4FBO A;  2BSZ A;  2ZAI A;  4NW4 A;  4ZFX A;  1K3B A;  4O49 A;  5D8J A;  1LID A;  1W5R A;  1QG5 A;  3D4R A;  1ADL A;  4K19 A;  5F7G A;  4AZQ A;  1GT3 A;  2WQ9 A;  1BEB A;  3SAO A;  1UYO X;  1Z24 A;  2RTC B;  3VHH A;  2RTQ B;  4YMY A;  4Y0R A;  3SLT A;  1VYF A;  2P8G A;  4A1Y A;  4GGT A;  4TKH A;  4BX7 A;  2FR2 A;  3DTQ A;  5BVQ A;  2FS7 A;  2L68 A;  2IZB A;  3HPE A;  5EPQ A;  3BU1 A;  2OL6 O;  5KID A;  4LQZ A;  4OEM A;  5HBS A;  3WJD A;  3ZW1 B;  1SRI A;  4ORY A;  5F2B A;  5IRW A;  1E02 A;  1HBP A;  1YP7 A;  2IZH B;  2Y3E A;  3PK2 A;  3SLO A;  2WEW A;  4DNE A;  3LTW A;  3Q6L A;  1VWP B;  4MIS A;  1EPA A;  1PTS A;  4MVK A;  3BX7 A;  1DZP A;  4MEE A;  1X8U A;  3BSZ E;  3KFH A;  4NV8 A;  4IB6 A;  5HZ8 A;  3OE3 A;  5HWZ A;  5K67 A;  2Y32 A;  3BU9 A;  4XMC A;  5CE4 A;  1SLE B;  2BHV A;  2OY8 A;  3P6C A;  4NV7 A;  3VG3 A;  4B55 A;  2RTA A;  5FQ6 E;  4U8U O; 
#chains in the Genus database with same CATH homology
 4ZHD A;  4PJ2 A;  3KZA A;  1GT5 A;  1OPA A;  1DZK A;  1QQS A;  3U9P C;  1NP1 A;  2WUT A;  2QM9 A;  3NP1 A;  2HZR A;  5HCD C;  3APW A;  4ZR2 A;  1LIC A;  4TKJ A;  4BOE A;  4MVE A;  1G7N A;  2FS6 A;  1JJX A;  1LFO A;  5LJH A;  3PH6 A;  4GU8 A;  1R0U A;  4QQ1 A;  2FR3 A;  2G79 A;  1LNM A;  2JN3 A;  4A1H A;  1EI5 A;  1YWB A;  3L4R A;  1YP6 A;  1OBP A;  2W2B A;  5HTD A;  5H9L A;  3RZY A;  3IA8 A;  3S60 A;  3ZW2 A;  1LIF A;  2ACO A;  3BS2 A;  3HOE A;  5K06 A;  3NQ9 A;  4U9C A;  2OVD A;  3C76 X;  2NP1 A;  1SXY A;  5EZ2 A;  1ALB A;  1OBQ A;  5L8N A;  1XKI A;  3GE2 A;  4KH8 A;  1GKA A;  4DQ4 A;  1ZNK A;  3WXQ A;  2Q2M A;  4AYH A;  3VU1 A;  4YBP A;  2G78 A;  4YDB A;  3WJG A;  4IMN A;  1XCA A;  2CM9 A;  3LV4 A;  1JV4 A;  2X46 A;  5HAE A;  4YCE A;  3HWE A;  5LJK A;  1MUP A;  3TZS A;  1GXA A;  4QRL A;  2YMS A;  2OZQ A;  1ZNH A;  1I05 A;  3B2J A;  3PEC A;  2QOS C;  4DQ3 A;  1EIO A;  1I06 A;  3FA8 A;  2NNE A;  2MHD A;  4QNI A;  2GTL O;  2JU3 A;  5IO7 A;  1CBQ A;  1SY3 A;  1TW4 A;  2X8F A;  4ZHH A;  1QFV A;  4O3W A;  1OBU A;  2DM5 A;  1EW3 A;  3HWG A;  4FBR A;  2AL0 X;  4YFR A;  1BSO A;  2HZQ A;  2O62 A;  4UU2 A;  3I0A A;  2Q4N A;  3C78 X;  3OBL A;  3TF6 A;  2W2A A;  3FMZ A;  3NR3 A;  1CJ5 A;  1TXL A;  3EM0 A;  3UEX A;  1E06 A;  3QKG A;  2AH7 X;  1SY1 A;  1TOU A;  1RLB E;  1BRP A;  3P02 A;  5D45 A;  5EEE A;  4BVM A;  1B8E A;  4QGX A;  2BT9 A;  4N7D A;  3WJF A;  4CSB A;  4ZHF A;  1ZNL A;  3FIQ A;  5DPQ A;  4COT A;  2LBV A;  4TJZ A;  4YFP A;  1L6M A;  2E4J A;  1URE A;  2JU7 A;  2Q39 A;  2R73 A;  3PP6 A;  5B27 A;  4A60 A;  1BRQ A;  3BX8 A;  3NX2 A;  2GC9 A;  2A2U A;  2GTF X;  4NYQ A;  1AEL A;  1SY2 A;  4O4O A;  2JU8 A;  2KTS A;  4O4S A;  4KII A;  1JYJ A;  1A3Y A;  2LKK A;  3D95 A;  4O4X A;  1KT7 A;  2A0A A;  3FA7 A;  4IB8 A;  5HZQ A;  4D6B A;  1G5W A;  3CBS A;  4BQU A;  4I3D A;  1D2U A;  2CM4 A;  2F09 A;  1H91 A;  2NNQ A;  1GKA B;  4OMW A;  1T8V A;  4LKP A;  5IO5 A;  2AT3 X;  2K23 A;  1JYD A;  1FE3 A;  4I9S A;  4QYP A;  4XMF A;  3CMP A;  3CR6 A;  3U03 A;  4ZHG A;  4IAW A;  2WR6 A;  2OFM X;  4YFQ A;  2R56 A;  3T1D A;  1T0V A;  3FYF A;  2FT9 A;  3UAQ A;  1D3S A;  4WFV A;  5HCE C;  1KZW A;  3O2Y A;  1CBR A;  1SMP I;  1PBO A;  4ZGF A;  3VG6 A;  1JJJ A;  1DZM A;  4N7C A;  3UEV A;  4YGG A;  4EEJ A;  1YUP A;  3ZQ3 A;  4UU3 A;  1YWD A;  2AT0 X;  3STM X;  1ML7 A;  1S44 A;  3HWF A;  3BRN A;  3DSZ A;  2Z4I A;  4ORS A;  1FEL A;  1KQX A;  3MX7 A;  5FEN A;  1U17 A;  4KC7 A;  5F7G A;  3HK1 A;  4M6S A;  4GK9 A;  2YG2 A;  2L67 A;  3ZUI A;  4EXZ A;  5D4A A;  5HZ5 A;  5BVS A;  1BSY A;  1YIV A;  1BM5 A;  3GAQ A;  5F58 A;  4OMX A;  5JR8 A;  2AT5 X;  5EED A;  2MJI A;  1OEE A;  1YWC A;  1RBP A;  1ZNE A;  1HN2 A;  3FEL A;  1QAB E;  5C0N A;  3G7X A;  4ZCB A;  2GTL N;  3RWX A;  1YWA A;  3TGA A;  4ZGU A;  2A3F X;  2A2G A;  3STN A;  4IMO A;  1G74 A;  4I6S A;  4L3R A;  3ZZV A;  3NX1 A;  3EMM A;  3P6G A;  4ORU A;  4WFU A;  3RKG A;  4I95 A;  2KTD A;  5H9A A;  3RSW A;  4O4U A;  1ZNG A;  1VYG A;  1ICM A;  2Q2P A;  4YKO A;  1MVG A;  2HNX A;  1X71 A;  1O1U A;  1UZ2 X;  1GT1 A;  2IFB A;  3VG2 A;  2L9C A;  3OJY C;  4GNY A;  4ORW A;  1KZX A;  4ALB A;  1IKE A;  3B2H A;  2KT4 B;  5L8O A;  4FBV A;  4FQB B;  3U0D A;  5F6Z A;  4M7M A;  1KT3 A;  1EPB A;  2FLJ A;  3FW4 A;  1GX8 A;  1ERX A;  1X8O A;  3KFG A;  1I4U A;  4AZM A;  2OFR X;  4AZN A;  1SXU A;  5HTE A;  2WSJ A;  2QMI A;  3FA9 A;  3BDR A;  1KOI A;  2ASN X;  3BLG A;  1ICN A;  4HPC A;  5LKE A;  1A57 A;  4L1N A;  2MO5 A;  3ZW0 A;  1EQD A;  3CQN A;  4EFG A;  1DF3 A;  4NLJ A;  1Y9L A;  3APU A;  1HMS A;  4ES7 A;  3VG7 A;  4O3Z A;  1IW2 A;  3H3I A;  4HFO A;  3PQS A;  1QY2 A;  1EII A;  2EU7 X;  4CV7 A;  2HLV A;  1PEE A;  3SOT A;  4EQA C;  1DZJ A;  3FEP A;  4JGL A;  3P6E A;  5HZ6 A;  4U8U M;  4KC8 A;  4OS8 A;  1KT4 A;  4INN A;  1QFT A;  1E00 A;  1HMT A;  2POA A;  3FEN A;  3VE2 A;  2FWV A;  2GJ5 A;  3S26 A;  1AVG I;  2QO6 A;  1GT4 A;  1AB0 A;  1LIE A;  2RD7 C;  3LHN A;  5F1E A;  3F8A A;  1DFV A;  1IFC A;  1LPJ A;  4AZQ A;  3ZW1 A;  5LJB A;  4QGW A;  4LZV A;  5AQ6 A;  2ACP X;  4PSQ A;  4Y0P A;  3I17 A;  1X8Q A;  3WJB A;  1EXS A;  5H9N A;  5IO6 A;  1MDC A;  2BS6 A;  4U3Q A;  3HWD A;  3FW5 A;  4U8U N;  1GM6 A;  1ZRY A;  3NQK A;  4ML7 B;  2BLG A;  2FTB A;  3NQ3 A;  3PED A;  1LF7 A;  3B2K A;  1ACD A;  2AKQ A;  4RUU A;  1LKE A;  2RCQ A;  4HWM A;  5BYP A;  1HBQ A;  1OEJ A;  5H9K A;  4TKB A;  2AT6 X;  1N0S A;  1DC9 A;  1SXX A;  2K62 A;  3APX A;  1BSQ A;  2PY1 A;  4XMH A;  4ON1 A;  1JIW I;  5H8T A;  2OVA A;  2A13 A;  2RCT A;  2RQ0 A;  5BVT A;  4ZJ0 A;  1CBS A;  4NP1 A;  4NNS A;  2X8T A;  2FRS A;  4QZT A;  4IAB A;  1CRB A;  4QZU A;  1FTP A;  4ODD A;  4OS3 A;  3NBX X;  4GET A;  4NLI A;  5CYB A;  4ZH6 A;  1SXW A;  3KFF A;  3WJE A;  2JW1 A;  2G7B A;  1KT6 A;  2WQA E;  3CBC A;  3ELZ A;  3WJC A;  3BY0 A;  1A2D A;  5HA0 A;  3D96 A;  1FEN A;  1TVQ A;  3C77 X;  4AZO A;  3JS1 A;  1DV9 A;  2NND A;  1KQW A;  3ZWE A;  2WEX A;  3EYC A;  3KFI A;  4AZR A;  4GRJ A;  2GTL M;  3NAD A;  3KQ0 A;  3P24 A;  3S5X A;  5EDB A;  2BS5 A;  4KT5 A;  5B29 A;  4YBU A;  1SA8 A;  1X8N A;  1AQB A;  4TQ2 A;  1KGL A;  1KT5 A;  1P6P A;  4RUN A;  2X8S A;  1BBP A;  5KHP A;  5LJC A;  1U18 A;  1X89 A;  4IBA A;  5LKF A;  1O8V A;  1JBH A;  5HZ9 A;  2AMM X;  2AT8 X;  5L8I A;  1S7D A;  1B0O A;  4CK4 A;  3O22 A;  2LA7 A;  1LIB A;  2OVS A;  1S2P A;  4XMG A;  3ZI8 A;  1GX9 A;  1PMP A;  4QGV A;  3EBW A;  1IIU A;  2CBS A;  2Z4H A;  4O3X B;  3STK A;  2XKL A;  4QYN A;  4KCA A;  2LBA A;  5D47 A;  3HTY A;  1O1V A;  2R74 A;  4O9S A;  5FQ7 E;  2F73 A;  2M4L A;  1ZND A;  4YGH A;  5LJE A;  2QO4 A;  5AJC A;  3UEU A;  1BWY A;  3JQO A;  3VG5 A;  3FA6 A;  4XME A;  4HPD A;  4I9R A;  4MVL A;  1SY0 A;  1EUO A;  4HPB A;  4ALO A;  4D6A A;  2KD2 A;  4AW8 A;  4YDA A;  2LFO A;  4NYR A;  3F6Z B;  4GH7 A;  4ID2 A;  3UEW A;  1EAL A;  3P6F A;  3TGB A;  4LKT A;  3D97 A;  5D48 A;  3F9D A;  3NPO A;  3FR5 A;  3N91 A;  3VG4 A;  3WOV A;  4QAE A;  2Q9S A;  1NP4 A;  4MVI A;  4WBK A;  2CZT A;  3P6H A;  4EDE A;  5DG4 A;  1IKJ A;  2KW1 A;  2RN4 A;  3HOL A;  2CZU A;  3JSQ A;  4GDZ A;  2MWH A;  1X8P A;  4IB7 A;  4ORR A;  1TOW A;  1KXO A;  3CWK A;  1OEK A;  1G85 A;  1BLR A;  3OD9 A;  4MIR A;  5HA1 A;  4HPA A;  4XMD A;  2OVE A;  4YH0 A;  2XST A;  3K3L A;  4GNW A;  4AZP A;  1PM1 X;  3ELX A;  3VE1 A;  1HMR A;  4IB9 A;  3WBG A;  3FR2 A;  4NNT A;  4ORX A;  5HCC C;  1JZU A;  5KIC A;  1VPR A;  3EBK A;  3V8U A;  4Y0S A;  2ALL X;  3MBT A;  3AKN A;  4OS0 A;  5FFH A;  4GZV A;  4IAX A;  3CQR A;  3APV A;  1Y9T A;  3PPT A;  4GE1 A;  3TGC A;  1ERB A;  2HYS A;  3IFB A;  3O19 A;  4TLJ A;  1QY1 A;  3PH5 A;  4ARH A;  4A8Z A;  1B4M A;  1E5P A;  5EDC A;  4I3C A;  1FDQ A;  4GKC A;  4YGZ A;  3S5V A;  5FQ8 E;  1QWD A;  1QY0 A;  5F6B A;  4R0B A;  1T68 X;  3VPJ E;  2MM3 A;  2JMB A;  1NGL A;  2W2F A;  5AJB A;  2HMB A;  3P6D A;  4WHI A;  3E3C A;  4YKM A;  5FAZ A;  1HQP A;  2N93 A;  3FEK A;  1B56 A;  1A18 A;  4TNN A;  5LJG A;  3PQU A;  4O3Y A;  1IFB A;  3RBY A;  1GGL A;  4ZHC A;  1FEM A;  2L5P A;  2QO5 A;  3B2L A;  3FR4 A;  5LJD A;  2LB6 A;  2WWP A;  4Y0Q A;  1BJ7 A;  3AKM A;  1CBI A;  4ZH9 A;  2CBR A;  4FGI B;  2RA6 A;  3ZUO A;  2ZAG A;  1I04 A;  4I3B A;  3ZW0 B;  1OPB A;  3B2I A;  1MX8 A;  3FLL A;  3MVF A;  3WVM A;  2X45 A;  1U0X A;  2JOZ A;  2ANS A;  1MX7 A;  5AEO A;  4LZU A;  4YCH A;  4FBO A;  2ZAI A;  4NW4 A;  4ZFX A;  4O49 A;  5D8J A;  1LID A;  4K19 A;  1QG5 A;  3D4R A;  1ADL A;  1GT3 A;  2WQ9 A;  1BEB A;  3SAO A;  1Z24 A;  4YMY A;  4Y0R A;  1VYF A;  2P8G A;  4A1Y A;  4TKH A;  2FR2 A;  3DTQ A;  5BVQ A;  2FS7 A;  2L68 A;  5EPQ A;  3BU1 A;  5KID A;  4LQZ A;  5HBS A;  3WJD A;  3ZW1 B;  4ORY A;  1E02 A;  1HBP A;  1YP7 A;  2WEW A;  3Q6L A;  4MIS A;  1EPA A;  4MVK A;  3BX7 A;  1DZP A;  1X8U A;  3BSZ E;  3KFH A;  4IB6 A;  5HZ8 A;  3OE3 A;  5HWZ A;  3BU9 A;  4XMC A;  5CE4 A;  2BHV A;  3P6C A;  3VG3 A;  5FQ6 E;  4U8U O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...