4I6UA

Crystal structure of a y37f mutant of the restriction-modification controller protein c.esp1396i
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
79
structure length
79
Chain Sequence
MESFLLSKVSFVIKKIRLEKGMTQEDLAYKSNLDRTFISGIERNSRNLTIKSLELIMKGLEVSDVVFFEMLIKEILKHD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Mutagenic Analysis of the RM Controller Protein C.Esp1396I.
pubmed doi rcsb
source organism Enterobacter sp.
molecule tags Transcription
molecule keywords Regulatory protein
total genus 34
structure length 79
sequence length 79
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2012-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 4i6uA00
1PRUA 2IUOA 4YG4A 3EUSA 1L1MA 1ZZCA 2LYJA 4Z58A 1X2LA 1QP7A 4I6UA 1HF0A 1RPEL 1QPZA 1EFAA 4I6TA 1Y7YA 3GN5B 4JQDA 4FN3A 1CQTA 1DW9A 3H5TA 3DNVB 2XIUA 2IV1A 4IA8A 1LCCA 2IU7A 2IVQA 2LYLA 3MLFA 1JFTA 3JXDL 1UXDA 3F6WA 2O49A 2EF8A 4Y42A 5K98B 2PUBA 3KXAA 4YBAA 2PE5A 1ZPQA 2XSDC 2CSFA 2OFYA 4X4GA 3BDNA 4X4FA 2XI8A 3KJXA 1PRAA 3FYAA 2BJCA 2KZ8A 3GN5A 2AWIA 1ZVVA 3RZZA 1JFSA 4X4DA 2JVLA 1R63A 1ZAYA 1R69A 2EBYA 1PRVA 1ZZ6A 1NEQA 3CECA 4GHJA 2LYRA 4F8DA 3OQNA 1LCDA 3OQMA 5A7LA 1UTXA 3PXPA 2WIUB 2IVGA 2O4AA 1LLIA 4I8TA 2BNNA 3S8QA 2IVBA 1QQBA 2WUSR 2KPJA 1SQ8A 2PUFA 1IC8A 3QF3A 4IVZA 3U3WA 4X4CA 2D5VA 1GT0C 3QYXA 4J1XA 1WH6A 3QQ6A 2AUWA 3OQOA 3LISA 3VK0A 2PUDA 2FJRA 3FMYA 3KZ3A 1VPWA 3IVPA 4Z59A 3L1PA 2AW6A 4FBIA 2LYKA 2XJ3A 2PPXA 3BS3A 4JCYA 3CROL 3JXBC 1ZZ9A 2R1JL 1RIOA 4Z5CA 2L8NA 3SCFA 2PUAA 1LQCA 1WH8A 4I6RA 4J1WA 1RZSA 1BDHA 1WIZA 4MCXA 2O38A 3ZHMA 4OB4A 3SCGA 1Y9QA 2LCVA 3F52A 1AU7A 4X4EA 2CROA 2ICTA 1ADRA 3F51A 2KEJA 2A6CA 2XCJA 1B0NA 2LYSA 3SCHA 3BD1A 1QQAA 1NERA 2EWTA 4PU4C 2B5AA 1ZS4A 4O8BA 1XWRA 2LYQA 3UFDA 1OSLA 1BDIA 3OP9A 1POUA 3LFPA 2L49A 3TRBA 4X4BA 2GZUA 2ICPA 1ZUGA 1ZZBA 3D1NI 1E3OC 3JXCL 1ZZ8A 2AXZA 4JCXA 2R63A 1UXCA 3HZIB 4PU3C 3R1FA 2PUCA 1RZRD 2HINA 3ZKCA 1JWLA 3FYMA 1QP0A 2PUGA 1JH9A 3O9XA 2GRMA 3G5GA 1LMB3 2H8RA 1QP4A 1CJGA 2KEKA 2AXUA 4YG7B 4PU8A 4IWRA 4PU7A 3B7HA 4Z5HA 1PNRA 1WETA 2MEZA 3ZHIA 2BNOA 3CLCA 4GQMA 4NDWA 1YSEA 4YG1A 2PUEA 1OCTC 1DWKA 1RZRA 1O4XA 4X4HA 1X57A 1ZZ7A 2JCGA 2BNMA 2LYPA 2HSGA 2KEIA 2PIJA 1S7EA 4YARA 3QWGA 1PERL 2GRLA 4X4IA 4MCTA 4Z5DA 3OMTA 3GBFA 2OR1L 2AXVA 2MQKA 3G7DA
chains in the Genus database with same CATH superfamily
3EUSA 4I6UA 2PXBA 1EFAA 5DTQA 4JQDA 4IA8A 4DE8A 2JQEA 2EF8A 2PE5A 2HCSA 2XSDC 4X4FA 1PRAA 1JFSA 1R63A 2EBYA 1PRVA 1NEQA 4F8DA 2LYRA 1LCDA 3OQMA 4ER0A 2BNNA 1SQ8A 1IC8A 4IVZA 4X4CA 1GT0C 3QYXA 1WH6A 3QQ6A 2PXVA 3VK0A 3FMYA 3IVPA 2HFZA 3BS3A 3JXBC 2R1JL 2PXLA 1RIOA 1WH8A 4J1WA 1BDHA 3MEJA 1AU7A 4X4EA 2CROA 2A6CA 2XCJA 1B0NA 3BD1A 4Q2JA 2PXTA 1BDIA 3TRBA 3GZDA 4ER7A 3M9LA 1JWLA 1QP0A 2PUGA 2GRMA 1QZXA 1CJGA 3ME5A 3NXHA 4PU8A 4PU7A 3GZDC 4EK9A 4ER6A 1O4XA 1X57A 2JCGA 2HSGA 4X4IA 4Z5DA 4FBIA 3QFIA 2IUOA 4YG4A 3VWSA 2LYJA 1HF0A 1QPZA 2PXQA 1DULA 1Y7YA 3H5TA 1LCCA 2O49A 4Y42A 5K98B 2PUBA 2CSFA 5DSXA 3TEPA 3KJXA 2LLWA 2KZ8A 1ZVVA 2AWIA 4X4DA 2JVLA 2V3CC 1R69A 4GHJA 2O4AA 1LLIA 3S8QA 2IVBA 1QQBA 2PXPA 3QF3A 4ER3A 2AUWA 3LISA 1VPWA 3L1PA 2LYKA 2PPXA 1ZZ9A 4OBMA 4Z5CA 3SCFA 2PXEA 2PUAA 4I6RA 4OB4A 3SCGA 5GAHi 2LCVA 1ADRA 2ICTA 3F51A 2ODRD 3SCHA 1QQAA 4O8BA 2LYQA 1POUA 2GZUA 2ICPA 2M4HA 1E3OC 1ZZ8A 2AXZA 2R63A 3HZIB 4PU3C 3ZKCA 1JH9A 1LMB3 2H8RA 2LLVA 4Z5HA 3ZHIA 2BNOA 4NDWA 2PUEA 1DWKA 1RZRA 4X4HA 3PE5A 3QOWA 2BNMA 1QB2A 4YARA 2OR1L 3G7DA 3SX0A 2YBDA 1RPEL 4I6TA 4FN3A 1CQTA 2PXDA 1DW9A 3SR4A 4HRAA 3DNVB 2IV1A 2XXPA 2IU7A 2IVQA 2LYLA 1JFTA 1HQ1A 1UXDA 3KXAA 2FFHA 4X4GA 2XI8A 3FYAA 3CECA 5DTRA 3OQNA 1UTXA 2MXDA 1MFQC 2WIUB 2IVGA 4I8TA 4EZIA 2PUFA 3NZLA 3U3WA 4EQZA 2PXFA 4EKIA 2L1PA 3OQOA 2PUDA 5DRYA 2FJRA 3KZ3A 4Z59A 3KL4A 2AW6A 2XJ3A 2PXKA 4JCYA 3CROL 3ZPXA 3R09A 1WIZA 2HCNA 2O38A 2XXQA 2LNMA 4WVLA 4ER5A 1NERA 2B5AA 1OSLA 3OP9A 4EKGA 4X4BA 1ZUGA 1ZZBA 3JXCL 4JCXA 5DT2A 1UXCA 3R1FA 2HINA 3FYMA 3OKZA 3G5GA 5DTMA 2J7UA 1QP4A 2VEOA 2KEKA 3TFLA 4YG7B 1PNRA 1WETA 3QOXA 3CLCA 1YSEA 1OCTC 3GUUA 1ZZ7A 3A9ZA 2LYPA 1S7EA 1PERL 5DRTA 4MCTA 3OMTA 2AXVA 1PRUA 1L1MA 3UWPA 1ZZCA 4Z58A 1X2LA 3NROA 1QP7A 3GN5B 3OWQA 2XIUA 3TELA 3MLFA 5JUWA 3JXDL 3F6WA 4YBAA 4DE9A 3LQXA 1ZPQA 2OFYA 3BDNA 5GAGi 3A9YA 2BJCA 3GN5A 3RZZA 1ZAYA 1ZZ6A 3G0TA 1NW3A 5A7LA 3PXPA 3A9XA 2WUSR 2KPJA 2D5VA 4J1XA 3DM5A 3GZCA 2L8NA 1LQCA 1RZSA 4MCXA 3ZHMA 2XXAA 1Y9QA 3F52A 2KEJA 2LYSA 2EWTA 4PU4C 1ZS4A 1XWRA 3UFDA 3LFPA 2L49A 3D1NI 2PUCA 1RZRD 3O9XA 2J7WA 2AXUA 4IWRA 3B7HA 3NDBB 2PXUA 2MEZA 4GQMA 4YG1A 1U2ZA 2KEIA 2PIJA 3QWGA 2GRLA 3GBFA 2MQKA
chains in the Genus database with same CATH topology
1PRUA 2IUOA 4YG4A 3EUSA 1L1MA 1ZZCA 2LYJA 4Z58A 1X2LA 1QP7A 4I6UA 1HF0A 1RPEL 1QPZA 1EFAA 4I6TA 1Y7YA 3GN5B 4JQDA 4FN3A 1CQTA 1DW9A 3H5TA 3DNVB 2XIUA 2IV1A 4IA8A 1LCCA 2IU7A 2IVQA 2LYLA 3MLFA 1JFTA 3JXDL 1UXDA 3F6WA 2O49A 2EF8A 4Y42A 5K98B 2PUBA 3KXAA 4YBAA 2PE5A 1ZPQA 2XSDC 2CSFA 2OFYA 4X4GA 3BDNA 4X4FA 2XI8A 3KJXA 1PRAA 3FYAA 2BJCA 2KZ8A 3GN5A 2AWIA 1ZVVA 3RZZA 1JFSA 4X4DA 2JVLA 1R63A 1ZAYA 1R69A 2EBYA 1PRVA 1ZZ6A 1NEQA 3CECA 4GHJA 2LYRA 4F8DA 3OQNA 1LCDA 3OQMA 5A7LA 1UTXA 3PXPA 2WIUB 2IVGA 2O4AA 1LLIA 4I8TA 2BNNA 3S8QA 2IVBA 1QQBA 2WUSR 2KPJA 1SQ8A 2PUFA 1IC8A 3QF3A 4IVZA 3U3WA 4X4CA 2D5VA 1GT0C 3QYXA 4J1XA 1WH6A 3QQ6A 2AUWA 3OQOA 3LISA 3VK0A 2PUDA 2FJRA 3FMYA 3KZ3A 1VPWA 3IVPA 4Z59A 3L1PA 2AW6A 4FBIA 2LYKA 2XJ3A 2PPXA 3BS3A 4JCYA 3CROL 3JXBC 1ZZ9A 2R1JL 1RIOA 4Z5CA 2L8NA 3SCFA 2PUAA 1LQCA 1WH8A 4I6RA 4J1WA 1RZSA 1BDHA 1WIZA 4MCXA 2O38A 3ZHMA 4OB4A 3SCGA 1Y9QA 2LCVA 3F52A 1AU7A 4X4EA 2CROA 2ICTA 1ADRA 3F51A 2KEJA 2A6CA 2XCJA 1B0NA 2LYSA 3SCHA 3BD1A 1QQAA 1NERA 2EWTA 4PU4C 2B5AA 1ZS4A 4O8BA 1XWRA 2LYQA 3UFDA 1OSLA 1BDIA 3OP9A 1POUA 3LFPA 2L49A 3TRBA 4X4BA 2GZUA 2ICPA 1ZUGA 1ZZBA 3D1NI 1E3OC 3JXCL 1ZZ8A 2AXZA 4JCXA 2R63A 1UXCA 3HZIB 4PU3C 3R1FA 2PUCA 1RZRD 2HINA 3ZKCA 1JWLA 3FYMA 1QP0A 2PUGA 1JH9A 3O9XA 2GRMA 3G5GA 1LMB3 2H8RA 1QP4A 1CJGA 2KEKA 2AXUA 4YG7B 4PU8A 4IWRA 4PU7A 3B7HA 4Z5HA 1PNRA 1WETA 2MEZA 3ZHIA 2BNOA 3CLCA 4GQMA 4NDWA 1YSEA 4YG1A 2PUEA 1OCTC 1DWKA 1RZRA 1O4XA 4X4HA 1X57A 1ZZ7A 2JCGA 2BNMA 2LYPA 2HSGA 2KEIA 2PIJA 1S7EA 4YARA 3QWGA 1PERL 2GRLA 4X4IA 4MCTA 4Z5DA 3OMTA 3GBFA 2OR1L 2AXVA 2MQKA 3G7DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PRU A;  2IUO A;  4YG4 A;  3EUS A;  1L1M A;  1ZZC A;  2LYJ A;  4Z58 A;  1X2L A;  1QP7 A;  4I6U A;  1HF0 A;  1RPE L;  1QPZ A;  1EFA A;  4I6T A;  1Y7Y A;  3GN5 B;  4JQD A;  4FN3 A;  1CQT A;  1DW9 A;  3H5T A;  3DNV B;  2XIU A;  2IV1 A;  4IA8 A;  1LCC A;  2IU7 A;  2IVQ A;  2LYL A;  3MLF A;  1JFT A;  3JXD L;  1UXD A;  3F6W A;  2O49 A;  2EF8 A;  4Y42 A;  5K98 B;  2PUB A;  3KXA A;  4YBA A;  2PE5 A;  1ZPQ A;  2XSD C;  2CSF A;  2OFY A;  4X4G A;  3BDN A;  4X4F A;  2XI8 A;  3KJX A;  1PRA A;  3FYA A;  2BJC A;  2KZ8 A;  3GN5 A;  2AWI A;  1ZVV A;  3RZZ A;  1JFS A;  4X4D A;  2JVL A;  1R63 A;  1ZAY A;  1R69 A;  2EBY A;  1PRV A;  1ZZ6 A;  1NEQ A;  3CEC A;  4GHJ A;  2LYR A;  4F8D A;  3OQN A;  1LCD A;  3OQM A;  5A7L A;  1UTX A;  3PXP A;  2WIU B;  2IVG A;  2O4A A;  1LLI A;  4I8T A;  2BNN A;  3S8Q A;  2IVB A;  1QQB A;  2WUS R;  2KPJ A;  1SQ8 A;  2PUF A;  1IC8 A;  3QF3 A;  4IVZ A;  3U3W A;  4X4C A;  2D5V A;  1GT0 C;  3QYX A;  4J1X A;  1WH6 A;  3QQ6 A;  2AUW A;  3OQO A;  3LIS A;  3VK0 A;  2PUD A;  2FJR A;  3FMY A;  3KZ3 A;  1VPW A;  3IVP A;  4Z59 A;  3L1P A;  2AW6 A;  4FBI A;  2LYK A;  2XJ3 A;  2PPX A;  3BS3 A;  4JCY A;  3CRO L;  3JXB C;  1ZZ9 A;  2R1J L;  1RIO A;  4Z5C A;  2L8N A;  3SCF A;  2PUA A;  1LQC A;  1WH8 A;  4I6R A;  4J1W A;  1RZS A;  1BDH A;  1WIZ A;  4MCX A;  2O38 A;  3ZHM A;  4OB4 A;  3SCG A;  1Y9Q A;  2LCV A;  3F52 A;  1AU7 A;  4X4E A;  2CRO A;  2ICT A;  1ADR A;  3F51 A;  2KEJ A;  2A6C A;  2XCJ A;  1B0N A;  2LYS A;  3SCH A;  3BD1 A;  1QQA A;  1NER A;  2EWT A;  4PU4 C;  2B5A A;  1ZS4 A;  4O8B A;  1XWR A;  2LYQ A;  3UFD A;  1OSL A;  1BDI A;  3OP9 A;  1POU A;  3LFP A;  2L49 A;  3TRB A;  4X4B A;  2GZU A;  2ICP A;  1ZUG A;  1ZZB A;  3D1N I;  1E3O C;  3JXC L;  1ZZ8 A;  2AXZ A;  4JCX A;  2R63 A;  1UXC A;  3HZI B;  4PU3 C;  3R1F A;  2PUC A;  1RZR D;  2HIN A;  3ZKC A;  1JWL A;  3FYM A;  1QP0 A;  2PUG A;  1JH9 A;  3O9X A;  2GRM A;  3G5G A;  1LMB 3;  2H8R A;  1QP4 A;  1CJG A;  2KEK A;  2AXU A;  4YG7 B;  4PU8 A;  4IWR A;  4PU7 A;  3B7H A;  4Z5H A;  1PNR A;  1WET A;  2MEZ A;  3ZHI A;  2BNO A;  3CLC A;  4GQM A;  4NDW A;  1YSE A;  4YG1 A;  2PUE A;  1OCT C;  1DWK A;  1RZR A;  1O4X A;  4X4H A;  1X57 A;  1ZZ7 A;  2JCG A;  2BNM A;  2LYP A;  2HSG A;  2KEI A;  2PIJ A;  1S7E A;  4YAR A;  3QWG A;  1PER L;  2GRL A;  4X4I A;  4MCT A;  4Z5D A;  3OMT A;  3GBF A;  2OR1 L;  2AXV A;  2MQK A;  3G7D A; 
#chains in the Genus database with same CATH topology
 3EUS A;  4I6U A;  2PXB A;  1EFA A;  5DTQ A;  4JQD A;  4IA8 A;  4DE8 A;  2JQE A;  2EF8 A;  2PE5 A;  2HCS A;  2XSD C;  4X4F A;  1PRA A;  1JFS A;  1R63 A;  2EBY A;  1PRV A;  1NEQ A;  4F8D A;  2LYR A;  1LCD A;  3OQM A;  4ER0 A;  2BNN A;  1SQ8 A;  1IC8 A;  4IVZ A;  4X4C A;  1GT0 C;  3QYX A;  1WH6 A;  3QQ6 A;  2PXV A;  3VK0 A;  3FMY A;  3IVP A;  2HFZ A;  3BS3 A;  3JXB C;  2R1J L;  2PXL A;  1RIO A;  1WH8 A;  4J1W A;  1BDH A;  3MEJ A;  1AU7 A;  4X4E A;  2CRO A;  2A6C A;  2XCJ A;  1B0N A;  3BD1 A;  4Q2J A;  2PXT A;  1BDI A;  3TRB A;  3GZD A;  4ER7 A;  3M9L A;  1JWL A;  1QP0 A;  2PUG A;  2GRM A;  1QZX A;  1CJG A;  3ME5 A;  3NXH A;  4PU8 A;  4PU7 A;  3GZD C;  4EK9 A;  4ER6 A;  1O4X A;  1X57 A;  2JCG A;  2HSG A;  4X4I A;  4Z5D A;  4FBI A;  3QFI A;  2IUO A;  4YG4 A;  3VWS A;  2LYJ A;  1HF0 A;  1QPZ A;  2PXQ A;  1DUL A;  1Y7Y A;  3H5T A;  1LCC A;  2O49 A;  4Y42 A;  5K98 B;  2PUB A;  2CSF A;  5DSX A;  3TEP A;  3KJX A;  2LLW A;  2KZ8 A;  1ZVV A;  2AWI A;  4X4D A;  2JVL A;  2V3C C;  1R69 A;  4GHJ A;  2O4A A;  1LLI A;  3S8Q A;  2IVB A;  1QQB A;  2PXP A;  3QF3 A;  4ER3 A;  2AUW A;  3LIS A;  1VPW A;  3L1P A;  2LYK A;  2PPX A;  1ZZ9 A;  4OBM A;  4Z5C A;  3SCF A;  2PXE A;  2PUA A;  4I6R A;  4OB4 A;  3SCG A;  5GAH i;  2LCV A;  1ADR A;  2ICT A;  3F51 A;  2ODR D;  3SCH A;  1QQA A;  4O8B A;  2LYQ A;  1POU A;  2GZU A;  2ICP A;  2M4H A;  1E3O C;  1ZZ8 A;  2AXZ A;  2R63 A;  3HZI B;  4PU3 C;  3ZKC A;  1JH9 A;  1LMB 3;  2H8R A;  2LLV A;  4Z5H A;  3ZHI A;  2BNO A;  4NDW A;  2PUE A;  1DWK A;  1RZR A;  4X4H A;  3PE5 A;  3QOW A;  2BNM A;  1QB2 A;  4YAR A;  2OR1 L;  3G7D A;  3SX0 A;  2YBD A;  1RPE L;  4I6T A;  4FN3 A;  1CQT A;  2PXD A;  1DW9 A;  3SR4 A;  4HRA A;  3DNV B;  2IV1 A;  2XXP A;  2IU7 A;  2IVQ A;  2LYL A;  1JFT A;  1HQ1 A;  1UXD A;  3KXA A;  2FFH A;  4X4G A;  2XI8 A;  3FYA A;  3CEC A;  5DTR A;  3OQN A;  1UTX A;  2MXD A;  1MFQ C;  2WIU B;  2IVG A;  4I8T A;  4EZI A;  2PUF A;  3NZL A;  3U3W A;  4EQZ A;  2PXF A;  4EKI A;  2L1P A;  3OQO A;  2PUD A;  5DRY A;  2FJR A;  3KZ3 A;  4Z59 A;  3KL4 A;  2AW6 A;  2XJ3 A;  2PXK A;  4JCY A;  3CRO L;  3ZPX A;  3R09 A;  1WIZ A;  2HCN A;  2O38 A;  2XXQ A;  2LNM A;  4WVL A;  4ER5 A;  1NER A;  2B5A A;  1OSL A;  3OP9 A;  4EKG A;  4X4B A;  1ZUG A;  1ZZB A;  3JXC L;  4JCX A;  5DT2 A;  1UXC A;  3R1F A;  2HIN A;  3FYM A;  3OKZ A;  3G5G A;  5DTM A;  2J7U A;  1QP4 A;  2VEO A;  2KEK A;  3TFL A;  4YG7 B;  1PNR A;  1WET A;  3QOX A;  3CLC A;  1YSE A;  1OCT C;  3GUU A;  1ZZ7 A;  3A9Z A;  2LYP A;  1S7E A;  1PER L;  5DRT A;  4MCT A;  3OMT A;  2AXV A;  1PRU A;  1L1M A;  3UWP A;  1ZZC A;  4Z58 A;  1X2L A;  3NRO A;  1QP7 A;  3GN5 B;  3OWQ A;  2XIU A;  3TEL A;  3MLF A;  5JUW A;  3JXD L;  3F6W A;  4YBA A;  4DE9 A;  3LQX A;  1ZPQ A;  2OFY A;  3BDN A;  5GAG i;  3A9Y A;  2BJC A;  3GN5 A;  3RZZ A;  1ZAY A;  1ZZ6 A;  3G0T A;  1NW3 A;  5A7L A;  3PXP A;  3A9X A;  2WUS R;  2KPJ A;  2D5V A;  4J1X A;  3DM5 A;  3GZC A;  2L8N A;  1LQC A;  1RZS A;  4MCX A;  3ZHM A;  2XXA A;  1Y9Q A;  3F52 A;  2KEJ A;  2LYS A;  2EWT A;  4PU4 C;  1ZS4 A;  1XWR A;  3UFD A;  3LFP A;  2L49 A;  3D1N I;  2PUC A;  1RZR D;  3O9X A;  2J7W A;  2AXU A;  4IWR A;  3B7H A;  3NDB B;  2PXU A;  2MEZ A;  4GQM A;  4YG1 A;  1U2Z A;  2KEI A;  2PIJ A;  3QWG A;  2GRL A;  3GBF A;  2MQK A; 
#chains in the Genus database with same CATH homology
 1PRU A;  2IUO A;  4YG4 A;  3EUS A;  1L1M A;  1ZZC A;  2LYJ A;  4Z58 A;  1X2L A;  1QP7 A;  4I6U A;  1HF0 A;  1RPE L;  1QPZ A;  1EFA A;  4I6T A;  1Y7Y A;  3GN5 B;  4JQD A;  4FN3 A;  1CQT A;  1DW9 A;  3H5T A;  3DNV B;  2XIU A;  2IV1 A;  4IA8 A;  1LCC A;  2IU7 A;  2IVQ A;  2LYL A;  3MLF A;  1JFT A;  3JXD L;  1UXD A;  3F6W A;  2O49 A;  2EF8 A;  4Y42 A;  5K98 B;  2PUB A;  3KXA A;  4YBA A;  2PE5 A;  1ZPQ A;  2XSD C;  2CSF A;  2OFY A;  4X4G A;  3BDN A;  4X4F A;  2XI8 A;  3KJX A;  1PRA A;  3FYA A;  2BJC A;  2KZ8 A;  3GN5 A;  2AWI A;  1ZVV A;  3RZZ A;  1JFS A;  4X4D A;  2JVL A;  1R63 A;  1ZAY A;  1R69 A;  2EBY A;  1PRV A;  1ZZ6 A;  1NEQ A;  3CEC A;  4GHJ A;  2LYR A;  4F8D A;  3OQN A;  1LCD A;  3OQM A;  5A7L A;  1UTX A;  3PXP A;  2WIU B;  2IVG A;  2O4A A;  1LLI A;  4I8T A;  2BNN A;  3S8Q A;  2IVB A;  1QQB A;  2WUS R;  2KPJ A;  1SQ8 A;  2PUF A;  1IC8 A;  3QF3 A;  4IVZ A;  3U3W A;  4X4C A;  2D5V A;  1GT0 C;  3QYX A;  4J1X A;  1WH6 A;  3QQ6 A;  2AUW A;  3OQO A;  3LIS A;  3VK0 A;  2PUD A;  2FJR A;  3FMY A;  3KZ3 A;  1VPW A;  3IVP A;  4Z59 A;  3L1P A;  2AW6 A;  4FBI A;  2LYK A;  2XJ3 A;  2PPX A;  3BS3 A;  4JCY A;  3CRO L;  3JXB C;  1ZZ9 A;  2R1J L;  1RIO A;  4Z5C A;  2L8N A;  3SCF A;  2PUA A;  1LQC A;  1WH8 A;  4I6R A;  4J1W A;  1RZS A;  1BDH A;  1WIZ A;  4MCX A;  2O38 A;  3ZHM A;  4OB4 A;  3SCG A;  1Y9Q A;  2LCV A;  3F52 A;  1AU7 A;  4X4E A;  2CRO A;  2ICT A;  1ADR A;  3F51 A;  2KEJ A;  2A6C A;  2XCJ A;  1B0N A;  2LYS A;  3SCH A;  3BD1 A;  1QQA A;  1NER A;  2EWT A;  4PU4 C;  2B5A A;  1ZS4 A;  4O8B A;  1XWR A;  2LYQ A;  3UFD A;  1OSL A;  1BDI A;  3OP9 A;  1POU A;  3LFP A;  2L49 A;  3TRB A;  4X4B A;  2GZU A;  2ICP A;  1ZUG A;  1ZZB A;  3D1N I;  1E3O C;  3JXC L;  1ZZ8 A;  2AXZ A;  4JCX A;  2R63 A;  1UXC A;  3HZI B;  4PU3 C;  3R1F A;  2PUC A;  1RZR D;  2HIN A;  3ZKC A;  1JWL A;  3FYM A;  1QP0 A;  2PUG A;  1JH9 A;  3O9X A;  2GRM A;  3G5G A;  1LMB 3;  2H8R A;  1QP4 A;  1CJG A;  2KEK A;  2AXU A;  4YG7 B;  4PU8 A;  4IWR A;  4PU7 A;  3B7H A;  4Z5H A;  1PNR A;  1WET A;  2MEZ A;  3ZHI A;  2BNO A;  3CLC A;  4GQM A;  4NDW A;  1YSE A;  4YG1 A;  2PUE A;  1OCT C;  1DWK A;  1RZR A;  1O4X A;  4X4H A;  1X57 A;  1ZZ7 A;  2JCG A;  2BNM A;  2LYP A;  2HSG A;  2KEI A;  2PIJ A;  1S7E A;  4YAR A;  3QWG A;  1PER L;  2GRL A;  4X4I A;  4MCT A;  4Z5D A;  3OMT A;  3GBF A;  2OR1 L;  2AXV A;  2MQK A;  3G7D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...