4I76A

Crystal structure of transcriptional regulator tm1030 with octanol
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
198
structure length
198
Chain Sequence
b'SKRDAILKAAVEVFGKKGYDRATTDEIAEKAGVAKGLIFHYFKNKEELYYQAYMSVTEKLQKEFENFLMKNRNRDIFDFMERWIEKKLEYSASHPEEADFLITLVSVDEGLRKRILLDLEKSQRVFFDFVREKLKDLDLAEDVTEEIALKFLMWFFSGFEEVYLRTYQGKPELLKRDMNTLVEEVKVMLRILKKGMTK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, TetR family
publication title Crystal structure of transcriptional regulator TM1030 with octanol
rcsb
source organism Thermotoga maritima msb8
molecule tags Transcription regulator
total genus 77
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4i76A01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 4i76A02
4AUXA 3GTJJ 4C3IJ 3CJDA 2QIBA 2ID6A 2VPRA 1TWCJ 2GM4A 4BXXJ 1U9NA 1FEXA 3MN2A 3HOYJ 5J1YA 2YS9A 4JX6A 3BR6A 3Q0WA 4CYCA 4IHVA 5JLXA 3BQZA 2CJJA 2DA6A 5K7HA 3VP5A 2LKXA 2CUEA 4IEJA 3GTLJ 4JL3A 3JREA 3CQZJ 2WV1A 1G2HA 1UI6A 2EZHA 3VW1A 2LD5A 4CYCB 2Y30A 3VOXA 3HB9A 2JJ7A 2XB0X 3G56A 5FJ8J 4RDUA 1MSFC 1U9OA 1H8AC 3VW2A 4MLOA 1MBEA 2JA7J 2E19A 3MVPA 3VUQA 3BTLA 2Y0SN 3W6VA 2X6OA 2VKVA 2HDDA 4FE7A 3ON2A 3Q3SA 3E7LA 2YU9J 2YVHA 3JRDA 3UKGA 1ENHA 3E7QA 3O60A 1JT6A 1IDYA 1DU0A 1BJZA 1QPIA 2HQ5A 2HYJA 1BW5A 2YVEA 3ON4A 4IHWA 2EZIA 1K61A 3NI7A 5F04A 3HOWJ 3ZOBA 3HTAA 4IHXA 2ECCA 2GENA 2DA7A 4MFDA 1GVDA 5EZHA 5FKKA 4W1UA 5DS9A 2R92J 1JGGA 2R5ZA 1BA5A 5C44J 2NVXJ 5CXIA 5F0FA 1I6HJ 5FLMJ 1POGA 5HBUA 2DG8A 2RASA 4LOCA 4C3HJ 3GTOJ 1ITYA 2COBA 5IOYA 2W53A 1B8IA 4QSHA 2QOPA 2E1OA 2Y9ZA 2ZCMA 1ZR2A 9ANTA 1LFBA 4M3GA 3CCYA 1ETYA 2R5ZB 2L9RA 3QPLA 4MK6A 3VW0A 4FTHA 3D1NI 1ORKA 3ZQIA 1MBFA 3Q0UA 1B8IB 4UUSA 2GLOA 1WH7A 3LSGA 2B63J 3IH4A 2R93J 4C3JJ 5M3FJ 1SANA 4MFEA 3KNWA 2L7ZA 4I76A 1T33A 4A3GJ 1TC3C 2QWTA 4UUSB 5F1JA 1HDDC 3VPRA 2V57A 4AC6A 2GBYA 1Z0XA 3HM5A 3DEWA 3NNRA 1IRZA 1LE8A 2IU5A 5EDNA 5EG0A 3M3YJ 2JMWA 4X6AJ 3HOXJ 1QVTA 2RHAA 1MBJA 2Y31A 2ZOYA 3HIMA 5F0HA 3BCGA 4KWAA 2NOGA 1JKOC 2NVYJ 1AU7A 2JN6A 1APLC 1H88C 4GCTA 1JKPC 5EG0B 2H1KA 2G3BA 2NP3A 4NELA 2R0QC 3VVXA 3BR3A 5K7FA 3FRQA 3RQIA 2RAEA 1MBGA 2DN0A 3FKIJ 3BR2A 5BNGA 2F07A 2ELKA 4ME9A 2E2HJ 1GV2A 2VUMJ 1IDZA 4S0HB 2G7LA 2XPVA 5D1RA 4C2MJ 1MSEC 3SDGA 3EUPA 3G7RA 3NARA 4BY7J 4A69C 2DA2A 3ZQLA 3ANGA 4AYBN 1GT0C 3BNIA 3PO3J 1FTZA 2LFBA 5HODA 1P7JA 3JRCA 4L62A 4FISA 3O8GA 5C3EJ 3FK6A 2JWTA 4HKUA 1X2MA 1TWFJ 3OIOA 5FHPA 4Y7NJ 2OPTA 4EEFG 3C07A 3DCFA 2VKEA 3ZQHA 2ZOZA 1WCMJ 5IYCJ 4BBSJ 2LP0A 3ZQFA 1WH5A 4GFLA 2XPUA 2XRLA 4BKXA 3NPIA 5IOZA 1HOMA 2M9HA 3S2DJ 2ME6A 3S1QJ 3AQTA 3K2AA 3COLA 2G0EA 2UXOA 3VVYA 5C4JJ 4DYCA 1DU6A 4GFBA 1RKTA 3BR0A 3GBGA 3TW6A 2UXHA 1H89C 3HOUJ 2JK3A 3TEDA 1R9TJ 1Q1VA 3IV5A 1NTCA 5IYBJ 1ETWA 1WI3A 4JNNA 1JKQC 1JJ6C 3OOUA 3ZQCA 4MO7A 1W0TA 5K58A 3BJBA 2UXIA 2LLKA 3PO2J 1UG2A 5M5YJ 2OI8A 2CU7A 5C4XJ 1TWAJ 1A6IA 4J19A 3GTQJ 2KT0A 5K7ZA 3L1PA 2DMQA 5FKMA 4A3BJ 2HYTA 3LJLA 2O7TA 2ZB9A 3S2HJ 5CXGA 2NS8A 2M8GX 3GTKJ 3H3VK 2IAIA 3G1LA 1ZR4A 2E2JJ 1NK2P 1ETOA 2DG7A 2H8RA 5JLWA 2ZCNA 1ZQ3P 1ZKGA 2EBIA 3KKDA 3JSJA 2DMPA 4IHYA 1IUFA 1ETXA 2L0KA 3S1NJ 3FISA 1UMQA 2K9NA 5CW8A 1OCTC 3G1OA 3S1RJ 3O8HA 3S14J 3OSFA 2D5VA 2QF7A 4V2GA 3HDDA 2EZLA 3LHQA 1RESA 1MNMC 5M5XJ 2GUHA 5J1RA 2K9QA 4NN1A 2FX0A 3CWRA 3LSPA 2CQXA 3BTIA 2JA6J 2HOAA 1CQTA 1P7IA 4UUTA 4DZJA 4A3LJ 4XK4A 1Y1VJ 3RZDJ 4Y52J 1JUPA 2HI3A 1IJWC 1ETVA 2PBXA 2X9DA 4G12A 3F1BA 3H0GJ 1BW6A 2X48A 5IP7J 3HTIA 2LVSA 3VVZA 2LY9A 2NX4A 1MBKA 5FKNA 1TWGJ 5IP6A 2DMUA 2G7SA 4AC0A 5DTDA 4PXIA 3S17J 3DPJA 1EF4A 3JRFA 4AF5A 3S15J 4A3EJ 2DA5A 1ETQA 3V78A 5FKLA 4XRSG 3PM1A 3WHBA 3QQAA 1F43A 3GTGJ 2JA8J 2FBQA 2L7MP 3K7AJ 1RKWA 2FD5A 3MKLA 2Q24A 2G7GA 5IPAA 2UXUA 1Z77A 1WGXA 1OJLA 3LNQA 3HOVJ 5DAJA 3BG5A 3FK7A 4DYQA 2O8KA 3AQSA 2XDNA 3BR5A 3S5RA 3TW7A 5FKOA 4DW6A 4L5EA 1FIPA 2VI6A 4A3IJ 3VIBA 4UDSA 4M3DA 2XSDC 5F0CA 2TRTA 4ICHA 2Y9YA 5M5WJ 1W0UA 4JX4A 4M3EA 2HXOA 2MSYA 5F27A 3JR9A 4FE4A 3HGGA 2TCTA 3BHQA 2I10A 3TP0A 1A5JA 1GDTA 2L7FP 1AKHA 5EZGA 2AO9A 3OSGA 1UHSA 2KDZA 1PUFA 1S7EA 1F36A 2WUIA 2WGBA 1JTXA 2EH3A 1AKHB 1X58A 2NVTJ 4XRMA 5EEAA 3CDLA 1IG7A 4CGRA 1JTYA 1LFUP 3B6CA 1PUFB 4MIMA 4A93J 2HOTA 2NP5A 4D5CA 1IC8A 3JRBA 2QKOA 3PPBA 4B1RA 4NDLA 4RBOA 3EGQA 2FJ1A 2OERA 2XGDA 3WHCA 3KKCA 1NK3P 4A3FJ 2QCOA 2WB1N 2ME0A 4M6VA 2WAQN 3NXCA 5EGOA 2GFNA 2M0CA 2JA5J 1FTTA 1VI0A 4XIDA 1U78A 3GZIA 2EZKA 2MGQA 2HXIA 3HBLA 3QKXA 5D19A 1JUSA 1FIAA 3PASA 1YRNA 1HDPA 2CQQA 4JYKA 5EGOB 1B72A 3TP3A 5HAWA 3A01A 5EYRA 3BT9A 1XG1A 2FQ4A 1HF0A 5AQCA 5IP9J 3SJMA 2PZ9A 2P81A 2IEKA 1OCPA 3FIWA 4GCLA 4DYRA 1YRNB 4JKZA 3RD3A 1I3QJ 1B72B 1WPKA 3I4MJ 1VF9A 3A01B 5J3LA 5IYDJ 2NVQJ 1OFCX 2DMTA 2OF7A 1MBHA 3LSJA 3ANPA 3P9TA 5HSZA 1GUUA 1UI5A 4BBRJ 3T6NA 2K9SA 4M3FA 3V6GA 3VOKA 5J1UA 2K40A 3QPSA 4D7NA 4D7MA 3NAUA 5F08A 5GP9A 3MNLA 3RH2A 1MH4A 2XGCA 4MXMA 2NS7A 2EQRA 3A03A 5C4YA 2PMZN 3HTHA 2ID3A 2XB5A 3IUVA 4GCKA 4JX5A 4XRSA 1AHDP 1ETKA 2W48A 1QVUA 4A3JJ 2E2IJ 1FJLA 3HGYA 3HEFA 5EF6A 4I6ZA 3LWJA 2HOSA 3I4NJ 1HCRA 2DJNA 4DZPA 4YZEA 2LR8A 1JJ8C 4V2FA 1Y1WJ 2UXPA 1SGMA 2DA1A 3M4OJ 2QTQA 1JUMA 2MW8A 2O9LA 5FGLA 1T56A 3KZ9A 2AHQA 2D6YA 3B6AA 5E3LA 2N8GA 2ZCXA 1GV5A 5E3OA 3LSRA 2R7ZJ 5GPAA 1RETA 1MH3A 2DMNA 4FCYA 1I50J 5GPCA 5EFYA 2CUFA 2R5YA 4A3KJ 3Q0VA 3B81A 1O4XA 2HKUA 3RKQA 4ABZA 4A3MJ 3JRHA 3F0CA 3NRGA 3JRGA 1K83J 2MG4A 3HTJA 2R5YB 1U8BA 3HOZJ 2REKA 3CRJA 2CRGA 1SFOJ 3RZOJ 1QRYA 3S1MJ 1ZK8A 1JT0A 1IGNA 3CMYA 5FLVA 4B3AA 4M3BA 3SFIA 4W97A 3GTPJ 1E3OC 4HNVA 5D18A 1VNDA 2ECBA 4A3DJ 4ACIA 1HLVA 3IH3A 2IBDA 3LOCA 4JP0A 4B4CA 2DA4A 1XS9A 2O7OA 4GFKA 4BY1J 1BL0A 3BRUA 3GTMJ 3HE0A 3BTCA 3A02A 3JRAA 1D5YA 4XICA 3JRIA 3IH2A 3S16J 1LE8B 1RR7A 3QBMA 1TWHJ 3HKZN 1IV6A 2LTPA 2DTZA 5E3NA 1VFCA 4X1EA 3BG3A 4QTRA 3C2BA 5M3MJ 1ZGWA 4A3CJ 3BG9A 1ZTRA 1XC5A 2XGEA 4D5FA 2DA3A 2YUSA 3BR1A 5E3MA 3GEUA 2Y2ZA 2M2EA 2LK2A 5FMPA 3BTJA 3G1MA 3ZQGA 1RPWA 3BQYA 1JKRC 5H9TA 2M34A 2XPWA 1X2NA 4QIWN
chains in the Genus database with same CATH superfamily
3VODA 4BAYA 2PI0A 2GOXB 3MWMA 2H1LA 2VPRA 3RI4A 1IXSB 3DKXA 3HOYJ 4XN3A 4B8XA 2YS9A 4I01A 1UFMA 2TDXA 2KIQA 3K6GA 1GXQA 1FYMA 1TW2A 3PIPF 1VQLI 2E1CA 3F8NA 2QGUA 4G8XA 2DXIA 1WVRA 4ITVA 3PFYA 2HZTA 1YE9A 4C2UA 5FJ8J 4LG0A 1U9OA 3I54A 3MFKA 2EB7A 2JA7J 4U87A 2OTLI 3VUQA 2V79A 2Y0SN 3AAFA 4MEYF 1O7FA 3RPUA 3CMEI 4EM2A 4LG0B 2DU9A 3IKVA 4BE0A 3E7LA 1ZHFA 4FX4A 2Q0OA 2QUFA 1LB2A 2P0WA 1NG7A 2OV7A 3O60A 3R0JA 1EJ9A 4DBQA 4LG3A 1DU0A 2QENA 2VASA 1Z7LA 1YLFA 2A2FX 2HQ5A 2E1NA 1BW5A 1DGRM 4XSZF 2DO7A 4C2TA 2EZIA 1ZRDA 3NI7A 3LQQA 5F04A 1K4TA 3HOWJ 5D5WB 3BPXA 3ZOBA 5KAFC 1U8RA 4MFDA 5FKKA 5DS9A 2HQNA 2FU4A 3UR3C 1JGGA 2R5ZA 1V54H 4A6EA 2J5OA 2XVCA 4PSXA 5FLMJ 3CCVI 1POGA 4V19K 1HKTA 1Z6RA 3GTOJ 4KMFA 4I0AA 2Y9ZA 2O03A 1VQ4I 1FC3A 2ZCMA 2CQNA 2PMHA 1HSTA 9ANTA 5KNLA 4KMUX 3T8TA 1TQPA 3A4CA 2R5ZB 3QPLA 1E3PA 3E5UA 3D1NI 4GCVA 4EJUA 5FRNA 2GLOA 1WH7A 4RAGA 4G9YA 3J80Z 3KP5A 3OV8A 1D0YA 3BLYA 4C3JJ 4ENMA 5M3FJ 1SANA 5HNHA 3EPZA 4UV8A 1QZYA 3KNWA 4D0PA 2ACJA 2M87A 1T6SA 1HDDC 1SVMA 3OYEA 5K5OA 2XAHA 2Q2EA 4ASNA 1G3YA 2I5UA 1IRZA 1LE8A 3OS0A 3M3YJ 4F7ZA 1MGTA 3HOXJ 1QHHD 2BZTA 4RAZA 2ZOYA 3HIMA 2EILH 2Q2EB 1FOKA 3CDHA 4YFKF 2NOGA 1MKMA 4F93B 2CWEA 1JKPC 2HDCA 2G3BA 4NHJA 4NELA 2VJJA 3BR3A 3FRQA 3VOEA 3RQIA 5BNGA 3KYDB 2F07A 2PN6A 2E2HJ 1GV2A 1XMKA 3DP7A 2VUMJ 4S0HB 4BS9A 2G7LA 5LHHA 1D1CA 1Z3YA 5D1RA 4M6XA 4ESFA 4RAFA 3M9AA 2MA3A 3EUPA 4BY7J 2DODA 1SD4A 3ANGA 4AYBN 3DLLF 4LIUA 3T5XA 2KISA 4M9ZA 1OCOH 1P7JA 3KLNA 5DCFA 4Q5SF 1ONVA 5C3EJ 2JWTA 1XGMA 1TWFJ 1WQ2A 3C07A 4DIQA 2XGXA 1KYWA 2MBFA 4UB6C 3GCMA 1V5GA 3WE3A 3ZQHA 4BNCA 4GDFA 1X3ZB 2LP0A 2PG4A 1WH5A 2Q1ZB 2V9VA 4BBSJ 4BJ5C 4BKXA 3H9GA 2M9HA 3S2DJ 3S1QJ 5TGTA 1QNTA 3QPTA 5CVUA 2UXOA 3VVYA 4KICA 2UXHA 3BR0A 3GBGA 3TW6A 3BY6A 3A0HC 2JK3A 2O6GE 4XM3A 1D5VA 3DTEA 4O3MA 1ETWA 2M7AA 4BQNA 4XLNF 1W0TA 4LB5A 3BJBA 3ABTA 2RNGA 2LLKA 2DFIA 3PO2J 2GIZA 2DQLA 2DOFA 4DJAA 4F3QA 3NS4A 4J19A 3GTQJ 5DUKA 3JTGA 1R1UA 1UB9A 3L1PA 3GFIA 5DD4A 5FKMA 4LLLA 1PYVA 3LA2A 1QA6A 1OLTA 3FXMA 5CXGA 2OJED 2NS8A 2GWRA 3H3VK 2H09A 3OYJA 3ZPLA 1R49A 1FWZA 1ETOA 2XASA 1RUNA 2QSFX 5JLWA 2EPFA 1EA3A 3B02A 2BHZA 3S1NJ 3FISA 4PSWA 2K9NA 5CW8A 4UHTA 4CICA 3WTXC 2JSCA 2W7NA 3O8HA 3OSFA 2HTJA 2QF7A 2L9SA 4EM0B 2ZCWA 4NC8A 4XLHA 2BVMA 1FSEA 1IW7F 2LMDA 1B9NA 4UNOA 3OYGA 3HSRA 4NN1A 5F6FA 3DBLB 3F8CA 3CWRA 4OD5A 1Z7UA 2VT3A 1FT9A 2F5FA 3VSLA 1BOAA 2PQ8A 3M8JA 4A3LJ 1Y1VJ 3RZDJ 3VTIA 2HI3A 5LEJA 2PBXA 4G12A 1BW6A 3H3UA 2VJ4A 1LVAA 2NX4A 2V9PA 2FJI1 1TWGJ 1X1DA 2DMUA 4AC0A 2XROA 5CQEA 4ZJZA 4PXIA 3DPJA 1FX7A 4Y3OA 1XSDA 2GZWA 1NHAA 3S15J 3V4GA 1Z21A 5CVJA 2OQGA 3ZMSA 1GHCA 2HOEA 3PM1A 1BC8C 4IRGA 4KDPA 1UZCA 3S8PA 3C1DA 4IQ4A 5J8FA 2O5RA 4EGZA 1E2XA 3AFHA 4HX4A 1Z77A 5JI6A 3FXQA 1STZA 4LK0F 3HOVJ 4U9NA 1PP8F 4EATA 2A07F 3ML6A 4MNUA 5FKOA 3TW7A 4DW6A 4L5EA 1TQMA 2VI6A 4EGYA 1BBYA 4M3DA 1QO0D 3MKZA 3K0LA 1S6LA 2CGPA 1KQ8A 4M3EA 2FEZA 4E70A 5L3EA 4BHBA 1FBQA 2M45A 2BV6A 2WAEA 3BPVA 3C2GA 5ILSA 3Q5FA 3GXOA 2TCTA 2F5DA 4E7ZA 3GYHX 1IRGA 4RA2A 3T8RA 4XR6A 3OSGA 4BQQA 4Q48A 3CC2I 1YW8A 3GFMA 4A0ZA 3JSPA 3N4MA 1JXSA 4GRIA 3G71I 2YR2A 3GO5A 4A12A 1R5HA 4NUBA 3E6BA 3HXLA 1RI7A 3ABLH 5L3DA 1WSUA 4XRMA 3CDLA 3WU2C 4F91B 2XSJC 3FHZA 2NP5A 4JK1X 4IRIA 1IC8A 2MD5A 2XAJA 4HSRA 4NDLA 2OERA 3P9IA 1N25A 3FWEA 4XL9A 2Y48A 1T2KA 3KX2A 2IA0A 3LFUA 2CS3A 1NK3P 3W6JB 2EFNA 1TP4A 1USTA 2ME0A 4M6VA 1HSJA 2GFNA 2OTJI 2D1VA 3FF5A 3WODF 1FTTA 1OKRA 1D0ZA 3FMRA 4O6JA 1E0EA 4RLQA 3MQ0A 3GWZA 2LF8A 2MGQA 3FZVA 2DDBA 2DI3A 2LOOA 3LA3A 4IJAA 4NC6A 1OMIA 1JI8A 1FIAA 3O6BB 5EYRA 3FMQA 2KMUA 4KIFA 1B6AA 2CQKA 3CMMA 4CO8A 2FQ4A 1QZEA 5IP9J 3SJMA 3FBIB 2JA2A 3CC7I 4GCLA 4AD9A 2VJIA 1VQOI 3BCAA 5HS9A 5L3FA 4JKZA 3ABKH 1BJAA 4IVNA 2NVQJ 2BGCA 4WXDA 2DMTA 4QPOA 3AL0C 1MBHA 3ANPA 3P9TA 5HSZA 1GUUA 3VOKA 4M3FA 5DM7F 2K40A 2NYXA 3QPSA 4IZZA 2OZ6A 1YYVA 3BCBA 1R22A 2XGCA 4RM2A 2ADUA 1D1BA 4XORA 3S3OA 3HOSA 3IUVA 2X1EA 4OMZA 5H20A 4JX5A 1ETKA 4M6YA 4KIBA 1SAUA 3V7CA 3HRMA 3L2VA 2LY1A 4I6ZA 4WCGA 3PIOF 4ZYDA 2IGOA 3IRRA 2HOSA 2DJNA 1SMTA 3ZP5A 4YZEA 2LR8A 2QA4I 1AOYA 1Y1WJ 2UXPA 4XNFA 1T38A 3BDDA 4BE2A 1JUMA 2A68F 5ILVA 5HLTA 2O9LA 2M4KA 2CO5A 3CP8A 3DBHB 5FGLA 5KAIC 3I5UA 4OIOF 4PJ0C 3CUQC 4N9HA 2ZCXA 5D4SA 2UXNA 5GPAA 3OIQA 5GAGJ 1BM9A 4FCYA 4U0WA 4HV5A 1VQMI 3K70C 3CO6C 5EFYA 2CUFA 4A3KJ 3Q0VA 4XKWA 3ZMUA 3WGIA 2ISYA 3DTKA 3ELKA 1SMYF 2K85A 5CPRB 1TQIA 3SZGA 2IS2A 1O3QA 2G9WA 4G6TB 1P9QC 3PQKA 3OYBA 4XSXF 2REKA 3HZJA 3EYIA 1QRYA 2K5CA 2CV2A 1O3TA 3SFIA 3WGGA 2K7LA 1MW7A 4HNVA 2ECBA 4CZZA 4A3DJ 5BOXA 4BQOA 1ACIA 1HLVA 3BROA 3PNVA 1XS9A 3SEQA 2O7OA 4GO1A 1TZLA 3CJTB 3AG1H 3T0YA 3CCMI 2JTVA 1R23A 2B1EA 2VBZA 3HE0A 1FP1D 3JRAA 1YHQI 3S93A 3S16J 1RR7A 1ZG1A 3CD6I 3BZCA 1SFEA 3HKZN 4H0EA 2H27A 2DTZA 1J75A 2EFOA 1Z91A 4PJJA 2CQ7A 5IT9K 3H35A 4EJVA 5M3MJ 3ZN0A 1ZGWA 4A3CJ 1HC8A 3QU6A 2A69F 3K8PC 2XF7A 1W7PA 3DXJF 2L4MA 3BTJA 2LSOA 2OZUA 2DPDA 1RPWA 1EH7A 4WXHA 3ULQB 2IS6A 2VQHA 3CLOA 3VFZA 2I8DA 1ZYRF 5HLHA 4KISA 2VOPA 1NG6A 5LBQA 2ESHA 3DEUA 3U21A 1W7PB 5GTHC 1C0WA 4C3IJ 3HSEA 2QIBA 3QYEA 1TWCJ 4BXXJ 1U9NA 2PX9A 5J1YA 2X1CA 3P9KA 3BR6A 3W2WA 3WGHA 2F4IA 1PJRA 2DQRA 3BQZA 2DA6A 4JQFA 3VP5A 2LKXA 1JE8A 3CJNA 4IEJA 4JL3A 1XSVA 2LG4A 3NEUA 1YIJI 3EETA 3HJEA 4BXUA 1G2HA 2LKSA 5HNFA 3IKTA 2LD5A 3VOXA 4HOBA 2JPBA 5LGNA 1MSFC 2OCCH 4MLOA 2QWWA 1MBEA 3OL3A 4KT5C 2CH0A 2DCEA 3ECOA 4I99C 1J59A 3W6VA 3H5NA 4HPQA 4EMSA 4I09A 2HDDA 1QU3A 3D5RC 1X1PA 4BXFA 5GTIC 2X51A 2YVHA 2P4WA 3UKGA 3G3ZA 3JAMZ 1KU2A 4GXOA 2ELJA 4HQEA 3OYMA 4MQVA 2YVEA 1K61A 4CCMA 2HQAA 1KU3A 1B59A 2HFHA 4LLNA 3I64A 1SC7A 2L5QA 1XGOA 2XV4S 4B3XA 4XLPF 2P7CB 2GENA 5EZHA 2R7VA 4XLCA 1E17A 1D8KA 1FPQA 4Y13A 5CXIA 3L2WA 4IHSA 1VQ6I 2VODA 4HF0A 1TTYA 3MEXA 3WU1B 5IOYA 4QPQA 3BJOA 3WG7H 4QSHA 2CFOA 2CFXA 4ZYGA 4C30A 4FT8A 1OQYA 4ANJA 4S04A 3CCEI 2OCEA 2L9RA 3M8FA 4UV9A 4F52A 4FTHA 4Z2YA 1VQNI 1ORKA 3KFWX 2ZJQF 5FLXK 2H6CA 2LH9A 4UUSA 3FXKA 2B63J 2X85A 5FD5A 2CV0A 3MZ8A 3DPLC 1MNDA 4A0YA 3CP2A 2VE8A 3ZMZA 4RM3A 3KEYA 3DU6A 4UUSB 4L9VA 5KVRA 3VPRA 2V57A 2GBYA 3V7SA 4L9TA 4E7KA 1X3WB 2H6BA 3QOPA 2CSOA 2OUMA 3PL8A 2DT6A 1QVTA 3U2RA 1WJAA 2Y31A 5CVRA 3BCGA 4HF2A 2L02A 1AU7A 2JN6A 1APLC 1H88C 2JZYA 1Z6TA 1A04A 2H1KA 1SAXA 4M74A 2R0QC 2BW3A 1PDNC 1MBGA 2DN0A 2XRNA 3S2WA 3L7WA 4M73A 2FUG2 4WXCA 4ME9A 3HOTA 2XPVA 1RR8C 3IC7A 2K02A 3GUDA 3K70D 2BW3B 3NARA 4A69C 3FDYA 3WE2A 3ZQLA 1GT0C 3QYBA 2RC4A 4MGRA 2JSPA 3NWSA 2LFBA 1IN7A 3JRCA 3BG7A 3FK6A 1X2MA 1K6YA 2VN2A 2QQAA 1DP3A 4Y7NJ 2OPTA 3CCJI 4EEFG 2HNHA 2ZOZA 3I59A 1WWXA 4EM1A 3CCRI 1Y0UA 2CW8A 1IN5A 3QP5A 2XRLA 1IZ1A 1HOMA 4XKCA 2ME6A 2PMZA 3WTVC 3ZMTA 3COLA 3PJRA 2Y0MA 3I59B 4GFBA 1RKTA 1XGSA 3ZR8X 3LWFA 2WA0A 1ULYA 3HOUJ 4B48A 2XUBA 3TO7A 2STWA 1ZLKA 1NTCA 3L2UA 1MIJA 4JNNA 1Z9CA 1SFKA 1JKQC 4ZZDA 4N4OB 4DVYP 2LKPA 2R7DA 3ZQCA 4MO7A 1ZELA 5K58A 2A05A 2UXIA 3FXJA 3NRVA 1JGSA 2IJLA 1KYZA 2CU7A 2JVHA 2W1OA 5B66C 1YO5C 2QLZA 2DMQA 2OC6A 2FSWA 4IQJA 2VXDA 2E7WA 1ERDA 2ZB9A 2P6SA 4BACA 4OD4A 1U3EM 3GTKJ 2M8GX 1LDKB 3ONQA 3IP4B 3G1LA 4PCQA 5KHDA 4IKFA 1I27A 1P4WA 5LHIA 1ZR4A 2E2JJ 2QZ8A 1GVJA 2AXTC 2HPIA 2ZCNA 3LSKA 1ZKGA 2JVGA 4IHYA 5L3CA 5GAHJ 1AWCA 1RNLA 1TT5B 2F5VA 1A6QA 1AA7A 3N97A 5IY5H 1UMQA 3SYTA 3JAMK 1J2XA 4JBAA 4BDZA 2QKLB 3V8LA 4V2GA 2RDPA 2EZLA 4EQQA 1L3LA 1H0MA 3LHQA 1MNMC 1WJCA 5DEQA 3TBIA 3RSNA 2OA4A 1SEUA 2PMUA 3R0AA 3GLXA 4M72A 5FB2A 1REPC 4BDYA 2IGNA 3DWLE 2O8XA 3DF8A 4PJLA 3CLQA 3LSPA 1VQ7I 3BTIA 3ESWB 2HOAA 2V7FA 1ZG3A 4UUTA 1XTAA 1F1ZA 4XK4A 1I1GA 5HS7A 2KQRA 3EYYA 4KITB 1YITI 2LYCA 1ETVA 4QWQA 2RN7A 2W57A 2D1HA 1XMXA 4PK4A 4M9XA 5IP7J 3HTIA 1EV7A 3DEEA 4DNCA 3VVZA 3KE2A 5IP6A 2BY2A 3R6SA 3GZ6A 3H5RA 5BMZA 1XDUA 5DTDA 1RC9A 1X1CA 1EF4A 2HDWA 1IN6A 4IL6C 4UVCA 3L2CA 4AF5A 4L9NA 2QEXI 4DQ2A 5J4VA 1ETQA 5FKLA 3U9GA 3OYKA 3H92A 3QOEA 2L4AA 4BQAA 5BS6A 1KU9A 3K7AJ 2FD5A 3J7AO 1ZN2A 2DOEA 5IPAA 3ISPA 3I55I 2EIMH 4U0VA 4YG2F 1B9MA 2OD5A 1U2WA 3FK7A 2O8KA 3IUOA 3S5RA 2XDNA 4GYGA 2QSGX 2VONA 3HIFA 3OS2A 2IA2A 2ZXHA 2TRTA 1DUXC 3BP8A 1A35A 5M5WJ 2HXOA 2MSYA 5F27A 2M30A 2WADA 1IRFA 1HKQA 1I1SA 4XLFA 3GFJA 3EUHA 3HSFA 4P1WA 4U7DA 2FBKA 3ZQ7A 4FE4A 5D8LB 3BHQA 2X6XA 1IXRC 4BEHA 1TT0A 1GDTA 2DK8A 2L7FP 2FOWA 2R7FA 1AKHA 2AO9A 1XB4A 4HX8A 2W24A 1UHSA 1PUFA 1S7EA 1F36A 2WUIA 2WGBA 1XCVA 1JTXA 2A6EF 3LL7A 1V3FA 4BEHB 5HDGA 2HZDA 4RAYA 4ZYHA 1WI9A 1AKHB 1LJ9A 2VJ5A 2ZO4A 5EEAA 4CGRA 2H94A 1PUFB 3C7JA 3ZGKA 1X3UA 3H5AA 4D5CA 1XSXA 2FMYA 4HX7A 4B1RA 3LAPA 5ILUA 4Z6YA 1U5TA 4RGXA 3A0BC 3E5QA 4A3FJ 1VQ5I 3GLLA 2QCOA 5J8CA 2WAQN 5EGOA 3MCZA 1IUYA 2L54A 3DV8A 1U5TB 4P9UA 1VI0A 3NQOA 3OIPA 3I56I 2EZKA 3HBLA 2HXIA 2WWYA 3QKXA 5HLGA 1T0FC 2LBFA 3BZKA 1YRNA 2J5PA 4JYKA 5EGOB 1B72A 3K4KA 1FOWA 5HAWA 4C9YA 4UY8I 1MJ9A 1HF0A 1T95A 2PZ9A 2MLGA 2P81A 1OCPA 1G6NA 4ZH4F 3OYFA 2LBFB 2VQLA 1YRNB 1B72B 3I4MJ 3WTTC 3DU5A 4PJNA 3FM5A 5J40A 3L9FA 3V6GA 4B44A 5J1UA 1MMAA 3I71A 2Y75A 3MNLA 4D7MA 5GP9A 4I0BA 2P6TA 4E6KG 3NWTA 4L0ZB 2IW5A 5H6RA 5H6QA 1NH3A 3HTHA 2ID3A 1T08B 2MABA 2XB5A 3WTSC 1F5TA 4KJZA 2KRHA 2XAQA 3CCSI 2JUCA 2W48A 2E2IJ 1FJLA 3HEFA 4KN7X 5AIQA 1YG2A 1FBSA 4HBLA 3OOPA 3IL2A 1JJ8C 1EH6A 4XOPA 1BI3A 4V2FA 2D45A 1OCZH 1WJ5A 3R61A 2VC1A 2KKOA 3ERMA 3PSIA 1TW3A 3UNGC 4MQ9F 3H9JA 1FY7A 3KZ9A 2GA1A 4Y4RA 5LEKA 2D6YA 3B6AA 1BI1A 2IT0A 2ZMEA 1GV5A 2JRMA 3GMEA 2R7ZJ 2WC2A 2Z9OA 1WKMA 4NBQA 4PFOA 4RB2C 1MH3A 2DMNA 2WV0A 3DBRB 3K4NA 5E1WA 5GPCA 1GXPA 5JHFA 2DOAA 2DFFA 2ZMEB 3B81A 1O4XA 3RKQA 5LRRA 2DK5A 4ENNA 2PJPA 1R7JA 2O61A 1R4NB 3F0CA 2IGMA 3NRGA 3RDIA 3W2VA 3REOA 1K83J 2MG4A 2KJCA 4E7SA 3PQJA 5DDGA 1MMNA 3HOZJ 2MYSA 4A5NA 3CRJA 1SFOJ 3H36A 1FMVA 3S1MJ 5EEGA 4KYWA 1JT0A 3CMYA 3F21A 1FP2A 2NNNA 2UXXA 4ON0A 1LUJB 4ACIA 2E60A 3IH3A 3LOCA 4B4CA 2RKHA 4BHCA 5IT9Z 3RJPA 4GFKA 1WJDA 3HHGA 3TGNA 3COAC 3BRUA 3PFIA 3GTMJ 3QRFF 4RGRA 4AVZA 2K4JA 1R6RA 2KDOA 4HNTA 4XICA 2QYOA 5CVVA 1L0OC 3E1SA 3IH2A 3CJQB 3EUAA 3LSMA 5FGMA 3P9CA 3KZIC 3OYLA 3QBMA 1RRJA 1TWHJ 1X19A 1IV6A 1D1AA 2E5NA 3K4BA 3PNTA 1VFCA 1Y56A 3BZ6A 5B1BH 2R7WA 3SDBA 3C2BA 1MMSA 4ZYAA 2XIGA 3BG9A 2Z2SB 3H3ZA 4Y15A 2K9LA 2XGEA 1IXCA 4D5FA 5E3MA 1FLIA 4I02A 3G1MA 3LSTA 3ZQGA 5JR3A 4IF4A 1XMAA 2BHYA 3BQYA 2HS5A 1MJBA 3G7RA 3ZXSA 4QIWN 4AUXA 5DM6F 1N75A 1S7OA 1UJ8A 3F9KA 3GTJJ 3CJDA 4RB3C 2ID6A 3WTUC 3SHFA 2EFQA 3E6DA 1FEXA 3MKWB 4PGHA 1YFHA 3RCOA 1FZPB 4HW0A 2NAZA 2VBXA 4CYCA 4CHUA 4IHVA 2F6CA 3OYHA 2XHKA 2CJJA 3HC7A 1OYYA 5K7HA 2CUEA 3K9TA 1W5SA 4C2MA 3EUKL 2DBBA 3MZYA 1X4PA 4NC7A 2WV1A 2VIXA 1R58A 3VW1A 3QWLA 4CYCB 2Y30A 5HDKA 4X0GA 4LFUA 3HB9A 3J7YJ 4PFPA 1T39A 2XB0X 1N77A 4RMNA 1H8AC 1SVLA 1BIBA 3VW2A 4OMYA 4B43A 2UZKA 2E19A 3MVPA 3CMAI 3BTLA 2X1DA 2X6OA 2EV0A 1DPUA 3Q3SA 5TISC 3LA7A 3JRDA 1T8IA 2E5ZA 1JT6A 2BY3A 3L09A 4BJTA 4E4HA 1IDYA 4FETA 1I39A 1BJZA 4CSWA 3U1DA 2HYJA 4EV0A 4IHWA 1BR1A 2Z33A 4OIRF 4CUGA 1WRJA 3L2QA 2NNYA 4YFNF 1K4SA 1G59A 1YOVB 4R1HA 2ECCA 3C2HA 4HDUA 2DA7A 3OMYA 4W1UA 2IP2A 2R7SA 4LIVA 2WTEA 3V8JA 5FLXZ 5C44J 2NVXJ 1BA5A 3VYUB 1I6HJ 3OL4A 5HBUA 2DG8A 2IXSA 3CESA 3W6KB 2RASA 1ITYA 4C3HJ 2COBA 2W53A 5LLQA 2P5KA 1YX5A 2W85A 2QOPA 3F22A 3N05A 1ZR2A 2IS4A 3CCYA 3JSOA 1P4AA 3MMYB 5GAEJ 3VW0A 2M0MA 4CCJA 3I58A 1MBFA 2VL8A 4R8HA 2HKXA 2R93J 3HKZA 5HLIA 3PUBA 2DDAA 4NQWA 3GFLA 2F2EA 3QYFA 1I3AA 4AWXB 2E1MB 3P5JA 5F1JA 5ED4A 2WY7Q 3RQ4A 4AC6A 3I53A 4E7IA 1Z05A 3DEWA 3NNRA 1GLNA 5F1RA 4NQWB 2BY0A 2YX4A 3OR1C 5LGUA 3D0SA 3RKWA 5EDNA 3J7AY 2DFHA 2P8TA 2WBMA 2JMWA 2GXBA 3K2ZA 2CUZA 2RHAA 3HRSA 1FYKA 2WB1A 5F0HA 5EJCA 4KWAA 2W84A 3PNYA 5DYMA 5K5QA 1ON1A 2H8WA 5ERIA 2VOOA 5TJJA 3KP3A 3FXUA 1HW1A 3F6OA 5K7FA 3ZN1A 2L9VA 2RAEA 3FKIJ 4J00A 4ZYEA 1ZGJA 5D5XB 2ELKA 3VSKA 3KP6A 5ICGA 1W36C 1R00A 2DT5A 2DJIA 4C2MJ 1IRXA 1MSEC 1J0RA 1OYWA 3HTUA 2DA2A 3MD2A 3DLAA 3PO3J 1FTZA 2BOLA 5HODA 4L62A 2X4HA 3KYCB 4HKUA 2IA1A 2LF7A 3ECHA 4F92B 1KA8A 3R4KA 4EJOA 3CF5F 2XKPA 4XOTA 5IYCJ 4LB6B 4FQGA 3ZQFA 1VQPI 3K4JA 5F64A 3FKJA 4EVIA 5J47A 2XPUA 3RTRA 5E20A 3F8BA 2ELHA 3K10A 3V42A 2FBIA 1DU6A 2CV1A 4L18B 4WF2A 2BYVE 3Q9VA 3D5SC 4BJ6C 4ZDOA 1BOBA 3OY9A 4CCOA 1W1WE 2FOKA 3GZNB 4HQMA 5IYBJ 3TDUC 4ZTFA 1FMWA 2XKOA 3HPHA 1YW7A 1Z67A 3OOUA 4CCKA 1K79A 3ASNH 3GZ5A 3FM3A 2GXAA 3RKYA 3K4LA 1OPCA 2A6TA 1UG2A 1W4MA 1KU7A 1TWAJ 5C4XJ 2ZJPF 5CJ9A 5DCMA 4E7LA 5DUIA 3G2BA 4ZDPA 4IXAA 1OISA 1Q1HA 1Z1DA 2IAIA 2Z5UA 1LNWA 2MH9A 3O2PE 1NK2P 3KZYA 2M7BA 5DCMB 1VQ8I 2DG7A 5FFZA 4N4NB 1ZQ3P 4FX0A 2DT7B 3JSJA 2DMPA 1UAAA 1H9GA 2KP6A 1YJNI 3EUHC 1ETXA 2L0KA 4A2UA 1JHHA 4MTEA 3GX4X 2FRHA 1QQIA 1QHGA 3MZHA 3S14J 2D5VA 4YIRX 2L7KA 3E6MA 1XN7A 2V1DA 5FO5A 2Z16A 2GUHA 4XRFA 5J1RA 5ICEA 2FX0A 3KP7A 2IS1A 4F55A 3ROUA 2XF6A 2CQXA 2JA6J 3BJ6A 3QODA 1CQTA 2B7EA 1P7IA 4Q47A 3C18A 4DZJA 5E8GA 4M9SA 2BEOA 3TO9A 2BVLA 1OYIA 1H9TA 4Y52J 1Y8RB 1LPQA 1IJWC 3F1BA 2FQ3A 2HVQA 3H0GJ 2DPUA 2EJRA 2KIFA 1MMDA 4KUMA 2VE9A 4LJZF 1U5TC 1MBKA 3G4SI 2G7SA 5B1AH 2COMA 3E5XA 4EJWA 4IRVA 1O3SA 1R36A 5GADJ 4YRVA 1T98A 4UB8C 2RV8A 4BHPA 2DA5A 3V78A 3OYIA 4OINF 1TNSA 3WHBA 1ZGAA 2MC4A 3QQAA 1F43A 2JQ7A 3ERED 1HXDA 2FBQA 1S29A 1RKWA 3MKLA 1LKXA 1PP7U 2G7GA 5E18F 2UXUA 2BBYA 1WGXA 2EINH 1S8NA 1F9NA 3LNQA 1WJEA 2AQFA 3BG5A 3FXOA 3TMOA 1RZ4A 4U0YA 1FIPA 1YQAA 3VIBA 1HQCA 2XSDC 2A3SA 3F72A 4I98B 1W0UA 4JX4A 4HZFA 3BG6A 1HW2A 3JR9A 3CZ6A 2IRFG 3MKYB 2M5WA 2YPRA 2ZNZA 1FOXA 3HGGA 3SWHA 2O0YA 2I10A 1RUOA 4BGDA 1BI0A 2XF5A 3F8FA 3OYAA 2A5YB 2NRAC 2EA2A 4BL0B 2CYYA 2HVRA 3W2AA 4LITA 3HRUA 4HF1A 1XDSA 2EWNA 4P9FA 2HKOA 2Y0SA 4YIFA 2ZNYA 4MEXF 1TLHB 1BN5A 2EH3A 3VWBA 2K86A 2GOMA 1OR7A 3VDXA 2OBPA 1IG7A 3J7ZI 1JTYA 1LFUP 3FMSA 2DYSH 3JRBA 2QKOA 3PPBA 3RPUD 4ZZLA 3E3VA 4OU0A 4RBOA 3EGQA 2FJ1A 2DW4A 4AIKA 2V1NA 2R7UA 3WHCA 2EIJH 2KIUA 1MMGA 2ZMEC 3KKCA 5D8KB 3CUQA 1R5ID 2DLLA 2E36A 2M0CA 2JA5J 2X0LA 5BPDA 4CGZA 1J5YA 3KCCA 3ZCOA 4N9IA 1U78A 3GZIA 2KRFA 4B47A 2CW7A 3CUQB 3AG2H 5KCMA 3PASA 1YJ9I 2LDUA 2RGVA 1W36D 3F23A 2QQ8A 3A01A 1XG1A 4HLYA 3Q9SA 3OYNA 5AQCA 2YU3A 1E3HA 2O3FA 2W4SA 3E0JB 3LFKA 2IEKA 5JVTA 2VC0A 1I3QJ 2LREA 1MJAA 1VF9A 3A01B 5J3LA 5IYDJ 2KJBA 1OFCX 1DPRA 2OF7A 3GEZA 3LSJA 4M71A 5HDNA 4I7HA 1W5CC 3J81K 3HTSB 3T6NA 3A2KA 3JCUC 4ZDLA 4H4KC 2ZXIA 2EK5A 4BYYA 1O3RA 3RH2A 2M3AA 3JTHA 2IPQX 1SFXA 3TDZC 3WTWC 3SZTA 4XLEA 1LDJA 2LRDA 2EQRA 3A03A 4MXMA 3MAJA 1QGPA 5C4YA 2PMZN 4LGWA 1VTNC 4GCKA 1AHDP 1G4DA 2ZXWH 2P5VA 1QVUA 4A3JJ 1X1BA 2L2OA 3S3MA 3HGYA 3VB2A 5EF6A 4RGUA 2PEXA 3FXLA 1HCRA 2QQBA 1S3JA 5D5VB 3DTIA 2R3SA 3EQLF 4GGGA 4CXFA 3M4OJ 1SGMA 2BXZA 2WAFA 1UG0A 2MW8A 3M1EA 4Q4ZF 2R7XA 4HV6A 4RGSA 4G6DA 1FYLA 2AHQA 4IOAF 2EFWA 5JFRA 2N8GA 2F5EA 5E3OA 3LSRA 4A0XA 2HYFA 1I50J 2ZJ2A 4TV7A 2RVCA 2XAUA 4XONA 4AYBA 5CQGA 4KNYA 3KLOA 4XKVA 5FD6A 1HA8A 2HKUA 1LEAA 2X6YA 5E79C 3JRHA 2M4GA 3JRGA 2W82A 3KETA 5CVIA 2RNJA 3CF2A 3HTJA 2RREA 1IF1A 3I9V2 1Y6IA 3RZOJ 1ODDA 1HBXG 4CCNA 4CDGA 1WHUA 1IGNA 2FE3A 2V6EA 4NB5A 4W97A 2MH2A 3GTPJ 3D5LA 2R7QA 1U0JA 5D18A 2E71A 3OYCA 3RIRA 1YTYA 1UCRA 2KLOA 2YX7A 2IBDA 1ZRFA 2QVOA 1U6GA 2DYRH 3GVAA 2XDVA 1I5ZA 3BJAA 2VBYA 3ZMVA 4HAMA 3AKZA 2EV6A 2PJRA 3BTCA 4N0BA 4ZC3A 3A02A 2NS0A 1D5YA 2WAQA 2XAFA 3HYIA 4AU7A 2ZSIB 1YJWI 1N78A 1LE8B 2FMLA 1Y0NA 2B3WA 2PJRB 5E3NA 4J01A 4X1EA 2R7OA 5EEHA 3BG3A 4QTRA 1X4OA 4U9LA 5E1XA 1ZTRA 3M1CA 4L5IA 1R1TA 1XC5A 2FF4A 4KFCA 2Y2ZA 2LK2A 4BU2A 2ZSHB 1JKRC 2KFDA 1ZRCA 2UUZA 2XPWA 2ZFUA 3AG4H 2YVXA 3KYLA 3PUFA 1J7KA 3KEOA 1LQ1A 3ZMDA 1FNNA 2GM4A 3MN2A 2V9KA 2FA5A 3TKYA 4BE1A 4JX6A 3Q0WA 3K4CA 5JLXA 2RQPA 4AIHA 5DV5A 4BH9A 3C3WA 4XKBA 2E1MC 3K4MA 3GTLJ 1G3SA 3JREA 4RB0A 2PLYA 3CQZJ 5HOOA 1IAWA 1UI6A 1BI2A 1X1AA 2EZHA 1DQUA 4UUVA 3RKXA 2JJ7A 2NXNB 3G56A 4G94A 4RDUA 1V55H 3SXYA 3K1NA 5B3SH 2DTRA 1BR4A 1S5LC 3IAM2 5CLSA 2VKVA 3RYPA 1TNTA 2EA4A 4FE7A 5KK1A 3ON2A 2YU9J 4U88A 5ICFA 3E7QA 1ENHA 2AQEA 3FHNA 4OWRB 4CH7A 2GQQA 1IN8A 2K3PA 2G7HA 1QPIA 2UWMA 3ON4A 2VB6A 5L3GA 4DBRA 1B4AA 2F5CA 4XN0A 3HTAA 2JPCA 3SZPA 4Y17A 4IHXA 4RLFA 3VYSB 2HTSA 1UELB 1GVDA 2R92J 3CC4I 3B73A 1UHMA 5F0FA 3EDPA 3G73A 1R71A 3KIOA 4LOCA 3V8KA 3P7NA 4B09A 2LY2A 1P4XA 4R79A 1B8IA 3TL4X 2E1OA 1G3WA 1M1EB 2HYGD 1TBXA 1LFBA 1XPXA 4M3GA 4FHTA 1Y8QB 5CYVA 1ETYA 4XBFA 4CZCA 4OAYA 3M8EA 4PUSA 4MK6A 4U7BA 3DFGA 3ZQIA 4IX7A 3Q0UA 1B8IB 1PUEE 3M07A 3LSGA 3IH4A 4D9JA 2RQQA 2AXLA 3S32A 4MFEA 3SFZA 3H9QA 5B5EC 4MTDA 4OIPF 2L7ZA 4I76A 1T33A 2D2WA 2Z99A 2ZXJA 1TC3C 4A3GJ 2QWTA 3ASOH 5BQTA 4AM3A 1KQ0A 2PBIA 1O7LA 4P5OA 1Z0XA 3HM5A 5JVGF 3J80K 1UHWA 3FBNB 3IWFA 1K7AA 4HEA2 3F6VA 4PZJA 4G7OF 2IU5A 5EG0A 3KEQA 1KZHA 3CCLI 3W3CA 4X6AJ 1F4KA 1MBJA 3ZQQA 3CCQI 1JKOC 2YSRA 3K69A 4DGWB 2NVYJ 4DOZA 4CYDA 2DAOA 3CUOA 4PJMA 4GCTA 3VVXA 5EG0B 2NP3A 4K2EA 3E97A 4LMYA 4L9JA 1FBUA 3BR2A 3IWZA 2OQRA 4LD5A 1IDZA 3T1BA 3IHUA 4YELA 1V5FA 5D6FA 1USSA 3GF2A 4LLGF 4RS8A 1QBJA 4I2OA 2MFZA 3SDGA 1MZBA 2DFEA 3BNIA 4OAZA 1BIAA 4FISA 4ZTJA 3O8GA 2HU9A 5LHGA 2AS5F 3OIOA 3IRQA 5FHPA 1R5GA 4HYEA 3ABUA 1VQKI 4LK1F 5A2QZ 3HPGA 3DCFA 2VKEA 1WCMJ 4GFLA 3VYTB 3F8MA 4A5MA 2QQ9A 3HRTA 1HW5A 3NPIA 1D0XA 3WU0A 5IOZA 2OAZA 2L3DA 2XAGA 3K2AA 4EJTA 1WJFA 2G0EA 3LSIA 3AQTA 2HR3A 5D5UB 2F4OB 2NVUB 4ETSA 1IO2A 4PDKA 2HEOA 5C4JJ 1IN4A 4DYCA 4KA4A 1S7AA 2NOJB 4FASD 4UXNA 4KT6A 2IVMA 1H89C 1QPMA 3L00A 3TEDA 3H0DA 3VYRB 3WTZA 2FNPA 2KIMA 1SD7A 1Q1VA 1R9TJ 3IV5A 1WI3A 1JJ6C 3KP4A 1YW9A 4HLXA 3GW2A 3TO6A 2B9SA 1WJBA 4IOCF 3OS1A 4AIDA 1ZREA 1DP7P 3K1MA 3SQNA 5M5YJ 2OI8A 1A36A 2ZY9A 4WIBA 2ISZA 1A6IA 3CTAA 2KT0A 5FROA 1VQ9I 5K7ZA 2R4GA 2GIVA 4GYIA 4A3BJ 5D4RA 2HYTA 3LJLA 2O7TA 5FFXA 2CMPA 3S2HJ 3CO7C 1I6XA 2MD0A 2MLKA 4IPAA 3E6CC 2H8RA 3KKDA 2EBIA 2LC2A 4HRIA 3TQNA 1IUFA 4G7HF 2L01A 2V4JC 4XLAA 3KZZA 1ZARA 4II2A 2M1BA 4IRHA 3G1OA 4HSTA 1OCTC 3S1RJ 4Y33A 1DGWY 3HDDA 3ABMH 3AG3H 1RESA 2E35A 5M5XJ 1YI2I 4L5JA 3V7RA 3TOAA 2K9QA 2PFBA 1YS7A 4II3A 1OR7C 3OWTA 1G8XA 1XD7A 4G7ZF 3SEZA 2QM3A 1BC7C 3LAJA 1JUPA 1ZLJA 3FXRA 2X9DA 1YS6A 2QKMB 4AIJA 2X48A 1FOYA 2LVSA 2LNBA 2LY9A 5LD2C 2V1XA 1MDMA 2G7UA 1LFPA 5FKNA 2EV5A 4BUPA 3A1YA 2EIKH 2ETHA 1K6OA 5H2FC 2R7RA 3S17J 2K27A 1EKEA 2CG4A 1Y39A 1S72I 3CDIA 4XQFA 3JRFA 1ZH5A 3BC8A 2GA2A 3DQVC 3I3LA 4HG2A 5K5RA 4P96A 2ZJRF 4A3EJ 3CCUI 1MDMB 3LSHA 4XRSG 4E7JA 5AONA 1CF7A 4IHTA 3GTGJ 2JA8J 3DPUA 2L7MP 3OR2C 2EFPA 1OCRH 1SD6A 2Q24A 1T0FA 1W7PD 2V1UA 4KN4X 1OJLA 2ZC2A 5DAJA 2F48A 4DYQA 1CF7B 3AQSA 3BR5A 2ZKZA 4RB1A 3IAS2 3LMMA 2KZVA 4A3IJ 4UDSA 2HGCA 5F0CA 2Z1DA 2VPLA 2PFVA 4ICHA 2Y9YA 1KONA 2Y69H 3I4PA 2OU2A 3G6EI 2B0LA 1VZ0A 3JW4A 4CA0A 5E17F 2P7VB 1XX5A 2VXZA 3HHHA 1SD5A 1LDDA 1A5JA 3TP0A 3KPHA 1TL8A 1ZAOA 2F4MB 1OCCH 4QLCU 1XCBA 6PAXA 5EZGA 1W5TA 1KGSA 2FNAA 2HQRA 3F3XA 5J6XA 4S05A 2KDZA 2BE5F 3M7GA 3LQRA 3WG9A 2BXYA 1LEBA 1O57A 4HNUA 2GXGA 1X58A 3L2RA 1D8JA 2NVTJ 1QZZA 5HVQC 4L0YB 3B6CA 2ZFWA 4MIMA 2VKDA 2KL4A 4A93J 2HOTA 4ENKA 1ZG5A 1WZ2A 5J4YA 2JRTA 1P2FA 2XGDA 2JUGA 5A2QK 2QBYA 1D3YA 2STTA 3NXCA 2WB1N 1ON2A 1J9IA 4YEJA 3H1CA 2XC7A 2ICWG 1J09A 4XIDA 2W25A 4PGGA 2QBYB 4P55A 5D19A 1JUSA 1EH8A 2VLAA 1HDPA 2CQQA 2KZGA 2KPMA 5HS8A 3TP3A 3RPQA 3J81Z 3BT9A 2K4BA 2W00A 3QP6A 2A5WA 2JT1A 3QAHA 1R4MB 1FSHA 1G3TA 3FIWA 3OYDA 3I0TA 4DYRA 3K1PA 1K78A 1WPKA 2P5LC 5TRDA 2ESNA 1KQ9A 1PVEA 1UI5A 4BBRJ 2K9SA 3RYRA 2CW0F 1K78B 4D7NA 3NAUA 5D6EA 5E1ZB 5F08A 2VBWA 1MH4A 2NS7A 2WY8Q 3BOQA 1YIOA 1MD0A 2A6HF 3DKYA 1RIOH 4HA8A 4XRSA 5AIPA 1A31A 2FXAA 4OIQF 3O3KA 5ICCA 2CUJA 4AVPA 3LWJA 3DKWA 3I4NJ 4A6DA 4G6QA 4DZPA 2VQGA 4XMYA 2DA1A 2GAUA 3U1KA 2KHMA 2QTQA 4O5VA 5K1YA 3QU3A 2E34A 5IT3A 3S3NA 1S9HA 4WX9A 1T56A 4YFXF 5BPIA 3WTYC 2HWVA 5LRSA 5JHUA 5E3LA 2M8EA 5CKTA 2E7XA 3ZRGA 2V26A 3HUGA 1RETA 2K9MA 3DPTA 4YIIA 5DD8A 4OOIA 4ENJA 3VEPA 4MHGA 2R5YA 2K3FA 1BR2A 1V4RA 3BWGA 4E7HA 2HPMA 4ABZA 4A3MJ 3HUGB 2KRCA 2L9NA 5LGTA 2R5YB 1U8BA 2R7TA 2CRGA 4UVBA 1MNEA 1ZK8A 1Z3XA 2A61A 5FLVA 1IV8A 2ZBKA 2BY1A 4M3BA 4B3AA 1JHFA 5L3BA 1E3OC 1R1VA 1SVOA 1VNDA 1YX3A 4WK8F 1P6RA 2QSHX 3FX3A 4JP0A 2C6YA 2DA4A 2MC3A 2HVSA 1CGPA 2Q8KA 5FRMA 4JOMA 2VT2A 4CCLA 4D1QA 1BL0A 4BY1J 1LVKA 5LFAA 3KP2A 1V5EA 3X2QH 3AL0B 2V6CA 1B1BA 3JRIA 1P92A 1HKSA 3PSFA 3HG9A 2LTPA 2VQCA 3QPHA 5E8IA 4WWCA 2Z3YA 4HDVA 3TOBA 2VKHA 3R60A 4KIGA 2IGKA 1SFUA 1XGNA 2X6WA 1WFXA 2DA3A 2YUSA 3BR1A 4UVAA 3HL2A 3GEUA 2M2EA 5FMPA 4IO9F 2UV1A 4NNJA 4ESJA 3CJRB 1DDNA 5H9TA 2FBHA 2M34A 1X2NA 4ESBA 3RD3A
chains in the Genus database with same CATH topology
4AUXA 3GTJJ 4C3IJ 3CJDA 2QIBA 2ID6A 2VPRA 1TWCJ 2GM4A 4BXXJ 1U9NA 1FEXA 3MN2A 3HOYJ 5J1YA 2YS9A 4JX6A 3BR6A 3Q0WA 4CYCA 4IHVA 5JLXA 3BQZA 2CJJA 2DA6A 5K7HA 3VP5A 2LKXA 2CUEA 4IEJA 3GTLJ 4JL3A 3JREA 3CQZJ 2WV1A 1G2HA 1UI6A 2EZHA 3VW1A 2LD5A 4CYCB 2Y30A 3VOXA 3HB9A 2JJ7A 2XB0X 3G56A 5FJ8J 4RDUA 1MSFC 1U9OA 1H8AC 3VW2A 4MLOA 1MBEA 2JA7J 2E19A 3MVPA 3VUQA 3BTLA 2Y0SN 3W6VA 2X6OA 2VKVA 2HDDA 4FE7A 3ON2A 3Q3SA 3E7LA 2YU9J 2YVHA 3JRDA 3UKGA 1ENHA 3E7QA 3O60A 1JT6A 1IDYA 1DU0A 1BJZA 1QPIA 2HQ5A 2HYJA 1BW5A 2YVEA 3ON4A 4IHWA 2EZIA 1K61A 3NI7A 5F04A 3HOWJ 3ZOBA 3HTAA 4IHXA 2ECCA 2GENA 2DA7A 4MFDA 1GVDA 5EZHA 5FKKA 4W1UA 5DS9A 2R92J 1JGGA 2R5ZA 1BA5A 5C44J 2NVXJ 5CXIA 5F0FA 1I6HJ 5FLMJ 1POGA 5HBUA 2DG8A 2RASA 4LOCA 4C3HJ 3GTOJ 1ITYA 2COBA 5IOYA 2W53A 1B8IA 4QSHA 2QOPA 2E1OA 2Y9ZA 2ZCMA 1ZR2A 9ANTA 1LFBA 4M3GA 3CCYA 1ETYA 2R5ZB 2L9RA 3QPLA 4MK6A 3VW0A 4FTHA 3D1NI 1ORKA 3ZQIA 1MBFA 3Q0UA 1B8IB 4UUSA 2GLOA 1WH7A 3LSGA 2B63J 3IH4A 2R93J 4C3JJ 5M3FJ 1SANA 4MFEA 3KNWA 2L7ZA 4I76A 1T33A 4A3GJ 1TC3C 2QWTA 4UUSB 5F1JA 1HDDC 3VPRA 2V57A 4AC6A 2GBYA 1Z0XA 3HM5A 3DEWA 3NNRA 1IRZA 1LE8A 2IU5A 5EDNA 5EG0A 3M3YJ 2JMWA 4X6AJ 3HOXJ 1QVTA 2RHAA 1MBJA 2Y31A 2ZOYA 3HIMA 5F0HA 3BCGA 4KWAA 2NOGA 1JKOC 2NVYJ 1AU7A 2JN6A 1APLC 1H88C 4GCTA 1JKPC 5EG0B 2H1KA 2G3BA 2NP3A 4NELA 2R0QC 3VVXA 3BR3A 5K7FA 3FRQA 3RQIA 2RAEA 1MBGA 2DN0A 3FKIJ 3BR2A 5BNGA 2F07A 2ELKA 4ME9A 2E2HJ 1GV2A 2VUMJ 1IDZA 4S0HB 2G7LA 2XPVA 5D1RA 4C2MJ 1MSEC 3SDGA 3EUPA 3G7RA 3NARA 4BY7J 4A69C 2DA2A 3ZQLA 3ANGA 4AYBN 1GT0C 3BNIA 3PO3J 1FTZA 2LFBA 5HODA 1P7JA 3JRCA 4L62A 4FISA 3O8GA 5C3EJ 3FK6A 2JWTA 4HKUA 1X2MA 1TWFJ 3OIOA 5FHPA 4Y7NJ 2OPTA 4EEFG 3C07A 3DCFA 2VKEA 3ZQHA 2ZOZA 1WCMJ 5IYCJ 4BBSJ 2LP0A 3ZQFA 1WH5A 4GFLA 2XPUA 2XRLA 4BKXA 3NPIA 5IOZA 1HOMA 2M9HA 3S2DJ 2ME6A 3S1QJ 3AQTA 3K2AA 3COLA 2G0EA 2UXOA 3VVYA 5C4JJ 4DYCA 1DU6A 4GFBA 1RKTA 3BR0A 3GBGA 3TW6A 2UXHA 1H89C 3HOUJ 2JK3A 3TEDA 1R9TJ 1Q1VA 3IV5A 1NTCA 5IYBJ 1ETWA 1WI3A 4JNNA 1JKQC 1JJ6C 3OOUA 3ZQCA 4MO7A 1W0TA 5K58A 3BJBA 2UXIA 2LLKA 3PO2J 1UG2A 5M5YJ 2OI8A 2CU7A 5C4XJ 1TWAJ 1A6IA 4J19A 3GTQJ 2KT0A 5K7ZA 3L1PA 2DMQA 5FKMA 4A3BJ 2HYTA 3LJLA 2O7TA 2ZB9A 3S2HJ 5CXGA 2NS8A 2M8GX 3GTKJ 3H3VK 2IAIA 3G1LA 1ZR4A 2E2JJ 1NK2P 1ETOA 2DG7A 2H8RA 5JLWA 2ZCNA 1ZQ3P 1ZKGA 2EBIA 3KKDA 3JSJA 2DMPA 4IHYA 1IUFA 1ETXA 2L0KA 3S1NJ 3FISA 1UMQA 2K9NA 5CW8A 1OCTC 3G1OA 3S1RJ 3O8HA 3S14J 3OSFA 2D5VA 2QF7A 4V2GA 3HDDA 2EZLA 3LHQA 1RESA 1MNMC 5M5XJ 2GUHA 5J1RA 2K9QA 4NN1A 2FX0A 3CWRA 3LSPA 2CQXA 3BTIA 2JA6J 2HOAA 1CQTA 1P7IA 4UUTA 4DZJA 4A3LJ 4XK4A 1Y1VJ 3RZDJ 4Y52J 1JUPA 2HI3A 1IJWC 1ETVA 2PBXA 2X9DA 4G12A 3F1BA 3H0GJ 1BW6A 2X48A 5IP7J 3HTIA 2LVSA 3VVZA 2LY9A 2NX4A 1MBKA 5FKNA 1TWGJ 5IP6A 2DMUA 2G7SA 4AC0A 5DTDA 4PXIA 3S17J 3DPJA 1EF4A 3JRFA 4AF5A 3S15J 4A3EJ 2DA5A 1ETQA 3V78A 5FKLA 4XRSG 3PM1A 3WHBA 3QQAA 1F43A 3GTGJ 2JA8J 2FBQA 2L7MP 3K7AJ 1RKWA 2FD5A 3MKLA 2Q24A 2G7GA 5IPAA 2UXUA 1Z77A 1WGXA 1OJLA 3LNQA 3HOVJ 5DAJA 3BG5A 3FK7A 4DYQA 2O8KA 3AQSA 2XDNA 3BR5A 3S5RA 3TW7A 5FKOA 4DW6A 4L5EA 1FIPA 2VI6A 4A3IJ 3VIBA 4UDSA 4M3DA 2XSDC 5F0CA 2TRTA 4ICHA 2Y9YA 5M5WJ 1W0UA 4JX4A 4M3EA 2HXOA 2MSYA 5F27A 3JR9A 4FE4A 3HGGA 2TCTA 3BHQA 2I10A 3TP0A 1A5JA 1GDTA 2L7FP 1AKHA 5EZGA 2AO9A 3OSGA 1UHSA 2KDZA 1PUFA 1S7EA 1F36A 2WUIA 2WGBA 1JTXA 2EH3A 1AKHB 1X58A 2NVTJ 4XRMA 5EEAA 3CDLA 1IG7A 4CGRA 1JTYA 1LFUP 3B6CA 1PUFB 4MIMA 4A93J 2HOTA 2NP5A 4D5CA 1IC8A 3JRBA 2QKOA 3PPBA 4B1RA 4NDLA 4RBOA 3EGQA 2FJ1A 2OERA 2XGDA 3WHCA 3KKCA 1NK3P 4A3FJ 2QCOA 2WB1N 2ME0A 4M6VA 2WAQN 3NXCA 5EGOA 2GFNA 2M0CA 2JA5J 1FTTA 1VI0A 4XIDA 1U78A 3GZIA 2EZKA 2MGQA 2HXIA 3HBLA 3QKXA 5D19A 1JUSA 1FIAA 3PASA 1YRNA 1HDPA 2CQQA 4JYKA 5EGOB 1B72A 3TP3A 5HAWA 3A01A 5EYRA 3BT9A 1XG1A 2FQ4A 1HF0A 5AQCA 5IP9J 3SJMA 2PZ9A 2P81A 2IEKA 1OCPA 3FIWA 4GCLA 4DYRA 1YRNB 4JKZA 3RD3A 1I3QJ 1B72B 1WPKA 3I4MJ 1VF9A 3A01B 5J3LA 5IYDJ 2NVQJ 1OFCX 2DMTA 2OF7A 1MBHA 3LSJA 3ANPA 3P9TA 5HSZA 1GUUA 1UI5A 4BBRJ 3T6NA 2K9SA 4M3FA 3V6GA 3VOKA 5J1UA 2K40A 3QPSA 4D7NA 4D7MA 3NAUA 5F08A 5GP9A 3MNLA 3RH2A 1MH4A 2XGCA 4MXMA 2NS7A 2EQRA 3A03A 5C4YA 2PMZN 3HTHA 2ID3A 2XB5A 3IUVA 4GCKA 4JX5A 4XRSA 1AHDP 1ETKA 2W48A 1QVUA 4A3JJ 2E2IJ 1FJLA 3HGYA 3HEFA 5EF6A 4I6ZA 3LWJA 2HOSA 3I4NJ 1HCRA 2DJNA 4DZPA 4YZEA 2LR8A 1JJ8C 4V2FA 1Y1WJ 2UXPA 1SGMA 2DA1A 3M4OJ 2QTQA 1JUMA 2MW8A 2O9LA 5FGLA 1T56A 3KZ9A 2AHQA 2D6YA 3B6AA 5E3LA 2N8GA 2ZCXA 1GV5A 5E3OA 3LSRA 2R7ZJ 5GPAA 1RETA 1MH3A 2DMNA 4FCYA 1I50J 5GPCA 5EFYA 2CUFA 2R5YA 4A3KJ 3Q0VA 3B81A 1O4XA 2HKUA 3RKQA 4ABZA 4A3MJ 3JRHA 3F0CA 3NRGA 3JRGA 1K83J 2MG4A 3HTJA 2R5YB 1U8BA 3HOZJ 2REKA 3CRJA 2CRGA 1SFOJ 3RZOJ 1QRYA 3S1MJ 1ZK8A 1JT0A 1IGNA 3CMYA 5FLVA 4B3AA 4M3BA 3SFIA 4W97A 3GTPJ 1E3OC 4HNVA 5D18A 1VNDA 2ECBA 4A3DJ 4ACIA 1HLVA 3IH3A 2IBDA 3LOCA 4JP0A 4B4CA 2DA4A 1XS9A 2O7OA 4GFKA 4BY1J 1BL0A 3BRUA 3GTMJ 3HE0A 3BTCA 3A02A 3JRAA 1D5YA 4XICA 3JRIA 3IH2A 3S16J 1LE8B 1RR7A 3QBMA 1TWHJ 3HKZN 1IV6A 2LTPA 2DTZA 5E3NA 1VFCA 4X1EA 3BG3A 4QTRA 3C2BA 5M3MJ 1ZGWA 4A3CJ 3BG9A 1ZTRA 1XC5A 2XGEA 4D5FA 2DA3A 2YUSA 3BR1A 5E3MA 3GEUA 2Y2ZA 2M2EA 2LK2A 5FMPA 3BTJA 3G1MA 3ZQGA 1RPWA 3BQYA 1JKRC 5H9TA 2M34A 2XPWA 1X2NA 4QIWN
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AUX A;  3GTJ J;  4C3I J;  3CJD A;  2QIB A;  2ID6 A;  2VPR A;  1TWC J;  2GM4 A;  4BXX J;  1U9N A;  1FEX A;  3MN2 A;  3HOY J;  5J1Y A;  2YS9 A;  4JX6 A;  3BR6 A;  3Q0W A;  4CYC A;  4IHV A;  5JLX A;  3BQZ A;  2CJJ A;  2DA6 A;  5K7H A;  3VP5 A;  2LKX A;  2CUE A;  4IEJ A;  3GTL J;  4JL3 A;  3JRE A;  3CQZ J;  2WV1 A;  1G2H A;  1UI6 A;  2EZH A;  3VW1 A;  2LD5 A;  4CYC B;  2Y30 A;  3VOX A;  3HB9 A;  2JJ7 A;  2XB0 X;  3G56 A;  5FJ8 J;  4RDU A;  1MSF C;  1U9O A;  1H8A C;  3VW2 A;  4MLO A;  1MBE A;  2JA7 J;  2E19 A;  3MVP A;  3VUQ A;  3BTL A;  2Y0S N;  3W6V A;  2X6O A;  2VKV A;  2HDD A;  4FE7 A;  3ON2 A;  3Q3S A;  3E7L A;  2YU9 J;  2YVH A;  3JRD A;  3UKG A;  1ENH A;  3E7Q A;  3O60 A;  1JT6 A;  1IDY A;  1DU0 A;  1BJZ A;  1QPI A;  2HQ5 A;  2HYJ A;  1BW5 A;  2YVE A;  3ON4 A;  4IHW A;  2EZI A;  1K61 A;  3NI7 A;  5F04 A;  3HOW J;  3ZOB A;  3HTA A;  4IHX A;  2ECC A;  2GEN A;  2DA7 A;  4MFD A;  1GVD A;  5EZH A;  5FKK A;  4W1U A;  5DS9 A;  2R92 J;  1JGG A;  2R5Z A;  1BA5 A;  5C44 J;  2NVX J;  5CXI A;  5F0F A;  1I6H J;  5FLM J;  1POG A;  5HBU A;  2DG8 A;  2RAS A;  4LOC A;  4C3H J;  3GTO J;  1ITY A;  2COB A;  5IOY A;  2W53 A;  1B8I A;  4QSH A;  2QOP A;  2E1O A;  2Y9Z A;  2ZCM A;  1ZR2 A;  9ANT A;  1LFB A;  4M3G A;  3CCY A;  1ETY A;  2R5Z B;  2L9R A;  3QPL A;  4MK6 A;  3VW0 A;  4FTH A;  3D1N I;  1ORK A;  3ZQI A;  1MBF A;  3Q0U A;  1B8I B;  4UUS A;  2GLO A;  1WH7 A;  3LSG A;  2B63 J;  3IH4 A;  2R93 J;  4C3J J;  5M3F J;  1SAN A;  4MFE A;  3KNW A;  2L7Z A;  4I76 A;  1T33 A;  4A3G J;  1TC3 C;  2QWT A;  4UUS B;  5F1J A;  1HDD C;  3VPR A;  2V57 A;  4AC6 A;  2GBY A;  1Z0X A;  3HM5 A;  3DEW A;  3NNR A;  1IRZ A;  1LE8 A;  2IU5 A;  5EDN A;  5EG0 A;  3M3Y J;  2JMW A;  4X6A J;  3HOX J;  1QVT A;  2RHA A;  1MBJ A;  2Y31 A;  2ZOY A;  3HIM A;  5F0H A;  3BCG A;  4KWA A;  2NOG A;  1JKO C;  2NVY J;  1AU7 A;  2JN6 A;  1APL C;  1H88 C;  4GCT A;  1JKP C;  5EG0 B;  2H1K A;  2G3B A;  2NP3 A;  4NEL A;  2R0Q C;  3VVX A;  3BR3 A;  5K7F A;  3FRQ A;  3RQI A;  2RAE A;  1MBG A;  2DN0 A;  3FKI J;  3BR2 A;  5BNG A;  2F07 A;  2ELK A;  4ME9 A;  2E2H J;  1GV2 A;  2VUM J;  1IDZ A;  4S0H B;  2G7L A;  2XPV A;  5D1R A;  4C2M J;  1MSE C;  3SDG A;  3EUP A;  3G7R A;  3NAR A;  4BY7 J;  4A69 C;  2DA2 A;  3ZQL A;  3ANG A;  4AYB N;  1GT0 C;  3BNI A;  3PO3 J;  1FTZ A;  2LFB A;  5HOD A;  1P7J A;  3JRC A;  4L62 A;  4FIS A;  3O8G A;  5C3E J;  3FK6 A;  2JWT A;  4HKU A;  1X2M A;  1TWF J;  3OIO A;  5FHP A;  4Y7N J;  2OPT A;  4EEF G;  3C07 A;  3DCF A;  2VKE A;  3ZQH A;  2ZOZ A;  1WCM J;  5IYC J;  4BBS J;  2LP0 A;  3ZQF A;  1WH5 A;  4GFL A;  2XPU A;  2XRL A;  4BKX A;  3NPI A;  5IOZ A;  1HOM A;  2M9H A;  3S2D J;  2ME6 A;  3S1Q J;  3AQT A;  3K2A A;  3COL A;  2G0E A;  2UXO A;  3VVY A;  5C4J J;  4DYC A;  1DU6 A;  4GFB A;  1RKT A;  3BR0 A;  3GBG A;  3TW6 A;  2UXH A;  1H89 C;  3HOU J;  2JK3 A;  3TED A;  1R9T J;  1Q1V A;  3IV5 A;  1NTC A;  5IYB J;  1ETW A;  1WI3 A;  4JNN A;  1JKQ C;  1JJ6 C;  3OOU A;  3ZQC A;  4MO7 A;  1W0T A;  5K58 A;  3BJB A;  2UXI A;  2LLK A;  3PO2 J;  1UG2 A;  5M5Y J;  2OI8 A;  2CU7 A;  5C4X J;  1TWA J;  1A6I A;  4J19 A;  3GTQ J;  2KT0 A;  5K7Z A;  3L1P A;  2DMQ A;  5FKM A;  4A3B J;  2HYT A;  3LJL A;  2O7T A;  2ZB9 A;  3S2H J;  5CXG A;  2NS8 A;  2M8G X;  3GTK J;  3H3V K;  2IAI A;  3G1L A;  1ZR4 A;  2E2J J;  1NK2 P;  1ETO A;  2DG7 A;  2H8R A;  5JLW A;  2ZCN A;  1ZQ3 P;  1ZKG A;  2EBI A;  3KKD A;  3JSJ A;  2DMP A;  4IHY A;  1IUF A;  1ETX A;  2L0K A;  3S1N J;  3FIS A;  1UMQ A;  2K9N A;  5CW8 A;  1OCT C;  3G1O A;  3S1R J;  3O8H A;  3S14 J;  3OSF A;  2D5V A;  2QF7 A;  4V2G A;  3HDD A;  2EZL A;  3LHQ A;  1RES A;  1MNM C;  5M5X J;  2GUH A;  5J1R A;  2K9Q A;  4NN1 A;  2FX0 A;  3CWR A;  3LSP A;  2CQX A;  3BTI A;  2JA6 J;  2HOA A;  1CQT A;  1P7I A;  4UUT A;  4DZJ A;  4A3L J;  4XK4 A;  1Y1V J;  3RZD J;  4Y52 J;  1JUP A;  2HI3 A;  1IJW C;  1ETV A;  2PBX A;  2X9D A;  4G12 A;  3F1B A;  3H0G J;  1BW6 A;  2X48 A;  5IP7 J;  3HTI A;  2LVS A;  3VVZ A;  2LY9 A;  2NX4 A;  1MBK A;  5FKN A;  1TWG J;  5IP6 A;  2DMU A;  2G7S A;  4AC0 A;  5DTD A;  4PXI A;  3S17 J;  3DPJ A;  1EF4 A;  3JRF A;  4AF5 A;  3S15 J;  4A3E J;  2DA5 A;  1ETQ A;  3V78 A;  5FKL A;  4XRS G;  3PM1 A;  3WHB A;  3QQA A;  1F43 A;  3GTG J;  2JA8 J;  2FBQ A;  2L7M P;  3K7A J;  1RKW A;  2FD5 A;  3MKL A;  2Q24 A;  2G7G A;  5IPA A;  2UXU A;  1Z77 A;  1WGX A;  1OJL A;  3LNQ A;  3HOV J;  5DAJ A;  3BG5 A;  3FK7 A;  4DYQ A;  2O8K A;  3AQS A;  2XDN A;  3BR5 A;  3S5R A;  3TW7 A;  5FKO A;  4DW6 A;  4L5E A;  1FIP A;  2VI6 A;  4A3I J;  3VIB A;  4UDS A;  4M3D A;  2XSD C;  5F0C A;  2TRT A;  4ICH A;  2Y9Y A;  5M5W J;  1W0U A;  4JX4 A;  4M3E A;  2HXO A;  2MSY A;  5F27 A;  3JR9 A;  4FE4 A;  3HGG A;  2TCT A;  3BHQ A;  2I10 A;  3TP0 A;  1A5J A;  1GDT A;  2L7F P;  1AKH A;  5EZG A;  2AO9 A;  3OSG A;  1UHS A;  2KDZ A;  1PUF A;  1S7E A;  1F36 A;  2WUI A;  2WGB A;  1JTX A;  2EH3 A;  1AKH B;  1X58 A;  2NVT J;  4XRM A;  5EEA A;  3CDL A;  1IG7 A;  4CGR A;  1JTY A;  1LFU P;  3B6C A;  1PUF B;  4MIM A;  4A93 J;  2HOT A;  2NP5 A;  4D5C A;  1IC8 A;  3JRB A;  2QKO A;  3PPB A;  4B1R A;  4NDL A;  4RBO A;  3EGQ A;  2FJ1 A;  2OER A;  2XGD A;  3WHC A;  3KKC A;  1NK3 P;  4A3F J;  2QCO A;  2WB1 N;  2ME0 A;  4M6V A;  2WAQ N;  3NXC A;  5EGO A;  2GFN A;  2M0C A;  2JA5 J;  1FTT A;  1VI0 A;  4XID A;  1U78 A;  3GZI A;  2EZK A;  2MGQ A;  2HXI A;  3HBL A;  3QKX A;  5D19 A;  1JUS A;  1FIA A;  3PAS A;  1YRN A;  1HDP A;  2CQQ A;  4JYK A;  5EGO B;  1B72 A;  3TP3 A;  5HAW A;  3A01 A;  5EYR A;  3BT9 A;  1XG1 A;  2FQ4 A;  1HF0 A;  5AQC A;  5IP9 J;  3SJM A;  2PZ9 A;  2P81 A;  2IEK A;  1OCP A;  3FIW A;  4GCL A;  4DYR A;  1YRN B;  4JKZ A;  3RD3 A;  1I3Q J;  1B72 B;  1WPK A;  3I4M J;  1VF9 A;  3A01 B;  5J3L A;  5IYD J;  2NVQ J;  1OFC X;  2DMT A;  2OF7 A;  1MBH A;  3LSJ A;  3ANP A;  3P9T A;  5HSZ A;  1GUU A;  1UI5 A;  4BBR J;  3T6N A;  2K9S A;  4M3F A;  3V6G A;  3VOK A;  5J1U A;  2K40 A;  3QPS A;  4D7N A;  4D7M A;  3NAU A;  5F08 A;  5GP9 A;  3MNL A;  3RH2 A;  1MH4 A;  2XGC A;  4MXM A;  2NS7 A;  2EQR A;  3A03 A;  5C4Y A;  2PMZ N;  3HTH A;  2ID3 A;  2XB5 A;  3IUV A;  4GCK A;  4JX5 A;  4XRS A;  1AHD P;  1ETK A;  2W48 A;  1QVU A;  4A3J J;  2E2I J;  1FJL A;  3HGY A;  3HEF A;  5EF6 A;  4I6Z A;  3LWJ A;  2HOS A;  3I4N J;  1HCR A;  2DJN A;  4DZP A;  4YZE A;  2LR8 A;  1JJ8 C;  4V2F A;  1Y1W J;  2UXP A;  1SGM A;  2DA1 A;  3M4O J;  2QTQ A;  1JUM A;  2MW8 A;  2O9L A;  5FGL A;  1T56 A;  3KZ9 A;  2AHQ A;  2D6Y A;  3B6A A;  5E3L A;  2N8G A;  2ZCX A;  1GV5 A;  5E3O A;  3LSR A;  2R7Z J;  5GPA A;  1RET A;  1MH3 A;  2DMN A;  4FCY A;  1I50 J;  5GPC A;  5EFY A;  2CUF A;  2R5Y A;  4A3K J;  3Q0V A;  3B81 A;  1O4X A;  2HKU A;  3RKQ A;  4ABZ A;  4A3M J;  3JRH A;  3F0C A;  3NRG A;  3JRG A;  1K83 J;  2MG4 A;  3HTJ A;  2R5Y B;  1U8B A;  3HOZ J;  2REK A;  3CRJ A;  2CRG A;  1SFO J;  3RZO J;  1QRY A;  3S1M J;  1ZK8 A;  1JT0 A;  1IGN A;  3CMY A;  5FLV A;  4B3A A;  4M3B A;  3SFI A;  4W97 A;  3GTP J;  1E3O C;  4HNV A;  5D18 A;  1VND A;  2ECB A;  4A3D J;  4ACI A;  1HLV A;  3IH3 A;  2IBD A;  3LOC A;  4JP0 A;  4B4C A;  2DA4 A;  1XS9 A;  2O7O A;  4GFK A;  4BY1 J;  1BL0 A;  3BRU A;  3GTM J;  3HE0 A;  3BTC A;  3A02 A;  3JRA A;  1D5Y A;  4XIC A;  3JRI A;  3IH2 A;  3S16 J;  1LE8 B;  1RR7 A;  3QBM A;  1TWH J;  3HKZ N;  1IV6 A;  2LTP A;  2DTZ A;  5E3N A;  1VFC A;  4X1E A;  3BG3 A;  4QTR A;  3C2B A;  5M3M J;  1ZGW A;  4A3C J;  3BG9 A;  1ZTR A;  1XC5 A;  2XGE A;  4D5F A;  2DA3 A;  2YUS A;  3BR1 A;  5E3M A;  3GEU A;  2Y2Z A;  2M2E A;  2LK2 A;  5FMP A;  3BTJ A;  3G1M A;  3ZQG A;  1RPW A;  3BQY A;  1JKR C;  5H9T A;  2M34 A;  2XPW A;  1X2N A;  4QIW N; 
#chains in the Genus database with same CATH topology
 3VOD A;  4BAY A;  2PI0 A;  2GOX B;  3MWM A;  2H1L A;  2VPR A;  3RI4 A;  1IXS B;  3DKX A;  3HOY J;  4XN3 A;  4B8X A;  2YS9 A;  4I01 A;  1UFM A;  2TDX A;  2KIQ A;  3K6G A;  1GXQ A;  1FYM A;  1TW2 A;  3PIP F;  1VQL I;  2E1C A;  3F8N A;  2QGU A;  4G8X A;  2DXI A;  1WVR A;  4ITV A;  3PFY A;  2HZT A;  1YE9 A;  4C2U A;  5FJ8 J;  4LG0 A;  1U9O A;  3I54 A;  3MFK A;  2EB7 A;  2JA7 J;  4U87 A;  2OTL I;  3VUQ A;  2V79 A;  2Y0S N;  3AAF A;  4MEY F;  1O7F A;  3RPU A;  3CME I;  4EM2 A;  4LG0 B;  2DU9 A;  3IKV A;  4BE0 A;  3E7L A;  1ZHF A;  4FX4 A;  2Q0O A;  2QUF A;  1LB2 A;  2P0W A;  1NG7 A;  2OV7 A;  3O60 A;  3R0J A;  1EJ9 A;  4DBQ A;  4LG3 A;  1DU0 A;  2QEN A;  2VAS A;  1Z7L A;  1YLF A;  2A2F X;  2HQ5 A;  2E1N A;  1BW5 A;  1DGR M;  4XSZ F;  2DO7 A;  4C2T A;  2EZI A;  1ZRD A;  3NI7 A;  3LQQ A;  5F04 A;  1K4T A;  3HOW J;  5D5W B;  3BPX A;  3ZOB A;  5KAF C;  1U8R A;  4MFD A;  5FKK A;  5DS9 A;  2HQN A;  2FU4 A;  3UR3 C;  1JGG A;  2R5Z A;  1V54 H;  4A6E A;  2J5O A;  2XVC A;  4PSX A;  5FLM J;  3CCV I;  1POG A;  4V19 K;  1HKT A;  1Z6R A;  3GTO J;  4KMF A;  4I0A A;  2Y9Z A;  2O03 A;  1VQ4 I;  1FC3 A;  2ZCM A;  2CQN A;  2PMH A;  1HST A;  9ANT A;  5KNL A;  4KMU X;  3T8T A;  1TQP A;  3A4C A;  2R5Z B;  3QPL A;  1E3P A;  3E5U A;  3D1N I;  4GCV A;  4EJU A;  5FRN A;  2GLO A;  1WH7 A;  4RAG A;  4G9Y A;  3J80 Z;  3KP5 A;  3OV8 A;  1D0Y A;  3BLY A;  4C3J J;  4ENM A;  5M3F J;  1SAN A;  5HNH A;  3EPZ A;  4UV8 A;  1QZY A;  3KNW A;  4D0P A;  2ACJ A;  2M87 A;  1T6S A;  1HDD C;  1SVM A;  3OYE A;  5K5O A;  2XAH A;  2Q2E A;  4ASN A;  1G3Y A;  2I5U A;  1IRZ A;  1LE8 A;  3OS0 A;  3M3Y J;  4F7Z A;  1MGT A;  3HOX J;  1QHH D;  2BZT A;  4RAZ A;  2ZOY A;  3HIM A;  2EIL H;  2Q2E B;  1FOK A;  3CDH A;  4YFK F;  2NOG A;  1MKM A;  4F93 B;  2CWE A;  1JKP C;  2HDC A;  2G3B A;  4NHJ A;  4NEL A;  2VJJ A;  3BR3 A;  3FRQ A;  3VOE A;  3RQI A;  5BNG A;  3KYD B;  2F07 A;  2PN6 A;  2E2H J;  1GV2 A;  1XMK A;  3DP7 A;  2VUM J;  4S0H B;  4BS9 A;  2G7L A;  5LHH A;  1D1C A;  1Z3Y A;  5D1R A;  4M6X A;  4ESF A;  4RAF A;  3M9A A;  2MA3 A;  3EUP A;  4BY7 J;  2DOD A;  1SD4 A;  3ANG A;  4AYB N;  3DLL F;  4LIU A;  3T5X A;  2KIS A;  4M9Z A;  1OCO H;  1P7J A;  3KLN A;  5DCF A;  4Q5S F;  1ONV A;  5C3E J;  2JWT A;  1XGM A;  1TWF J;  1WQ2 A;  3C07 A;  4DIQ A;  2XGX A;  1KYW A;  2MBF A;  4UB6 C;  3GCM A;  1V5G A;  3WE3 A;  3ZQH A;  4BNC A;  4GDF A;  1X3Z B;  2LP0 A;  2PG4 A;  1WH5 A;  2Q1Z B;  2V9V A;  4BBS J;  4BJ5 C;  4BKX A;  3H9G A;  2M9H A;  3S2D J;  3S1Q J;  5TGT A;  1QNT A;  3QPT A;  5CVU A;  2UXO A;  3VVY A;  4KIC A;  2UXH A;  3BR0 A;  3GBG A;  3TW6 A;  3BY6 A;  3A0H C;  2JK3 A;  2O6G E;  4XM3 A;  1D5V A;  3DTE A;  4O3M A;  1ETW A;  2M7A A;  4BQN A;  4XLN F;  1W0T A;  4LB5 A;  3BJB A;  3ABT A;  2RNG A;  2LLK A;  2DFI A;  3PO2 J;  2GIZ A;  2DQL A;  2DOF A;  4DJA A;  4F3Q A;  3NS4 A;  4J19 A;  3GTQ J;  5DUK A;  3JTG A;  1R1U A;  1UB9 A;  3L1P A;  3GFI A;  5DD4 A;  5FKM A;  4LLL A;  1PYV A;  3LA2 A;  1QA6 A;  1OLT A;  3FXM A;  5CXG A;  2OJE D;  2NS8 A;  2GWR A;  3H3V K;  2H09 A;  3OYJ A;  3ZPL A;  1R49 A;  1FWZ A;  1ETO A;  2XAS A;  1RUN A;  2QSF X;  5JLW A;  2EPF A;  1EA3 A;  3B02 A;  2BHZ A;  3S1N J;  3FIS A;  4PSW A;  2K9N A;  5CW8 A;  4UHT A;  4CIC A;  3WTX C;  2JSC A;  2W7N A;  3O8H A;  3OSF A;  2HTJ A;  2QF7 A;  2L9S A;  4EM0 B;  2ZCW A;  4NC8 A;  4XLH A;  2BVM A;  1FSE A;  1IW7 F;  2LMD A;  1B9N A;  4UNO A;  3OYG A;  3HSR A;  4NN1 A;  5F6F A;  3DBL B;  3F8C A;  3CWR A;  4OD5 A;  1Z7U A;  2VT3 A;  1FT9 A;  2F5F A;  3VSL A;  1BOA A;  2PQ8 A;  3M8J A;  4A3L J;  1Y1V J;  3RZD J;  3VTI A;  2HI3 A;  5LEJ A;  2PBX A;  4G12 A;  1BW6 A;  3H3U A;  2VJ4 A;  1LVA A;  2NX4 A;  2V9P A;  2FJI 1;  1TWG J;  1X1D A;  2DMU A;  4AC0 A;  2XRO A;  5CQE A;  4ZJZ A;  4PXI A;  3DPJ A;  1FX7 A;  4Y3O A;  1XSD A;  2GZW A;  1NHA A;  3S15 J;  3V4G A;  1Z21 A;  5CVJ A;  2OQG A;  3ZMS A;  1GHC A;  2HOE A;  3PM1 A;  1BC8 C;  4IRG A;  4KDP A;  1UZC A;  3S8P A;  3C1D A;  4IQ4 A;  5J8F A;  2O5R A;  4EGZ A;  1E2X A;  3AFH A;  4HX4 A;  1Z77 A;  5JI6 A;  3FXQ A;  1STZ A;  4LK0 F;  3HOV J;  4U9N A;  1PP8 F;  4EAT A;  2A07 F;  3ML6 A;  4MNU A;  5FKO A;  3TW7 A;  4DW6 A;  4L5E A;  1TQM A;  2VI6 A;  4EGY A;  1BBY A;  4M3D A;  1QO0 D;  3MKZ A;  3K0L A;  1S6L A;  2CGP A;  1KQ8 A;  4M3E A;  2FEZ A;  4E70 A;  5L3E A;  4BHB A;  1FBQ A;  2M45 A;  2BV6 A;  2WAE A;  3BPV A;  3C2G A;  5ILS A;  3Q5F A;  3GXO A;  2TCT A;  2F5D A;  4E7Z A;  3GYH X;  1IRG A;  4RA2 A;  3T8R A;  4XR6 A;  3OSG A;  4BQQ A;  4Q48 A;  3CC2 I;  1YW8 A;  3GFM A;  4A0Z A;  3JSP A;  3N4M A;  1JXS A;  4GRI A;  3G71 I;  2YR2 A;  3GO5 A;  4A12 A;  1R5H A;  4NUB A;  3E6B A;  3HXL A;  1RI7 A;  3ABL H;  5L3D A;  1WSU A;  4XRM A;  3CDL A;  3WU2 C;  4F91 B;  2XSJ C;  3FHZ A;  2NP5 A;  4JK1 X;  4IRI A;  1IC8 A;  2MD5 A;  2XAJ A;  4HSR A;  4NDL A;  2OER A;  3P9I A;  1N25 A;  3FWE A;  4XL9 A;  2Y48 A;  1T2K A;  3KX2 A;  2IA0 A;  3LFU A;  2CS3 A;  1NK3 P;  3W6J B;  2EFN A;  1TP4 A;  1UST A;  2ME0 A;  4M6V A;  1HSJ A;  2GFN A;  2OTJ I;  2D1V A;  3FF5 A;  3WOD F;  1FTT A;  1OKR A;  1D0Z A;  3FMR A;  4O6J A;  1E0E A;  4RLQ A;  3MQ0 A;  3GWZ A;  2LF8 A;  2MGQ A;  3FZV A;  2DDB A;  2DI3 A;  2LOO A;  3LA3 A;  4IJA A;  4NC6 A;  1OMI A;  1JI8 A;  1FIA A;  3O6B B;  5EYR A;  3FMQ A;  2KMU A;  4KIF A;  1B6A A;  2CQK A;  3CMM A;  4CO8 A;  2FQ4 A;  1QZE A;  5IP9 J;  3SJM A;  3FBI B;  2JA2 A;  3CC7 I;  4GCL A;  4AD9 A;  2VJI A;  1VQO I;  3BCA A;  5HS9 A;  5L3F A;  4JKZ A;  3ABK H;  1BJA A;  4IVN A;  2NVQ J;  2BGC A;  4WXD A;  2DMT A;  4QPO A;  3AL0 C;  1MBH A;  3ANP A;  3P9T A;  5HSZ A;  1GUU A;  3VOK A;  4M3F A;  5DM7 F;  2K40 A;  2NYX A;  3QPS A;  4IZZ A;  2OZ6 A;  1YYV A;  3BCB A;  1R22 A;  2XGC A;  4RM2 A;  2ADU A;  1D1B A;  4XOR A;  3S3O A;  3HOS A;  3IUV A;  2X1E A;  4OMZ A;  5H20 A;  4JX5 A;  1ETK A;  4M6Y A;  4KIB A;  1SAU A;  3V7C A;  3HRM A;  3L2V A;  2LY1 A;  4I6Z A;  4WCG A;  3PIO F;  4ZYD A;  2IGO A;  3IRR A;  2HOS A;  2DJN A;  1SMT A;  3ZP5 A;  4YZE A;  2LR8 A;  2QA4 I;  1AOY A;  1Y1W J;  2UXP A;  4XNF A;  1T38 A;  3BDD A;  4BE2 A;  1JUM A;  2A68 F;  5ILV A;  5HLT A;  2O9L A;  2M4K A;  2CO5 A;  3CP8 A;  3DBH B;  5FGL A;  5KAI C;  3I5U A;  4OIO F;  4PJ0 C;  3CUQ C;  4N9H A;  2ZCX A;  5D4S A;  2UXN A;  5GPA A;  3OIQ A;  5GAG J;  1BM9 A;  4FCY A;  4U0W A;  4HV5 A;  1VQM I;  3K70 C;  3CO6 C;  5EFY A;  2CUF A;  4A3K J;  3Q0V A;  4XKW A;  3ZMU A;  3WGI A;  2ISY A;  3DTK A;  3ELK A;  1SMY F;  2K85 A;  5CPR B;  1TQI A;  3SZG A;  2IS2 A;  1O3Q A;  2G9W A;  4G6T B;  1P9Q C;  3PQK A;  3OYB A;  4XSX F;  2REK A;  3HZJ A;  3EYI A;  1QRY A;  2K5C A;  2CV2 A;  1O3T A;  3SFI A;  3WGG A;  2K7L A;  1MW7 A;  4HNV A;  2ECB A;  4CZZ A;  4A3D J;  5BOX A;  4BQO A;  1ACI A;  1HLV A;  3BRO A;  3PNV A;  1XS9 A;  3SEQ A;  2O7O A;  4GO1 A;  1TZL A;  3CJT B;  3AG1 H;  3T0Y A;  3CCM I;  2JTV A;  1R23 A;  2B1E A;  2VBZ A;  3HE0 A;  1FP1 D;  3JRA A;  1YHQ I;  3S93 A;  3S16 J;  1RR7 A;  1ZG1 A;  3CD6 I;  3BZC A;  1SFE A;  3HKZ N;  4H0E A;  2H27 A;  2DTZ A;  1J75 A;  2EFO A;  1Z91 A;  4PJJ A;  2CQ7 A;  5IT9 K;  3H35 A;  4EJV A;  5M3M J;  3ZN0 A;  1ZGW A;  4A3C J;  1HC8 A;  3QU6 A;  2A69 F;  3K8P C;  2XF7 A;  1W7P A;  3DXJ F;  2L4M A;  3BTJ A;  2LSO A;  2OZU A;  2DPD A;  1RPW A;  1EH7 A;  4WXH A;  3ULQ B;  2IS6 A;  2VQH A;  3CLO A;  3VFZ A;  2I8D A;  1ZYR F;  5HLH A;  4KIS A;  2VOP A;  1NG6 A;  5LBQ A;  2ESH A;  3DEU A;  3U21 A;  1W7P B;  5GTH C;  1C0W A;  4C3I J;  3HSE A;  2QIB A;  3QYE A;  1TWC J;  4BXX J;  1U9N A;  2PX9 A;  5J1Y A;  2X1C A;  3P9K A;  3BR6 A;  3W2W A;  3WGH A;  2F4I A;  1PJR A;  2DQR A;  3BQZ A;  2DA6 A;  4JQF A;  3VP5 A;  2LKX A;  1JE8 A;  3CJN A;  4IEJ A;  4JL3 A;  1XSV A;  2LG4 A;  3NEU A;  1YIJ I;  3EET A;  3HJE A;  4BXU A;  1G2H A;  2LKS A;  5HNF A;  3IKT A;  2LD5 A;  3VOX A;  4HOB A;  2JPB A;  5LGN A;  1MSF C;  2OCC H;  4MLO A;  2QWW A;  1MBE A;  3OL3 A;  4KT5 C;  2CH0 A;  2DCE A;  3ECO A;  4I99 C;  1J59 A;  3W6V A;  3H5N A;  4HPQ A;  4EMS A;  4I09 A;  2HDD A;  1QU3 A;  3D5R C;  1X1P A;  4BXF A;  5GTI C;  2X51 A;  2YVH A;  2P4W A;  3UKG A;  3G3Z A;  3JAM Z;  1KU2 A;  4GXO A;  2ELJ A;  4HQE A;  3OYM A;  4MQV A;  2YVE A;  1K61 A;  4CCM A;  2HQA A;  1KU3 A;  1B59 A;  2HFH A;  4LLN A;  3I64 A;  1SC7 A;  2L5Q A;  1XGO A;  2XV4 S;  4B3X A;  4XLP F;  2P7C B;  2GEN A;  5EZH A;  2R7V A;  4XLC A;  1E17 A;  1D8K A;  1FPQ A;  4Y13 A;  5CXI A;  3L2W A;  4IHS A;  1VQ6 I;  2VOD A;  4HF0 A;  1TTY A;  3MEX A;  3WU1 B;  5IOY A;  4QPQ A;  3BJO A;  3WG7 H;  4QSH A;  2CFO A;  2CFX A;  4ZYG A;  4C30 A;  4FT8 A;  1OQY A;  4ANJ A;  4S04 A;  3CCE I;  2OCE A;  2L9R A;  3M8F A;  4UV9 A;  4F52 A;  4FTH A;  4Z2Y A;  1VQN I;  1ORK A;  3KFW X;  2ZJQ F;  5FLX K;  2H6C A;  2LH9 A;  4UUS A;  3FXK A;  2B63 J;  2X85 A;  5FD5 A;  2CV0 A;  3MZ8 A;  3DPL C;  1MND A;  4A0Y A;  3CP2 A;  2VE8 A;  3ZMZ A;  4RM3 A;  3KEY A;  3DU6 A;  4UUS B;  4L9V A;  5KVR A;  3VPR A;  2V57 A;  2GBY A;  3V7S A;  4L9T A;  4E7K A;  1X3W B;  2H6B A;  3QOP A;  2CSO A;  2OUM A;  3PL8 A;  2DT6 A;  1QVT A;  3U2R A;  1WJA A;  2Y31 A;  5CVR A;  3BCG A;  4HF2 A;  2L02 A;  1AU7 A;  2JN6 A;  1APL C;  1H88 C;  2JZY A;  1Z6T A;  1A04 A;  2H1K A;  1SAX A;  4M74 A;  2R0Q C;  2BW3 A;  1PDN C;  1MBG A;  2DN0 A;  2XRN A;  3S2W A;  3L7W A;  4M73 A;  2FUG 2;  4WXC A;  4ME9 A;  3HOT A;  2XPV A;  1RR8 C;  3IC7 A;  2K02 A;  3GUD A;  3K70 D;  2BW3 B;  3NAR A;  4A69 C;  3FDY A;  3WE2 A;  3ZQL A;  1GT0 C;  3QYB A;  2RC4 A;  4MGR A;  2JSP A;  3NWS A;  2LFB A;  1IN7 A;  3JRC A;  3BG7 A;  3FK6 A;  1X2M A;  1K6Y A;  2VN2 A;  2QQA A;  1DP3 A;  4Y7N J;  2OPT A;  3CCJ I;  4EEF G;  2HNH A;  2ZOZ A;  3I59 A;  1WWX A;  4EM1 A;  3CCR I;  1Y0U A;  2CW8 A;  1IN5 A;  3QP5 A;  2XRL A;  1IZ1 A;  1HOM A;  4XKC A;  2ME6 A;  2PMZ A;  3WTV C;  3ZMT A;  3COL A;  3PJR A;  2Y0M A;  3I59 B;  4GFB A;  1RKT A;  1XGS A;  3ZR8 X;  3LWF A;  2WA0 A;  1ULY A;  3HOU J;  4B48 A;  2XUB A;  3TO7 A;  2STW A;  1ZLK A;  1NTC A;  3L2U A;  1MIJ A;  4JNN A;  1Z9C A;  1SFK A;  1JKQ C;  4ZZD A;  4N4O B;  4DVY P;  2LKP A;  2R7D A;  3ZQC A;  4MO7 A;  1ZEL A;  5K58 A;  2A05 A;  2UXI A;  3FXJ A;  3NRV A;  1JGS A;  2IJL A;  1KYZ A;  2CU7 A;  2JVH A;  2W1O A;  5B66 C;  1YO5 C;  2QLZ A;  2DMQ A;  2OC6 A;  2FSW A;  4IQJ A;  2VXD A;  2E7W A;  1ERD A;  2ZB9 A;  2P6S A;  4BAC A;  4OD4 A;  1U3E M;  3GTK J;  2M8G X;  1LDK B;  3ONQ A;  3IP4 B;  3G1L A;  4PCQ A;  5KHD A;  4IKF A;  1I27 A;  1P4W A;  5LHI A;  1ZR4 A;  2E2J J;  2QZ8 A;  1GVJ A;  2AXT C;  2HPI A;  2ZCN A;  3LSK A;  1ZKG A;  2JVG A;  4IHY A;  5L3C A;  5GAH J;  1AWC A;  1RNL A;  1TT5 B;  2F5V A;  1A6Q A;  1AA7 A;  3N97 A;  5IY5 H;  1UMQ A;  3SYT A;  3JAM K;  1J2X A;  4JBA A;  4BDZ A;  2QKL B;  3V8L A;  4V2G A;  2RDP A;  2EZL A;  4EQQ A;  1L3L A;  1H0M A;  3LHQ A;  1MNM C;  1WJC A;  5DEQ A;  3TBI A;  3RSN A;  2OA4 A;  1SEU A;  2PMU A;  3R0A A;  3GLX A;  4M72 A;  5FB2 A;  1REP C;  4BDY A;  2IGN A;  3DWL E;  2O8X A;  3DF8 A;  4PJL A;  3CLQ A;  3LSP A;  1VQ7 I;  3BTI A;  3ESW B;  2HOA A;  2V7F A;  1ZG3 A;  4UUT A;  1XTA A;  1F1Z A;  4XK4 A;  1I1G A;  5HS7 A;  2KQR A;  3EYY A;  4KIT B;  1YIT I;  2LYC A;  1ETV A;  4QWQ A;  2RN7 A;  2W57 A;  2D1H A;  1XMX A;  4PK4 A;  4M9X A;  5IP7 J;  3HTI A;  1EV7 A;  3DEE A;  4DNC A;  3VVZ A;  3KE2 A;  5IP6 A;  2BY2 A;  3R6S A;  3GZ6 A;  3H5R A;  5BMZ A;  1XDU A;  5DTD A;  1RC9 A;  1X1C A;  1EF4 A;  2HDW A;  1IN6 A;  4IL6 C;  4UVC A;  3L2C A;  4AF5 A;  4L9N A;  2QEX I;  4DQ2 A;  5J4V A;  1ETQ A;  5FKL A;  3U9G A;  3OYK A;  3H92 A;  3QOE A;  2L4A A;  4BQA A;  5BS6 A;  1KU9 A;  3K7A J;  2FD5 A;  3J7A O;  1ZN2 A;  2DOE A;  5IPA A;  3ISP A;  3I55 I;  2EIM H;  4U0V A;  4YG2 F;  1B9M A;  2OD5 A;  1U2W A;  3FK7 A;  2O8K A;  3IUO A;  3S5R A;  2XDN A;  4GYG A;  2QSG X;  2VON A;  3HIF A;  3OS2 A;  2IA2 A;  2ZXH A;  2TRT A;  1DUX C;  3BP8 A;  1A35 A;  5M5W J;  2HXO A;  2MSY A;  5F27 A;  2M30 A;  2WAD A;  1IRF A;  1HKQ A;  1I1S A;  4XLF A;  3GFJ A;  3EUH A;  3HSF A;  4P1W A;  4U7D A;  2FBK A;  3ZQ7 A;  4FE4 A;  5D8L B;  3BHQ A;  2X6X A;  1IXR C;  4BEH A;  1TT0 A;  1GDT A;  2DK8 A;  2L7F P;  2FOW A;  2R7F A;  1AKH A;  2AO9 A;  1XB4 A;  4HX8 A;  2W24 A;  1UHS A;  1PUF A;  1S7E A;  1F36 A;  2WUI A;  2WGB A;  1XCV A;  1JTX A;  2A6E F;  3LL7 A;  1V3F A;  4BEH B;  5HDG A;  2HZD A;  4RAY A;  4ZYH A;  1WI9 A;  1AKH B;  1LJ9 A;  2VJ5 A;  2ZO4 A;  5EEA A;  4CGR A;  2H94 A;  1PUF B;  3C7J A;  3ZGK A;  1X3U A;  3H5A A;  4D5C A;  1XSX A;  2FMY A;  4HX7 A;  4B1R A;  3LAP A;  5ILU A;  4Z6Y A;  1U5T A;  4RGX A;  3A0B C;  3E5Q A;  4A3F J;  1VQ5 I;  3GLL A;  2QCO A;  5J8C A;  2WAQ N;  5EGO A;  3MCZ A;  1IUY A;  2L54 A;  3DV8 A;  1U5T B;  4P9U A;  1VI0 A;  3NQO A;  3OIP A;  3I56 I;  2EZK A;  3HBL A;  2HXI A;  2WWY A;  3QKX A;  5HLG A;  1T0F C;  2LBF A;  3BZK A;  1YRN A;  2J5P A;  4JYK A;  5EGO B;  1B72 A;  3K4K A;  1FOW A;  5HAW A;  4C9Y A;  4UY8 I;  1MJ9 A;  1HF0 A;  1T95 A;  2PZ9 A;  2MLG A;  2P81 A;  1OCP A;  1G6N A;  4ZH4 F;  3OYF A;  2LBF B;  2VQL A;  1YRN B;  1B72 B;  3I4M J;  3WTT C;  3DU5 A;  4PJN A;  3FM5 A;  5J40 A;  3L9F A;  3V6G A;  4B44 A;  5J1U A;  1MMA A;  3I71 A;  2Y75 A;  3MNL A;  4D7M A;  5GP9 A;  4I0B A;  2P6T A;  4E6K G;  3NWT A;  4L0Z B;  2IW5 A;  5H6R A;  5H6Q A;  1NH3 A;  3HTH A;  2ID3 A;  1T08 B;  2MAB A;  2XB5 A;  3WTS C;  1F5T A;  4KJZ A;  2KRH A;  2XAQ A;  3CCS I;  2JUC A;  2W48 A;  2E2I J;  1FJL A;  3HEF A;  4KN7 X;  5AIQ A;  1YG2 A;  1FBS A;  4HBL A;  3OOP A;  3IL2 A;  1JJ8 C;  1EH6 A;  4XOP A;  1BI3 A;  4V2F A;  2D45 A;  1OCZ H;  1WJ5 A;  3R61 A;  2VC1 A;  2KKO A;  3ERM A;  3PSI A;  1TW3 A;  3UNG C;  4MQ9 F;  3H9J A;  1FY7 A;  3KZ9 A;  2GA1 A;  4Y4R A;  5LEK A;  2D6Y A;  3B6A A;  1BI1 A;  2IT0 A;  2ZME A;  1GV5 A;  2JRM A;  3GME A;  2R7Z J;  2WC2 A;  2Z9O A;  1WKM A;  4NBQ A;  4PFO A;  4RB2 C;  1MH3 A;  2DMN A;  2WV0 A;  3DBR B;  3K4N A;  5E1W A;  5GPC A;  1GXP A;  5JHF A;  2DOA A;  2DFF A;  2ZME B;  3B81 A;  1O4X A;  3RKQ A;  5LRR A;  2DK5 A;  4ENN A;  2PJP A;  1R7J A;  2O61 A;  1R4N B;  3F0C A;  2IGM A;  3NRG A;  3RDI A;  3W2V A;  3REO A;  1K83 J;  2MG4 A;  2KJC A;  4E7S A;  3PQJ A;  5DDG A;  1MMN A;  3HOZ J;  2MYS A;  4A5N A;  3CRJ A;  1SFO J;  3H36 A;  1FMV A;  3S1M J;  5EEG A;  4KYW A;  1JT0 A;  3CMY A;  3F21 A;  1FP2 A;  2NNN A;  2UXX A;  4ON0 A;  1LUJ B;  4ACI A;  2E60 A;  3IH3 A;  3LOC A;  4B4C A;  2RKH A;  4BHC A;  5IT9 Z;  3RJP A;  4GFK A;  1WJD A;  3HHG A;  3TGN A;  3COA C;  3BRU A;  3PFI A;  3GTM J;  3QRF F;  4RGR A;  4AVZ A;  2K4J A;  1R6R A;  2KDO A;  4HNT A;  4XIC A;  2QYO A;  5CVV A;  1L0O C;  3E1S A;  3IH2 A;  3CJQ B;  3EUA A;  3LSM A;  5FGM A;  3P9C A;  3KZI C;  3OYL A;  3QBM A;  1RRJ A;  1TWH J;  1X19 A;  1IV6 A;  1D1A A;  2E5N A;  3K4B A;  3PNT A;  1VFC A;  1Y56 A;  3BZ6 A;  5B1B H;  2R7W A;  3SDB A;  3C2B A;  1MMS A;  4ZYA A;  2XIG A;  3BG9 A;  2Z2S B;  3H3Z A;  4Y15 A;  2K9L A;  2XGE A;  1IXC A;  4D5F A;  5E3M A;  1FLI A;  4I02 A;  3G1M A;  3LST A;  3ZQG A;  5JR3 A;  4IF4 A;  1XMA A;  2BHY A;  3BQY A;  2HS5 A;  1MJB A;  3G7R A;  3ZXS A;  4QIW N;  4AUX A;  5DM6 F;  1N75 A;  1S7O A;  1UJ8 A;  3F9K A;  3GTJ J;  3CJD A;  4RB3 C;  2ID6 A;  3WTU C;  3SHF A;  2EFQ A;  3E6D A;  1FEX A;  3MKW B;  4PGH A;  1YFH A;  3RCO A;  1FZP B;  4HW0 A;  2NAZ A;  2VBX A;  4CYC A;  4CHU A;  4IHV A;  2F6C A;  3OYH A;  2XHK A;  2CJJ A;  3HC7 A;  1OYY A;  5K7H A;  2CUE A;  3K9T A;  1W5S A;  4C2M A;  3EUK L;  2DBB A;  3MZY A;  1X4P A;  4NC7 A;  2WV1 A;  2VIX A;  1R58 A;  3VW1 A;  3QWL A;  4CYC B;  2Y30 A;  5HDK A;  4X0G A;  4LFU A;  3HB9 A;  3J7Y J;  4PFP A;  1T39 A;  2XB0 X;  1N77 A;  4RMN A;  1H8A C;  1SVL A;  1BIB A;  3VW2 A;  4OMY A;  4B43 A;  2UZK A;  2E19 A;  3MVP A;  3CMA I;  3BTL A;  2X1D A;  2X6O A;  2EV0 A;  1DPU A;  3Q3S A;  5TIS C;  3LA7 A;  3JRD A;  1T8I A;  2E5Z A;  1JT6 A;  2BY3 A;  3L09 A;  4BJT A;  4E4H A;  1IDY A;  4FET A;  1I39 A;  1BJZ A;  4CSW A;  3U1D A;  2HYJ A;  4EV0 A;  4IHW A;  1BR1 A;  2Z33 A;  4OIR F;  4CUG A;  1WRJ A;  3L2Q A;  2NNY A;  4YFN F;  1K4S A;  1G59 A;  1YOV B;  4R1H A;  2ECC A;  3C2H A;  4HDU A;  2DA7 A;  3OMY A;  4W1U A;  2IP2 A;  2R7S A;  4LIV A;  2WTE A;  3V8J A;  5FLX Z;  5C44 J;  2NVX J;  1BA5 A;  3VYU B;  1I6H J;  3OL4 A;  5HBU A;  2DG8 A;  2IXS A;  3CES A;  3W6K B;  2RAS A;  1ITY A;  4C3H J;  2COB A;  2W53 A;  5LLQ A;  2P5K A;  1YX5 A;  2W85 A;  2QOP A;  3F22 A;  3N05 A;  1ZR2 A;  2IS4 A;  3CCY A;  3JSO A;  1P4A A;  3MMY B;  5GAE J;  3VW0 A;  2M0M A;  4CCJ A;  3I58 A;  1MBF A;  2VL8 A;  4R8H A;  2HKX A;  2R93 J;  3HKZ A;  5HLI A;  3PUB A;  2DDA A;  4NQW A;  3GFL A;  2F2E A;  3QYF A;  1I3A A;  4AWX B;  2E1M B;  3P5J A;  5F1J A;  5ED4 A;  2WY7 Q;  3RQ4 A;  4AC6 A;  3I53 A;  4E7I A;  1Z05 A;  3DEW A;  3NNR A;  1GLN A;  5F1R A;  4NQW B;  2BY0 A;  2YX4 A;  3OR1 C;  5LGU A;  3D0S A;  3RKW A;  5EDN A;  3J7A Y;  2DFH A;  2P8T A;  2WBM A;  2JMW A;  2GXB A;  3K2Z A;  2CUZ A;  2RHA A;  3HRS A;  1FYK A;  2WB1 A;  5F0H A;  5EJC A;  4KWA A;  2W84 A;  3PNY A;  5DYM A;  5K5Q A;  1ON1 A;  2H8W A;  5ERI A;  2VOO A;  5TJJ A;  3KP3 A;  3FXU A;  1HW1 A;  3F6O A;  5K7F A;  3ZN1 A;  2L9V A;  2RAE A;  3FKI J;  4J00 A;  4ZYE A;  1ZGJ A;  5D5X B;  2ELK A;  3VSK A;  3KP6 A;  5ICG A;  1W36 C;  1R00 A;  2DT5 A;  2DJI A;  4C2M J;  1IRX A;  1MSE C;  1J0R A;  1OYW A;  3HTU A;  2DA2 A;  3MD2 A;  3DLA A;  3PO3 J;  1FTZ A;  2BOL A;  5HOD A;  4L62 A;  2X4H A;  3KYC B;  4HKU A;  2IA1 A;  2LF7 A;  3ECH A;  4F92 B;  1KA8 A;  3R4K A;  4EJO A;  3CF5 F;  2XKP A;  4XOT A;  5IYC J;  4LB6 B;  4FQG A;  3ZQF A;  1VQP I;  3K4J A;  5F64 A;  3FKJ A;  4EVI A;  5J47 A;  2XPU A;  3RTR A;  5E20 A;  3F8B A;  2ELH A;  3K10 A;  3V42 A;  2FBI A;  1DU6 A;  2CV1 A;  4L18 B;  4WF2 A;  2BYV E;  3Q9V A;  3D5S C;  4BJ6 C;  4ZDO A;  1BOB A;  3OY9 A;  4CCO A;  1W1W E;  2FOK A;  3GZN B;  4HQM A;  5IYB J;  3TDU C;  4ZTF A;  1FMW A;  2XKO A;  3HPH A;  1YW7 A;  1Z67 A;  3OOU A;  4CCK A;  1K79 A;  3ASN H;  3GZ5 A;  3FM3 A;  2GXA A;  3RKY A;  3K4L A;  1OPC A;  2A6T A;  1UG2 A;  1W4M A;  1KU7 A;  1TWA J;  5C4X J;  2ZJP F;  5CJ9 A;  5DCM A;  4E7L A;  5DUI A;  3G2B A;  4ZDP A;  4IXA A;  1OIS A;  1Q1H A;  1Z1D A;  2IAI A;  2Z5U A;  1LNW A;  2MH9 A;  3O2P E;  1NK2 P;  3KZY A;  2M7B A;  5DCM B;  1VQ8 I;  2DG7 A;  5FFZ A;  4N4N B;  1ZQ3 P;  4FX0 A;  2DT7 B;  3JSJ A;  2DMP A;  1UAA A;  1H9G A;  2KP6 A;  1YJN I;  3EUH C;  1ETX A;  2L0K A;  4A2U A;  1JHH A;  4MTE A;  3GX4 X;  2FRH A;  1QQI A;  1QHG A;  3MZH A;  3S14 J;  2D5V A;  4YIR X;  2L7K A;  3E6M A;  1XN7 A;  2V1D A;  5FO5 A;  2Z16 A;  2GUH A;  4XRF A;  5J1R A;  5ICE A;  2FX0 A;  3KP7 A;  2IS1 A;  4F55 A;  3ROU A;  2XF6 A;  2CQX A;  2JA6 J;  3BJ6 A;  3QOD A;  1CQT A;  2B7E A;  1P7I A;  4Q47 A;  3C18 A;  4DZJ A;  5E8G A;  4M9S A;  2BEO A;  3TO9 A;  2BVL A;  1OYI A;  1H9T A;  4Y52 J;  1Y8R B;  1LPQ A;  1IJW C;  3F1B A;  2FQ3 A;  2HVQ A;  3H0G J;  2DPU A;  2EJR A;  2KIF A;  1MMD A;  4KUM A;  2VE9 A;  4LJZ F;  1U5T C;  1MBK A;  3G4S I;  2G7S A;  5B1A H;  2COM A;  3E5X A;  4EJW A;  4IRV A;  1O3S A;  1R36 A;  5GAD J;  4YRV A;  1T98 A;  4UB8 C;  2RV8 A;  4BHP A;  2DA5 A;  3V78 A;  3OYI A;  4OIN F;  1TNS A;  3WHB A;  1ZGA A;  2MC4 A;  3QQA A;  1F43 A;  2JQ7 A;  3ERE D;  1HXD A;  2FBQ A;  1S29 A;  1RKW A;  3MKL A;  1LKX A;  1PP7 U;  2G7G A;  5E18 F;  2UXU A;  2BBY A;  1WGX A;  2EIN H;  1S8N A;  1F9N A;  3LNQ A;  1WJE A;  2AQF A;  3BG5 A;  3FXO A;  3TMO A;  1RZ4 A;  4U0Y A;  1FIP A;  1YQA A;  3VIB A;  1HQC A;  2XSD C;  2A3S A;  3F72 A;  4I98 B;  1W0U A;  4JX4 A;  4HZF A;  3BG6 A;  1HW2 A;  3JR9 A;  3CZ6 A;  2IRF G;  3MKY B;  2M5W A;  2YPR A;  2ZNZ A;  1FOX A;  3HGG A;  3SWH A;  2O0Y A;  2I10 A;  1RUO A;  4BGD A;  1BI0 A;  2XF5 A;  3F8F A;  3OYA A;  2A5Y B;  2NRA C;  2EA2 A;  4BL0 B;  2CYY A;  2HVR A;  3W2A A;  4LIT A;  3HRU A;  4HF1 A;  1XDS A;  2EWN A;  4P9F A;  2HKO A;  2Y0S A;  4YIF A;  2ZNY A;  4MEX F;  1TLH B;  1BN5 A;  2EH3 A;  3VWB A;  2K86 A;  2GOM A;  1OR7 A;  3VDX A;  2OBP A;  1IG7 A;  3J7Z I;  1JTY A;  1LFU P;  3FMS A;  2DYS H;  3JRB A;  2QKO A;  3PPB A;  3RPU D;  4ZZL A;  3E3V A;  4OU0 A;  4RBO A;  3EGQ A;  2FJ1 A;  2DW4 A;  4AIK A;  2V1N A;  2R7U A;  3WHC A;  2EIJ H;  2KIU A;  1MMG A;  2ZME C;  3KKC A;  5D8K B;  3CUQ A;  1R5I D;  2DLL A;  2E36 A;  2M0C A;  2JA5 J;  2X0L A;  5BPD A;  4CGZ A;  1J5Y A;  3KCC A;  3ZCO A;  4N9I A;  1U78 A;  3GZI A;  2KRF A;  4B47 A;  2CW7 A;  3CUQ B;  3AG2 H;  5KCM A;  3PAS A;  1YJ9 I;  2LDU A;  2RGV A;  1W36 D;  3F23 A;  2QQ8 A;  3A01 A;  1XG1 A;  4HLY A;  3Q9S A;  3OYN A;  5AQC A;  2YU3 A;  1E3H A;  2O3F A;  2W4S A;  3E0J B;  3LFK A;  2IEK A;  5JVT A;  2VC0 A;  1I3Q J;  2LRE A;  1MJA A;  1VF9 A;  3A01 B;  5J3L A;  5IYD J;  2KJB A;  1OFC X;  1DPR A;  2OF7 A;  3GEZ A;  3LSJ A;  4M71 A;  5HDN A;  4I7H A;  1W5C C;  3J81 K;  3HTS B;  3T6N A;  3A2K A;  3JCU C;  4ZDL A;  4H4K C;  2ZXI A;  2EK5 A;  4BYY A;  1O3R A;  3RH2 A;  2M3A A;  3JTH A;  2IPQ X;  1SFX A;  3TDZ C;  3WTW C;  3SZT A;  4XLE A;  1LDJ A;  2LRD A;  2EQR A;  3A03 A;  4MXM A;  3MAJ A;  1QGP A;  5C4Y A;  2PMZ N;  4LGW A;  1VTN C;  4GCK A;  1AHD P;  1G4D A;  2ZXW H;  2P5V A;  1QVU A;  4A3J J;  1X1B A;  2L2O A;  3S3M A;  3HGY A;  3VB2 A;  5EF6 A;  4RGU A;  2PEX A;  3FXL A;  1HCR A;  2QQB A;  1S3J A;  5D5V B;  3DTI A;  2R3S A;  3EQL F;  4GGG A;  4CXF A;  3M4O J;  1SGM A;  2BXZ A;  2WAF A;  1UG0 A;  2MW8 A;  3M1E A;  4Q4Z F;  2R7X A;  4HV6 A;  4RGS A;  4G6D A;  1FYL A;  2AHQ A;  4IOA F;  2EFW A;  5JFR A;  2N8G A;  2F5E A;  5E3O A;  3LSR A;  4A0X A;  2HYF A;  1I50 J;  2ZJ2 A;  4TV7 A;  2RVC A;  2XAU A;  4XON A;  4AYB A;  5CQG A;  4KNY A;  3KLO A;  4XKV A;  5FD6 A;  1HA8 A;  2HKU A;  1LEA A;  2X6Y A;  5E79 C;  3JRH A;  2M4G A;  3JRG A;  2W82 A;  3KET A;  5CVI A;  2RNJ A;  3CF2 A;  3HTJ A;  2RRE A;  1IF1 A;  3I9V 2;  1Y6I A;  3RZO J;  1ODD A;  1HBX G;  4CCN A;  4CDG A;  1WHU A;  1IGN A;  2FE3 A;  2V6E A;  4NB5 A;  4W97 A;  2MH2 A;  3GTP J;  3D5L A;  2R7Q A;  1U0J A;  5D18 A;  2E71 A;  3OYC A;  3RIR A;  1YTY A;  1UCR A;  2KLO A;  2YX7 A;  2IBD A;  1ZRF A;  2QVO A;  1U6G A;  2DYR H;  3GVA A;  2XDV A;  1I5Z A;  3BJA A;  2VBY A;  3ZMV A;  4HAM A;  3AKZ A;  2EV6 A;  2PJR A;  3BTC A;  4N0B A;  4ZC3 A;  3A02 A;  2NS0 A;  1D5Y A;  2WAQ A;  2XAF A;  3HYI A;  4AU7 A;  2ZSI B;  1YJW I;  1N78 A;  1LE8 B;  2FML A;  1Y0N A;  2B3W A;  2PJR B;  5E3N A;  4J01 A;  4X1E A;  2R7O A;  5EEH A;  3BG3 A;  4QTR A;  1X4O A;  4U9L A;  5E1X A;  1ZTR A;  3M1C A;  4L5I A;  1R1T A;  1XC5 A;  2FF4 A;  4KFC A;  2Y2Z A;  2LK2 A;  4BU2 A;  2ZSH B;  1JKR C;  2KFD A;  1ZRC A;  2UUZ A;  2XPW A;  2ZFU A;  3AG4 H;  2YVX A;  3KYL A;  3PUF A;  1J7K A;  3KEO A;  1LQ1 A;  3ZMD A;  1FNN A;  2GM4 A;  3MN2 A;  2V9K A;  2FA5 A;  3TKY A;  4BE1 A;  4JX6 A;  3Q0W A;  3K4C A;  5JLX A;  2RQP A;  4AIH A;  5DV5 A;  4BH9 A;  3C3W A;  4XKB A;  2E1M C;  3K4M A;  3GTL J;  1G3S A;  3JRE A;  4RB0 A;  2PLY A;  3CQZ J;  5HOO A;  1IAW A;  1UI6 A;  1BI2 A;  1X1A A;  2EZH A;  1DQU A;  4UUV A;  3RKX A;  2JJ7 A;  2NXN B;  3G56 A;  4G94 A;  4RDU A;  1V55 H;  3SXY A;  3K1N A;  5B3S H;  2DTR A;  1BR4 A;  1S5L C;  3IAM 2;  5CLS A;  2VKV A;  3RYP A;  1TNT A;  2EA4 A;  4FE7 A;  5KK1 A;  3ON2 A;  2YU9 J;  4U88 A;  5ICF A;  3E7Q A;  1ENH A;  2AQE A;  3FHN A;  4OWR B;  4CH7 A;  2GQQ A;  1IN8 A;  2K3P A;  2G7H A;  1QPI A;  2UWM A;  3ON4 A;  2VB6 A;  5L3G A;  4DBR A;  1B4A A;  2F5C A;  4XN0 A;  3HTA A;  2JPC A;  3SZP A;  4Y17 A;  4IHX A;  4RLF A;  3VYS B;  2HTS A;  1UEL B;  1GVD A;  2R92 J;  3CC4 I;  3B73 A;  1UHM A;  5F0F A;  3EDP A;  3G73 A;  1R71 A;  3KIO A;  4LOC A;  3V8K A;  3P7N A;  4B09 A;  2LY2 A;  1P4X A;  4R79 A;  1B8I A;  3TL4 X;  2E1O A;  1G3W A;  1M1E B;  2HYG D;  1TBX A;  1LFB A;  1XPX A;  4M3G A;  4FHT A;  1Y8Q B;  5CYV A;  1ETY A;  4XBF A;  4CZC A;  4OAY A;  3M8E A;  4PUS A;  4MK6 A;  4U7B A;  3DFG A;  3ZQI A;  4IX7 A;  3Q0U A;  1B8I B;  1PUE E;  3M07 A;  3LSG A;  3IH4 A;  4D9J A;  2RQQ A;  2AXL A;  3S32 A;  4MFE A;  3SFZ A;  3H9Q A;  5B5E C;  4MTD A;  4OIP F;  2L7Z A;  4I76 A;  1T33 A;  2D2W A;  2Z99 A;  2ZXJ A;  1TC3 C;  4A3G J;  2QWT A;  3ASO H;  5BQT A;  4AM3 A;  1KQ0 A;  2PBI A;  1O7L A;  4P5O A;  1Z0X A;  3HM5 A;  5JVG F;  3J80 K;  1UHW A;  3FBN B;  3IWF A;  1K7A A;  4HEA 2;  3F6V A;  4PZJ A;  4G7O F;  2IU5 A;  5EG0 A;  3KEQ A;  1KZH A;  3CCL I;  3W3C A;  4X6A J;  1F4K A;  1MBJ A;  3ZQQ A;  3CCQ I;  1JKO C;  2YSR A;  3K69 A;  4DGW B;  2NVY J;  4DOZ A;  4CYD A;  2DAO A;  3CUO A;  4PJM A;  4GCT A;  3VVX A;  5EG0 B;  2NP3 A;  4K2E A;  3E97 A;  4LMY A;  4L9J A;  1FBU A;  3BR2 A;  3IWZ A;  2OQR A;  4LD5 A;  1IDZ A;  3T1B A;  3IHU A;  4YEL A;  1V5F A;  5D6F A;  1USS A;  3GF2 A;  4LLG F;  4RS8 A;  1QBJ A;  4I2O A;  2MFZ A;  3SDG A;  1MZB A;  2DFE A;  3BNI A;  4OAZ A;  1BIA A;  4FIS A;  4ZTJ A;  3O8G A;  2HU9 A;  5LHG A;  2AS5 F;  3OIO A;  3IRQ A;  5FHP A;  1R5G A;  4HYE A;  3ABU A;  1VQK I;  4LK1 F;  5A2Q Z;  3HPG A;  3DCF A;  2VKE A;  1WCM J;  4GFL A;  3VYT B;  3F8M A;  4A5M A;  2QQ9 A;  3HRT A;  1HW5 A;  3NPI A;  1D0X A;  3WU0 A;  5IOZ A;  2OAZ A;  2L3D A;  2XAG A;  3K2A A;  4EJT A;  1WJF A;  2G0E A;  3LSI A;  3AQT A;  2HR3 A;  5D5U B;  2F4O B;  2NVU B;  4ETS A;  1IO2 A;  4PDK A;  2HEO A;  5C4J J;  1IN4 A;  4DYC A;  4KA4 A;  1S7A A;  2NOJ B;  4FAS D;  4UXN A;  4KT6 A;  2IVM A;  1H89 C;  1QPM A;  3L00 A;  3TED A;  3H0D A;  3VYR B;  3WTZ A;  2FNP A;  2KIM A;  1SD7 A;  1Q1V A;  1R9T J;  3IV5 A;  1WI3 A;  1JJ6 C;  3KP4 A;  1YW9 A;  4HLX A;  3GW2 A;  3TO6 A;  2B9S A;  1WJB A;  4IOC F;  3OS1 A;  4AID A;  1ZRE A;  1DP7 P;  3K1M A;  3SQN A;  5M5Y J;  2OI8 A;  1A36 A;  2ZY9 A;  4WIB A;  2ISZ A;  1A6I A;  3CTA A;  2KT0 A;  5FRO A;  1VQ9 I;  5K7Z A;  2R4G A;  2GIV A;  4GYI A;  4A3B J;  5D4R A;  2HYT A;  3LJL A;  2O7T A;  5FFX A;  2CMP A;  3S2H J;  3CO7 C;  1I6X A;  2MD0 A;  2MLK A;  4IPA A;  3E6C C;  2H8R A;  3KKD A;  2EBI A;  2LC2 A;  4HRI A;  3TQN A;  1IUF A;  4G7H F;  2L01 A;  2V4J C;  4XLA A;  3KZZ A;  1ZAR A;  4II2 A;  2M1B A;  4IRH A;  3G1O A;  4HST A;  1OCT C;  3S1R J;  4Y33 A;  1DGW Y;  3HDD A;  3ABM H;  3AG3 H;  1RES A;  2E35 A;  5M5X J;  1YI2 I;  4L5J A;  3V7R A;  3TOA A;  2K9Q A;  2PFB A;  1YS7 A;  4II3 A;  1OR7 C;  3OWT A;  1G8X A;  1XD7 A;  4G7Z F;  3SEZ A;  2QM3 A;  1BC7 C;  3LAJ A;  1JUP A;  1ZLJ A;  3FXR A;  2X9D A;  1YS6 A;  2QKM B;  4AIJ A;  2X48 A;  1FOY A;  2LVS A;  2LNB A;  2LY9 A;  5LD2 C;  2V1X A;  1MDM A;  2G7U A;  1LFP A;  5FKN A;  2EV5 A;  4BUP A;  3A1Y A;  2EIK H;  2ETH A;  1K6O A;  5H2F C;  2R7R A;  3S17 J;  2K27 A;  1EKE A;  2CG4 A;  1Y39 A;  1S72 I;  3CDI A;  4XQF A;  3JRF A;  1ZH5 A;  3BC8 A;  2GA2 A;  3DQV C;  3I3L A;  4HG2 A;  5K5R A;  4P96 A;  2ZJR F;  4A3E J;  3CCU I;  1MDM B;  3LSH A;  4XRS G;  4E7J A;  5AON A;  1CF7 A;  4IHT A;  3GTG J;  2JA8 J;  3DPU A;  2L7M P;  3OR2 C;  2EFP A;  1OCR H;  1SD6 A;  2Q24 A;  1T0F A;  1W7P D;  2V1U A;  4KN4 X;  1OJL A;  2ZC2 A;  5DAJ A;  2F48 A;  4DYQ A;  1CF7 B;  3AQS A;  3BR5 A;  2ZKZ A;  4RB1 A;  3IAS 2;  3LMM A;  2KZV A;  4A3I J;  4UDS A;  2HGC A;  5F0C A;  2Z1D A;  2VPL A;  2PFV A;  4ICH A;  2Y9Y A;  1KON A;  2Y69 H;  3I4P A;  2OU2 A;  3G6E I;  2B0L A;  1VZ0 A;  3JW4 A;  4CA0 A;  5E17 F;  2P7V B;  1XX5 A;  2VXZ A;  3HHH A;  1SD5 A;  1LDD A;  1A5J A;  3TP0 A;  3KPH A;  1TL8 A;  1ZAO A;  2F4M B;  1OCC H;  4QLC U;  1XCB A;  6PAX A;  5EZG A;  1W5T A;  1KGS A;  2FNA A;  2HQR A;  3F3X A;  5J6X A;  4S05 A;  2KDZ A;  2BE5 F;  3M7G A;  3LQR A;  3WG9 A;  2BXY A;  1LEB A;  1O57 A;  4HNU A;  2GXG A;  1X58 A;  3L2R A;  1D8J A;  2NVT J;  1QZZ A;  5HVQ C;  4L0Y B;  3B6C A;  2ZFW A;  4MIM A;  2VKD A;  2KL4 A;  4A93 J;  2HOT A;  4ENK A;  1ZG5 A;  1WZ2 A;  5J4Y A;  2JRT A;  1P2F A;  2XGD A;  2JUG A;  5A2Q K;  2QBY A;  1D3Y A;  2STT A;  3NXC A;  2WB1 N;  1ON2 A;  1J9I A;  4YEJ A;  3H1C A;  2XC7 A;  2ICW G;  1J09 A;  4XID A;  2W25 A;  4PGG A;  2QBY B;  4P55 A;  5D19 A;  1JUS A;  1EH8 A;  2VLA A;  1HDP A;  2CQQ A;  2KZG A;  2KPM A;  5HS8 A;  3TP3 A;  3RPQ A;  3J81 Z;  3BT9 A;  2K4B A;  2W00 A;  3QP6 A;  2A5W A;  2JT1 A;  3QAH A;  1R4M B;  1FSH A;  1G3T A;  3FIW A;  3OYD A;  3I0T A;  4DYR A;  3K1P A;  1K78 A;  1WPK A;  2P5L C;  5TRD A;  2ESN A;  1KQ9 A;  1PVE A;  1UI5 A;  4BBR J;  2K9S A;  3RYR A;  2CW0 F;  1K78 B;  4D7N A;  3NAU A;  5D6E A;  5E1Z B;  5F08 A;  2VBW A;  1MH4 A;  2NS7 A;  2WY8 Q;  3BOQ A;  1YIO A;  1MD0 A;  2A6H F;  3DKY A;  1RIO H;  4HA8 A;  4XRS A;  5AIP A;  1A31 A;  2FXA A;  4OIQ F;  3O3K A;  5ICC A;  2CUJ A;  4AVP A;  3LWJ A;  3DKW A;  3I4N J;  4A6D A;  4G6Q A;  4DZP A;  2VQG A;  4XMY A;  2DA1 A;  2GAU A;  3U1K A;  2KHM A;  2QTQ A;  4O5V A;  5K1Y A;  3QU3 A;  2E34 A;  5IT3 A;  3S3N A;  1S9H A;  4WX9 A;  1T56 A;  4YFX F;  5BPI A;  3WTY C;  2HWV A;  5LRS A;  5JHU A;  5E3L A;  2M8E A;  5CKT A;  2E7X A;  3ZRG A;  2V26 A;  3HUG A;  1RET A;  2K9M A;  3DPT A;  4YII A;  5DD8 A;  4OOI A;  4ENJ A;  3VEP A;  4MHG A;  2R5Y A;  2K3F A;  1BR2 A;  1V4R A;  3BWG A;  4E7H A;  2HPM A;  4ABZ A;  4A3M J;  3HUG B;  2KRC A;  2L9N A;  5LGT A;  2R5Y B;  1U8B A;  2R7T A;  2CRG A;  4UVB A;  1MNE A;  1ZK8 A;  1Z3X A;  2A61 A;  5FLV A;  1IV8 A;  2ZBK A;  2BY1 A;  4M3B A;  4B3A A;  1JHF A;  5L3B A;  1E3O C;  1R1V A;  1SVO A;  1VND A;  1YX3 A;  4WK8 F;  1P6R A;  2QSH X;  3FX3 A;  4JP0 A;  2C6Y A;  2DA4 A;  2MC3 A;  2HVS A;  1CGP A;  2Q8K A;  5FRM A;  4JOM A;  2VT2 A;  4CCL A;  4D1Q A;  1BL0 A;  4BY1 J;  1LVK A;  5LFA A;  3KP2 A;  1V5E A;  3X2Q H;  3AL0 B;  2V6C A;  1B1B A;  3JRI A;  1P92 A;  1HKS A;  3PSF A;  3HG9 A;  2LTP A;  2VQC A;  3QPH A;  5E8I A;  4WWC A;  2Z3Y A;  4HDV A;  3TOB A;  2VKH A;  3R60 A;  4KIG A;  2IGK A;  1SFU A;  1XGN A;  2X6W A;  1WFX A;  2DA3 A;  2YUS A;  3BR1 A;  4UVA A;  3HL2 A;  3GEU A;  2M2E A;  5FMP A;  4IO9 F;  2UV1 A;  4NNJ A;  4ESJ A;  3CJR B;  1DDN A;  5H9T A;  2FBH A;  2M34 A;  1X2N A;  4ESB A;  3RD3 A; 
#chains in the Genus database with same CATH homology
 4AUX A;  3GTJ J;  4C3I J;  3CJD A;  2QIB A;  2ID6 A;  2VPR A;  1TWC J;  2GM4 A;  4BXX J;  1U9N A;  1FEX A;  3MN2 A;  3HOY J;  5J1Y A;  2YS9 A;  4JX6 A;  3BR6 A;  3Q0W A;  4CYC A;  4IHV A;  5JLX A;  3BQZ A;  2CJJ A;  2DA6 A;  5K7H A;  3VP5 A;  2LKX A;  2CUE A;  4IEJ A;  3GTL J;  4JL3 A;  3JRE A;  3CQZ J;  2WV1 A;  1G2H A;  1UI6 A;  2EZH A;  3VW1 A;  2LD5 A;  4CYC B;  2Y30 A;  3VOX A;  3HB9 A;  2JJ7 A;  2XB0 X;  3G56 A;  5FJ8 J;  4RDU A;  1MSF C;  1U9O A;  1H8A C;  3VW2 A;  4MLO A;  1MBE A;  2JA7 J;  2E19 A;  3MVP A;  3VUQ A;  3BTL A;  2Y0S N;  3W6V A;  2X6O A;  2VKV A;  2HDD A;  4FE7 A;  3ON2 A;  3Q3S A;  3E7L A;  2YU9 J;  2YVH A;  3JRD A;  3UKG A;  1ENH A;  3E7Q A;  3O60 A;  1JT6 A;  1IDY A;  1DU0 A;  1BJZ A;  1QPI A;  2HQ5 A;  2HYJ A;  1BW5 A;  2YVE A;  3ON4 A;  4IHW A;  2EZI A;  1K61 A;  3NI7 A;  5F04 A;  3HOW J;  3ZOB A;  3HTA A;  4IHX A;  2ECC A;  2GEN A;  2DA7 A;  4MFD A;  1GVD A;  5EZH A;  5FKK A;  4W1U A;  5DS9 A;  2R92 J;  1JGG A;  2R5Z A;  1BA5 A;  5C44 J;  2NVX J;  5CXI A;  5F0F A;  1I6H J;  5FLM J;  1POG A;  5HBU A;  2DG8 A;  2RAS A;  4LOC A;  4C3H J;  3GTO J;  1ITY A;  2COB A;  5IOY A;  2W53 A;  1B8I A;  4QSH A;  2QOP A;  2E1O A;  2Y9Z A;  2ZCM A;  1ZR2 A;  9ANT A;  1LFB A;  4M3G A;  3CCY A;  1ETY A;  2R5Z B;  2L9R A;  3QPL A;  4MK6 A;  3VW0 A;  4FTH A;  3D1N I;  1ORK A;  3ZQI A;  1MBF A;  3Q0U A;  1B8I B;  4UUS A;  2GLO A;  1WH7 A;  3LSG A;  2B63 J;  3IH4 A;  2R93 J;  4C3J J;  5M3F J;  1SAN A;  4MFE A;  3KNW A;  2L7Z A;  4I76 A;  1T33 A;  4A3G J;  1TC3 C;  2QWT A;  4UUS B;  5F1J A;  1HDD C;  3VPR A;  2V57 A;  4AC6 A;  2GBY A;  1Z0X A;  3HM5 A;  3DEW A;  3NNR A;  1IRZ A;  1LE8 A;  2IU5 A;  5EDN A;  5EG0 A;  3M3Y J;  2JMW A;  4X6A J;  3HOX J;  1QVT A;  2RHA A;  1MBJ A;  2Y31 A;  2ZOY A;  3HIM A;  5F0H A;  3BCG A;  4KWA A;  2NOG A;  1JKO C;  2NVY J;  1AU7 A;  2JN6 A;  1APL C;  1H88 C;  4GCT A;  1JKP C;  5EG0 B;  2H1K A;  2G3B A;  2NP3 A;  4NEL A;  2R0Q C;  3VVX A;  3BR3 A;  5K7F A;  3FRQ A;  3RQI A;  2RAE A;  1MBG A;  2DN0 A;  3FKI J;  3BR2 A;  5BNG A;  2F07 A;  2ELK A;  4ME9 A;  2E2H J;  1GV2 A;  2VUM J;  1IDZ A;  4S0H B;  2G7L A;  2XPV A;  5D1R A;  4C2M J;  1MSE C;  3SDG A;  3EUP A;  3G7R A;  3NAR A;  4BY7 J;  4A69 C;  2DA2 A;  3ZQL A;  3ANG A;  4AYB N;  1GT0 C;  3BNI A;  3PO3 J;  1FTZ A;  2LFB A;  5HOD A;  1P7J A;  3JRC A;  4L62 A;  4FIS A;  3O8G A;  5C3E J;  3FK6 A;  2JWT A;  4HKU A;  1X2M A;  1TWF J;  3OIO A;  5FHP A;  4Y7N J;  2OPT A;  4EEF G;  3C07 A;  3DCF A;  2VKE A;  3ZQH A;  2ZOZ A;  1WCM J;  5IYC J;  4BBS J;  2LP0 A;  3ZQF A;  1WH5 A;  4GFL A;  2XPU A;  2XRL A;  4BKX A;  3NPI A;  5IOZ A;  1HOM A;  2M9H A;  3S2D J;  2ME6 A;  3S1Q J;  3AQT A;  3K2A A;  3COL A;  2G0E A;  2UXO A;  3VVY A;  5C4J J;  4DYC A;  1DU6 A;  4GFB A;  1RKT A;  3BR0 A;  3GBG A;  3TW6 A;  2UXH A;  1H89 C;  3HOU J;  2JK3 A;  3TED A;  1R9T J;  1Q1V A;  3IV5 A;  1NTC A;  5IYB J;  1ETW A;  1WI3 A;  4JNN A;  1JKQ C;  1JJ6 C;  3OOU A;  3ZQC A;  4MO7 A;  1W0T A;  5K58 A;  3BJB A;  2UXI A;  2LLK A;  3PO2 J;  1UG2 A;  5M5Y J;  2OI8 A;  2CU7 A;  5C4X J;  1TWA J;  1A6I A;  4J19 A;  3GTQ J;  2KT0 A;  5K7Z A;  3L1P A;  2DMQ A;  5FKM A;  4A3B J;  2HYT A;  3LJL A;  2O7T A;  2ZB9 A;  3S2H J;  5CXG A;  2NS8 A;  2M8G X;  3GTK J;  3H3V K;  2IAI A;  3G1L A;  1ZR4 A;  2E2J J;  1NK2 P;  1ETO A;  2DG7 A;  2H8R A;  5JLW A;  2ZCN A;  1ZQ3 P;  1ZKG A;  2EBI A;  3KKD A;  3JSJ A;  2DMP A;  4IHY A;  1IUF A;  1ETX A;  2L0K A;  3S1N J;  3FIS A;  1UMQ A;  2K9N A;  5CW8 A;  1OCT C;  3G1O A;  3S1R J;  3O8H A;  3S14 J;  3OSF A;  2D5V A;  2QF7 A;  4V2G A;  3HDD A;  2EZL A;  3LHQ A;  1RES A;  1MNM C;  5M5X J;  2GUH A;  5J1R A;  2K9Q A;  4NN1 A;  2FX0 A;  3CWR A;  3LSP A;  2CQX A;  3BTI A;  2JA6 J;  2HOA A;  1CQT A;  1P7I A;  4UUT A;  4DZJ A;  4A3L J;  4XK4 A;  1Y1V J;  3RZD J;  4Y52 J;  1JUP A;  2HI3 A;  1IJW C;  1ETV A;  2PBX A;  2X9D A;  4G12 A;  3F1B A;  3H0G J;  1BW6 A;  2X48 A;  5IP7 J;  3HTI A;  2LVS A;  3VVZ A;  2LY9 A;  2NX4 A;  1MBK A;  5FKN A;  1TWG J;  5IP6 A;  2DMU A;  2G7S A;  4AC0 A;  5DTD A;  4PXI A;  3S17 J;  3DPJ A;  1EF4 A;  3JRF A;  4AF5 A;  3S15 J;  4A3E J;  2DA5 A;  1ETQ A;  3V78 A;  5FKL A;  4XRS G;  3PM1 A;  3WHB A;  3QQA A;  1F43 A;  3GTG J;  2JA8 J;  2FBQ A;  2L7M P;  3K7A J;  1RKW A;  2FD5 A;  3MKL A;  2Q24 A;  2G7G A;  5IPA A;  2UXU A;  1Z77 A;  1WGX A;  1OJL A;  3LNQ A;  3HOV J;  5DAJ A;  3BG5 A;  3FK7 A;  4DYQ A;  2O8K A;  3AQS A;  2XDN A;  3BR5 A;  3S5R A;  3TW7 A;  5FKO A;  4DW6 A;  4L5E A;  1FIP A;  2VI6 A;  4A3I J;  3VIB A;  4UDS A;  4M3D A;  2XSD C;  5F0C A;  2TRT A;  4ICH A;  2Y9Y A;  5M5W J;  1W0U A;  4JX4 A;  4M3E A;  2HXO A;  2MSY A;  5F27 A;  3JR9 A;  4FE4 A;  3HGG A;  2TCT A;  3BHQ A;  2I10 A;  3TP0 A;  1A5J A;  1GDT A;  2L7F P;  1AKH A;  5EZG A;  2AO9 A;  3OSG A;  1UHS A;  2KDZ A;  1PUF A;  1S7E A;  1F36 A;  2WUI A;  2WGB A;  1JTX A;  2EH3 A;  1AKH B;  1X58 A;  2NVT J;  4XRM A;  5EEA A;  3CDL A;  1IG7 A;  4CGR A;  1JTY A;  1LFU P;  3B6C A;  1PUF B;  4MIM A;  4A93 J;  2HOT A;  2NP5 A;  4D5C A;  1IC8 A;  3JRB A;  2QKO A;  3PPB A;  4B1R A;  4NDL A;  4RBO A;  3EGQ A;  2FJ1 A;  2OER A;  2XGD A;  3WHC A;  3KKC A;  1NK3 P;  4A3F J;  2QCO A;  2WB1 N;  2ME0 A;  4M6V A;  2WAQ N;  3NXC A;  5EGO A;  2GFN A;  2M0C A;  2JA5 J;  1FTT A;  1VI0 A;  4XID A;  1U78 A;  3GZI A;  2EZK A;  2MGQ A;  2HXI A;  3HBL A;  3QKX A;  5D19 A;  1JUS A;  1FIA A;  3PAS A;  1YRN A;  1HDP A;  2CQQ A;  4JYK A;  5EGO B;  1B72 A;  3TP3 A;  5HAW A;  3A01 A;  5EYR A;  3BT9 A;  1XG1 A;  2FQ4 A;  1HF0 A;  5AQC A;  5IP9 J;  3SJM A;  2PZ9 A;  2P81 A;  2IEK A;  1OCP A;  3FIW A;  4GCL A;  4DYR A;  1YRN B;  4JKZ A;  3RD3 A;  1I3Q J;  1B72 B;  1WPK A;  3I4M J;  1VF9 A;  3A01 B;  5J3L A;  5IYD J;  2NVQ J;  1OFC X;  2DMT A;  2OF7 A;  1MBH A;  3LSJ A;  3ANP A;  3P9T A;  5HSZ A;  1GUU A;  1UI5 A;  4BBR J;  3T6N A;  2K9S A;  4M3F A;  3V6G A;  3VOK A;  5J1U A;  2K40 A;  3QPS A;  4D7N A;  4D7M A;  3NAU A;  5F08 A;  5GP9 A;  3MNL A;  3RH2 A;  1MH4 A;  2XGC A;  4MXM A;  2NS7 A;  2EQR A;  3A03 A;  5C4Y A;  2PMZ N;  3HTH A;  2ID3 A;  2XB5 A;  3IUV A;  4GCK A;  4JX5 A;  4XRS A;  1AHD P;  1ETK A;  2W48 A;  1QVU A;  4A3J J;  2E2I J;  1FJL A;  3HGY A;  3HEF A;  5EF6 A;  4I6Z A;  3LWJ A;  2HOS A;  3I4N J;  1HCR A;  2DJN A;  4DZP A;  4YZE A;  2LR8 A;  1JJ8 C;  4V2F A;  1Y1W J;  2UXP A;  1SGM A;  2DA1 A;  3M4O J;  2QTQ A;  1JUM A;  2MW8 A;  2O9L A;  5FGL A;  1T56 A;  3KZ9 A;  2AHQ A;  2D6Y A;  3B6A A;  5E3L A;  2N8G A;  2ZCX A;  1GV5 A;  5E3O A;  3LSR A;  2R7Z J;  5GPA A;  1RET A;  1MH3 A;  2DMN A;  4FCY A;  1I50 J;  5GPC A;  5EFY A;  2CUF A;  2R5Y A;  4A3K J;  3Q0V A;  3B81 A;  1O4X A;  2HKU A;  3RKQ A;  4ABZ A;  4A3M J;  3JRH A;  3F0C A;  3NRG A;  3JRG A;  1K83 J;  2MG4 A;  3HTJ A;  2R5Y B;  1U8B A;  3HOZ J;  2REK A;  3CRJ A;  2CRG A;  1SFO J;  3RZO J;  1QRY A;  3S1M J;  1ZK8 A;  1JT0 A;  1IGN A;  3CMY A;  5FLV A;  4B3A A;  4M3B A;  3SFI A;  4W97 A;  3GTP J;  1E3O C;  4HNV A;  5D18 A;  1VND A;  2ECB A;  4A3D J;  4ACI A;  1HLV A;  3IH3 A;  2IBD A;  3LOC A;  4JP0 A;  4B4C A;  2DA4 A;  1XS9 A;  2O7O A;  4GFK A;  4BY1 J;  1BL0 A;  3BRU A;  3GTM J;  3HE0 A;  3BTC A;  3A02 A;  3JRA A;  1D5Y A;  4XIC A;  3JRI A;  3IH2 A;  3S16 J;  1LE8 B;  1RR7 A;  3QBM A;  1TWH J;  3HKZ N;  1IV6 A;  2LTP A;  2DTZ A;  5E3N A;  1VFC A;  4X1E A;  3BG3 A;  4QTR A;  3C2B A;  5M3M J;  1ZGW A;  4A3C J;  3BG9 A;  1ZTR A;  1XC5 A;  2XGE A;  4D5F A;  2DA3 A;  2YUS A;  3BR1 A;  5E3M A;  3GEU A;  2Y2Z A;  2M2E A;  2LK2 A;  5FMP A;  3BTJ A;  3G1M A;  3ZQG A;  1RPW A;  3BQY A;  1JKR C;  5H9T A;  2M34 A;  2XPW A;  1X2N A;  4QIW N; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...