4I7AA

Grpn pentameric microcompartment shell protein from rhodospirillum rubrum
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
88
structure length
84
Chain Sequence
MYLGKVIGTVVSTSKNESLSGTKLLVVARLTEKLIPDGSTQVVVDTVGAGNGEIVIVSCGSSARQSHSVIDAAVVGIVDTVETV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ethanolamine utilization protein EutN/carboxysome structural
publication title Bacterial microcompartment shells of diverse functional types possess pentameric vertex proteins.
pubmed doi rcsb
source organism Rhodospirillum rubrum
molecule tags Structural protein
total genus 12
structure length 84
sequence length 88
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2012-11-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.220 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) EutN/Ccml 4i7aA00
2RCFA 4JVZA 2HD3A 4I7AA 5L37A 4JW0A 2QW7A 2Z9HA 4N8FA 4N8X1
chains in the Genus database with same CATH superfamily
5IWAQ 3P7JA 3MXUA 1GOZA 2N8NA 2Q2HA 1Q81C 4JBKA 4HIMA 2LXJA 2K5WA 1C4QA 2PZTA 3K7AB 3U50C 1F2ZA 1JICA 2E2DC 1HZBA 1H9KA 2MGSA 4K2LA 4MN3A 2F0FA 1E2VA 5LL6S 2LY7A 3KYHC 1MJEA 1OXUA 3OIPA 5FK9C 3H3VH 3S1QB 1VQCA 4DXGA 3RZOB 1MIUA 2VQFL 4X62L 1HNXL 3NWTA 4JVZA 2F1MA 4HJ8A 1I4QA 4CJ2C 5JJKA 3T1YQ 1A2TA 3D3RA 1I6HB 2I5LX 3CAMA 1CQFA 3CP0A 1DM0B 5D3DA 4OO1G 1R4PB 4KD3A 4P71A 1B3AA 4IUQA 2I5MX 1K8MA 4A3JB 3R8BA 4DV3L 1DZ1A 4PZ8A 4BBRH 1IZ6A 4A3IG 2UUAQ 1HXYD 3HZXA 1TWCB 3AYHB 3DXJC 3TDQA 2O5IC 2UXBQ 3TP6A 3DM1A 1B50A 2C35B 1NUCA 4OHJA 4L5RC 4H0LC 2OT2A 1VQNA 1E2WA 1Y8OB 4LJZC 3BS1A 1QILA 2XGTA 3U4ZA 3HKZB 1PRTC 1YHBA 4XT3B 4KJOA 4DR7L 1SMXA 1N32L 5C44H 2QDBA 1U4PA 4DR2L 2EYOA 3M4YA 5I6YA 1X54A 1PH5A 1EQVA 4H7BA 3PO2B 2VUMG 2VQEQ 1FNUA 1VMPA 2CH4A 1PRTF 1TWFB 5IGGA 5J39A 2E2IH 1FR3A 5CBEE 3S1NB 2YU9B 1A3UA 4RCOA 1STBA 4N9PA 4AIMA 1EQRA 2UU9L 1UE1A 2PMZE 1LTSD 2JA6G 1NTGA 5BN4A 1CT1D 4JI5L 4F7XA 1Y1WH 4A3IB 4WORA 2KENA 5LMNQ 2I07B 2E8GA 3L3OC 4R9WA 3R2TA 2B2WA 2E2HH 3I4MH 2H1EA 3AEVA 4DR4L 4ALPA 4XQQA 3H15A 2EYJA 1C0AA 1V9PA 2R92H 2UUCQ 1GKHA 4P72A 5JEAJ 4MTNA 1EWCA 5LMUL 4DV5Q 1S72A 1PYWD 1TS4A 1G2SA 1WTPA 2K5NA 4V0BA 1BUVT 2XN9C 1X55A 5K36H 2MO0A 2CWAA 2K1BA 5T1IA 1STGA 4K6LA 1Q86C 2FMCA 3I4NH 2NVQB 1CKNB 1CUKA 5M5XH 1ILPA 2AQ1B 4JI3Q 1FJGL 3PIOA 2RBMA 2J7ZA 4FVMA 3WWVA 2ASBA 1XWEA 5CBAE 3G4SA 1BCPF 3NPPA 1MHWC 1TWGB 1IBML 2OXPA 4DR5L 2LXKA 2K14A 2YTXA 1K83H 1SYFA 3VYTA 5C4XG 1WTHA 5FO8B 1A0IA 4LUZA 1VF5C 4IQZA 4DF7A 3V96A 3OTOL 5K5PA 1LTBD 2F0NA 4WFN3 2LSSA 2NVXB 3PUZA 1Q1EA 2EJFC 1L1OB 1SNOA 1PTOC 3CCSA 4OX9Q 4A3CG 1BO0A 1U4RA 2R6GA 1BQQT 1A3VA 4HN7A 2IHFA 2Y0SG 3MFYA 2JXMB 4A3KB 1YZ6A 4UY8C 2F0JA 5JOBA 3MXPA 4HMJA 4IFDG 4XTCS 3I8ZA 2KOLA 1EEFD 5C3EG 5JPMC 2ZXOA 4CDCC 5LL6X 3G6EA 4CGYB 4DK3C 1EYGA 1EY8A 5C4XB 1NR2A 3QOJA 1HR0L 5EPLA 4N8FA 2L15A 2TSSA 3EJIA 4JK1C 4LMQD 3SHLA 1PTOD 4CHTB 2KA7A 4HCSA 2OTJA 3KF6B 5FLXc 3OHXC 1ESFA 1X3QA 4YHHQ 4B9WA 3T4AC 3J81i 3CC7A 4CDEC 3K59A 4A3EB 2EJGC 3RR5A 1Q46A 2EXDA 1Z6HA 4DNIA 3Q6SA 1DYQA 4HJ9A 2ZTCA 1HH2P 2WKDA 2Y0SB 1F2MA 1N9WA 5JEAH 2RHSB 2R7ZG 4B3TL 5C3EB 5IE8A 1YIJA 3GV3A 1X3GA 4HTHA 4L63B 1J6QA 1MKHA 3GDEA 3HOYG 1QB5D 1UWVA 2DN8A 4QIWB 4LUVA 2BOSA 1CZWA 3CD6A 1B4OA 4GNXA 5E3FA 1D5MC 1U0LA 2QKIC 4BBSH 1IYUA 4A3LH 1XJVA 4LF4L 2O2LD 1SRUA 4LUOA 1V1PB 1SBBB 4QB4A 4NXMQ 1Q8KA 3PCOB 1N33Q 4TVAB 4KI0A 1M90C 4BY7H 2K01A 1SE8A 3SVMA 2B29A 1LTLA 2CVRA 2Z4IA 2FHTA 2Z4HA 4EQ5A 5FLMH 2AWNA 1VQ7A 3ZYYX 2ATWA 1YNND 1QOHA 5C4HA 4LFCQ 3N52A 3NQIA 4LW1A 3D31A 4IALA 2F0PA 1TWHH 2WB1G 1SXTA 4RAUC 3RZDH 5TSSA 2WKCA 1LYLA 3HOYB 5G3LD 4C3HH 3M4PA 1H9SB 2G5DA 3SGIA 3W5OA 1HFNA 1LACA 1C8CA 1G6ZA 3T1YL 2D0PA 4C1NI 3PF5A 1YEZA 5CV4A 1K3RA 2XNAC 1TKWB 4UDUC 3S2DB 4C56C 1NR4A 5FO9B 2ZM6Q 2J4XA 3K7AH 1Q90A 3JAML 3IL8A 2NTTA 5CV6A 2HD3A 1KRTA 4L5QA 4CKCA 2RDGA 4UP8A 3E0JA 2K04A 4QCLA 3A74A 4I7ZC 3CCQA 3SK6A 3K81C 1N34L 3E3XA 2K75A 2F0KA 3M4OH 2R61A 2JA8H 4PG3A 4J6HA 2H4OA 5IP9H 2WACA 2M2LA 2VS1A 3K8AA 3STBD 1KAWA 1JWMD 5H1SE 2PQAA 2YV5A 2B63B 3S15B 2G9DA 2JE6I 4LFAQ 3HP3A 1SFOB 4IJHA 2EYMA 4GN5A 1VDZA 4FDBA 3QR8A 1YJWA 2L9HA 1DXMA 5C4JH 1VS0A 2G9HD 3I91A 5F2DA 4B3SQ 4S3SA 1PMRA 3K0XA 1GXDC 1ZYRC 5HGQA 1I3QB 4FXDA 1QUQB 3S1MH 1D2BA 5C44G 2RDFA 5LMNL 3PO2H 3GQBA 1GHJA 3J81E 1E3PA 1SNDA 4QJFA 3K5OA 2KCTA 2AKWB 4YIJA 5FJ8H 3OYYA 2JA5H 2OF1A 1S5FD 2RKSA 3A55A 1FNWA 4IURA 2CKZB 1FGUA 1HQMC 1TY0A 1EFWA 2UUCL 1TVXA 4DV5L 4K5WA 1GVPA 4MIUA 1G2TA 4X3TA 3MA2B 1X56A 2FJ2A 4V190 1KXLA 3D8GA 3BDOA 3PUVA 4DNRB 1VQ8A 1Y1WG 3I73A 4ZK9B 3VR5A 1ZYRD 2NZOA 4JI3L 4NPSA 3CMEA 2ENBA 2Z1CA 1A8VA 4KN7C 2KBNA 4CDFC 5FOBB 4C1NK 2NZHA 4DKAC 1XPRA 1K8AC 1VQEA 1HFGA 2MO1A 1OXTA 3HRZC 1Q1BA 4DPGA 1HTLD 2XRQD 4POGA 4HIDA 1R9TH 2QEXA 2RA4A 3HOVH 2R93H 1GUTA 2Q2IA 4NB3A 3MXGA 1LLRD 1GD7A 3MXNB 5M3MB 1G91A 1TS2A 5HY6A 1HA6A 1B1ZA 2AHOB 3I4NG 1W6JA 5DM73 5D3IB 1FYCA 1RF2D 2DGYA 4C3IH 1KDAA 2E2JB 2ZTEA 1AEXA 2F0GA 5IT9L 3G7LA 5IYCG 3I7FA 2PO4A 3QOLA 4LF6Q 4OX9L 1WJJA 3WDNA 3V05A 2CHBD 4AYBG 1ZEQX 3CW2C 2IX0A 1BVSA 1GUWA 4UAIA 1AW7A 2MJ8A 1EY4A 3C46A 5KRUA 2MP1A 1TWAH 1KQSA 3C3LA 4F88A 1SDFA 1SNQA 2F03A 1ESRA 5DAUA 1LABA 1VQDA 3VR3A 1PYBA 4M1UB 4FF3A 1EWHA 2C5CA 4IN3A 3ITPA 4YHHL 1OO9B 1V43A 1KHIA 3IAYA 3A5ZB 2OQ0A 3D6CA 3HOXB 1CI3M 1WI5A 2FXQA 5KYIA 1V1QA 1EYAA 2K5QA 3KDFA 5COYA 1NNXA 1HUNA 2QDLA 3K6OA 3C1FA 5IODA 4IUVA 2LFNA 4QGUA 1L1OC 4AYBB 5ELCA 3FHWA 2F0OA 4YCWA 1Q82C 2OEOA 3HOUG 4BA2I 1VQAA 1VQMA 3H91A 2Z6KC 3A8JE 2ZJPA 2OCEA 4C3JG 1CA5A 3VYRA 3TS0A 1Y1VH 3U9SA 1W6KA 1VQ6A 2IX1A 3GV6A 3DWAA 1IHZA 4XQJA 4A3MG 4BXXH 3TP8A 3SK5A 5EQ0A 1QVGA 3K5LA 1VQFA 2QCPX 5FO7B 3KLWA 2NVTB 1CHPD 2BDOA 2WV6D 4CJ0B 4G7HC 2L12A 5CR3A 4NXML 3BJUA 4LF8Q 4KKTA 5EPJA 4HIOA 2WP8J 4XDXA 4UHVA 2ICIA 1JJCB 2JSOA 4ILWA 4BS9A 4DA2A 3HOUB 2ICEC 3NBHB 3I2ZA 3I4LA 2RF4A 4LFCL 3FKIB 2HHHQ 3DMUA 4YWMA 4C3JB 1WTQA 2PCFB 2PNHA 1VQBA 4JC0A 1K3BC 1WCMG 2IL8A 4NP5A 5EKIA 2VNUD 4B3MQ 4A3MB 1PZKD 1S4ZA 2Z8LA 3OMGA 2HDLA 3S24A 5GROA 1F9SA 1ET9A 2IWHA 4X3KA 2PI2E 3PV0A 3U9OA 4KHPL 3FEWX 1EU4A 3GTJH 5FLMG 2ZM6L 4WJWA 3E9HA 1IYVA 1ONLA 1RHPA 2K32A 3FMCA 3FRPB 2JP1A 1K73C 3PO3H 4A76A 2K50A 2BCOA 1NBWA 4DAYA 4FXKC 4OIJA 4DAPA 2GVBA 1YVCA 3MAQA 2RVLA 4PNYA 2BH8A 2PI2A 1F77A 1SNPA 1T5EA 1UE7A 1BBWA 2L4NA 3FP9A 4IJLA 5HURA 4DV4Q 4WRDA 2WAQE 4NXNQ 2AQ3B 4G7OC 1WCMB 4XIGS 1Q8IA 2HT1A 1I5FA 4WJ4A 2XWBB 3M3YB 1I50B 4DU9A 1JMCA 4K0KQ 4LFAL 3HOZG 3NTKA 4PZ7A 1F9PA 2HCIA 1XNQQ 5ELFA 1WYDA 3KBXA 4RKBA 4PMCA 3J81c 3K80C 2XTIA 2IW3A 2D62A 4B3SL 5KGUA 5E7NA 3CMAA 2QF7A 1RKNA 2OWOA 3HOWH 1NY4A 2KVMA 5C5LA 3H0GH 4PMWA 1AZPA 3I72A 4DR1Q 1SFOH 3TP7A 1J5EQ 4A93H 3CRKC 3OWFA 2LS01 2V4DA 3NTHA 4NKLA 4A3GB 2K28A 2A1AA 3GTMB 1XX8A 1KDBA 3HOZB 5ELBA 2IX3A 1HRJA 3KJPA 1O78A 1B2TA 4C2MH 3Q0AA 4KHVA 3KFUA 3CHBD 1BKBA 2CCZA 4PZ6A 1KTKA 4DR3Q 3NXWA 1XTDA 1CKOA 4JI0Q 1D6EC 3S16B 4LF9Q 2RCNA 4QUCA 1N36Q 4IOAA 4ZQ3A 3QB3A 4JI1Q 3IFTA 1XMOQ 3BG3A 3CCRA 4FF4A 2B2YC 4OWWB 5L37A 3CXCA 1MSHA 1VQJA 4R4OA 2MHVA 2RQXA 4LF6L 2DY8A 5IP7H 4HJ7A 3K0YA 3NHHA 4A3FG 2NN6H 1NSNS 1DD2A 2JA7G 3W3AA 2HIXA 1JOKA 2GVAA 2AUJD 5IGFA 3J81L 2I46A 1VCIA 5M3MH 2F0UA 2NYZD 3EIVA 3RLFA 2R93G 1CSPA 5E4WC 2KEDA 4CKEA 3EVQA 3L7ZC 4I7AA 4UP7A 2PQEA 3HKZE 3VR4A 3HKSA 2NTSA 5IYBH 3J7AF 1WTWA 2UXCQ 1M4VA 2JJQA 3WOFA 4XQNA 1DJRD 2VUMB 3PSIA 1STYA 4FNFA 2Z6BA 2LMCB 1LUZA 1TS3A 2Q8TA 3TS2A 3H3VI 3J7A5 4Y7NB 1I4PA 2EXZA 2A8VA 2M9VA 2JA6B 1LO5D 2R3ZA 1PTOH 5M9OA 4P75A 1Q12A 4O42A 3DEPA 1FNVA 1Z7TA 1VF7A 3KBGA 5JVG3 1SR3A 4DFAA 1RODA 1K8GA 1O7LA 2SNSA 3DHQA 2ID0A 4RKLA 4HSPA 1SJHD 2A6HC 3GTGB 2OTLA 3HOXH 3LWUA 1QZHA 2B2TC 1JOOA 5DEHA 4A3BG 1E1TA 3QIAA 1RL2A 3SXHA 1EY5A 4HIKA 1EYDA 5M5WH 1IXRA 1E2ZA 2F0HA 3U4VA 3TZDA 2BA1A 3DM3A 3I56A 3N6RA 5CGKA 1R4QB 4LF8L 1IL2A 3URYA 2QW7A 4R4IA 2EOTA 2FMMA 4BY1G 5GADC 4ULLA 1PFNA 1HUMA 1ENFA 1PTOF 2ZJRA 1JE5A 1Y1VG 2F0EA 2A6HD 1SROA 2I5HA 4GNXB 2NWGA 4G4KA 5CC4A 2PPBC 1T5XD 2ZXRA 4EX5A 4ZRZA 1KNEA 4G7ZC 3OPOA 2E74C 1QJOA 1YHAA 5IY0A 5ELDA 2AWOA 4KN4C 4JI2Q 4KV6A 4KMUC 1PZID 1KLGD 1CKNA 2HCCA 4A3BB 1Y8NB 1K28A 3HEJA 2ZXPA 1HZ9A 4IPCA 2EDGA 3VDYA 3CQZH 3E5SA 5M5YH 2VXWA 1MGSA 1KABA 1PHJA 2DNCA 2B8GA 2F0LA 4BY1B 1D5ZC 4OIKA 4LF5L 2RCFA 3S14H 4WJ3M 1AH9A 2R7FA 1B7YB 4R8IA 3GTQH 5I6WA 1YHQA 1X3EA 4GOPA 3TBIB 1LTTD 1EY9A 2EQSA 1YNNC 3L9AX 4A3DG 2MPMA 4AQYQ 4YWLA 1CTMA 4DV4L 4ME5A 3DUZA 2UXDQ 1HQRD 4K5XA 4H44C 4I65A 2RDHA 3PGZA 2F0IA 5D14A 1DCZA 1O7ZA 1SJED 2L1BA 4L5TA 3NP8A 4TQUS 1EEID 4K8IA 2F0MA 1HNWQ 1XNQL 3PO3G 3L0OA 2EY2A 1PH3A 4YY3Q 5G3LF 3HGBA 4K2KA 3NK9A 5IWAL 2KUMA 2F3WA 1RDPD 1O7IA 4JW0A 4L8JA 2Y0SE 3PQIA 2R7ZB 4JI4Q 3NEMA 5M3FH 1G8ZD 1VQKA 4POFA 4M8AA 2IHEA 2Q8RE 1Q3LA 4EGVA 1XMQQ 4A3DB 1NJIC 2NB0A 1J5EL 1HTPA 3GTKB 3KUPA 2EYLA 2KCMA 2BDNA 2B2UC 1QZGA 2KQ3A 3H09A 5IYDG 3STBC 2RSOA 4DXFA 1JOQA 5FLXL 4RH6A 4JG2A 2JQOA 1KLUD 4LFBQ 2X6GA 1BF4A 1YITA 4X64Q 4XYOA 3RLOA 5JPNC 2LKVA 1AZQA 1S5ED 3HOWG 1LTGD 1P16A 4CDDC 2UUAL 1GO3E 3KLSA 3H0GG 3S1QH 4DV7Q 1G6PA 2UXBL 1PA6A 3RZOH 1HPCA 4DUZQ 3GTOB 3UDIA 3W2DA 1BR9A 5CV7A 3D4DA 1C9OA 4EVOA 2KHIA 4RHRA 4DR3L 4DNTB 3S1RB 4A93G 1K0RA 1LTAD 1I6HH 3CC4A 1WOCA 1I6VC 5I2XA 4A3GH 3H6MA 4E6IA 4LF9L 2WB1B 3GTMH 1CKMA 1MI2A 4DK0A 1WTRA 5CV8A 4A3JH 4JI1L 1E1OA 1J9OA 2VQEL 3BYYB 1XMOL 5IGCA 1B8AA 1GUGA 1W3SA 1TIID 1TWCH 2DNEA 4BBRG 5C0XJ 1E24A 4N8X1 1LT3D 4K14A 3BU2A 2QILA 1F2YA 3TREA 2D5DA 1GUNA 1S5BD 3RNUA 1HR0W 4JV5Q 5EGTA 3L2PA 2E5LQ 1STAA 1QG7A 1S40A 1QVCA 1RD9D 3OOCA 2RHQB 5ISRA 1O7YA 4OONA 3EBEA 1TWFH 4XT1B 3VR2A 1IBLQ 2VW9A 1Y69U 3S1NH 2YU9H 1GUSA 2KHJA 3ONAB 2B2WC 4BA1I 1MSGA 3BZKA 3BDCA 3R93A 1QNKA 1PRTB 1PH7A 1J8IA 3DWPA 4OO1H 3LX0A 3W1GA 3KK7A 2UXCL 4K8JA 1QCBD 1EQQA 1HJPA 2CWPA 3MEHA 4A3IH 3MVVA 2ZTDA 3TMEA 3J7AV 3NUCA 4BBRB 3CKIB 2PYKA 5DNFA 3PIP3 1RIPA 2VQFQ 4X62Q 1HHVA 3VR6A 4RGTA 2VL6A 1TU2B 1DOLA 3I4MG 1JORA 4HR7B 2QA4A 5C44B 2R92G 2X69A 5A35A 1I4RA 2A69C 2PNRC 4IPHA 3A7AB 2YYZA 4RA8A 3TQYA 3MWYW 1WFQA 5DLQE 5KNDA 2MNAA 2JK8A 2V1CC 4DK6C 2NVQH 1S3OA 2MQHA 2F0SA 3DEOA 4HJAA 1AN8A 1CFMA 3NE5B 2E2IB 1ET6A 3J80E 3P20A 1KIXA 3RN5A 3H94A 2SDFA 2JA6H 4F87A 1VMCA 3KDFB 1O80A 5JVH3 4APVA 1TWGH 1FD7D 3IRBA 2KHSA 1RCVD 3ND8A 2VZAA 5CV5A 1Y1WB 5KYLA 1T9HA 3I3CA 1BCPB 1NE3A 3F8TA 4H02A 3G48A 4QY7A 2B2YA 2A69D 2RSNA 2E2HB 1D5XC 3I4MB 3F1ZA 2NVXH 4DN4M 5C0XH 2B3GA 2F3VA 3R2IA 2R92B 1I4HA 4FXGC 5AJ3Q 3CCVA 1NMFA 3K58A 2KCCA 4ZYSA 5GAEC 1SE2A 4A3KH 1A2UA 1EY0A 4JOIC 4L6TB 1BBUA 3I4NB 1WD0A 5M5XB 3ER0A 5KNCA 4LK1C 4X66Q 3PMFA 3K5NA 2EYPA 2BH2A 1GM5A 1DGSA 4R4CA 1CA6A 3I55A 1KNAA 1E7ZA 1KRSA 3SEBA 4DV0Q 5C4XH 5K36G 3T56B 5JJZA 1SAPA 4OELB 1I94Q 1EFID 1K83B 2SEBD 4JBJA 5A2QE 3DLLA 2JYOA 4XYQA 4IPDA 5AFWA 4RMFA 3NWSA 4AQYL 1JE4A 4A3EH 5CYUA 4EQOA 1IL8A 3X3NA 1FVIA 4IUTA 4GNXC 3Q24A 2UXDL 4IPGA 1D7QA 1L2FA 3NBIA 2WAQG 2WINB 5LMNW 2FFKB 4Z9CB 4J8QA 2QEJC 3QJYA 4HAEA 1UE6A 5C3EH 1EIGA 1HNWL 5JEAG 1N33L 1PZJD 2B2TA 4PV1C 1LT6D 4O2DA 4YY3L 3OTOQ 2AMCB 3CCEA 3KF8A 3T16A 3ICEA 5IGBA 1EZ6A 4ZLTF 1B9MA 1EYCA 2XRSD 3CRLC 1STHA 3E0EA 2NZ1D 4JI4L 3HG9A 4BBSG 2JA9A 4A3LG 2CH4W 2VB2X 5I9PA 4JPBW 5I2YA 2ZJQA 1XMQL 3A8KE 1PFBA 1HZAA 1YNXA 1F9RA 3SK8A 2PW7A 4DV1Q 4BY7G 3F2BA 3BDLA 1PDQA 1K9MC 2NVYB 2DUDA 1JT8A 2WAQB 5C0XI 1BXTA 1QVFA 4LFBL 5JAVA 3M4QA 4X64L 4GS3A 1H9MA 1CSQA 1UEBA 2L11A 4JI6Q 3D0FA 3M7GA 4MHEA 3WOEA 1TT2A 5M3FG 3LWEA 4IUUA 2QGQA 4DV7L 3HOYH 2N78A 4JI8Q 3UE0A 2Z9HA 4C3HG 1SYDA 4RGMA 1OTCA 1A15A 5GAGC 3VA7A 1C48A 2IT1A 3MEFA 2UUBQ 3S2DH 1FL0A 1BBXC 1EL0A 3X3MA 3Q23A 4H13C 5ELEA 4ZCKA 4IOCA 3T51B 3RD4A 1V1OA 2AQ2B 2KEEA 1SN8A 3JAME 1HA5A 4BY7B 4Q0FA 3S1RH 4QQBX 5EKLA 1G291 2L55A 1HNZQ 3NBHA 4RFBA 4JV5L 3UE1A 2JA8G 1TWHB 5IP9G 4OEMB 4Y52H 2B63H 1JCKB 3S15H 1SYEA 3RZDB 3ULPA 1PVOA 1L0YB 1WTOA 4A3JG 1PH2A 4YWKA 1IBLL 3SDZA 4ZAIA 3SE0A 4C3HB 4DV6Q 5BR8Q 1EIFA 1SYCA 5J3BA 2EY5A 4R1JA 4JBWA 3I70A 4TKOB 1MBYA 2DJGC 1ENAA 2ZT9C 1H9JA 4IZ8A 1WD1A 3UDGA 3HKZG 1A6XA 1I3QH 2GN5A 5BN5A 4KY6A 3U58A 4X65Q 2HDMA 3PO2G 4DV2Q 2O5JC 4GKKQ 4DR6Q 2F0WA 2NUCA 1DONA 2K5DA 2B2UA 4FO2A 1XTCD 2J0TD 5KNBA 1A63A 1X6OA 1X32A 3KJOA 5FJ8G 2F3IA 2JA5G 1IYJB 2PMZB 4PMBA 3IKJA 3J80c 3M4OB 2JA8B 4IO9A 3ULLA 1EWIA 2EY1A 1WTXA 3FDTA 3CCMA 1SEBD 1AE3A 3NENA 1KAAA 5KIXA 4HMIA 4GLAC 3A56A 3B6YA 3H3VC 2N3SA 3K57A 2K03A 2HQLA 3HFZB 3BVGA 3PF4A 1N34Q 5C4JB 1B70B 4O1NA 3RMHA 3ERQA 4EQPA 5IIFA 1AFPA 1CQVA 4FF1A 1XXGA 3S1MB 2XVSA 1SE4A 3TZUA 3TEHB 5IGDA 5GAHC 2CQOA 3HOVG 4X3UA 5CV9A 2JA5B 1X3FA 2EY6A 5CORA 4B3RQ 5FKAC 2F0QA 4L5SA 2E2JH 2PZUA 1EIYB 3GTPB 4C3IG 3T13A 4UP9A 5AJ3L 5IT9E 1YNJC 3CCUA 1U4LA 1U5KA 1NMGA 1WTVA 4O0AA 3I90A 1PRTD 5C3XA 1W2BA 1XPOA 1TS5A 1X65A 1BOSA 3PUYA 4CKBA 2ES2A 2F0VA 3QO2A 1ASYA 3BVMA 3S2HB 3VA5A 4X66L 1Y14B 1JWSD 5D65A 2Z0SA 4A3FB 3DWQA 1A62A 2JA7B 4DV0L 1TXYA 1IKMA 2A68C 5T1GA 1CHQD 5C0XG 2KECA 1S5CD 4KTAA 1I94L 3JC66 1R9TB 1LM0A 1CK1A 3HOVB 4OL7A 2R93B 4GLVB 1JJ2A 1STEA 3M85A 1BCPC 2HQEA 4ZUJA 1YNJD 3J80L 1RTNA 3A54A 1EU3A 4A3KG 5JJIA 2N88A 4FP5D 5IYCH 1IW7C 1QWYA 4C3IB 1VQ4A 4U673 1VQOA 5EJWA 1SMYC 4IUNA 1KDCA 2D9UA 3OSOA 2B2VC 2A68D 4OXPA 1STNA 2K4KA 1B44D 3PIPA 4JI7Q 2F4VQ 5EKKA 4GOPB 1PH8A 4GN3B 4X3SA 4RGOS 1BCPD 4JYAQ 4QMGA 4OGQC 3BZDB 3D4WA 1TWAB 4A3EG 1SYBA 3AFQA 4BXXG 1VQ5A 2NVTH 2A6EC 2Q8IB 2HHHL 1IW7D 2DJFC 1XPUA 2NN6I 2XIWA 1PFMA 1SMYD 2YTYA 1P8LA 4MTKA 4ID6A 4B3ML 3AFPA 3W1BA 3J7YW 2EYFA 4J15A 3TRZA 4DV1L 1DOMA 3J81j 1VQGA 1C7YA 3HOUH 3FKIH 4GLXA 5HGTA 4RHSA 3S17B 5A2QL 4KD4A 4C3JH 4JI6L 2EYHA 3GP7A 3E6ZX 4KY5A 4JOIA 2A6ED 2O4XA 1B9NA 3CU7A 1UE5A 4JI8L 4A3MH 1Y1VB 3NSWA 2VB3X 1PV4A 2A73B 4QF4A 1TR5A 5NUCA 1M1KC 2XWJB 3JAMc 2F4IA 3MC0B 2NVYH 1PH1A 5EAYA 2KCNA 2UUBL 1L1OA 2AUKA 4NXNL 4OWXB 4LNQA 1OXXK 3R3OA 4ZKBB 2Z6KA 2C9OA 3Q8DA 2WIIB 4K0KL 3Q22A 2BA0A 4ZKCB 4QL5A 1KD1C 4DUYQ 1D8LA 3RUZA 4GKJQ 2X6LA 2A5HA 3QWNA 1SSOA 3J80i 1HNZL 3GTLB 3FPUB 3V2TA 1WCMH 1UUPA 3GO5A 4LF7Q 1CM9A 3M3YH 1I50H 1EOVA 4DR1L 1SNCA 1JC7A 4OWTB 2PQAB 1A3TA 3KF6A 3CPWA 4DV6L 3ZJYC 5BR8L 5J22A 3UDXA 1OXSC 2E75C 1U9RA 1VQIA 3C1EA 4QIWE 1TQOA 2BE5C 3IFDA 4CBVA 1G51A 4X6AH 1DOKA 3CCJA 2EIFA 4HJ5A 3GTJB 4LWCA 4ABNA 2SNMA 1I4XA 1B53A 1M8AA 4X65L 1KL9A 4KK7A 3A7LA 1VQHA 4KY7A 3PO3B 2K52A 3OIQA 2CQAA 1H9RA 4DV2L 4RG1A 3LNNA 4ME3A 1PXUA 2B63G 3KLSX 4DR6L 4GKKL 2CW0C 2D0OA 4K6DA 4FF2A 1E0BA 5BN3A 3OW2A 1EY6A 1B3QA 1MD2D 1I4GA 4LAAA 4HEDA 4KHPQ 2P5ZX 4JI0L 4DK1A 2BE5D 3GD7A 1N36L 3CF5A 3HOZH 1PH9A 1V1PA 4TSSA 4KKUA 2JN4A 5GQOA 2A74C 1IBKQ 3CPFA 4KHZA 5EPKA 4TRDA 1SYGA 1YJNA 1XNRQ 1PLFA 1U4MA 2CW0D 3S16H 3NTIA 4A75A 2SOBA 4KJNA 1SE3A 3OWEB 3HOWB 1ILQA 1ZXTA 3H0GB 1SNMA 1D1IA 1GUOA 2KJXA 3AU7A 2PZWA 5C3WA 3NELA 5IT9c 2K5VA 3T1HQ 1EUJA 1Q7YC 5LHY1 1H9SA 4GN4B 4HSVA 4B3RL 2NBFA 4A93B 3PIO3 1ASZA 2DY7A 1OXVA 1PH6A 1KC8C 5E1FA 2EZVA 4J1MA 2WB1E 1D1KA 1SLJA 5IP7G 1EZ8A 3A8IE 1JJGA 1LT4D 2NN6G 5IGEA 3G6JB 4K5VA 1ENCA 5J1ZA 5EBCA 1F2LA 4C2MB 3G71A 1LTID 3UDFA 5M3MG 3MTSA 2E76C 3J7ZC 3A0JA 5EBDA 3SK4A 2Q2UA 1YBYA 3TN2A 1YI2A 1HNXQ 4RGNA 1X9NA 4HCEA 3GTPH 1K0SA 2VY3A 3HS0C 3OW7A 2EE1A 3EQLC 1BDOA 1Z47A 1JQYD 1S5DD 3KOJA 3PUXA 4IFDJ 1AP0A 2HIVA 2F0TA 1UNSA 5IYBG 3RN2A 2VUMH 1BNZA 3TSSA 3AMUA 2N55A 4DV3Q 3BZCA 3BYTB 4Q5VA 3S2HH 2CFMA 1L0XB 4Y7NH 1H95A 4A3FH 3P1HA 5E4XA 2JA7H 2EVBA 2I0QA 2R7DA 4CJ1B 2PW5A 5CMDA 1LT5D 2K6AA 2L5TA 4DR7Q 1N32Q 1QUQA 3AQQA 4DR2Q 1E22A 4A4IA 5DM63 2GA4B 3LGJA 4JI7L 2F52A 4QUFA 3GTGH 2F4VL 1JWUD 1LTRD 3VYSA 5C6AA 2HUGA 3D4RA 4JYAL 3RLNA 1PH4A 3JAMi 3EN2A 3HOXG 4P2CB 3C2PA 4IUPA 2UU9Q 2JEBI 3CCLA 2YTVA 2M00A 3O13A 1ICWA 2IPKD 4JI5Q 4JI2L 2B39A 1HZCA 3AB9A 2B8FA 4MNOA 1EIHA 1QNUA 4BWGB 1UAPA 3PUWA 3EA6A 3BVZA 1IKLA 3KF8B 4DR4Q 4B9XA 3I4OA 2TMPA 4AH6A 1PTOB 5LMUQ 4OO1I 4P74A 3MZ5A 5C4ZA 4MZ9A 1FGBD 3MXNA 1II3A 5KEEA 4R4QA 1RTOA 4A3BH 1VQLA 4NDXA 3E9IA 4GOPC 1FJGQ 4ODGA 5I4DA 3KLRA 4FYDA 4NMZA 1GJXA 3EFXD 3M7NA 1K8OA 3K7UC 4N9TA 4A3CH 2A19A 5M5WB 2IY5B 2K33A 2L0CA 3S17H 3ERSX 1LV9A 1IBMQ 1NAPA 4EQNA 5JJLA 4DR5Q 1PYSB 1V8QA 3K5MA 4BY1H 4GZYC 3FKIG 3EROA 4JCVE 4PQXA 1JB7A 2N49A 4JBMA 2IJ0A 4IFDH 4DAMA 4R4TA 4DUYL 2WFWA 4DAYB 4GKJL 3T53B 4UPAA 3S9WA 1X3PA 3M9BA 1QE6A 3F2UA 4DGZA 3UI2A 1UEAB 4AYBE 1CZGA 2F0DA 1VQ9A 4LF7L 2MUYA 2B2VA 1GHKA 4G57A 1VQPA 3MFGA 2K5HA 4RWSC 2ALYB 4YCUA 1HCZA 1JB3A 3CQZB 3GTLH 5M5YB 3F2DA 2MFIA 4P73A 4DAVA 4KKSA 2K7VA 2R7ZH 1Y8PB 1NCVA 1HR0Q 4KLKA 2EPBA 3S14B 3A5UA 5ELOA 3TP5A 3VYUA 1EY7A 3ULJA 1EOTA 3GTQB 1JR0D 5ELNA 4A3DH 4DUZL 2K05A 3GTKH 1PFSA 1TY2A 3FVQA 5I9OA 1ZKOA 4BBSB 3CC2A 4YCVA 1N8RC 3NQTA 3FPPA 4F8MA 5FLXE 1YJ9A 1RJTA 4B08A 2OQKA 3F2CA 4NW2A 4LF5Q 3MHBA 2Q2TA 2XSCA 4B3TQ 4RCNA 1F9QA 1IBKL 3GTOH 1AE2A 3OMCA 4U68A 2D2CC 1XYIA 1MJCA 3D6WA 1XNRL 1WVLA 3SR1A 2EJMA 2H5XA 2JEAI 2E5LL 1Z9FA 4ZUIA 5C5MA 4A3GG 1EQTA 1L0WA 3QG1A 3ND9A 4LF4Q 5M3FB 4XXEA 1ICFB 3T1HL 3P75A 5IOCA 4IFDI 5IYDH 1ML0D 4R8NA 2FINB
chains in the Genus database with same CATH topology
2RCFA 4JVZA 2HD3A 4I7AA 5L37A 4JW0A 2QW7A 2Z9HA 4N8FA 4N8X1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RCF A;  4JVZ A;  2HD3 A;  4I7A A;  5L37 A;  4JW0 A;  2QW7 A;  2Z9H A;  4N8F A;  4N8X 1; 
#chains in the Genus database with same CATH topology
 5IWA Q;  3P7J A;  3MXU A;  1GOZ A;  2N8N A;  2Q2H A;  1Q81 C;  4JBK A;  4HIM A;  2LXJ A;  2K5W A;  1C4Q A;  2PZT A;  3K7A B;  3U50 C;  1F2Z A;  1JIC A;  2E2D C;  1HZB A;  1H9K A;  2MGS A;  4K2L A;  4MN3 A;  2F0F A;  1E2V A;  5LL6 S;  2LY7 A;  3KYH C;  1MJE A;  1OXU A;  3OIP A;  5FK9 C;  3H3V H;  3S1Q B;  1VQC A;  4DXG A;  3RZO B;  1MIU A;  2VQF L;  4X62 L;  1HNX L;  3NWT A;  4JVZ A;  2F1M A;  4HJ8 A;  1I4Q A;  4CJ2 C;  5JJK A;  3T1Y Q;  1A2T A;  3D3R A;  1I6H B;  2I5L X;  3CAM A;  1CQF A;  3CP0 A;  1DM0 B;  5D3D A;  4OO1 G;  1R4P B;  4KD3 A;  4P71 A;  1B3A A;  4IUQ A;  2I5M X;  1K8M A;  4A3J B;  3R8B A;  4DV3 L;  1DZ1 A;  4PZ8 A;  4BBR H;  1IZ6 A;  4A3I G;  2UUA Q;  1HXY D;  3HZX A;  1TWC B;  3AYH B;  3DXJ C;  3TDQ A;  2O5I C;  2UXB Q;  3TP6 A;  3DM1 A;  1B50 A;  2C35 B;  1NUC A;  4OHJ A;  4L5R C;  4H0L C;  2OT2 A;  1VQN A;  1E2W A;  1Y8O B;  4LJZ C;  3BS1 A;  1QIL A;  2XGT A;  3U4Z A;  3HKZ B;  1PRT C;  1YHB A;  4XT3 B;  4KJO A;  4DR7 L;  1SMX A;  1N32 L;  5C44 H;  2QDB A;  1U4P A;  4DR2 L;  2EYO A;  3M4Y A;  5I6Y A;  1X54 A;  1PH5 A;  1EQV A;  4H7B A;  3PO2 B;  2VUM G;  2VQE Q;  1FNU A;  1VMP A;  2CH4 A;  1PRT F;  1TWF B;  5IGG A;  5J39 A;  2E2I H;  1FR3 A;  5CBE E;  3S1N B;  2YU9 B;  1A3U A;  4RCO A;  1STB A;  4N9P A;  4AIM A;  1EQR A;  2UU9 L;  1UE1 A;  2PMZ E;  1LTS D;  2JA6 G;  1NTG A;  5BN4 A;  1CT1 D;  4JI5 L;  4F7X A;  1Y1W H;  4A3I B;  4WOR A;  2KEN A;  5LMN Q;  2I07 B;  2E8G A;  3L3O C;  4R9W A;  3R2T A;  2B2W A;  2E2H H;  3I4M H;  2H1E A;  3AEV A;  4DR4 L;  4ALP A;  4XQQ A;  3H15 A;  2EYJ A;  1C0A A;  1V9P A;  2R92 H;  2UUC Q;  1GKH A;  4P72 A;  5JEA J;  4MTN A;  1EWC A;  5LMU L;  4DV5 Q;  1S72 A;  1PYW D;  1TS4 A;  1G2S A;  1WTP A;  2K5N A;  4V0B A;  1BUV T;  2XN9 C;  1X55 A;  5K36 H;  2MO0 A;  2CWA A;  2K1B A;  5T1I A;  1STG A;  4K6L A;  1Q86 C;  2FMC A;  3I4N H;  2NVQ B;  1CKN B;  1CUK A;  5M5X H;  1ILP A;  2AQ1 B;  4JI3 Q;  1FJG L;  3PIO A;  2RBM A;  2J7Z A;  4FVM A;  3WWV A;  2ASB A;  1XWE A;  5CBA E;  3G4S A;  1BCP F;  3NPP A;  1MHW C;  1TWG B;  1IBM L;  2OXP A;  4DR5 L;  2LXK A;  2K14 A;  2YTX A;  1K83 H;  1SYF A;  3VYT A;  5C4X G;  1WTH A;  5FO8 B;  1A0I A;  4LUZ A;  1VF5 C;  4IQZ A;  4DF7 A;  3V96 A;  3OTO L;  5K5P A;  1LTB D;  2F0N A;  4WFN 3;  2LSS A;  2NVX B;  3PUZ A;  1Q1E A;  2EJF C;  1L1O B;  1SNO A;  1PTO C;  3CCS A;  4OX9 Q;  4A3C G;  1BO0 A;  1U4R A;  2R6G A;  1BQQ T;  1A3V A;  4HN7 A;  2IHF A;  2Y0S G;  3MFY A;  2JXM B;  4A3K B;  1YZ6 A;  4UY8 C;  2F0J A;  5JOB A;  3MXP A;  4HMJ A;  4IFD G;  4XTC S;  3I8Z A;  2KOL A;  1EEF D;  5C3E G;  5JPM C;  2ZXO A;  4CDC C;  5LL6 X;  3G6E A;  4CGY B;  4DK3 C;  1EYG A;  1EY8 A;  5C4X B;  1NR2 A;  3QOJ A;  1HR0 L;  5EPL A;  4N8F A;  2L15 A;  2TSS A;  3EJI A;  4JK1 C;  4LMQ D;  3SHL A;  1PTO D;  4CHT B;  2KA7 A;  4HCS A;  2OTJ A;  3KF6 B;  5FLX c;  3OHX C;  1ESF A;  1X3Q A;  4YHH Q;  4B9W A;  3T4A C;  3J81 i;  3CC7 A;  4CDE C;  3K59 A;  4A3E B;  2EJG C;  3RR5 A;  1Q46 A;  2EXD A;  1Z6H A;  4DNI A;  3Q6S A;  1DYQ A;  4HJ9 A;  2ZTC A;  1HH2 P;  2WKD A;  2Y0S B;  1F2M A;  1N9W A;  5JEA H;  2RHS B;  2R7Z G;  4B3T L;  5C3E B;  5IE8 A;  1YIJ A;  3GV3 A;  1X3G A;  4HTH A;  4L63 B;  1J6Q A;  1MKH A;  3GDE A;  3HOY G;  1QB5 D;  1UWV A;  2DN8 A;  4QIW B;  4LUV A;  2BOS A;  1CZW A;  3CD6 A;  1B4O A;  4GNX A;  5E3F A;  1D5M C;  1U0L A;  2QKI C;  4BBS H;  1IYU A;  4A3L H;  1XJV A;  4LF4 L;  2O2L D;  1SRU A;  4LUO A;  1V1P B;  1SBB B;  4QB4 A;  4NXM Q;  1Q8K A;  3PCO B;  1N33 Q;  4TVA B;  4KI0 A;  1M90 C;  4BY7 H;  2K01 A;  1SE8 A;  3SVM A;  2B29 A;  1LTL A;  2CVR A;  2Z4I A;  2FHT A;  2Z4H A;  4EQ5 A;  5FLM H;  2AWN A;  1VQ7 A;  3ZYY X;  2ATW A;  1YNN D;  1QOH A;  5C4H A;  4LFC Q;  3N52 A;  3NQI A;  4LW1 A;  3D31 A;  4IAL A;  2F0P A;  1TWH H;  2WB1 G;  1SXT A;  4RAU C;  3RZD H;  5TSS A;  2WKC A;  1LYL A;  3HOY B;  5G3L D;  4C3H H;  3M4P A;  1H9S B;  2G5D A;  3SGI A;  3W5O A;  1HFN A;  1LAC A;  1C8C A;  1G6Z A;  3T1Y L;  2D0P A;  4C1N I;  3PF5 A;  1YEZ A;  5CV4 A;  1K3R A;  2XNA C;  1TKW B;  4UDU C;  3S2D B;  4C56 C;  1NR4 A;  5FO9 B;  2ZM6 Q;  2J4X A;  3K7A H;  1Q90 A;  3JAM L;  3IL8 A;  2NTT A;  5CV6 A;  2HD3 A;  1KRT A;  4L5Q A;  4CKC A;  2RDG A;  4UP8 A;  3E0J A;  2K04 A;  4QCL A;  3A74 A;  4I7Z C;  3CCQ A;  3SK6 A;  3K81 C;  1N34 L;  3E3X A;  2K75 A;  2F0K A;  3M4O H;  2R61 A;  2JA8 H;  4PG3 A;  4J6H A;  2H4O A;  5IP9 H;  2WAC A;  2M2L A;  2VS1 A;  3K8A A;  3STB D;  1KAW A;  1JWM D;  5H1S E;  2PQA A;  2YV5 A;  2B63 B;  3S15 B;  2G9D A;  2JE6 I;  4LFA Q;  3HP3 A;  1SFO B;  4IJH A;  2EYM A;  4GN5 A;  1VDZ A;  4FDB A;  3QR8 A;  1YJW A;  2L9H A;  1DXM A;  5C4J H;  1VS0 A;  2G9H D;  3I91 A;  5F2D A;  4B3S Q;  4S3S A;  1PMR A;  3K0X A;  1GXD C;  1ZYR C;  5HGQ A;  1I3Q B;  4FXD A;  1QUQ B;  3S1M H;  1D2B A;  5C44 G;  2RDF A;  5LMN L;  3PO2 H;  3GQB A;  1GHJ A;  3J81 E;  1E3P A;  1SND A;  4QJF A;  3K5O A;  2KCT A;  2AKW B;  4YIJ A;  5FJ8 H;  3OYY A;  2JA5 H;  2OF1 A;  1S5F D;  2RKS A;  3A55 A;  1FNW A;  4IUR A;  2CKZ B;  1FGU A;  1HQM C;  1TY0 A;  1EFW A;  2UUC L;  1TVX A;  4DV5 L;  4K5W A;  1GVP A;  4MIU A;  1G2T A;  4X3T A;  3MA2 B;  1X56 A;  2FJ2 A;  4V19 0;  1KXL A;  3D8G A;  3BDO A;  3PUV A;  4DNR B;  1VQ8 A;  1Y1W G;  3I73 A;  4ZK9 B;  3VR5 A;  1ZYR D;  2NZO A;  4JI3 L;  4NPS A;  3CME A;  2ENB A;  2Z1C A;  1A8V A;  4KN7 C;  2KBN A;  4CDF C;  5FOB B;  4C1N K;  2NZH A;  4DKA C;  1XPR A;  1K8A C;  1VQE A;  1HFG A;  2MO1 A;  1OXT A;  3HRZ C;  1Q1B A;  4DPG A;  1HTL D;  2XRQ D;  4POG A;  4HID A;  1R9T H;  2QEX A;  2RA4 A;  3HOV H;  2R93 H;  1GUT A;  2Q2I A;  4NB3 A;  3MXG A;  1LLR D;  1GD7 A;  3MXN B;  5M3M B;  1G91 A;  1TS2 A;  5HY6 A;  1HA6 A;  1B1Z A;  2AHO B;  3I4N G;  1W6J A;  5DM7 3;  5D3I B;  1FYC A;  1RF2 D;  2DGY A;  4C3I H;  1KDA A;  2E2J B;  2ZTE A;  1AEX A;  2F0G A;  5IT9 L;  3G7L A;  5IYC G;  3I7F A;  2PO4 A;  3QOL A;  4LF6 Q;  4OX9 L;  1WJJ A;  3WDN A;  3V05 A;  2CHB D;  4AYB G;  1ZEQ X;  3CW2 C;  2IX0 A;  1BVS A;  1GUW A;  4UAI A;  1AW7 A;  2MJ8 A;  1EY4 A;  3C46 A;  5KRU A;  2MP1 A;  1TWA H;  1KQS A;  3C3L A;  4F88 A;  1SDF A;  1SNQ A;  2F03 A;  1ESR A;  5DAU A;  1LAB A;  1VQD A;  3VR3 A;  1PYB A;  4M1U B;  4FF3 A;  1EWH A;  2C5C A;  4IN3 A;  3ITP A;  4YHH L;  1OO9 B;  1V43 A;  1KHI A;  3IAY A;  3A5Z B;  2OQ0 A;  3D6C A;  3HOX B;  1CI3 M;  1WI5 A;  2FXQ A;  5KYI A;  1V1Q A;  1EYA A;  2K5Q A;  3KDF A;  5COY A;  1NNX A;  1HUN A;  2QDL A;  3K6O A;  3C1F A;  5IOD A;  4IUV A;  2LFN A;  4QGU A;  1L1O C;  4AYB B;  5ELC A;  3FHW A;  2F0O A;  4YCW A;  1Q82 C;  2OEO A;  3HOU G;  4BA2 I;  1VQA A;  1VQM A;  3H91 A;  2Z6K C;  3A8J E;  2ZJP A;  2OCE A;  4C3J G;  1CA5 A;  3VYR A;  3TS0 A;  1Y1V H;  3U9S A;  1W6K A;  1VQ6 A;  2IX1 A;  3GV6 A;  3DWA A;  1IHZ A;  4XQJ A;  4A3M G;  4BXX H;  3TP8 A;  3SK5 A;  5EQ0 A;  1QVG A;  3K5L A;  1VQF A;  2QCP X;  5FO7 B;  3KLW A;  2NVT B;  1CHP D;  2BDO A;  2WV6 D;  4CJ0 B;  4G7H C;  2L12 A;  5CR3 A;  4NXM L;  3BJU A;  4LF8 Q;  4KKT A;  5EPJ A;  4HIO A;  2WP8 J;  4XDX A;  4UHV A;  2ICI A;  1JJC B;  2JSO A;  4ILW A;  4BS9 A;  4DA2 A;  3HOU B;  2ICE C;  3NBH B;  3I2Z A;  3I4L A;  2RF4 A;  4LFC L;  3FKI B;  2HHH Q;  3DMU A;  4YWM A;  4C3J B;  1WTQ A;  2PCF B;  2PNH A;  1VQB A;  4JC0 A;  1K3B C;  1WCM G;  2IL8 A;  4NP5 A;  5EKI A;  2VNU D;  4B3M Q;  4A3M B;  1PZK D;  1S4Z A;  2Z8L A;  3OMG A;  2HDL A;  3S24 A;  5GRO A;  1F9S A;  1ET9 A;  2IWH A;  4X3K A;  2PI2 E;  3PV0 A;  3U9O A;  4KHP L;  3FEW X;  1EU4 A;  3GTJ H;  5FLM G;  2ZM6 L;  4WJW A;  3E9H A;  1IYV A;  1ONL A;  1RHP A;  2K32 A;  3FMC A;  3FRP B;  2JP1 A;  1K73 C;  3PO3 H;  4A76 A;  2K50 A;  2BCO A;  1NBW A;  4DAY A;  4FXK C;  4OIJ A;  4DAP A;  2GVB A;  1YVC A;  3MAQ A;  2RVL A;  4PNY A;  2BH8 A;  2PI2 A;  1F77 A;  1SNP A;  1T5E A;  1UE7 A;  1BBW A;  2L4N A;  3FP9 A;  4IJL A;  5HUR A;  4DV4 Q;  4WRD A;  2WAQ E;  4NXN Q;  2AQ3 B;  4G7O C;  1WCM B;  4XIG S;  1Q8I A;  2HT1 A;  1I5F A;  4WJ4 A;  2XWB B;  3M3Y B;  1I50 B;  4DU9 A;  1JMC A;  4K0K Q;  4LFA L;  3HOZ G;  3NTK A;  4PZ7 A;  1F9P A;  2HCI A;  1XNQ Q;  5ELF A;  1WYD A;  3KBX A;  4RKB A;  4PMC A;  3J81 c;  3K80 C;  2XTI A;  2IW3 A;  2D62 A;  4B3S L;  5KGU A;  5E7N A;  3CMA A;  2QF7 A;  1RKN A;  2OWO A;  3HOW H;  1NY4 A;  2KVM A;  5C5L A;  3H0G H;  4PMW A;  1AZP A;  3I72 A;  4DR1 Q;  1SFO H;  3TP7 A;  1J5E Q;  4A93 H;  3CRK C;  3OWF A;  2LS0 1;  2V4D A;  3NTH A;  4NKL A;  4A3G B;  2K28 A;  2A1A A;  3GTM B;  1XX8 A;  1KDB A;  3HOZ B;  5ELB A;  2IX3 A;  1HRJ A;  3KJP A;  1O78 A;  1B2T A;  4C2M H;  3Q0A A;  4KHV A;  3KFU A;  3CHB D;  1BKB A;  2CCZ A;  4PZ6 A;  1KTK A;  4DR3 Q;  3NXW A;  1XTD A;  1CKO A;  4JI0 Q;  1D6E C;  3S16 B;  4LF9 Q;  2RCN A;  4QUC A;  1N36 Q;  4IOA A;  4ZQ3 A;  3QB3 A;  4JI1 Q;  3IFT A;  1XMO Q;  3BG3 A;  3CCR A;  4FF4 A;  2B2Y C;  4OWW B;  5L37 A;  3CXC A;  1MSH A;  1VQJ A;  4R4O A;  2MHV A;  2RQX A;  4LF6 L;  2DY8 A;  5IP7 H;  4HJ7 A;  3K0Y A;  3NHH A;  4A3F G;  2NN6 H;  1NSN S;  1DD2 A;  2JA7 G;  3W3A A;  2HIX A;  1JOK A;  2GVA A;  2AUJ D;  5IGF A;  3J81 L;  2I46 A;  1VCI A;  5M3M H;  2F0U A;  2NYZ D;  3EIV A;  3RLF A;  2R93 G;  1CSP A;  5E4W C;  2KED A;  4CKE A;  3EVQ A;  3L7Z C;  4I7A A;  4UP7 A;  2PQE A;  3HKZ E;  3VR4 A;  3HKS A;  2NTS A;  5IYB H;  3J7A F;  1WTW A;  2UXC Q;  1M4V A;  2JJQ A;  3WOF A;  4XQN A;  1DJR D;  2VUM B;  3PSI A;  1STY A;  4FNF A;  2Z6B A;  2LMC B;  1LUZ A;  1TS3 A;  2Q8T A;  3TS2 A;  3H3V I;  3J7A 5;  4Y7N B;  1I4P A;  2EXZ A;  2A8V A;  2M9V A;  2JA6 B;  1LO5 D;  2R3Z A;  1PTO H;  5M9O A;  4P75 A;  1Q12 A;  4O42 A;  3DEP A;  1FNV A;  1Z7T A;  1VF7 A;  3KBG A;  5JVG 3;  1SR3 A;  4DFA A;  1ROD A;  1K8G A;  1O7L A;  2SNS A;  3DHQ A;  2ID0 A;  4RKL A;  4HSP A;  1SJH D;  2A6H C;  3GTG B;  2OTL A;  3HOX H;  3LWU A;  1QZH A;  2B2T C;  1JOO A;  5DEH A;  4A3B G;  1E1T A;  3QIA A;  1RL2 A;  3SXH A;  1EY5 A;  4HIK A;  1EYD A;  5M5W H;  1IXR A;  1E2Z A;  2F0H A;  3U4V A;  3TZD A;  2BA1 A;  3DM3 A;  3I56 A;  3N6R A;  5CGK A;  1R4Q B;  4LF8 L;  1IL2 A;  3URY A;  2QW7 A;  4R4I A;  2EOT A;  2FMM A;  4BY1 G;  5GAD C;  4ULL A;  1PFN A;  1HUM A;  1ENF A;  1PTO F;  2ZJR A;  1JE5 A;  1Y1V G;  2F0E A;  2A6H D;  1SRO A;  2I5H A;  4GNX B;  2NWG A;  4G4K A;  5CC4 A;  2PPB C;  1T5X D;  2ZXR A;  4EX5 A;  4ZRZ A;  1KNE A;  4G7Z C;  3OPO A;  2E74 C;  1QJO A;  1YHA A;  5IY0 A;  5ELD A;  2AWO A;  4KN4 C;  4JI2 Q;  4KV6 A;  4KMU C;  1PZI D;  1KLG D;  1CKN A;  2HCC A;  4A3B B;  1Y8N B;  1K28 A;  3HEJ A;  2ZXP A;  1HZ9 A;  4IPC A;  2EDG A;  3VDY A;  3CQZ H;  3E5S A;  5M5Y H;  2VXW A;  1MGS A;  1KAB A;  1PHJ A;  2DNC A;  2B8G A;  2F0L A;  4BY1 B;  1D5Z C;  4OIK A;  4LF5 L;  2RCF A;  3S14 H;  4WJ3 M;  1AH9 A;  2R7F A;  1B7Y B;  4R8I A;  3GTQ H;  5I6W A;  1YHQ A;  1X3E A;  4GOP A;  3TBI B;  1LTT D;  1EY9 A;  2EQS A;  1YNN C;  3L9A X;  4A3D G;  2MPM A;  4AQY Q;  4YWL A;  1CTM A;  4DV4 L;  4ME5 A;  3DUZ A;  2UXD Q;  1HQR D;  4K5X A;  4H44 C;  4I65 A;  2RDH A;  3PGZ A;  2F0I A;  5D14 A;  1DCZ A;  1O7Z A;  1SJE D;  2L1B A;  4L5T A;  3NP8 A;  4TQU S;  1EEI D;  4K8I A;  2F0M A;  1HNW Q;  1XNQ L;  3PO3 G;  3L0O A;  2EY2 A;  1PH3 A;  4YY3 Q;  5G3L F;  3HGB A;  4K2K A;  3NK9 A;  5IWA L;  2KUM A;  2F3W A;  1RDP D;  1O7I A;  4JW0 A;  4L8J A;  2Y0S E;  3PQI A;  2R7Z B;  4JI4 Q;  3NEM A;  5M3F H;  1G8Z D;  1VQK A;  4POF A;  4M8A A;  2IHE A;  2Q8R E;  1Q3L A;  4EGV A;  1XMQ Q;  4A3D B;  1NJI C;  2NB0 A;  1J5E L;  1HTP A;  3GTK B;  3KUP A;  2EYL A;  2KCM A;  2BDN A;  2B2U C;  1QZG A;  2KQ3 A;  3H09 A;  5IYD G;  3STB C;  2RSO A;  4DXF A;  1JOQ A;  5FLX L;  4RH6 A;  4JG2 A;  2JQO A;  1KLU D;  4LFB Q;  2X6G A;  1BF4 A;  1YIT A;  4X64 Q;  4XYO A;  3RLO A;  5JPN C;  2LKV A;  1AZQ A;  1S5E D;  3HOW G;  1LTG D;  1P16 A;  4CDD C;  2UUA L;  1GO3 E;  3KLS A;  3H0G G;  3S1Q H;  4DV7 Q;  1G6P A;  2UXB L;  1PA6 A;  3RZO H;  1HPC A;  4DUZ Q;  3GTO B;  3UDI A;  3W2D A;  1BR9 A;  5CV7 A;  3D4D A;  1C9O A;  4EVO A;  2KHI A;  4RHR A;  4DR3 L;  4DNT B;  3S1R B;  4A93 G;  1K0R A;  1LTA D;  1I6H H;  3CC4 A;  1WOC A;  1I6V C;  5I2X A;  4A3G H;  3H6M A;  4E6I A;  4LF9 L;  2WB1 B;  3GTM H;  1CKM A;  1MI2 A;  4DK0 A;  1WTR A;  5CV8 A;  4A3J H;  4JI1 L;  1E1O A;  1J9O A;  2VQE L;  3BYY B;  1XMO L;  5IGC A;  1B8A A;  1GUG A;  1W3S A;  1TII D;  1TWC H;  2DNE A;  4BBR G;  5C0X J;  1E24 A;  4N8X 1;  1LT3 D;  4K14 A;  3BU2 A;  2QIL A;  1F2Y A;  3TRE A;  2D5D A;  1GUN A;  1S5B D;  3RNU A;  1HR0 W;  4JV5 Q;  5EGT A;  3L2P A;  2E5L Q;  1STA A;  1QG7 A;  1S40 A;  1QVC A;  1RD9 D;  3OOC A;  2RHQ B;  5ISR A;  1O7Y A;  4OON A;  3EBE A;  1TWF H;  4XT1 B;  3VR2 A;  1IBL Q;  2VW9 A;  1Y69 U;  3S1N H;  2YU9 H;  1GUS A;  2KHJ A;  3ONA B;  2B2W C;  4BA1 I;  1MSG A;  3BZK A;  3BDC A;  3R93 A;  1QNK A;  1PRT B;  1PH7 A;  1J8I A;  3DWP A;  4OO1 H;  3LX0 A;  3W1G A;  3KK7 A;  2UXC L;  4K8J A;  1QCB D;  1EQQ A;  1HJP A;  2CWP A;  3MEH A;  4A3I H;  3MVV A;  2ZTD A;  3TME A;  3J7A V;  3NUC A;  4BBR B;  3CKI B;  2PYK A;  5DNF A;  3PIP 3;  1RIP A;  2VQF Q;  4X62 Q;  1HHV A;  3VR6 A;  4RGT A;  2VL6 A;  1TU2 B;  1DOL A;  3I4M G;  1JOR A;  4HR7 B;  2QA4 A;  5C44 B;  2R92 G;  2X69 A;  5A35 A;  1I4R A;  2A69 C;  2PNR C;  4IPH A;  3A7A B;  2YYZ A;  4RA8 A;  3TQY A;  3MWY W;  1WFQ A;  5DLQ E;  5KND A;  2MNA A;  2JK8 A;  2V1C C;  4DK6 C;  2NVQ H;  1S3O A;  2MQH A;  2F0S A;  3DEO A;  4HJA A;  1AN8 A;  1CFM A;  3NE5 B;  2E2I B;  1ET6 A;  3J80 E;  3P20 A;  1KIX A;  3RN5 A;  3H94 A;  2SDF A;  2JA6 H;  4F87 A;  1VMC A;  3KDF B;  1O80 A;  5JVH 3;  4APV A;  1TWG H;  1FD7 D;  3IRB A;  2KHS A;  1RCV D;  3ND8 A;  2VZA A;  5CV5 A;  1Y1W B;  5KYL A;  1T9H A;  3I3C A;  1BCP B;  1NE3 A;  3F8T A;  4H02 A;  3G48 A;  4QY7 A;  2B2Y A;  2A69 D;  2RSN A;  2E2H B;  1D5X C;  3I4M B;  3F1Z A;  2NVX H;  4DN4 M;  5C0X H;  2B3G A;  2F3V A;  3R2I A;  2R92 B;  1I4H A;  4FXG C;  5AJ3 Q;  3CCV A;  1NMF A;  3K58 A;  2KCC A;  4ZYS A;  5GAE C;  1SE2 A;  4A3K H;  1A2U A;  1EY0 A;  4JOI C;  4L6T B;  1BBU A;  3I4N B;  1WD0 A;  5M5X B;  3ER0 A;  5KNC A;  4LK1 C;  4X66 Q;  3PMF A;  3K5N A;  2EYP A;  2BH2 A;  1GM5 A;  1DGS A;  4R4C A;  1CA6 A;  3I55 A;  1KNA A;  1E7Z A;  1KRS A;  3SEB A;  4DV0 Q;  5C4X H;  5K36 G;  3T56 B;  5JJZ A;  1SAP A;  4OEL B;  1I94 Q;  1EFI D;  1K83 B;  2SEB D;  4JBJ A;  5A2Q E;  3DLL A;  2JYO A;  4XYQ A;  4IPD A;  5AFW A;  4RMF A;  3NWS A;  4AQY L;  1JE4 A;  4A3E H;  5CYU A;  4EQO A;  1IL8 A;  3X3N A;  1FVI A;  4IUT A;  4GNX C;  3Q24 A;  2UXD L;  4IPG A;  1D7Q A;  1L2F A;  3NBI A;  2WAQ G;  2WIN B;  5LMN W;  2FFK B;  4Z9C B;  4J8Q A;  2QEJ C;  3QJY A;  4HAE A;  1UE6 A;  5C3E H;  1EIG A;  1HNW L;  5JEA G;  1N33 L;  1PZJ D;  2B2T A;  4PV1 C;  1LT6 D;  4O2D A;  4YY3 L;  3OTO Q;  2AMC B;  3CCE A;  3KF8 A;  3T16 A;  3ICE A;  5IGB A;  1EZ6 A;  4ZLT F;  1B9M A;  1EYC A;  2XRS D;  3CRL C;  1STH A;  3E0E A;  2NZ1 D;  4JI4 L;  3HG9 A;  4BBS G;  2JA9 A;  4A3L G;  2CH4 W;  2VB2 X;  5I9P A;  4JPB W;  5I2Y A;  2ZJQ A;  1XMQ L;  3A8K E;  1PFB A;  1HZA A;  1YNX A;  1F9R A;  3SK8 A;  2PW7 A;  4DV1 Q;  4BY7 G;  3F2B A;  3BDL A;  1PDQ A;  1K9M C;  2NVY B;  2DUD A;  1JT8 A;  2WAQ B;  5C0X I;  1BXT A;  1QVF A;  4LFB L;  5JAV A;  3M4Q A;  4X64 L;  4GS3 A;  1H9M A;  1CSQ A;  1UEB A;  2L11 A;  4JI6 Q;  3D0F A;  3M7G A;  4MHE A;  3WOE A;  1TT2 A;  5M3F G;  3LWE A;  4IUU A;  2QGQ A;  4DV7 L;  3HOY H;  2N78 A;  4JI8 Q;  3UE0 A;  2Z9H A;  4C3H G;  1SYD A;  4RGM A;  1OTC A;  1A15 A;  5GAG C;  3VA7 A;  1C48 A;  2IT1 A;  3MEF A;  2UUB Q;  3S2D H;  1FL0 A;  1BBX C;  1EL0 A;  3X3M A;  3Q23 A;  4H13 C;  5ELE A;  4ZCK A;  4IOC A;  3T51 B;  3RD4 A;  1V1O A;  2AQ2 B;  2KEE A;  1SN8 A;  3JAM E;  1HA5 A;  4BY7 B;  4Q0F A;  3S1R H;  4QQB X;  5EKL A;  1G29 1;  2L55 A;  1HNZ Q;  3NBH A;  4RFB A;  4JV5 L;  3UE1 A;  2JA8 G;  1TWH B;  5IP9 G;  4OEM B;  4Y52 H;  2B63 H;  1JCK B;  3S15 H;  1SYE A;  3RZD B;  3ULP A;  1PVO A;  1L0Y B;  1WTO A;  4A3J G;  1PH2 A;  4YWK A;  1IBL L;  3SDZ A;  4ZAI A;  3SE0 A;  4C3H B;  4DV6 Q;  5BR8 Q;  1EIF A;  1SYC A;  5J3B A;  2EY5 A;  4R1J A;  4JBW A;  3I70 A;  4TKO B;  1MBY A;  2DJG C;  1ENA A;  2ZT9 C;  1H9J A;  4IZ8 A;  1WD1 A;  3UDG A;  3HKZ G;  1A6X A;  1I3Q H;  2GN5 A;  5BN5 A;  4KY6 A;  3U58 A;  4X65 Q;  2HDM A;  3PO2 G;  4DV2 Q;  2O5J C;  4GKK Q;  4DR6 Q;  2F0W A;  2NUC A;  1DON A;  2K5D A;  2B2U A;  4FO2 A;  1XTC D;  2J0T D;  5KNB A;  1A63 A;  1X6O A;  1X32 A;  3KJO A;  5FJ8 G;  2F3I A;  2JA5 G;  1IYJ B;  2PMZ B;  4PMB A;  3IKJ A;  3J80 c;  3M4O B;  2JA8 B;  4IO9 A;  3ULL A;  1EWI A;  2EY1 A;  1WTX A;  3FDT A;  3CCM A;  1SEB D;  1AE3 A;  3NEN A;  1KAA A;  5KIX A;  4HMI A;  4GLA C;  3A56 A;  3B6Y A;  3H3V C;  2N3S A;  3K57 A;  2K03 A;  2HQL A;  3HFZ B;  3BVG A;  3PF4 A;  1N34 Q;  5C4J B;  1B70 B;  4O1N A;  3RMH A;  3ERQ A;  4EQP A;  5IIF A;  1AFP A;  1CQV A;  4FF1 A;  1XXG A;  3S1M B;  2XVS A;  1SE4 A;  3TZU A;  3TEH B;  5IGD A;  5GAH C;  2CQO A;  3HOV G;  4X3U A;  5CV9 A;  2JA5 B;  1X3F A;  2EY6 A;  5COR A;  4B3R Q;  5FKA C;  2F0Q A;  4L5S A;  2E2J H;  2PZU A;  1EIY B;  3GTP B;  4C3I G;  3T13 A;  4UP9 A;  5AJ3 L;  5IT9 E;  1YNJ C;  3CCU A;  1U4L A;  1U5K A;  1NMG A;  1WTV A;  4O0A A;  3I90 A;  1PRT D;  5C3X A;  1W2B A;  1XPO A;  1TS5 A;  1X65 A;  1BOS A;  3PUY A;  4CKB A;  2ES2 A;  2F0V A;  3QO2 A;  1ASY A;  3BVM A;  3S2H B;  3VA5 A;  4X66 L;  1Y14 B;  1JWS D;  5D65 A;  2Z0S A;  4A3F B;  3DWQ A;  1A62 A;  2JA7 B;  4DV0 L;  1TXY A;  1IKM A;  2A68 C;  5T1G A;  1CHQ D;  5C0X G;  2KEC A;  1S5C D;  4KTA A;  1I94 L;  3JC6 6;  1R9T B;  1LM0 A;  1CK1 A;  3HOV B;  4OL7 A;  2R93 B;  4GLV B;  1JJ2 A;  1STE A;  3M85 A;  1BCP C;  2HQE A;  4ZUJ A;  1YNJ D;  3J80 L;  1RTN A;  3A54 A;  1EU3 A;  4A3K G;  5JJI A;  2N88 A;  4FP5 D;  5IYC H;  1IW7 C;  1QWY A;  4C3I B;  1VQ4 A;  4U67 3;  1VQO A;  5EJW A;  1SMY C;  4IUN A;  1KDC A;  2D9U A;  3OSO A;  2B2V C;  2A68 D;  4OXP A;  1STN A;  2K4K A;  1B44 D;  3PIP A;  4JI7 Q;  2F4V Q;  5EKK A;  4GOP B;  1PH8 A;  4GN3 B;  4X3S A;  4RGO S;  1BCP D;  4JYA Q;  4QMG A;  4OGQ C;  3BZD B;  3D4W A;  1TWA B;  4A3E G;  1SYB A;  3AFQ A;  4BXX G;  1VQ5 A;  2NVT H;  2A6E C;  2Q8I B;  2HHH L;  1IW7 D;  2DJF C;  1XPU A;  2NN6 I;  2XIW A;  1PFM A;  1SMY D;  2YTY A;  1P8L A;  4MTK A;  4ID6 A;  4B3M L;  3AFP A;  3W1B A;  3J7Y W;  2EYF A;  4J15 A;  3TRZ A;  4DV1 L;  1DOM A;  3J81 j;  1VQG A;  1C7Y A;  3HOU H;  3FKI H;  4GLX A;  5HGT A;  4RHS A;  3S17 B;  5A2Q L;  4KD4 A;  4C3J H;  4JI6 L;  2EYH A;  3GP7 A;  3E6Z X;  4KY5 A;  4JOI A;  2A6E D;  2O4X A;  1B9N A;  3CU7 A;  1UE5 A;  4JI8 L;  4A3M H;  1Y1V B;  3NSW A;  2VB3 X;  1PV4 A;  2A73 B;  4QF4 A;  1TR5 A;  5NUC A;  1M1K C;  2XWJ B;  3JAM c;  2F4I A;  3MC0 B;  2NVY H;  1PH1 A;  5EAY A;  2KCN A;  2UUB L;  1L1O A;  2AUK A;  4NXN L;  4OWX B;  4LNQ A;  1OXX K;  3R3O A;  4ZKB B;  2Z6K A;  2C9O A;  3Q8D A;  2WII B;  4K0K L;  3Q22 A;  2BA0 A;  4ZKC B;  4QL5 A;  1KD1 C;  4DUY Q;  1D8L A;  3RUZ A;  4GKJ Q;  2X6L A;  2A5H A;  3QWN A;  1SSO A;  3J80 i;  1HNZ L;  3GTL B;  3FPU B;  3V2T A;  1WCM H;  1UUP A;  3GO5 A;  4LF7 Q;  1CM9 A;  3M3Y H;  1I50 H;  1EOV A;  4DR1 L;  1SNC A;  1JC7 A;  4OWT B;  2PQA B;  1A3T A;  3KF6 A;  3CPW A;  4DV6 L;  3ZJY C;  5BR8 L;  5J22 A;  3UDX A;  1OXS C;  2E75 C;  1U9R A;  1VQI A;  3C1E A;  4QIW E;  1TQO A;  2BE5 C;  3IFD A;  4CBV A;  1G51 A;  4X6A H;  1DOK A;  3CCJ A;  2EIF A;  4HJ5 A;  3GTJ B;  4LWC A;  4ABN A;  2SNM A;  1I4X A;  1B53 A;  1M8A A;  4X65 L;  1KL9 A;  4KK7 A;  3A7L A;  1VQH A;  4KY7 A;  3PO3 B;  2K52 A;  3OIQ A;  2CQA A;  1H9R A;  4DV2 L;  4RG1 A;  3LNN A;  4ME3 A;  1PXU A;  2B63 G;  3KLS X;  4DR6 L;  4GKK L;  2CW0 C;  2D0O A;  4K6D A;  4FF2 A;  1E0B A;  5BN3 A;  3OW2 A;  1EY6 A;  1B3Q A;  1MD2 D;  1I4G A;  4LAA A;  4HED A;  4KHP Q;  2P5Z X;  4JI0 L;  4DK1 A;  2BE5 D;  3GD7 A;  1N36 L;  3CF5 A;  3HOZ H;  1PH9 A;  1V1P A;  4TSS A;  4KKU A;  2JN4 A;  5GQO A;  2A74 C;  1IBK Q;  3CPF A;  4KHZ A;  5EPK A;  4TRD A;  1SYG A;  1YJN A;  1XNR Q;  1PLF A;  1U4M A;  2CW0 D;  3S16 H;  3NTI A;  4A75 A;  2SOB A;  4KJN A;  1SE3 A;  3OWE B;  3HOW B;  1ILQ A;  1ZXT A;  3H0G B;  1SNM A;  1D1I A;  1GUO A;  2KJX A;  3AU7 A;  2PZW A;  5C3W A;  3NEL A;  5IT9 c;  2K5V A;  3T1H Q;  1EUJ A;  1Q7Y C;  5LHY 1;  1H9S A;  4GN4 B;  4HSV A;  4B3R L;  2NBF A;  4A93 B;  3PIO 3;  1ASZ A;  2DY7 A;  1OXV A;  1PH6 A;  1KC8 C;  5E1F A;  2EZV A;  4J1M A;  2WB1 E;  1D1K A;  1SLJ A;  5IP7 G;  1EZ8 A;  3A8I E;  1JJG A;  1LT4 D;  2NN6 G;  5IGE A;  3G6J B;  4K5V A;  1ENC A;  5J1Z A;  5EBC A;  1F2L A;  4C2M B;  3G71 A;  1LTI D;  3UDF A;  5M3M G;  3MTS A;  2E76 C;  3J7Z C;  3A0J A;  5EBD A;  3SK4 A;  2Q2U A;  1YBY A;  3TN2 A;  1YI2 A;  1HNX Q;  4RGN A;  1X9N A;  4HCE A;  3GTP H;  1K0S A;  2VY3 A;  3HS0 C;  3OW7 A;  2EE1 A;  3EQL C;  1BDO A;  1Z47 A;  1JQY D;  1S5D D;  3KOJ A;  3PUX A;  4IFD J;  1AP0 A;  2HIV A;  2F0T A;  1UNS A;  5IYB G;  3RN2 A;  2VUM H;  1BNZ A;  3TSS A;  3AMU A;  2N55 A;  4DV3 Q;  3BZC A;  3BYT B;  4Q5V A;  3S2H H;  2CFM A;  1L0X B;  4Y7N H;  1H95 A;  4A3F H;  3P1H A;  5E4X A;  2JA7 H;  2EVB A;  2I0Q A;  2R7D A;  4CJ1 B;  2PW5 A;  5CMD A;  1LT5 D;  2K6A A;  2L5T A;  4DR7 Q;  1N32 Q;  1QUQ A;  3AQQ A;  4DR2 Q;  1E22 A;  4A4I A;  5DM6 3;  2GA4 B;  3LGJ A;  4JI7 L;  2F52 A;  4QUF A;  3GTG H;  2F4V L;  1JWU D;  1LTR D;  3VYS A;  5C6A A;  2HUG A;  3D4R A;  4JYA L;  3RLN A;  1PH4 A;  3JAM i;  3EN2 A;  3HOX G;  4P2C B;  3C2P A;  4IUP A;  2UU9 Q;  2JEB I;  3CCL A;  2YTV A;  2M00 A;  3O13 A;  1ICW A;  2IPK D;  4JI5 Q;  4JI2 L;  2B39 A;  1HZC A;  3AB9 A;  2B8F A;  4MNO A;  1EIH A;  1QNU A;  4BWG B;  1UAP A;  3PUW A;  3EA6 A;  3BVZ A;  1IKL A;  3KF8 B;  4DR4 Q;  4B9X A;  3I4O A;  2TMP A;  4AH6 A;  1PTO B;  5LMU Q;  4OO1 I;  4P74 A;  3MZ5 A;  5C4Z A;  4MZ9 A;  1FGB D;  3MXN A;  1II3 A;  5KEE A;  4R4Q A;  1RTO A;  4A3B H;  1VQL A;  4NDX A;  3E9I A;  4GOP C;  1FJG Q;  4ODG A;  5I4D A;  3KLR A;  4FYD A;  4NMZ A;  1GJX A;  3EFX D;  3M7N A;  1K8O A;  3K7U C;  4N9T A;  4A3C H;  2A19 A;  5M5W B;  2IY5 B;  2K33 A;  2L0C A;  3S17 H;  3ERS X;  1LV9 A;  1IBM Q;  1NAP A;  4EQN A;  5JJL A;  4DR5 Q;  1PYS B;  1V8Q A;  3K5M A;  4BY1 H;  4GZY C;  3FKI G;  3ERO A;  4JCV E;  4PQX A;  1JB7 A;  2N49 A;  4JBM A;  2IJ0 A;  4IFD H;  4DAM A;  4R4T A;  4DUY L;  2WFW A;  4DAY B;  4GKJ L;  3T53 B;  4UPA A;  3S9W A;  1X3P A;  3M9B A;  1QE6 A;  3F2U A;  4DGZ A;  3UI2 A;  1UEA B;  4AYB E;  1CZG A;  2F0D A;  1VQ9 A;  4LF7 L;  2MUY A;  2B2V A;  1GHK A;  4G57 A;  1VQP A;  3MFG A;  2K5H A;  4RWS C;  2ALY B;  4YCU A;  1HCZ A;  1JB3 A;  3CQZ B;  3GTL H;  5M5Y B;  3F2D A;  2MFI A;  4P73 A;  4DAV A;  4KKS A;  2K7V A;  2R7Z H;  1Y8P B;  1NCV A;  1HR0 Q;  4KLK A;  2EPB A;  3S14 B;  3A5U A;  5ELO A;  3TP5 A;  3VYU A;  1EY7 A;  3ULJ A;  1EOT A;  3GTQ B;  1JR0 D;  5ELN A;  4A3D H;  4DUZ L;  2K05 A;  3GTK H;  1PFS A;  1TY2 A;  3FVQ A;  5I9O A;  1ZKO A;  4BBS B;  3CC2 A;  4YCV A;  1N8R C;  3NQT A;  3FPP A;  4F8M A;  5FLX E;  1YJ9 A;  1RJT A;  4B08 A;  2OQK A;  3F2C A;  4NW2 A;  4LF5 Q;  3MHB A;  2Q2T A;  2XSC A;  4B3T Q;  4RCN A;  1F9Q A;  1IBK L;  3GTO H;  1AE2 A;  3OMC A;  4U68 A;  2D2C C;  1XYI A;  1MJC A;  3D6W A;  1XNR L;  1WVL A;  3SR1 A;  2EJM A;  2H5X A;  2JEA I;  2E5L L;  1Z9F A;  4ZUI A;  5C5M A;  4A3G G;  1EQT A;  1L0W A;  3QG1 A;  3ND9 A;  4LF4 Q;  5M3F B;  4XXE A;  1ICF B;  3T1H L;  3P75 A;  5IOC A;  4IFD I;  5IYD H;  1ML0 D;  4R8N A;  2FIN B; 
#chains in the Genus database with same CATH homology
 2RCF A;  4JVZ A;  2HD3 A;  4I7A A;  5L37 A;  4JW0 A;  2QW7 A;  2Z9H A;  4N8F A;  4N8X 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...