4I7AA

Grpn pentameric microcompartment shell protein from rhodospirillum rubrum
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
88
structure length
84
Chain Sequence
b'MYLGKVIGTVVSTSKNESLSGTKLLVVARLTEKLIPDGSTQVVVDTVGAGNGEIVIVSCGSSARQSHSVIDAAVVGIVDTVETV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ethanolamine utilization protein EutN/carboxysome structural
publication title Bacterial microcompartment shells of diverse functional types possess pentameric vertex proteins.
pubmed doi rcsb
source organism Rhodospirillum rubrum
molecule tags Structural protein
total genus 12
structure length 84
sequence length 88
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2012-11-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.220 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) EutN/Ccml 4i7aA00
4I7AA 4JVZA 2HD3A 4N8FA 4JW0A 2RCFA 2QW7A 4N8X1 2Z9HA 5L37A
chains in the Genus database with same CATH superfamily
1NUCA 4R8NA 3M4QA 4CJ0B 2JA8H 1K3BC 4A3FG 2CCZA 1Y8NB 1DCZA 1EY8A 4C3IB 5C3EG 3ONAB 1HA6A 1B70B 3AYHB 2ZXOA 5JJZA 5M5XH 4DV1L 1D1IA 4C3JG 3MZ5A 3W5OA 1C8CA 3J80i 2OTLA 4GNXA 2R92H 1CKNB 4KTAA 2E2JH 3JAML 3H94A 1HNZQ 1PLFA 1E1OA 2L1BA 3VR6A 4AYBG 1QILA 3L9AX 2ZXRA 2KHSA 4DAYB 4XYOA 4DV0Q 2I07B 2V1CC 3CU7A 2FMMA 4IUUA 1EQRA 3MXUA 3CCMA 1IYVA 3HOZG 4H7BA 1UE7A 3STBD 2MGSA 4IQZA 3M7NA 1QNUA 3BYYB 2HHHQ 3MXNB 1EEID 2FXQA 5KYIA 1IYJB 2KUMA 2Y0SE 1GHJA 1A3VA 1NBWA 1Q8KA 1SNMA 4F8MA 1SYFA 1LT5D 4UP7A 1NNXA 4IFDJ 4PQXA 1DD2A 5IT9c 5C0XJ 4A3DH 4OXPA 5C4HA 2L5TA 5E4XA 3VYUA 1PH7A 4FF1A 1HZ9A 2F0NA 2VB3X 1Y1VB 2EYOA 1ONLA 2F0OA 4DV4Q 1AZQA 4HR7B 3UDXA 1CQFA 3W1GA 3VR3A 5FO8B 3AEVA 4QF4A 3PUYA 2Z4IA 3BVZA 3J80L 3S1NB 4JBWA 4U673 2NZOA 2ES2A 4NMZA 4OWWB 1VQ5A 4DR3Q 2K5WA 4K6LA 1ESFA 2Y0SB 1TWCH 4APVA 2R7ZG 1Y1VH 3RMHA 5CC4A 2F0QA 1ZYRC 3UDIA 3HOUB 2IX0A 5FKAC 2UXDL 1EOTA 4FF3A 1KLUD 2P5ZX 1YHQA 3CQZB 4DR4L 1GXDC 2K5NA 3QR8A 1RJTA 4BBRB 3S1NH 1EU3A 1TS5A 2A6EC 5DAUA 4JYAQ 3DM3A 3CMEA 1WTPA 2K52A 4IALA 2OQKA 2NUCA 2L15A 2HIXA 4BBSB 1VMPA 2WFWA 4IFDG 3K59A 4MTKA 5C0XG 3T1HQ 4PMCA 1KAWA 2A6HD 4DNIA 3HOUH 1E22A 3RZOB 1V1PA 4POFA 5HGQA 2QILA 1CKOA 2B2VA 3G48A 1WTVA 5KGUA 3CQZH 2N49A 3G4SA 4GZYC 2K50A 2PW7A 1X65A 1TU2B 1U0LA 3LX0A 2PYKA 5BN4A 2IT1A 1PH3A 1STAA 3S2HB 1V43A 4G7OC 4C2MB 4BBSH 3B6YA 1LO5D 1BR9A 1ZXTA 5EBDA 4BY1G 2K5VA 4DV2Q 1JB7A 4DN4M 4HN7A 2NTSA 3GTLB 4EVOA 3RZOH 1TWGB 2B2YC 1EY9A 3SK4A 1YNND 3R2TA 4ZAIA 1CA5A 3O13A 4CDFC 3IFTA 1JJCB 5J39A 5EKKA 1I4PA 5KNCA 1I3QB 4A4IA 2B8GA 5M3MG 2XIWA 2DJGC 1S40A 3S2HH 5EKIA 2F0DA 4B3SQ 4A76A 2LSSA 3F1ZA 4C2MH 4L5QA 5G3LF 1SYBA 2KHIA 1N33L 1LTTD 4R4CA 3GTLH 4DR1Q 3PGZA 4YIJA 3RZDB 2JXMB 3WDNA 3AU7A 4NXNL 1TWGH 1X55A 2K01A 3NTIA 5FLXE 3GTJB 1PV4A 2JQOA 1XMQQ 2QW7A 1B9NA 4EQOA 4KHPQ 1XPUA 3J7A5 2N55A 1DOKA 3PF5A 4IN3A 3HZXA 4LJZC 1I3QH 1PTOB 2E5LQ 4GOPC 4DXGA 1PZKD 4X64Q 2WV6D 4X62Q 2O5IC 1CM9A 1SBBB 4JPBW 1LTAD 1H9JA 5I6WA 1SYGA 4ZUJA 2NN6I 1EY0A 2F4IA 4ME5A 3T51B 1B9MA 3GTJH 2JP1A 4NP5A 2EJMA 3KF6B 3TZDA 4DK6C 2O5JC 3PCOB 5C4JB 4IOAA 1Z9FA 1SYCA 2TMPA 4KN7C 3U9SA 1JOOA 2EPBA 4UPAA 2Q2IA 1PTOH 4FVMA 4DK0A 1G6ZA 1FJGQ 3H3VH 1C7YA 3PO2B 2A6HC 4K5WA 3HS0C 3QB3A 1EWIA 1Q81C 5IGBA 1XWEA 3FP9A 5EPKA 3SHLA 1WD1A 4H44C 1EY5A 4LF5Q 2UUCQ 4JV5L 4RKLA 5IOCA 1VQDA 1B3AA 2PNHA 1PVOA 5CR3A 2L0CA 2R93G 1JE5A 4LK1C 2M00A 3A8JE 3K8AA 5C4JH 4XDXA 3J7AV 1SMXA 1TWAB 4YCWA 4C1NI 1AE3A 1EQTA 4HJ8A 1VQLA 3KLWA 2XVSA 4UP8A 2CWPA 3A5UA 1TVXA 2VNUD 3NTHA 5IT9L 1U4PA 4J8QA 2NVXB 4B08A 2IPKD 1QUQA 1LTID 1QVGA 1XNQL 2HT1A 1WCMB 1YNNC 3HP3A 2GA4B 4XYQA 5DLQE 1FYCA 1ICFB 1ZEQX 2JA7B 2B2YA 1GKHA 1KNAA 1FGUA 1UEAB 1TWAH 4IUVA 3M3YB 4K0KQ 3PIOA 2MFIA 1HQMC 3GTOB 1PH6A 3M7GA 2KCNA 1CHPD 1N8RC 4R4QA 3U4VA 3M4PA 1VQOA 1KDBA 1SNPA 4YY3L 1KRSA 3A56A 4CDDC 3H0GG 1NR2A 4JI3Q 1BBXC 4ZYSA 2QEXA 3E9HA 3OOCA 4JVZA 1WCMH 5IWAL 4LF8Q 1G51A 2KHJA 2CWAA 5DNFA 2JA7H 2E2HB 2C5CA 1BCPF 1PRTB 1G8ZD 2IY5B 3C1FA 1Y8PB 2MP1A 2BH2A 3ULJA 3JAME 1Q46A 1D5ZC 4K8JA 1NJIC 1DOLA 5IYBH 3GTOH 1DXMA 3TBIB 4JI5Q 3J7AF 1EFWA 2R6GA 1BQQT 4YWMA 4DF7A 4LUZA 4XQQA 4RGMA 2XGTA 4ZK9B 3FKIB 5C5LA 3SK6A 4S3SA 4FO2A 3FPUB 2K33A 1NAPA 2R61A 3KYHC 2MO1A 1EZ8A 2F0TA 2E2HH 5DEHA 4JI8Q 3E9IA 4B3RL 1GUNA 5JPMC 3E0EA 3HFZB 2RHSB 1PTOD 3I4MB 4FNFA 2VS1A 4BA2I 4GKJQ 1Q86C 2Z6KC 3EN2A 2CQAA 4X3TA 2WP8J 3GDEA 4TQUS 1IZ6A 2ZTEA 4A93B 5IIFA 1HPCA 3PUZA 4AIMA 1PZID 4O0AA 1VMCA 1VQ4A 3FKIH 5AJ3Q 3DWAA 3NP8A 4A3CH 3E0JA 5FLMH 3D0FA 2LFNA 2EYLA 3FDTA 3J7ZC 4BXXG 2IWHA 1B8AA 1A62A 2EZVA 4B3TQ 1OXXK 3M85A 2SEBD 1IYUA 4MZ9A 3I4MH 2KVMA 3MVVA 3F2CA 4BY7G 1H9KA 2BOSA 3A0JA 3A8KE 4JOIC 3AMUA 3KK7A 4A75A 2B29A 2F0MA 4A93H 5I9OA 4B3ML 2BDOA 1BF4A 1O7YA 1STBA 3CHBD 1BDOA 2H4OA 5GAGC 4HEDA 1CKNA 4C3HG 3CCQA 3I8ZA 4DV6L 2PZTA 1PA6A 1GUOA 4PG3A 4JI1Q 2TSSA 5K36H 2CH4W 1H9MA 5J3BA 2KOLA 2F3VA 4HJ5A 4X3UA 2VL6A 1FVIA 4X66Q 5GROA 4DAYA 4A3MG 2B39A 1VQJA 3G71A 1VQ8A 1DJRD 1F2ZA 3HOYB 4IZ8A 2M2LA 1PMRA 1Q82C 3VA7A 1WTWA 1MSHA 4DV7L 2RVLA 1CQVA 3EIVA 1QNKA 1HZAA 2WIIB 1BOSA 3MXNA 2PMZE 1HUMA 4TKOB 2DJFC 3FPPA 3D6CA 1TS2A 3NWTA 1F9QA 2F3IA 5JJKA 1G6PA 4KY5A 4CKBA 4N8FA 4P73A 2AKWB 3LWUA 1GD7A 4QY7A 4WJ3M 1TS3A 3D3RA 1HNWL 1VQMA 3HOYH 3QO2A 1AE2A 1QWYA 4DA2A 5EPJA 1SN8A 2E76C 3WWVA 1XNRQ 3A8IE 1PH9A 2NVQB 4ULLA 1PRTD 1I50B 2JA9A 1RTNA 1JWUD 1V8QA 2RQXA 2RA4A 4F7XA 4A3GG 5C44H 2NN6G 3LWEA 1WTRA 2PMZB 3RLOA 4FF4A 1NCVA 5FOBB 5IP9G 3E5SA 3A74A 1O78A 2ATWA 1SROA 4Y7NB 2MO0A 2QF7A 4CKEA 4J6HA 1BKBA 2FHTA 5C4XB 3LNNA 1N36Q 2XWBB 2NVQH 3G6JB 2SOBA 2HDLA 4NXML 4FYDA 3MXPA 1I50H 2ICEC 3P7JA 1CSQA 2KCTA 3OIQA 4HAEA 3TREA 3NSWA 4RGTA 3U50C 5DM63 1STYA 5A2QE 2XRSD 3A7AB 1MKHA 1HTLD 1H9RA 4JG2A 4ABNA 4X6AH 1G91A 5GAHC 2OT2A 4Y7NH 3PIPA 2GN5A 4A3EB 1PYBA 3OMGA 3CCSA 1Q8IA 4RWSC 3HOWB 1ICWA 1SRUA 2JA6B 5NUCA 4OO1H 1I5FA 4K5VA 1YHBA 5E1FA 4J15A 4YCUA 2NVTB 2B63G 2C35B 2F4VL 2NZ1D 3S1MB 1A3TA 3HOXG 2K5DA 1IW7D 5I4DA 3EFXD 4DPGA 4DK1A 1P16A 3U4ZA 4N9TA 4A3KB 1TR5A 1Y69U 1VQKA 3QJYA 3OMCA 1N34L 1KLGD 4AYBE 1MIUA 1WFQA 3S1RB 2UUBQ 4OWXB 1T5XD 5LMNW 1XTCD 2WB1E 1SLJA 3CCEA 3TZUA 2JA6H 4KV6A 2BA0A 3GTKB 1HR0W 1NE3A 2A69C 2QKIC 3CD6A 2YTYA 1Q90A 1YEZA 1XYIA 4ODGA 4HJAA 2SNMA 2NVTH 4C1NK 2UXCQ 3ICEA 1E2ZA 4IUTA 2Z4HA 3VA5A 1C9OA 3TN2A 4DAVA 5LMNL 4DR6L 3S1MH 1K83B 2B2TC 1SDFA 1S5BD 4A3FB 2I46A 3DWQA 4MN3A 1HR0L 1YZ6A 3VYTA 4DV3L 2DN8A 5C3EB 1QOHA 2UXBL 1ILQA 4C3JB 1QB5D 4CDCC 1NTGA 1M1KC 4DUYQ 4IPDA 5JEAG 1KDCA 5IYCH 1I4RA 4L63B 5IT9E 4PZ7A 2DNEA 2LMCB 1VQNA 2K75A 1GVPA 2JK8A 1E0BA 4AYBB 1J5EL 4KY6A 2A68D 1GO3E 2K14A 2WB1B 2IW3A 4PMWA 3TDQA 4DV5L 2RF4A 4M8AA 1WTHA 4A3FH 4HMJA 3D8GA 2B2VC 3HOZB 5C6AA 4HSVA 3PMFA 2KQ3A 1S5CD 5T1IA 4C3JH 4QMGA 2G9HD 2JA8G 1XMOQ 1H9SA 3V96A 5J22A 2K7VA 2E2DC 1YIJA 3CW2C 1A6XA 2HQLA 1EL0A 4AQYQ 2E2IB 4RG1A 1TS4A 2CKZB 1NMGA 4P2CB 4HJ7A 1F9RA 2B2UC 4C3IH 3M4OB 2MPMA 2J0TD 1LT6D 2VQEL 5EPLA 2F52A 2DUDA 2IL8A 4H0LC 4ZUIA 5HY6A 3P20A 2K28A 4KHZA 1WTXA 2AWOA 3UDGA 4DR2L 5JVG3 4DR7Q 3S17B 3BDLA 1IHZA 1HNXL 1AP0A 1ENFA 3BVMA 4UHVA 4YHHQ 4LF4L 1WTOA 2CVRA 4PMBA 1FD7D 1GUWA 2EY5A 3URYA 1AEXA 3NBHB 2ZM6Q 2E2IH 2A74C 1PFMA 2IX3A 3RN5A 2SNSA 1IW7C 5I2YA 3TSSA 4LF6L 5L37A 1I94L 1EY6A 5ELEA 2KBNA 5K5PA 3ER0A 1QZGA 2Z0SA 3CCLA 3OTOQ 2R7ZB 1HTPA 4A3DG 2F0JA 5C5MA 3SXHA 1FGBD 3I70A 3K81C 2F0IA 2SDFA 3KLSX 4DR5Q 3U9OA 3AB9A 1N9WA 5ELOA 2I5MX 2JSOA 3CCVA 4F87A 5A35A 4WFN3 1HNZL 1PH4A 2WKCA 2B2TA 1DGSA 3DHQA 1RCVD 1O7LA 4CJ2C 5EJWA 4KN4C 2R7ZH 4FXDA 1F77A 2WKDA 1KD1C 4DV0L 1EOVA 2EXDA 1SE8A 3PO3G 3S1QB 1A3UA 1MHWC 5BN5A 3CC4A 2JN4A 2B3GA 4XT1B 3HEJA 1TT2A 1E24A 2HDMA 2A68C 2OXPA 2MJ8A 1RL2A 2Q2UA 2PQAB 4NB3A 1Q1BA 2HHHL 3SDZA 2VUMG 3KF8A 4OGQC 2EVBA 4NPSA 4JI7Q 2XNAC 1PYWD 1CZWA 2R7FA 3BVGA 4IFDH 3BDCA 1JICA 2PZUA 4BY1B 2LY7A 5C0XH 1HFGA 2PI2E 3NENA 2AUKA 1EIHA 3ITPA 2AUJD 3I72A 3S1QH 5M5WB 1L1OB 3PIO3 5F2DA 4GKKQ 3R2IA 2D0OA 4JC0A 4BBRH 5H1SE 3HOUG 1OXUA 2F0UA 5I9PA 2VQFQ 2D62A 2F0SA 4DV4L 3STBC 5M3MB 1JB3A 3Q0AA 1JJ2A 3RNUA 5ELBA 2B2UA 4MNOA 5FO9B 2AQ1B 2RSNA 1VQFA 3NHHA 1K0SA 2PO4A 4FDBA 2Z8LA 4OIKA 1E2WA 4OL7A 1O7ZA 4L5RC 5M5WH 3I4LA 2G5DA 3MAQA 3W1BA 4RH6A 4DR3L 4RGOS 4O2DA 3FMCA 1CZGA 2Q8RE 2JA5G 1U9RA 5IYDH 1BCPB 5M3MH 4MTNA 2K5HA 5I6YA 1EYAA 4KLKA 2NB0A 1N32Q 3Q8DA 2K04A 2D5DA 4Z9CB 4RHSA 1ZKOA 3G6EA 1PZJD 4JYAL 5EQ0A 1SYEA 1WVLA 2QDLA 1VQAA 1V9PA 5JOBA 4POGA 2D0PA 1I6VC 2B2WC 2A1AA 1VDZA 1PFBA 3T1HL 4KJNA 1X32A 1T5EA 4QB4A 3R3OA 4XXEA 5IODA 1QVCA 4PNYA 4G7ZC 1EFID 3KOJA 3RD4A 1RHPA 2N78A 2ZT9C 2EY1A 1VF5C 4FXKC 2L4NA 2J7ZA 4LMQD 3RZDH 1Z7TA 4NDXA 4EQPA 4G57A 1LACA 3A5ZB 2F0KA 2YTVA 5LHY1 3X3NA 2R93B 4GNXB 3Q23A 4DV2L 2PQEA 1SSOA 4XTCS 1SXTA 2VZAA 4OX9Q 1WYDA 1R9TB 1K0RA 1EQVA 1PDQA 3FHWA 3F2BA 3TRZA 3PUWA 3S15B 1DM0B 4IOCA 2AHOB 3TP5A 2BE5D 4DXFA 1JMCA 4JI4Q 2ICIA 4HIDA 3MFGA 1LABA 2EYJA 4HSPA 5IWAQ 4IJLA 2N8NA 4OEMB 3T13A 1WOCA 4B3SL 4R4TA 2R93H 3RR5A 4N9PA 1CT1D 1K9MC 2HUGA 4DR1L 2B8FA 4L8JA 3UE1A 1TQOA 1PH8A 3PO2H 2Z6BA 4LF7Q 1XMQL 4KHPL 3BYTB 1LTLA 4JI2L 3CC2A 5C3WA 1S72A 4KHVA 3H0GB 1R4QB 4OO1I 2E5LL 1B1ZA 3BS1A 3KFUA 4X64L 4X62L 1EYDA 3DXJC 2E8GA 1SNOA 1TWFB 1OXSC 2HCIA 2NVXH 3CRKC 1IBMQ 2E75C 1IBKQ 4JI0L 1Q1EA 5D14A 1BUVT 3J81c 1W3SA 3HRZC 3N52A 4DUZQ 4M1UB 1JOQA 1A8VA 3TP8A 5IGCA 1FJGL 4K2KA 1EUJA 4LFCQ 3M3YH 1PH5A 2ENBA 4RHRA 3GD7A 5JJIA 1HQRD 1ML0D 5CORA 4ALPA 4X65Q 1WCMG 2B2WA 2PNRC 2UUCL 1BCPD 2MQHA 1XJVA 2KENA 4GN3B 5E3FA 4B9XA 4DFAA 3MEFA 5IGEA 2WACA 2UUAQ 4WJ4A 4BS9A 3L2PA 2YU9B 1AN8A 4LF9Q 2HQEA 1FR3A 2K4KA 1LM0A 3KUPA 5BR8Q 3RLNA 2JE6I 2MHVA 2RKSA 5CV7A 1TY2A 5M9OA 4BY7B 2FMCA 5D3DA 3KLRA 3NK9A 1VQCA 4DKAC 1BO0A 2KA7A 1IBLL 3UDFA 4K0KL 1CTMA 1CA6A 4RKBA 3DUZA 1Q12A 3CCJA 4C3HB 3MXGA 4CBVA 1PH1A 1LYLA 1EY7A 1UE6A 4KD4A 4BXXH 4JI6Q 1S5ED 1BBWA 4ME3A 4PV1C 4JI3L 3FKIG 4LUOA 4A3CG 3G7LA 2BH8A 4A3MB 3J80E 4LF8L 1I4GA 4BY7H 2K6AA 1EU4A 4P71A 3T1YQ 4O42A 3R8BA 2F0EA 4BWGB 3DWPA 1KDAA 2BCOA 4P74A 1CK1A 1QZHA 1AFPA 4C3HH 4RCOA 2ZJPA 3W2DA 4JI5L 3TS2A 1X3EA 1SNDA 5IP7H 2F0GA 4UDUC 2L9HA 1JORA 4UP9A 3IAYA 5FO7B 2FFKB 1HFNA 5KRUA 3A7LA 2A19A 1JJGA 2Q8IB 2F0FA 2VB2X 2K1BA 2MNAA 4BA1I 3QOLA 2WAQG 3E3XA 1E3PA 1G2TA 1SNQA 1VF7A 4JI8L 2X6GA 3DEOA 2XRQD 2YYZA 4IO9A 3MFYA 4K6DA 5FJ8H 2I5LX 1RKNA 4GKJL 3CAMA 3M4YA 3GTMB 3K5NA 3PSIA 3NQTA 2F0PA 3NBHA 5E4WC 1SE2A 2AQ3B 1KRTA 4IJHA 4ZLTF 4A3GB 5M3FG 2DGYA 3I73A 5AJ3L 3J81i 1D5MC 2AQ2B 5CV6A 2HD3A 1A2TA 4B3TL 2O2LD 4LFBQ 4TVAB 2NVYB 1TKWB 4HMIA 2FJ2A 2LXJA 1MSGA 2Q2HA 4IPCA 1L0YB 4WJWA 2UU9Q 1GUSA 2F0LA 1PTOC 3CRLC 2ALYB 3HGBA 4K14A 5D3IB 5C4ZA 4IPHA 3H3VC 1DONA 3WOFA 1UE5A 4DK3C 1J6QA 2Z1CA 3LGJA 2NN6H 5COYA 1RF2D 1JR0D 3I4NG 1HZCA 3SR1A 4KKUA 3SK5A 2XTIA 3ULLA 3T56B 5IP9H 1STGA 4JI1L 5LL6X 4LFAQ 3OWEB 1MJEA 2K05A 4OWTB 5C44G 1MGSA 2NVYH 1U4LA 1VQBA 2ZJQA 5JVH3 4X66L 1QUQB 1II3A 3X3MA 1OTCA 1RODA 2EY6A 2B63B 2F0HA 5HURA 3VYSA 2EOTA 3NPPA 1MBYA 4A3IG 3HOXB 1TWHB 5JEAJ 4RA8A 3KJOA 5IGDA 3K6OA 3S16B 2H1EA 5AFWA 1TIID 4DU9A 1BXTA 3H6MA 5C4XH 4XT3B 1KAAA 3IL8A 3OPOA 1LT4D 1W6JA 5C3XA 3J81L 4CDEC 2GVBA 1O7IA 3SE0A 2KECA 1OXVA 1L1OA 4A3JG 1GJXA 5ELFA 1L2FA 5GAEC 2B63H 5KIXA 3EJIA 4EGVA 1RTOA 1GM5A 1K8AC 4ID6A 2RCNA 4OO1G 2A8VA 1U5KA 1ASZA 4DV1Q 1TWHH 1XNRL 1YITA 4G4KA 1JWSD 4A3EH 3K80C 4OONA 1KNEA 2HCCA 3HOWH 3HKSA 2EYHA 1LTBD 1CFMA 1CUKA 4GOPB 1SNCA 1HH2P 1B44D 4QL5A 2ZTDA 3CCUA 4RGNA 5BN3A 3RUZA 2H5XA 1SJED 1UEBA 2PI2A 4A3KH 2FINB 1MJCA 3HOVG 4HCEA 1N36L 3I55A 1Y8OB 3TP7A 4QUFA 3S1RH 2DY8A 4FXGC 3HKZG 3C46A 2D9UA 1YJ9A 4EX5A 1XXGA 3GTKH 2JA8B 3NTKA 3GV6A 1PRTC 1M8AA 1R4PB 1KXLA 4A3BG 5CV8A 1ET9A 1NMFA 3BZDB 4QJFA 3CPFA 1L0WA 1O80A 3H3VI 1K83H 1ZYRD 3P75A 2E2JB 3V05A 1Y1WG 2VY3A 3S9WA 3RLFA 5IYCG 4XQNA 1TXYA 2OTJA 3NUCA 1K28A 5C3EH 1SJHD 4A3LG 5LMUL 1J8IA 1PYSB 3W3AA 5M5YB 5CYUA 2AMCB 4RCNA 3TMEA 3KDFB 1ENCA 2A6ED 1BNZA 1CKMA 2R3ZA 1HJPA 3KF6A 4MIUA 3T53B 1YJNA 1QE6A 4ZKBB 4V190 2R92G 4HIKA 1EWCA 1YBYA 3NELA 4KK7A 2NZHA 2UUBL 1K8OA 1PH2A 2KCMA 1LT3D 4DAPA 3HOZH 2EYFA 1CI3M 2UXDQ 4FP5D 2OWOA 4KKSA 1GOZA 2K32A 3NQIA 4GS3A 4TRDA 5M5YH 2UXCL 3SK8A 2WB1G 4DNTB 4A3DB 4C3IG 4DR4Q 3GQBA 4K2LA 2LKVA 3MHBA 2AWNA 4NW2A 5FK9C 2KEEA 1X3FA 4HIMA 4IUNA 1JWMD 1VQHA 3D4WA 3M4OH 2EE1A 1VQIA 1M90C 4DUYL 1KIXA 3D4RA 2A5HA 5GQOA 2L55A 3QOJA 4HCSA 4H13C 1HUNA 3S17H 1DZ1A 3I3CA 4IURA 4JBJA 4KKTA 3DMUA 2L11A 4YCVA 1X9NA 3PO3B 3C2PA 4P75A 1TWCB 3C1EA 2RCFA 4N8X1 1L0XB 5DM73 1HXYD 3L3OC 1LTRD 1VQEA 3H91A 3N6RA 2IX1A 2EYMA 2VUMB 1XMOL 4I7AA 1OXTA 1C48A 3PF4A 2F3WA 3OSOA 4AQYL 1X56A 1SE3A 1PXUA 3S24A 1SFOB 4KD3A 2M9VA 1Y1VG 1C0AA 3PO3H 1GUGA 1HCZA 4JW0A 2JJQA 2Z9HA 2BDNA 4LNQA 1K8MA 3D4DA 3PUXA 4DR7L 3NEMA 3MEHA 1G291 4R1JA 2VUMH 4YHHL 5IGGA 1N33Q 4CJ1B 3PV0A 3UE0A 2QA4A 3JC66 1VQ6A 4NXNQ 2F03A 1VS0A 2RSOA 2ZM6L 2HIVA 1QCBD 2V4DA 2Y0SG 2F0VA 1SFOH 1U4RA 4NKLA 1WJJA 2RBMA 2LS01 1UUPA 1HA5A 2OF1A 3VR2A 1KQSA 4HJ9A 3OTOL 1YVCA 2WINB 4RFBA 5CV5A 3P1HA 2X69A 3NWSA 2JA5B 1D6EC 3BZKA 4BY1H 5CBEE 4BBRG 4DR5L 4GLXA 1B50A 1F9SA 1MD2D 3HG9A 3K58A 1SAPA 3I4OA 3VYRA 3TS0A 4BBSG 5IGFA 3BJUA 1NY4A 2EJGC 1E1TA 3IRBA 1D8LA 2CFMA 3ZYYX 4AH6A 2D2CC 1DYQA 4ZKCB 4DNRB 4I7ZC 3AFPA 1STNA 1S4ZA 2JA5H 1D2BA 4JBKA 1Q3LA 1F9PA 4JV5Q 4I65A 4JK1C 3EROA 3MA2B 1XTDA 1F2LA 2EJFC 2N3SA 3K7AB 4ZRZA 5G3LD 4UY8C 5IYDG 1IKMA 1ENAA 3NE5B 3EA6A 4JI7L 1JCKB 3Q24A 3Q6SA 3MTSA 1PHJA 4UAIA 1X3GA 3VR4A 4EQNA 3EBEA 3I91A 2VXWA 1V1QA 4LW1A 3KJPA 5D65A 5A2QL 2E74C 1XNQQ 4JI2Q 1S5DD 1IL8A 3K5OA 5CV4A 4GKKL 3FVQA 1QVFA 1Z47A 3K7UC 1C4QA 4KI0A 2IHFA 2NTTA 3K7AH 2VQFL 3D6WA 2G9DA 4R8IA 1KL9A 1X6OA 2EDGA 3ZJYC 2ZTCA 5EAYA 3T16A 1EYGA 1H9SB 1ASYA 5J1ZA 2JYOA 5JJLA 4YY3Q 1JC7A 4YWLA 3J81E 1DOMA 4X3SA 4JI0Q 2XN9C 5JPNC 3SVMA 2DY7A 4TSSA 2QEJC 1XX8A 1W6KA 1JQYD 4F88A 1WTQA 4LAAA 3FRPB 1W2BA 1CSPA 2QCPX 5KYLA 3PQIA 1N32L 5CBAE 1X54A 1R9TH 1HHVA 3VR5A 3S15H 2K5QA 1LV9A 2Q8TA 1E2VA 1JE4A 1SMYD 5FLXc 2RDFA 3TP6A 1IL2A 1VQPA 1B4OA 4U68A 3U58A 4QQBX 4ZCKA 1H95A 2I5HA 3Q22A 4E6IA 4OHJA 3PO2G 3QG1A 1SR3A 4P72A 4B3RQ 1EWHA 1D5XC 1D1KA 1SYDA 1F2YA 2CW0D 1IXRA 4CKCA 4GLAC 5ELNA 3NXWA 1STEA 4B9WA 5GADC 1SEBD 2GVAA 5KNDA 5IY0A 2IHEA 3GTQB 3H0GH 4R4OA 1JOKA 2BA1A 2EXZA 4PZ8A 1A63A 1IBLQ 4KY7A 1PFSA 5EKLA 1IKLA 4X3KA 4OX9L 1EYCA 1YNJD 3H09A 1CHQD 4YWKA 4LF5L 1UE1A 1S3OA 1TWFH 4C56C 3I56A 1EEFD 2XWJB 4JI4L 2JA7G 3GTGB 3SEBA 3CF5A 1AH9A 1RD9D 4B3MQ 4QCLA 4XQJA 1UNSA 2L12A 2XSCA 3OHXC 5IYBG 2JEAI 1OO9B 3GTQH 1LLRD 1M4VA 3KF8B 4DV6Q 1A2UA 1YI2A 1EZ6A 3D31A 3IKJA 1EIYB 1V1PB 1KABA 1V1OA 1WI5A 4WORA 2F1MA 4GOPA 2RDGA 4LF7L 2Q2TA 3R93A 2K03A 3OW7A 2IJ0A 3I7FA 3PIP3 2WAQE 1XPRA 4CGYB 3SGIA 1FNUA 2BE5C 5IE8A 1PTOF 3GTGH 4L5TA 3BDOA 3M9BA 4DV7Q 5EGTA 3TEHB 1HRJA 3CP0A 1U4MA 1F2MA 4GN4B 3F2DA 1S5FD 3L0OA 3L7ZC 3CXCA 1GUTA 3E6ZX 1STHA 4GLVB 4Q0FA 3DM1A 1LUZA 2X6LA 5ELDA 3AQQA 2YU9H 1IBML 3K0YA 1HZBA 4IUPA 1IBKL 2DNCA 5FLMG 3T4AC 1SMYC 4QUCA 1HNWQ 3CKIB 3MWYW 1LTGD 4DUZL 2PW5A 1KC8C 3K57A 1I4HA 3I4MG 4LFCL 1K3RA 3IFDA 2WAQB 2LXKA 1L1OC 1PFNA 1RIPA 4K5XA 4X65L 3VDYA 3GO5A 2PCFB 3KDFA 4FF2A 3JAMc 4A93G 2CHBD 1MI2A 2YV5A 4HIOA 3PUVA 2NBFA 2CW0C 1UWVA 2RDHA 1I4XA 1X3QA 1B53A 4KMUC 3CPWA 4A3MH 5K36G 5M3FB 1A15A 1XPOA 5LL6S 1WD0A 2UUAL 5JAVA 3GP7A 1AW7A 5IP7G 4IPGA 4K8IA 1EQQA 3GTPB 2ASBA 5TSSA 2QGQA 1VQGA 4LF9L 4XIGS 4QIWE 4NXMQ 2EY2A 4JBMA 1YNJC 5BR8L 2JEBI 3WOEA 1EIGA 1ESRA 1UAPA 2J4XA 3OWFA 3UI2A 1BCPC 1FNWA 4PZ6A 5FJ8G 3EQLC 3J81j 3H15A 2NWGA 5M3FH 3S2DB 3I4NB 2A69D 4J1MA 3BG3A 1YNXA 1EIFA 3GTPH 4JCVE 3BZCA 4JI6L 5T1GA 3EVQA 5C44B 3CC7A 1JT8A 1KHIA 2F4VQ 3HOYG 2PZWA 5CMDA 3GTMH 2O4XA 4EQ5A 2OCEA 2YTXA 1J9OA 3T1YL 1PRTF 2ZXPA 4QGUA 4A3GH 4L5SA 3ND9A 3S14B 4HTHA 2ZJRA 4IFDI 4QIWB 3J80c 1GHKA 4V0BA 4A3IB 1N34Q 5C0XI 4G7HC 1EY4A 4H02A 5HGTA 3S2DH 3I4NH 2EQSA 1Q7YC 1NSNS 2KJXA 5FLXL 3OYYA 4KJOA 4GNXC 3K0XA 4L6TB 4DAMA 5LMNQ 4DR6Q 3OW2A 4ZQ3A 1I6HB 4A3JB 2Z6KA 3HKZE 1FL0A 1HR0Q 2PQAA 4R4IA 1T9HA 4GN5A 2QDBA 4DV3Q 1VQ9A 3S14H 3F2UA 3AFQA 1A0IA 2UXBQ 4A3IH 1LTSD 3CMAA 3KBGA 2EIFA 1NR4A 3J7YW 2VW9A 5E7NA 1SE4A 4ILWA 4IUQA 2F0WA 5KEEA 1G2SA 2N88A 1ET6A 2PPBC 3QIAA 3A55A 1B7YB 1J5EQ 1B2TA 4LWCA 1I6HH 1RDPD 4RAUC 4A3JH 4DV5Q 3HOXH 5C4XG 1ILPA 3NBIA 3KLSA 2RHQB 3FEWX 4JOIA 4LFBL 3DLLA 1KTKA 3TQYA 5LMUQ 2ID0A 1D7QA 3S16H 3HOVB 2UU9L 2A73B 3DEPA 3HKZB 2OQ0A 3BU2A 3JAMi 1QJOA 1AZPA 3A54A 1K8GA 4A3EG 3I90A 4OELB 3QWNA 1QG7A 2KEDA 2KCCA 3HOWG 3MC0B 4A3BB 2JA6G 4DGZA 1K73C 2R7DA 1B3QA 2VQEQ 5CV9A 4MHEA 3GV3A 1E7ZA 4LFAL 2C9OA 2MUYA 3ND8A 1Y1WB 4DR2Q 3K5LA 1TY0A 1HNXQ 4WRDA 3HOVH 4RMFA 5I2XA 4LF4Q 2EYPA 3C3LA 2CH4A 1BVSA 4CHTB 3F8TA 2I0QA 4A3KG 2CQOA 5JEAH 4OIJA 1FNVA 3KBXA 5ELCA 1X3PA 5M5XB 3CCRA 4O1NA 5CGKA 3OIPA 2OEOA 3ULPA 1VCIA 5EBCA 4LF6Q 2R92B 1I94Q 4A3BH 3ERSX 3RN2A 1Z6HA 1VQ7A 3V2TA 5KNBA 1BBUA 1I4QA 1Y14B 4LUVA 3K5MA 1Y1WH 1P8LA 1YHAA 5ISRA 3I2ZA 4R9WA 1YJWA 4Y52H 4Q5VA 3ERQA 4A3LH 2NYZD
chains in the Genus database with same CATH topology
4I7AA 4JVZA 2HD3A 4N8FA 4JW0A 2RCFA 2QW7A 4N8X1 2Z9HA 5L37A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I7A A;  4JVZ A;  2HD3 A;  4N8F A;  4JW0 A;  2RCF A;  2QW7 A;  4N8X 1;  2Z9H A;  5L37 A; 
#chains in the Genus database with same CATH topology
 1NUC A;  4R8N A;  3M4Q A;  4CJ0 B;  2JA8 H;  1K3B C;  4A3F G;  2CCZ A;  1Y8N B;  1DCZ A;  1EY8 A;  4C3I B;  5C3E G;  3ONA B;  1HA6 A;  1B70 B;  3AYH B;  2ZXO A;  5JJZ A;  5M5X H;  4DV1 L;  1D1I A;  4C3J G;  3MZ5 A;  3W5O A;  1C8C A;  3J80 i;  2OTL A;  4GNX A;  2R92 H;  1CKN B;  4KTA A;  2E2J H;  3JAM L;  3H94 A;  1HNZ Q;  1PLF A;  1E1O A;  2L1B A;  3VR6 A;  4AYB G;  1QIL A;  3L9A X;  2ZXR A;  2KHS A;  4DAY B;  4XYO A;  4DV0 Q;  2I07 B;  2V1C C;  3CU7 A;  2FMM A;  4IUU A;  1EQR A;  3MXU A;  3CCM A;  1IYV A;  3HOZ G;  4H7B A;  1UE7 A;  3STB D;  2MGS A;  4IQZ A;  3M7N A;  1QNU A;  3BYY B;  2HHH Q;  3MXN B;  1EEI D;  2FXQ A;  5KYI A;  1IYJ B;  2KUM A;  2Y0S E;  1GHJ A;  1A3V A;  1NBW A;  1Q8K A;  1SNM A;  4F8M A;  1SYF A;  1LT5 D;  4UP7 A;  1NNX A;  4IFD J;  4PQX A;  1DD2 A;  5IT9 c;  5C0X J;  4A3D H;  4OXP A;  5C4H A;  2L5T A;  5E4X A;  3VYU A;  1PH7 A;  4FF1 A;  1HZ9 A;  2F0N A;  2VB3 X;  1Y1V B;  2EYO A;  1ONL A;  2F0O A;  4DV4 Q;  1AZQ A;  4HR7 B;  3UDX A;  1CQF A;  3W1G A;  3VR3 A;  5FO8 B;  3AEV A;  4QF4 A;  3PUY A;  2Z4I A;  3BVZ A;  3J80 L;  3S1N B;  4JBW A;  4U67 3;  2NZO A;  2ES2 A;  4NMZ A;  4OWW B;  1VQ5 A;  4DR3 Q;  2K5W A;  4K6L A;  1ESF A;  2Y0S B;  1TWC H;  4APV A;  2R7Z G;  1Y1V H;  3RMH A;  5CC4 A;  2F0Q A;  1ZYR C;  3UDI A;  3HOU B;  2IX0 A;  5FKA C;  2UXD L;  1EOT A;  4FF3 A;  1KLU D;  2P5Z X;  1YHQ A;  3CQZ B;  4DR4 L;  1GXD C;  2K5N A;  3QR8 A;  1RJT A;  4BBR B;  3S1N H;  1EU3 A;  1TS5 A;  2A6E C;  5DAU A;  4JYA Q;  3DM3 A;  3CME A;  1WTP A;  2K52 A;  4IAL A;  2OQK A;  2NUC A;  2L15 A;  2HIX A;  4BBS B;  1VMP A;  2WFW A;  4IFD G;  3K59 A;  4MTK A;  5C0X G;  3T1H Q;  4PMC A;  1KAW A;  2A6H D;  4DNI A;  3HOU H;  1E22 A;  3RZO B;  1V1P A;  4POF A;  5HGQ A;  2QIL A;  1CKO A;  2B2V A;  3G48 A;  1WTV A;  5KGU A;  3CQZ H;  2N49 A;  3G4S A;  4GZY C;  2K50 A;  2PW7 A;  1X65 A;  1TU2 B;  1U0L A;  3LX0 A;  2PYK A;  5BN4 A;  2IT1 A;  1PH3 A;  1STA A;  3S2H B;  1V43 A;  4G7O C;  4C2M B;  4BBS H;  3B6Y A;  1LO5 D;  1BR9 A;  1ZXT A;  5EBD A;  4BY1 G;  2K5V A;  4DV2 Q;  1JB7 A;  4DN4 M;  4HN7 A;  2NTS A;  3GTL B;  4EVO A;  3RZO H;  1TWG B;  2B2Y C;  1EY9 A;  3SK4 A;  1YNN D;  3R2T A;  4ZAI A;  1CA5 A;  3O13 A;  4CDF C;  3IFT A;  1JJC B;  5J39 A;  5EKK A;  1I4P A;  5KNC A;  1I3Q B;  4A4I A;  2B8G A;  5M3M G;  2XIW A;  2DJG C;  1S40 A;  3S2H H;  5EKI A;  2F0D A;  4B3S Q;  4A76 A;  2LSS A;  3F1Z A;  4C2M H;  4L5Q A;  5G3L F;  1SYB A;  2KHI A;  1N33 L;  1LTT D;  4R4C A;  3GTL H;  4DR1 Q;  3PGZ A;  4YIJ A;  3RZD B;  2JXM B;  3WDN A;  3AU7 A;  4NXN L;  1TWG H;  1X55 A;  2K01 A;  3NTI A;  5FLX E;  3GTJ B;  1PV4 A;  2JQO A;  1XMQ Q;  2QW7 A;  1B9N A;  4EQO A;  4KHP Q;  1XPU A;  3J7A 5;  2N55 A;  1DOK A;  3PF5 A;  4IN3 A;  3HZX A;  4LJZ C;  1I3Q H;  1PTO B;  2E5L Q;  4GOP C;  4DXG A;  1PZK D;  4X64 Q;  2WV6 D;  4X62 Q;  2O5I C;  1CM9 A;  1SBB B;  4JPB W;  1LTA D;  1H9J A;  5I6W A;  1SYG A;  4ZUJ A;  2NN6 I;  1EY0 A;  2F4I A;  4ME5 A;  3T51 B;  1B9M A;  3GTJ H;  2JP1 A;  4NP5 A;  2EJM A;  3KF6 B;  3TZD A;  4DK6 C;  2O5J C;  3PCO B;  5C4J B;  4IOA A;  1Z9F A;  1SYC A;  2TMP A;  4KN7 C;  3U9S A;  1JOO A;  2EPB A;  4UPA A;  2Q2I A;  1PTO H;  4FVM A;  4DK0 A;  1G6Z A;  1FJG Q;  3H3V H;  1C7Y A;  3PO2 B;  2A6H C;  4K5W A;  3HS0 C;  3QB3 A;  1EWI A;  1Q81 C;  5IGB A;  1XWE A;  3FP9 A;  5EPK A;  3SHL A;  1WD1 A;  4H44 C;  1EY5 A;  4LF5 Q;  2UUC Q;  4JV5 L;  4RKL A;  5IOC A;  1VQD A;  1B3A A;  2PNH A;  1PVO A;  5CR3 A;  2L0C A;  2R93 G;  1JE5 A;  4LK1 C;  2M00 A;  3A8J E;  3K8A A;  5C4J H;  4XDX A;  3J7A V;  1SMX A;  1TWA B;  4YCW A;  4C1N I;  1AE3 A;  1EQT A;  4HJ8 A;  1VQL A;  3KLW A;  2XVS A;  4UP8 A;  2CWP A;  3A5U A;  1TVX A;  2VNU D;  3NTH A;  5IT9 L;  1U4P A;  4J8Q A;  2NVX B;  4B08 A;  2IPK D;  1QUQ A;  1LTI D;  1QVG A;  1XNQ L;  2HT1 A;  1WCM B;  1YNN C;  3HP3 A;  2GA4 B;  4XYQ A;  5DLQ E;  1FYC A;  1ICF B;  1ZEQ X;  2JA7 B;  2B2Y A;  1GKH A;  1KNA A;  1FGU A;  1UEA B;  1TWA H;  4IUV A;  3M3Y B;  4K0K Q;  3PIO A;  2MFI A;  1HQM C;  3GTO B;  1PH6 A;  3M7G A;  2KCN A;  1CHP D;  1N8R C;  4R4Q A;  3U4V A;  3M4P A;  1VQO A;  1KDB A;  1SNP A;  4YY3 L;  1KRS A;  3A56 A;  4CDD C;  3H0G G;  1NR2 A;  4JI3 Q;  1BBX C;  4ZYS A;  2QEX A;  3E9H A;  3OOC A;  4JVZ A;  1WCM H;  5IWA L;  4LF8 Q;  1G51 A;  2KHJ A;  2CWA A;  5DNF A;  2JA7 H;  2E2H B;  2C5C A;  1BCP F;  1PRT B;  1G8Z D;  2IY5 B;  3C1F A;  1Y8P B;  2MP1 A;  2BH2 A;  3ULJ A;  3JAM E;  1Q46 A;  1D5Z C;  4K8J A;  1NJI C;  1DOL A;  5IYB H;  3GTO H;  1DXM A;  3TBI B;  4JI5 Q;  3J7A F;  1EFW A;  2R6G A;  1BQQ T;  4YWM A;  4DF7 A;  4LUZ A;  4XQQ A;  4RGM A;  2XGT A;  4ZK9 B;  3FKI B;  5C5L A;  3SK6 A;  4S3S A;  4FO2 A;  3FPU B;  2K33 A;  1NAP A;  2R61 A;  3KYH C;  2MO1 A;  1EZ8 A;  2F0T A;  2E2H H;  5DEH A;  4JI8 Q;  3E9I A;  4B3R L;  1GUN A;  5JPM C;  3E0E A;  3HFZ B;  2RHS B;  1PTO D;  3I4M B;  4FNF A;  2VS1 A;  4BA2 I;  4GKJ Q;  1Q86 C;  2Z6K C;  3EN2 A;  2CQA A;  4X3T A;  2WP8 J;  3GDE A;  4TQU S;  1IZ6 A;  2ZTE A;  4A93 B;  5IIF A;  1HPC A;  3PUZ A;  4AIM A;  1PZI D;  4O0A A;  1VMC A;  1VQ4 A;  3FKI H;  5AJ3 Q;  3DWA A;  3NP8 A;  4A3C H;  3E0J A;  5FLM H;  3D0F A;  2LFN A;  2EYL A;  3FDT A;  3J7Z C;  4BXX G;  2IWH A;  1B8A A;  1A62 A;  2EZV A;  4B3T Q;  1OXX K;  3M85 A;  2SEB D;  1IYU A;  4MZ9 A;  3I4M H;  2KVM A;  3MVV A;  3F2C A;  4BY7 G;  1H9K A;  2BOS A;  3A0J A;  3A8K E;  4JOI C;  3AMU A;  3KK7 A;  4A75 A;  2B29 A;  2F0M A;  4A93 H;  5I9O A;  4B3M L;  2BDO A;  1BF4 A;  1O7Y A;  1STB A;  3CHB D;  1BDO A;  2H4O A;  5GAG C;  4HED A;  1CKN A;  4C3H G;  3CCQ A;  3I8Z A;  4DV6 L;  2PZT A;  1PA6 A;  1GUO A;  4PG3 A;  4JI1 Q;  2TSS A;  5K36 H;  2CH4 W;  1H9M A;  5J3B A;  2KOL A;  2F3V A;  4HJ5 A;  4X3U A;  2VL6 A;  1FVI A;  4X66 Q;  5GRO A;  4DAY A;  4A3M G;  2B39 A;  1VQJ A;  3G71 A;  1VQ8 A;  1DJR D;  1F2Z A;  3HOY B;  4IZ8 A;  2M2L A;  1PMR A;  1Q82 C;  3VA7 A;  1WTW A;  1MSH A;  4DV7 L;  2RVL A;  1CQV A;  3EIV A;  1QNK A;  1HZA A;  2WII B;  1BOS A;  3MXN A;  2PMZ E;  1HUM A;  4TKO B;  2DJF C;  3FPP A;  3D6C A;  1TS2 A;  3NWT A;  1F9Q A;  2F3I A;  5JJK A;  1G6P A;  4KY5 A;  4CKB A;  4N8F A;  4P73 A;  2AKW B;  3LWU A;  1GD7 A;  4QY7 A;  4WJ3 M;  1TS3 A;  3D3R A;  1HNW L;  1VQM A;  3HOY H;  3QO2 A;  1AE2 A;  1QWY A;  4DA2 A;  5EPJ A;  1SN8 A;  2E76 C;  3WWV A;  1XNR Q;  3A8I E;  1PH9 A;  2NVQ B;  4ULL A;  1PRT D;  1I50 B;  2JA9 A;  1RTN A;  1JWU D;  1V8Q A;  2RQX A;  2RA4 A;  4F7X A;  4A3G G;  5C44 H;  2NN6 G;  3LWE A;  1WTR A;  2PMZ B;  3RLO A;  4FF4 A;  1NCV A;  5FOB B;  5IP9 G;  3E5S A;  3A74 A;  1O78 A;  2ATW A;  1SRO A;  4Y7N B;  2MO0 A;  2QF7 A;  4CKE A;  4J6H A;  1BKB A;  2FHT A;  5C4X B;  3LNN A;  1N36 Q;  2XWB B;  2NVQ H;  3G6J B;  2SOB A;  2HDL A;  4NXM L;  4FYD A;  3MXP A;  1I50 H;  2ICE C;  3P7J A;  1CSQ A;  2KCT A;  3OIQ A;  4HAE A;  3TRE A;  3NSW A;  4RGT A;  3U50 C;  5DM6 3;  1STY A;  5A2Q E;  2XRS D;  3A7A B;  1MKH A;  1HTL D;  1H9R A;  4JG2 A;  4ABN A;  4X6A H;  1G91 A;  5GAH C;  2OT2 A;  4Y7N H;  3PIP A;  2GN5 A;  4A3E B;  1PYB A;  3OMG A;  3CCS A;  1Q8I A;  4RWS C;  3HOW B;  1ICW A;  1SRU A;  2JA6 B;  5NUC A;  4OO1 H;  1I5F A;  4K5V A;  1YHB A;  5E1F A;  4J15 A;  4YCU A;  2NVT B;  2B63 G;  2C35 B;  2F4V L;  2NZ1 D;  3S1M B;  1A3T A;  3HOX G;  2K5D A;  1IW7 D;  5I4D A;  3EFX D;  4DPG A;  4DK1 A;  1P16 A;  3U4Z A;  4N9T A;  4A3K B;  1TR5 A;  1Y69 U;  1VQK A;  3QJY A;  3OMC A;  1N34 L;  1KLG D;  4AYB E;  1MIU A;  1WFQ A;  3S1R B;  2UUB Q;  4OWX B;  1T5X D;  5LMN W;  1XTC D;  2WB1 E;  1SLJ A;  3CCE A;  3TZU A;  2JA6 H;  4KV6 A;  2BA0 A;  3GTK B;  1HR0 W;  1NE3 A;  2A69 C;  2QKI C;  3CD6 A;  2YTY A;  1Q90 A;  1YEZ A;  1XYI A;  4ODG A;  4HJA A;  2SNM A;  2NVT H;  4C1N K;  2UXC Q;  3ICE A;  1E2Z A;  4IUT A;  2Z4H A;  3VA5 A;  1C9O A;  3TN2 A;  4DAV A;  5LMN L;  4DR6 L;  3S1M H;  1K83 B;  2B2T C;  1SDF A;  1S5B D;  4A3F B;  2I46 A;  3DWQ A;  4MN3 A;  1HR0 L;  1YZ6 A;  3VYT A;  4DV3 L;  2DN8 A;  5C3E B;  1QOH A;  2UXB L;  1ILQ A;  4C3J B;  1QB5 D;  4CDC C;  1NTG A;  1M1K C;  4DUY Q;  4IPD A;  5JEA G;  1KDC A;  5IYC H;  1I4R A;  4L63 B;  5IT9 E;  4PZ7 A;  2DNE A;  2LMC B;  1VQN A;  2K75 A;  1GVP A;  2JK8 A;  1E0B A;  4AYB B;  1J5E L;  4KY6 A;  2A68 D;  1GO3 E;  2K14 A;  2WB1 B;  2IW3 A;  4PMW A;  3TDQ A;  4DV5 L;  2RF4 A;  4M8A A;  1WTH A;  4A3F H;  4HMJ A;  3D8G A;  2B2V C;  3HOZ B;  5C6A A;  4HSV A;  3PMF A;  2KQ3 A;  1S5C D;  5T1I A;  4C3J H;  4QMG A;  2G9H D;  2JA8 G;  1XMO Q;  1H9S A;  3V96 A;  5J22 A;  2K7V A;  2E2D C;  1YIJ A;  3CW2 C;  1A6X A;  2HQL A;  1EL0 A;  4AQY Q;  2E2I B;  4RG1 A;  1TS4 A;  2CKZ B;  1NMG A;  4P2C B;  4HJ7 A;  1F9R A;  2B2U C;  4C3I H;  3M4O B;  2MPM A;  2J0T D;  1LT6 D;  2VQE L;  5EPL A;  2F52 A;  2DUD A;  2IL8 A;  4H0L C;  4ZUI A;  5HY6 A;  3P20 A;  2K28 A;  4KHZ A;  1WTX A;  2AWO A;  3UDG A;  4DR2 L;  5JVG 3;  4DR7 Q;  3S17 B;  3BDL A;  1IHZ A;  1HNX L;  1AP0 A;  1ENF A;  3BVM A;  4UHV A;  4YHH Q;  4LF4 L;  1WTO A;  2CVR A;  4PMB A;  1FD7 D;  1GUW A;  2EY5 A;  3URY A;  1AEX A;  3NBH B;  2ZM6 Q;  2E2I H;  2A74 C;  1PFM A;  2IX3 A;  3RN5 A;  2SNS A;  1IW7 C;  5I2Y A;  3TSS A;  4LF6 L;  5L37 A;  1I94 L;  1EY6 A;  5ELE A;  2KBN A;  5K5P A;  3ER0 A;  1QZG A;  2Z0S A;  3CCL A;  3OTO Q;  2R7Z B;  1HTP A;  4A3D G;  2F0J A;  5C5M A;  3SXH A;  1FGB D;  3I70 A;  3K81 C;  2F0I A;  2SDF A;  3KLS X;  4DR5 Q;  3U9O A;  3AB9 A;  1N9W A;  5ELO A;  2I5M X;  2JSO A;  3CCV A;  4F87 A;  5A35 A;  4WFN 3;  1HNZ L;  1PH4 A;  2WKC A;  2B2T A;  1DGS A;  3DHQ A;  1RCV D;  1O7L A;  4CJ2 C;  5EJW A;  4KN4 C;  2R7Z H;  4FXD A;  1F77 A;  2WKD A;  1KD1 C;  4DV0 L;  1EOV A;  2EXD A;  1SE8 A;  3PO3 G;  3S1Q B;  1A3U A;  1MHW C;  5BN5 A;  3CC4 A;  2JN4 A;  2B3G A;  4XT1 B;  3HEJ A;  1TT2 A;  1E24 A;  2HDM A;  2A68 C;  2OXP A;  2MJ8 A;  1RL2 A;  2Q2U A;  2PQA B;  4NB3 A;  1Q1B A;  2HHH L;  3SDZ A;  2VUM G;  3KF8 A;  4OGQ C;  2EVB A;  4NPS A;  4JI7 Q;  2XNA C;  1PYW D;  1CZW A;  2R7F A;  3BVG A;  4IFD H;  3BDC A;  1JIC A;  2PZU A;  4BY1 B;  2LY7 A;  5C0X H;  1HFG A;  2PI2 E;  3NEN A;  2AUK A;  1EIH A;  3ITP A;  2AUJ D;  3I72 A;  3S1Q H;  5M5W B;  1L1O B;  3PIO 3;  5F2D A;  4GKK Q;  3R2I A;  2D0O A;  4JC0 A;  4BBR H;  5H1S E;  3HOU G;  1OXU A;  2F0U A;  5I9P A;  2VQF Q;  2D62 A;  2F0S A;  4DV4 L;  3STB C;  5M3M B;  1JB3 A;  3Q0A A;  1JJ2 A;  3RNU A;  5ELB A;  2B2U A;  4MNO A;  5FO9 B;  2AQ1 B;  2RSN A;  1VQF A;  3NHH A;  1K0S A;  2PO4 A;  4FDB A;  2Z8L A;  4OIK A;  1E2W A;  4OL7 A;  1O7Z A;  4L5R C;  5M5W H;  3I4L A;  2G5D A;  3MAQ A;  3W1B A;  4RH6 A;  4DR3 L;  4RGO S;  4O2D A;  3FMC A;  1CZG A;  2Q8R E;  2JA5 G;  1U9R A;  5IYD H;  1BCP B;  5M3M H;  4MTN A;  2K5H A;  5I6Y A;  1EYA A;  4KLK A;  2NB0 A;  1N32 Q;  3Q8D A;  2K04 A;  2D5D A;  4Z9C B;  4RHS A;  1ZKO A;  3G6E A;  1PZJ D;  4JYA L;  5EQ0 A;  1SYE A;  1WVL A;  2QDL A;  1VQA A;  1V9P A;  5JOB A;  4POG A;  2D0P A;  1I6V C;  2B2W C;  2A1A A;  1VDZ A;  1PFB A;  3T1H L;  4KJN A;  1X32 A;  1T5E A;  4QB4 A;  3R3O A;  4XXE A;  5IOD A;  1QVC A;  4PNY A;  4G7Z C;  1EFI D;  3KOJ A;  3RD4 A;  1RHP A;  2N78 A;  2ZT9 C;  2EY1 A;  1VF5 C;  4FXK C;  2L4N A;  2J7Z A;  4LMQ D;  3RZD H;  1Z7T A;  4NDX A;  4EQP A;  4G57 A;  1LAC A;  3A5Z B;  2F0K A;  2YTV A;  5LHY 1;  3X3N A;  2R93 B;  4GNX B;  3Q23 A;  4DV2 L;  2PQE A;  1SSO A;  4XTC S;  1SXT A;  2VZA A;  4OX9 Q;  1WYD A;  1R9T B;  1K0R A;  1EQV A;  1PDQ A;  3FHW A;  3F2B A;  3TRZ A;  3PUW A;  3S15 B;  1DM0 B;  4IOC A;  2AHO B;  3TP5 A;  2BE5 D;  4DXF A;  1JMC A;  4JI4 Q;  2ICI A;  4HID A;  3MFG A;  1LAB A;  2EYJ A;  4HSP A;  5IWA Q;  4IJL A;  2N8N A;  4OEM B;  3T13 A;  1WOC A;  4B3S L;  4R4T A;  2R93 H;  3RR5 A;  4N9P A;  1CT1 D;  1K9M C;  2HUG A;  4DR1 L;  2B8F A;  4L8J A;  3UE1 A;  1TQO A;  1PH8 A;  3PO2 H;  2Z6B A;  4LF7 Q;  1XMQ L;  4KHP L;  3BYT B;  1LTL A;  4JI2 L;  3CC2 A;  5C3W A;  1S72 A;  4KHV A;  3H0G B;  1R4Q B;  4OO1 I;  2E5L L;  1B1Z A;  3BS1 A;  3KFU A;  4X64 L;  4X62 L;  1EYD A;  3DXJ C;  2E8G A;  1SNO A;  1TWF B;  1OXS C;  2HCI A;  2NVX H;  3CRK C;  1IBM Q;  2E75 C;  1IBK Q;  4JI0 L;  1Q1E A;  5D14 A;  1BUV T;  3J81 c;  1W3S A;  3HRZ C;  3N52 A;  4DUZ Q;  4M1U B;  1JOQ A;  1A8V A;  3TP8 A;  5IGC A;  1FJG L;  4K2K A;  1EUJ A;  4LFC Q;  3M3Y H;  1PH5 A;  2ENB A;  4RHR A;  3GD7 A;  5JJI A;  1HQR D;  1ML0 D;  5COR A;  4ALP A;  4X65 Q;  1WCM G;  2B2W A;  2PNR C;  2UUC L;  1BCP D;  2MQH A;  1XJV A;  2KEN A;  4GN3 B;  5E3F A;  4B9X A;  4DFA A;  3MEF A;  5IGE A;  2WAC A;  2UUA Q;  4WJ4 A;  4BS9 A;  3L2P A;  2YU9 B;  1AN8 A;  4LF9 Q;  2HQE A;  1FR3 A;  2K4K A;  1LM0 A;  3KUP A;  5BR8 Q;  3RLN A;  2JE6 I;  2MHV A;  2RKS A;  5CV7 A;  1TY2 A;  5M9O A;  4BY7 B;  2FMC A;  5D3D A;  3KLR A;  3NK9 A;  1VQC A;  4DKA C;  1BO0 A;  2KA7 A;  1IBL L;  3UDF A;  4K0K L;  1CTM A;  1CA6 A;  4RKB A;  3DUZ A;  1Q12 A;  3CCJ A;  4C3H B;  3MXG A;  4CBV A;  1PH1 A;  1LYL A;  1EY7 A;  1UE6 A;  4KD4 A;  4BXX H;  4JI6 Q;  1S5E D;  1BBW A;  4ME3 A;  4PV1 C;  4JI3 L;  3FKI G;  4LUO A;  4A3C G;  3G7L A;  2BH8 A;  4A3M B;  3J80 E;  4LF8 L;  1I4G A;  4BY7 H;  2K6A A;  1EU4 A;  4P71 A;  3T1Y Q;  4O42 A;  3R8B A;  2F0E A;  4BWG B;  3DWP A;  1KDA A;  2BCO A;  4P74 A;  1CK1 A;  1QZH A;  1AFP A;  4C3H H;  4RCO A;  2ZJP A;  3W2D A;  4JI5 L;  3TS2 A;  1X3E A;  1SND A;  5IP7 H;  2F0G A;  4UDU C;  2L9H A;  1JOR A;  4UP9 A;  3IAY A;  5FO7 B;  2FFK B;  1HFN A;  5KRU A;  3A7L A;  2A19 A;  1JJG A;  2Q8I B;  2F0F A;  2VB2 X;  2K1B A;  2MNA A;  4BA1 I;  3QOL A;  2WAQ G;  3E3X A;  1E3P A;  1G2T A;  1SNQ A;  1VF7 A;  4JI8 L;  2X6G A;  3DEO A;  2XRQ D;  2YYZ A;  4IO9 A;  3MFY A;  4K6D A;  5FJ8 H;  2I5L X;  1RKN A;  4GKJ L;  3CAM A;  3M4Y A;  3GTM B;  3K5N A;  3PSI A;  3NQT A;  2F0P A;  3NBH A;  5E4W C;  1SE2 A;  2AQ3 B;  1KRT A;  4IJH A;  4ZLT F;  4A3G B;  5M3F G;  2DGY A;  3I73 A;  5AJ3 L;  3J81 i;  1D5M C;  2AQ2 B;  5CV6 A;  2HD3 A;  1A2T A;  4B3T L;  2O2L D;  4LFB Q;  4TVA B;  2NVY B;  1TKW B;  4HMI A;  2FJ2 A;  2LXJ A;  1MSG A;  2Q2H A;  4IPC A;  1L0Y B;  4WJW A;  2UU9 Q;  1GUS A;  2F0L A;  1PTO C;  3CRL C;  2ALY B;  3HGB A;  4K14 A;  5D3I B;  5C4Z A;  4IPH A;  3H3V C;  1DON A;  3WOF A;  1UE5 A;  4DK3 C;  1J6Q A;  2Z1C A;  3LGJ A;  2NN6 H;  5COY A;  1RF2 D;  1JR0 D;  3I4N G;  1HZC A;  3SR1 A;  4KKU A;  3SK5 A;  2XTI A;  3ULL A;  3T56 B;  5IP9 H;  1STG A;  4JI1 L;  5LL6 X;  4LFA Q;  3OWE B;  1MJE A;  2K05 A;  4OWT B;  5C44 G;  1MGS A;  2NVY H;  1U4L A;  1VQB A;  2ZJQ A;  5JVH 3;  4X66 L;  1QUQ B;  1II3 A;  3X3M A;  1OTC A;  1ROD A;  2EY6 A;  2B63 B;  2F0H A;  5HUR A;  3VYS A;  2EOT A;  3NPP A;  1MBY A;  4A3I G;  3HOX B;  1TWH B;  5JEA J;  4RA8 A;  3KJO A;  5IGD A;  3K6O A;  3S16 B;  2H1E A;  5AFW A;  1TII D;  4DU9 A;  1BXT A;  3H6M A;  5C4X H;  4XT3 B;  1KAA A;  3IL8 A;  3OPO A;  1LT4 D;  1W6J A;  5C3X A;  3J81 L;  4CDE C;  2GVB A;  1O7I A;  3SE0 A;  2KEC A;  1OXV A;  1L1O A;  4A3J G;  1GJX A;  5ELF A;  1L2F A;  5GAE C;  2B63 H;  5KIX A;  3EJI A;  4EGV A;  1RTO A;  1GM5 A;  1K8A C;  4ID6 A;  2RCN A;  4OO1 G;  2A8V A;  1U5K A;  1ASZ A;  4DV1 Q;  1TWH H;  1XNR L;  1YIT A;  4G4K A;  1JWS D;  4A3E H;  3K80 C;  4OON A;  1KNE A;  2HCC A;  3HOW H;  3HKS A;  2EYH A;  1LTB D;  1CFM A;  1CUK A;  4GOP B;  1SNC A;  1HH2 P;  1B44 D;  4QL5 A;  2ZTD A;  3CCU A;  4RGN A;  5BN3 A;  3RUZ A;  2H5X A;  1SJE D;  1UEB A;  2PI2 A;  4A3K H;  2FIN B;  1MJC A;  3HOV G;  4HCE A;  1N36 L;  3I55 A;  1Y8O B;  3TP7 A;  4QUF A;  3S1R H;  2DY8 A;  4FXG C;  3HKZ G;  3C46 A;  2D9U A;  1YJ9 A;  4EX5 A;  1XXG A;  3GTK H;  2JA8 B;  3NTK A;  3GV6 A;  1PRT C;  1M8A A;  1R4P B;  1KXL A;  4A3B G;  5CV8 A;  1ET9 A;  1NMF A;  3BZD B;  4QJF A;  3CPF A;  1L0W A;  1O80 A;  3H3V I;  1K83 H;  1ZYR D;  3P75 A;  2E2J B;  3V05 A;  1Y1W G;  2VY3 A;  3S9W A;  3RLF A;  5IYC G;  4XQN A;  1TXY A;  2OTJ A;  3NUC A;  1K28 A;  5C3E H;  1SJH D;  4A3L G;  5LMU L;  1J8I A;  1PYS B;  3W3A A;  5M5Y B;  5CYU A;  2AMC B;  4RCN A;  3TME A;  3KDF B;  1ENC A;  2A6E D;  1BNZ A;  1CKM A;  2R3Z A;  1HJP A;  3KF6 A;  4MIU A;  3T53 B;  1YJN A;  1QE6 A;  4ZKB B;  4V19 0;  2R92 G;  4HIK A;  1EWC A;  1YBY A;  3NEL A;  4KK7 A;  2NZH A;  2UUB L;  1K8O A;  1PH2 A;  2KCM A;  1LT3 D;  4DAP A;  3HOZ H;  2EYF A;  1CI3 M;  2UXD Q;  4FP5 D;  2OWO A;  4KKS A;  1GOZ A;  2K32 A;  3NQI A;  4GS3 A;  4TRD A;  5M5Y H;  2UXC L;  3SK8 A;  2WB1 G;  4DNT B;  4A3D B;  4C3I G;  4DR4 Q;  3GQB A;  4K2L A;  2LKV A;  3MHB A;  2AWN A;  4NW2 A;  5FK9 C;  2KEE A;  1X3F A;  4HIM A;  4IUN A;  1JWM D;  1VQH A;  3D4W A;  3M4O H;  2EE1 A;  1VQI A;  1M90 C;  4DUY L;  1KIX A;  3D4R A;  2A5H A;  5GQO A;  2L55 A;  3QOJ A;  4HCS A;  4H13 C;  1HUN A;  3S17 H;  1DZ1 A;  3I3C A;  4IUR A;  4JBJ A;  4KKT A;  3DMU A;  2L11 A;  4YCV A;  1X9N A;  3PO3 B;  3C2P A;  4P75 A;  1TWC B;  3C1E A;  2RCF A;  4N8X 1;  1L0X B;  5DM7 3;  1HXY D;  3L3O C;  1LTR D;  1VQE A;  3H91 A;  3N6R A;  2IX1 A;  2EYM A;  2VUM B;  1XMO L;  4I7A A;  1OXT A;  1C48 A;  3PF4 A;  2F3W A;  3OSO A;  4AQY L;  1X56 A;  1SE3 A;  1PXU A;  3S24 A;  1SFO B;  4KD3 A;  2M9V A;  1Y1V G;  1C0A A;  3PO3 H;  1GUG A;  1HCZ A;  4JW0 A;  2JJQ A;  2Z9H A;  2BDN A;  4LNQ A;  1K8M A;  3D4D A;  3PUX A;  4DR7 L;  3NEM A;  3MEH A;  1G29 1;  4R1J A;  2VUM H;  4YHH L;  5IGG A;  1N33 Q;  4CJ1 B;  3PV0 A;  3UE0 A;  2QA4 A;  3JC6 6;  1VQ6 A;  4NXN Q;  2F03 A;  1VS0 A;  2RSO A;  2ZM6 L;  2HIV A;  1QCB D;  2V4D A;  2Y0S G;  2F0V A;  1SFO H;  1U4R A;  4NKL A;  1WJJ A;  2RBM A;  2LS0 1;  1UUP A;  1HA5 A;  2OF1 A;  3VR2 A;  1KQS A;  4HJ9 A;  3OTO L;  1YVC A;  2WIN B;  4RFB A;  5CV5 A;  3P1H A;  2X69 A;  3NWS A;  2JA5 B;  1D6E C;  3BZK A;  4BY1 H;  5CBE E;  4BBR G;  4DR5 L;  4GLX A;  1B50 A;  1F9S A;  1MD2 D;  3HG9 A;  3K58 A;  1SAP A;  3I4O A;  3VYR A;  3TS0 A;  4BBS G;  5IGF A;  3BJU A;  1NY4 A;  2EJG C;  1E1T A;  3IRB A;  1D8L A;  2CFM A;  3ZYY X;  4AH6 A;  2D2C C;  1DYQ A;  4ZKC B;  4DNR B;  4I7Z C;  3AFP A;  1STN A;  1S4Z A;  2JA5 H;  1D2B A;  4JBK A;  1Q3L A;  1F9P A;  4JV5 Q;  4I65 A;  4JK1 C;  3ERO A;  3MA2 B;  1XTD A;  1F2L A;  2EJF C;  2N3S A;  3K7A B;  4ZRZ A;  5G3L D;  4UY8 C;  5IYD G;  1IKM A;  1ENA A;  3NE5 B;  3EA6 A;  4JI7 L;  1JCK B;  3Q24 A;  3Q6S A;  3MTS A;  1PHJ A;  4UAI A;  1X3G A;  3VR4 A;  4EQN A;  3EBE A;  3I91 A;  2VXW A;  1V1Q A;  4LW1 A;  3KJP A;  5D65 A;  5A2Q L;  2E74 C;  1XNQ Q;  4JI2 Q;  1S5D D;  1IL8 A;  3K5O A;  5CV4 A;  4GKK L;  3FVQ A;  1QVF A;  1Z47 A;  3K7U C;  1C4Q A;  4KI0 A;  2IHF A;  2NTT A;  3K7A H;  2VQF L;  3D6W A;  2G9D A;  4R8I A;  1KL9 A;  1X6O A;  2EDG A;  3ZJY C;  2ZTC A;  5EAY A;  3T16 A;  1EYG A;  1H9S B;  1ASY A;  5J1Z A;  2JYO A;  5JJL A;  4YY3 Q;  1JC7 A;  4YWL A;  3J81 E;  1DOM A;  4X3S A;  4JI0 Q;  2XN9 C;  5JPN C;  3SVM A;  2DY7 A;  4TSS A;  2QEJ C;  1XX8 A;  1W6K A;  1JQY D;  4F88 A;  1WTQ A;  4LAA A;  3FRP B;  1W2B A;  1CSP A;  2QCP X;  5KYL A;  3PQI A;  1N32 L;  5CBA E;  1X54 A;  1R9T H;  1HHV A;  3VR5 A;  3S15 H;  2K5Q A;  1LV9 A;  2Q8T A;  1E2V A;  1JE4 A;  1SMY D;  5FLX c;  2RDF A;  3TP6 A;  1IL2 A;  1VQP A;  1B4O A;  4U68 A;  3U58 A;  4QQB X;  4ZCK A;  1H95 A;  2I5H A;  3Q22 A;  4E6I A;  4OHJ A;  3PO2 G;  3QG1 A;  1SR3 A;  4P72 A;  4B3R Q;  1EWH A;  1D5X C;  1D1K A;  1SYD A;  1F2Y A;  2CW0 D;  1IXR A;  4CKC A;  4GLA C;  5ELN A;  3NXW A;  1STE A;  4B9W A;  5GAD C;  1SEB D;  2GVA A;  5KND A;  5IY0 A;  2IHE A;  3GTQ B;  3H0G H;  4R4O A;  1JOK A;  2BA1 A;  2EXZ A;  4PZ8 A;  1A63 A;  1IBL Q;  4KY7 A;  1PFS A;  5EKL A;  1IKL A;  4X3K A;  4OX9 L;  1EYC A;  1YNJ D;  3H09 A;  1CHQ D;  4YWK A;  4LF5 L;  1UE1 A;  1S3O A;  1TWF H;  4C56 C;  3I56 A;  1EEF D;  2XWJ B;  4JI4 L;  2JA7 G;  3GTG B;  3SEB A;  3CF5 A;  1AH9 A;  1RD9 D;  4B3M Q;  4QCL A;  4XQJ A;  1UNS A;  2L12 A;  2XSC A;  3OHX C;  5IYB G;  2JEA I;  1OO9 B;  3GTQ H;  1LLR D;  1M4V A;  3KF8 B;  4DV6 Q;  1A2U A;  1YI2 A;  1EZ6 A;  3D31 A;  3IKJ A;  1EIY B;  1V1P B;  1KAB A;  1V1O A;  1WI5 A;  4WOR A;  2F1M A;  4GOP A;  2RDG A;  4LF7 L;  2Q2T A;  3R93 A;  2K03 A;  3OW7 A;  2IJ0 A;  3I7F A;  3PIP 3;  2WAQ E;  1XPR A;  4CGY B;  3SGI A;  1FNU A;  2BE5 C;  5IE8 A;  1PTO F;  3GTG H;  4L5T A;  3BDO A;  3M9B A;  4DV7 Q;  5EGT A;  3TEH B;  1HRJ A;  3CP0 A;  1U4M A;  1F2M A;  4GN4 B;  3F2D A;  1S5F D;  3L0O A;  3L7Z C;  3CXC A;  1GUT A;  3E6Z X;  1STH A;  4GLV B;  4Q0F A;  3DM1 A;  1LUZ A;  2X6L A;  5ELD A;  3AQQ A;  2YU9 H;  1IBM L;  3K0Y A;  1HZB A;  4IUP A;  1IBK L;  2DNC A;  5FLM G;  3T4A C;  1SMY C;  4QUC A;  1HNW Q;  3CKI B;  3MWY W;  1LTG D;  4DUZ L;  2PW5 A;  1KC8 C;  3K57 A;  1I4H A;  3I4M G;  4LFC L;  1K3R A;  3IFD A;  2WAQ B;  2LXK A;  1L1O C;  1PFN A;  1RIP A;  4K5X A;  4X65 L;  3VDY A;  3GO5 A;  2PCF B;  3KDF A;  4FF2 A;  3JAM c;  4A93 G;  2CHB D;  1MI2 A;  2YV5 A;  4HIO A;  3PUV A;  2NBF A;  2CW0 C;  1UWV A;  2RDH A;  1I4X A;  1X3Q A;  1B53 A;  4KMU C;  3CPW A;  4A3M H;  5K36 G;  5M3F B;  1A15 A;  1XPO A;  5LL6 S;  1WD0 A;  2UUA L;  5JAV A;  3GP7 A;  1AW7 A;  5IP7 G;  4IPG A;  4K8I A;  1EQQ A;  3GTP B;  2ASB A;  5TSS A;  2QGQ A;  1VQG A;  4LF9 L;  4XIG S;  4QIW E;  4NXM Q;  2EY2 A;  4JBM A;  1YNJ C;  5BR8 L;  2JEB I;  3WOE A;  1EIG A;  1ESR A;  1UAP A;  2J4X A;  3OWF A;  3UI2 A;  1BCP C;  1FNW A;  4PZ6 A;  5FJ8 G;  3EQL C;  3J81 j;  3H15 A;  2NWG A;  5M3F H;  3S2D B;  3I4N B;  2A69 D;  4J1M A;  3BG3 A;  1YNX A;  1EIF A;  3GTP H;  4JCV E;  3BZC A;  4JI6 L;  5T1G A;  3EVQ A;  5C44 B;  3CC7 A;  1JT8 A;  1KHI A;  2F4V Q;  3HOY G;  2PZW A;  5CMD A;  3GTM H;  2O4X A;  4EQ5 A;  2OCE A;  2YTX A;  1J9O A;  3T1Y L;  1PRT F;  2ZXP A;  4QGU A;  4A3G H;  4L5S A;  3ND9 A;  3S14 B;  4HTH A;  2ZJR A;  4IFD I;  4QIW B;  3J80 c;  1GHK A;  4V0B A;  4A3I B;  1N34 Q;  5C0X I;  4G7H C;  1EY4 A;  4H02 A;  5HGT A;  3S2D H;  3I4N H;  2EQS A;  1Q7Y C;  1NSN S;  2KJX A;  5FLX L;  3OYY A;  4KJO A;  4GNX C;  3K0X A;  4L6T B;  4DAM A;  5LMN Q;  4DR6 Q;  3OW2 A;  4ZQ3 A;  1I6H B;  4A3J B;  2Z6K A;  3HKZ E;  1FL0 A;  1HR0 Q;  2PQA A;  4R4I A;  1T9H A;  4GN5 A;  2QDB A;  4DV3 Q;  1VQ9 A;  3S14 H;  3F2U A;  3AFQ A;  1A0I A;  2UXB Q;  4A3I H;  1LTS D;  3CMA A;  3KBG A;  2EIF A;  1NR4 A;  3J7Y W;  2VW9 A;  5E7N A;  1SE4 A;  4ILW A;  4IUQ A;  2F0W A;  5KEE A;  1G2S A;  2N88 A;  1ET6 A;  2PPB C;  3QIA A;  3A55 A;  1B7Y B;  1J5E Q;  1B2T A;  4LWC A;  1I6H H;  1RDP D;  4RAU C;  4A3J H;  4DV5 Q;  3HOX H;  5C4X G;  1ILP A;  3NBI A;  3KLS A;  2RHQ B;  3FEW X;  4JOI A;  4LFB L;  3DLL A;  1KTK A;  3TQY A;  5LMU Q;  2ID0 A;  1D7Q A;  3S16 H;  3HOV B;  2UU9 L;  2A73 B;  3DEP A;  3HKZ B;  2OQ0 A;  3BU2 A;  3JAM i;  1QJO A;  1AZP A;  3A54 A;  1K8G A;  4A3E G;  3I90 A;  4OEL B;  3QWN A;  1QG7 A;  2KED A;  2KCC A;  3HOW G;  3MC0 B;  4A3B B;  2JA6 G;  4DGZ A;  1K73 C;  2R7D A;  1B3Q A;  2VQE Q;  5CV9 A;  4MHE A;  3GV3 A;  1E7Z A;  4LFA L;  2C9O A;  2MUY A;  3ND8 A;  1Y1W B;  4DR2 Q;  3K5L A;  1TY0 A;  1HNX Q;  4WRD A;  3HOV H;  4RMF A;  5I2X A;  4LF4 Q;  2EYP A;  3C3L A;  2CH4 A;  1BVS A;  4CHT B;  3F8T A;  2I0Q A;  4A3K G;  2CQO A;  5JEA H;  4OIJ A;  1FNV A;  3KBX A;  5ELC A;  1X3P A;  5M5X B;  3CCR A;  4O1N A;  5CGK A;  3OIP A;  2OEO A;  3ULP A;  1VCI A;  5EBC A;  4LF6 Q;  2R92 B;  1I94 Q;  4A3B H;  3ERS X;  3RN2 A;  1Z6H A;  1VQ7 A;  3V2T A;  5KNB A;  1BBU A;  1I4Q A;  1Y14 B;  4LUV A;  3K5M A;  1Y1W H;  1P8L A;  1YHA A;  5ISR A;  3I2Z A;  4R9W A;  1YJW A;  4Y52 H;  4Q5V A;  3ERQ A;  4A3L H;  2NYZ D; 
#chains in the Genus database with same CATH homology
 4I7A A;  4JVZ A;  2HD3 A;  4N8F A;  4JW0 A;  2RCF A;  2QW7 A;  4N8X 1;  2Z9H A;  5L37 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...