4I7AA

Grpn pentameric microcompartment shell protein from rhodospirillum rubrum
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
88
structure length
84
Chain Sequence
MYLGKVIGTVVSTSKNESLSGTKLLVVARLTEKLIPDGSTQVVVDTVGAGNGEIVIVSCGSSARQSHSVIDAAVVGIVDTVETV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ethanolamine utilization protein EutN/carboxysome structural
publication title Bacterial microcompartment shells of diverse functional types possess pentameric vertex proteins.
pubmed doi rcsb
source organism Rhodospirillum rubrum
molecule tags Structural protein
total genus 12
structure length 84
sequence length 88
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2012-11-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.220 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) EutN/Ccml 4i7aA00
2QW7A 4N8X1 2Z9HA 5L37A 4JVZA 2HD3A 2RCFA 4N8FA 4I7AA 4JW0A
chains in the Genus database with same CATH superfamily
1U4LA 1YZ6A 2WIIB 1SN8A 1TT2A 4QY7A 1VQHA 3S14H 4R4IA 1XWEA 1AZQA 1ENFA 1HH2P 1FJGL 3I4NH 1S5BD 5CV4A 4LF8Q 1YVCA 4KLKA 1N32Q 4DV3Q 1S72A 3QOLA 4B08A 5JVH3 3OOCA 4CKEA 2C5CA 1CUKA 5JAVA 1SE4A 1KDCA 2B2TC 3I4LA 5IOCA 2F4VQ 4ILWA 3ZYYX 3HOUG 1YEZA 4WRDA 1Y1WG 4NDXA 1RL2A 2K50A 4K5VA 4HCEA 3LWUA 2B2UA 3T1HL 1IKMA 5GAEC 1EY6A 1V1PB 1WCMH 4K8IA 5C0XJ 3M3YH 2YV5A 4BBRH 4R4TA 4JI4Q 1TWGB 2ZXRA 1X3PA 1C9OA 3OYYA 3X3NA 3HKZE 2AWNA 3CCVA 3J81i 3FDTA 2AQ2B 3NSWA 3SK8A 1SE2A 4HMIA 1PLFA 1MJEA 4AIMA 5IT9E 1EYAA 3D8GA 5C3XA 2EVBA 3DHQA 2OXPA 5FLXc 1FYCA 5EKKA 3R93A 2F03A 1SMXA 4JI6Q 1VQ6A 4BBSH 1DYQA 4LFAQ 2L55A 1Z6HA 1VQMA 2PZTA 2SEBD 5EKLA 3V2TA 3CCUA 3KFUA 3D6CA 1BBWA 1UE7A 3MC0B 3NHHA 1MBYA 3JAMi 3S1QH 2BCOA 3J80i 1Z47A 2EYJA 1EYGA 2JA6H 2N49A 1KDBA 5IODA 2VQFQ 3HOYB 1H9MA 1F9QA 3MXNB 4Q0FA 3L2PA 4OWWB 4JI0L 4R8NA 1EZ8A 1HXYD 5E7NA 3QOJA 1TVXA 1XMOL 4DR6Q 3CAMA 5IYDH 3S1RB 4A3BG 3U9OA 2G5DA 1LTGD 4KHPQ 3TP5A 1K8AC 1B70B 2M2LA 2D9UA 1TWFB 1SYCA 1J5EQ 2RHSB 3PQIA 3AMUA 4WJ4A 1K8GA 1I4RA 3VR4A 2NN6I 2VY3A 1F2MA 1RD9D 5E1FA 3H0GH 2R61A 4MTKA 3T1YQ 3CKIB 1FD7D 1DONA 4X65L 2R92G 5EJWA 1PVOA 1J9OA 3NE5B 1WFQA 2HQLA 5C4HA 1RJTA 3EFXD 4POFA 4DK3C 2HIVA 2UXCL 2D62A 2K32A 4UHVA 1E7ZA 1B9MA 4OWTB 1EU3A 4AQYL 1V1OA 3S17H 4GN3B 1A8VA 4PZ8A 3GDEA 1HRJA 1G8ZD 1PFMA 1DOMA 2R6GA 1MSGA 3PUYA 4V0BA 2XWJB 1EFID 2MFIA 4I7ZC 3T16A 4C1NI 3STBC 1C48A 4DGZA 3G6EA 3D0FA 3M4QA 2Y0SG 2K1BA 4DFAA 4RCOA 1GM5A 4IFDI 5E4XA 4KKTA 3T1HQ 3HEJA 3TS0A 1ZYRC 1DM0B 3CCJA 3EA6A 2B2VC 4FVMA 1PHJA 2F0PA 3SE0A 3U4ZA 2UU9Q 1R4QB 4YCVA 1GUNA 1EIGA 5DM73 5IP9G 4A3IB 2NTTA 1Q46A 2Z6BA 4OO1I 4OWXB 1L0XB 2WAQG 1SLJA 3LGJA 4C3HB 2RHQB 1E22A 1EWHA 1SR3A 5COYA 4KHZA 4P75A 4GKKL 2EXZA 3K8AA 1G2SA 4BA1I 3E9HA 2BE5C 2F52A 1I94L 1YNNC 2OTJA 3DM3A 4A3JG 4BY7G 3KYHC 2J0TD 2PW5A 1GVPA 3CCEA 2ZTCA 4JC0A 4DV5L 1VQ5A 1B44D 1JOQA 1LT6D 2B2TA 2WFWA 4DK0A 3G7LA 5IE8A 3CMAA 4A3KG 1XPRA 2KOLA 3NBHB 1GUOA 1KRSA 5CBEE 3M85A 1PV4A 3HS0C 3VYSA 2Q2TA 4A3DG 4JI1L 1IBMQ 1KDAA 1D6EC 3PIP3 3S1NH 1XMOQ 2KVMA 2FHTA 3OW2A 1JICA 3D4DA 3P7JA 1E1TA 4ZAIA 1SSOA 4IQZA 3BJUA 3S16H 1WI5A 2I5HA 3OMGA 5CV7A 5CYUA 1SDFA 4LF6L 3J81j 3FPPA 4A3LG 1HZ9A 4X65Q 3MXNA 5FJ8G 1KRTA 1EZ6A 2UUBQ 1N33L 5FK9C 1ASYA 2UXCQ 1DXMA 5C3EH 1HJPA 1VF7A 2I5LX 4A3GB 2N8NA 3J7A5 2EYPA 2Q2HA 2EJMA 4AQYQ 4KK7A 2KBNA 3NUCA 2KECA 2E75C 3CRLC 2FMCA 1C4QA 3ND8A 4OIJA 3CMEA 5M5WH 3GTMH 1VQLA 5M9OA 3PV0A 2IT1A 5KNDA 2NN6G 2R93H 1KLGD 3J81L 5BN5A 1KNEA 1GUSA 3ULPA 4K0KQ 1Q82C 2FXQA 3BVMA 4HIDA 5IYBG 3PO2B 1PXUA 2WACA 3ONAB 2F0TA 2DJGC 4R4CA 5IYCH 3HOWB 1I3QB 1ET6A 2WAQE 5EQ0A 1WD1A 2H5XA 3W1BA 1CI3M 1IW7C 1LUZA 2N88A 1TS5A 4MZ9A 1VQBA 4QMGA 2A1AA 1PZJD 1W6KA 3STBD 3GTOH 5M3MB 2HHHL 3GTLH 5A2QE 5LMNL 3JAML 3MXUA 4KD4A 3J80L 5IIFA 1MI2A 2F4IA 3NELA 4IFDG 4F8MA 1GD7A 1ESRA 2G9HD 4A3EH 1DOLA 1Y8OB 4NP5A 5FKAC 1RF2D 3PUXA 4O0AA 4IO9A 4GKKQ 5EPLA 3RZOH 5H1SE 2UUCL 1K0SA 3CD6A 1A3VA 1O7ZA 3NQTA 1EY0A 2NZHA 4GLAC 1I94Q 3H15A 4ME3A 4P72A 1FNVA 3H3VC 2A74C 2E2IB 1TKWB 4OO1G 3EQLC 4DV5Q 2PYKA 3E5SA 3T4AC 2F0OA 2RQXA 2A5HA 4B9XA 3P20A 2B8GA 4DV6L 1CHPD 1SNOA 4KY6A 2ICEC 1E0BA 4Y7NB 1HFGA 1PDQA 3OMCA 5ELEA 3C1FA 2ZM6Q 1LTTD 4NPSA 4V190 3QJYA 2JA5H 2B2VA 3UDIA 2BE5D 1BO0A 1WOCA 4JOIC 1YNND 3DXJC 2V1CC 3HKSA 3MFYA 4HJ5A 2PZWA 1UUPA 3EJIA 3D6WA 3PIO3 3NEMA 1I4HA 2OT2A 4XYQA 2EOTA 2K01A 4JI2L 2QA4A 1STAA 4BS9A 4GNXC 4LF6Q 3NBHA 5CV8A 3E3XA 2KCCA 5BN4A 1N33Q 5IWAQ 2CCZA 4LW1A 5E4WC 4CDCC 2JA7B 1SMYD 2D0PA 2F1MA 4ZCKA 2ZT9C 1I6HB 1K3RA 4LF5L 5M5YH 2O4XA 1IKLA 4HJ8A 1LTAD 3H91A 4N8X1 2PI2A 1HFNA 4M8AA 3HOVH 3FP9A 1NR4A 1HQMC 4YCUA 2QW7A 2JXMB 1WTQA 2JE6I 3MA2B 4X6AH 4QQBX 4JBKA 2E2JB 4GNXB 1B9NA 1TIID 1GO3E 1CA5A 1A3TA 4LFCL 3VYTA 1XTCD 1NJIC 4B3RL 3S1MH 1QG7A 1YJ9A 2WP8J 3S14B 4L6TB 3I4NB 1VQFA 5GADC 2F3VA 4PNYA 4DV2L 5JPNC 5M3FH 2LS01 3H6MA 5KEEA 3PCOB 2F0IA 1XYIA 2AWOA 1S4ZA 1J8IA 2PNHA 3BDOA 4FP5D 4DR4Q 1XX8A 2NTSA 2HHHQ 4C2MH 2VS1A 3K80C 2K6AA 1MSHA 2KEDA 1HTLD 5FO8B 2X6GA 3K5MA 1CSQA 1SYDA 1TXYA 3PIOA 2R7ZH 3I3CA 3C2PA 2E2DC 2KCMA 3OTOQ 1KLUD 2L1BA 3M3YB 2EQSA 4RH6A 2B63G 4BBRB 1S5DD 3FPUB 4DV3L 1K83H 2UUCQ 4IPGA 1OXVA 1VQIA 5C0XI 4PZ7A 3KLSA 1KAAA 4QCLA 4RGMA 2F4VL 2CVRA 4YY3Q 2NUCA 1QVCA 3GV3A 2F0VA 4NMZA 4XT1B 4DV6Q 2EYMA 4JVZA 1C7YA 1EYDA 2QEJC 1Z7TA 4OEMB 3FMCA 1LTLA 2SOBA 1V8QA 4BBSB 2R3ZA 3OIQA 1T5XD 3M4PA 1X3QA 2EZVA 2Z9HA 2R7DA 4F87A 1B3AA 1YBYA 4H0LC 4DV1L 4O42A 4KY7A 3J7AF 4JI2Q 5C5LA 2I5MX 5C4JH 4C3IG 3S9WA 2XSCA 1XPUA 3S1QB 1AE3A 1AE2A 4G7HC 3S15H 1MIUA 3PO3H 5M5XH 2AMCB 4XQJA 4JI6L 4CDEC 4ULLA 1IL8A 2JEAI 1UNSA 1UEBA 4LF5Q 2XGTA 3URYA 3RN5A 1B1ZA 2AHOB 4BY1G 1G6PA 1Q3LA 1BF4A 3TZDA 1KC8C 4FDBA 3NQIA 1HR0Q 3PO2G 2KCTA 1DZ1A 1D5XC 3HOWG 2CHBD 2DNCA 1JOOA 3H0GB 4G7ZC 3BS1A 3HOUH 5KYLA 1Y1WH 2QDLA 4LUZA 3OW7A 3KOJA 2B8FA 2UXBL 1I4XA 4OIKA 1JJ2A 5M3MG 4JBWA 2X69A 4B3RQ 3NTKA 4KHPL 1SAPA 3S17B 5CGKA 1JQYD 5DAUA 4IJLA 3RLOA 4LNQA 5ELBA 4JOIA 4DV2Q 1O7IA 4G7OC 1L2FA 2RCNA 3K0YA 1PYWD 1JE5A 4XYOA 1OTCA 4GNXA 2PW7A 1F9PA 5IY0A 3QR8A 4TVAB 2NVXH 2F0QA 2K28A 5ISRA 3V05A 4MTNA 4LMQD 2KQ3A 5EPKA 2EY5A 4EQPA 4I7AA 4NXML 1E2ZA 2F0FA 3VYRA 5L37A 1O7YA 4KD3A 1AN8A 1J6QA 3AU7A 1S3OA 1SE8A 5LL6X 1SFOH 3MVVA 2DJFC 2N55A 3DMUA 3L0OA 2PI2E 1HNWL 3OWFA 2WB1B 2XTIA 3O13A 1CSPA 1VQKA 3E9IA 1BCPF 3ULLA 1JOKA 1STNA 1FNUA 2BH2A 2AQ1B 1VQJA 1QOHA 2MQHA 3JC66 4J15A 2VUMG 2K04A 5ELOA 1QVFA 4H7BA 3LX0A 2PPBC 2UU9L 3ND9A 5C0XG 2VQEL 2ZJRA 4JI5L 2JA7G 1Y69U 1XTDA 4IUVA 4DV1Q 2CFMA 3I90A 5CV5A 4WJ3M 2HDMA 3K57A 1QNKA 5IT9L 1LABA 1K3BC 3TP8A 4QUCA 4AH6A 2R92H 2XNAC 4KJNA 5C3WA 1CHQD 1U4MA 4GN5A 1YNXA 1HZBA 5KRUA 4ZUJA 1T5EA 3S1NB 2FJ2A 3I91A 2B2YC 1NR2A 3HOZH 2EDGA 1VQOA 1EWCA 3RUZA 1TWAH 2XRQD 4A3FB 1D8LA 4RFBA 1BR9A 3S16B 2ZTEA 4DV7L 1XXGA 2Q8IB 4MHEA 2NB0A 5FLXE 3GTJB 1NBWA 1Q8KA 3TP6A 2MNAA 4TRDA 1B7YB 4OGQC 2HDLA 3KLSX 1F9SA 3QB3A 5C6AA 4CJ0B 4Z9CB 1IBML 5ELCA 2UXBQ 4RKBA 5C3EB 5JEAH 1WD0A 3WOEA 3AB9A 2LMCB 1PZID 2I07B 2KUMA 1JORA 1JJGA 1HQRD 3CCMA 2C35B 1BUVT 4X64Q 1STEA 2NWGA 3HOXB 2NVQH 4EQ5A 1Y14B 1GUWA 1CZGA 4YCWA 4RG1A 1WYDA 1Y1VG 1YI2A 4CDDC 2KEEA 1E3PA 2CH4A 5IP9H 3TRZA 4BBRG 4KKUA 2R93B 4P74A 2UUBL 3PSIA 1SYBA 1YITA 3EN2A 3HG9A 1CKOA 1FL0A 4ZKCB 2NVTH 4ZQ3A 4NXMQ 2D2CC 1HR0W 2GVBA 4BXXG 4K2KA 1P8LA 2B2WC 1JJCB 4PMWA 5F2DA 1A0IA 3G4SA 4BY7H 1LTSD 1HNWQ 2LY7A 4XIGS 1R4PB 3GTOB 1SRUA 3NENA 1DJRD 3GTLB 1SROA 4DR1L 2MUYA 4ME5A 4K0KL 4A76A 1CTMA 4A3KH 3MHBA 3TBIB 1HZAA 1N36Q 4A3EB 4ZRZA 2A68D 1HTPA 4DNIA 5J3BA 3KDFB 2L9HA 3K0XA 4A3DH 1LT4D 1KNAA 1NY4A 1A2TA 3M4OH 3MWYW 3RZOB 1BVSA 5ELFA 4LK1C 2PQEA 4JBMA 1DCZA 4O1NA 4P2CB 2VQEQ 4N8FA 1VQDA 3W1GA 4S3SA 4DR3L 4JI5Q 2EY1A 1CZWA 1V43A 5C44G 2OTLA 3I4MH 4A75A 5IYDG 4FF2A 4TSSA 1M4VA 4A3LH 2MGSA 3TSSA 1Y8NB 4DR5Q 1PYBA 5FJ8H 1BCPD 2Q8RE 1SE3A 1W3SA 3F8TA 3P1HA 4RWSC 3UE0A 1PH8A 3J7YW 2F0NA 4XTCS 3A5UA 1Q8IA 3Q8DA 4PV1C 2MJ8A 1XNRQ 3ER0A 3U4VA 1B8AA 1NNXA 1CKNB 3DUZA 1CKMA 1V9PA 4EGVA 3KLWA 3A7LA 1F77A 3CQZH 4DV7Q 1K8OA 4EX5A 3CCSA 1CQVA 2NN6H 3SDZA 3TS2A 1D5MC 2K5WA 3IFDA 3DEOA 1JMCA 2K52A 4K8JA 1EIFA 4LAAA 2PMZB 2YTYA 2QKIC 3BZCA 5J22A 2D0OA 4DN4M 2ZM6L 1SMYC 1VQ7A 3T51B 3DWPA 4DXFA 3R3OA 3Q6SA 4HJ7A 3RLFA 3MXPA 3U58A 1CA6A 1EQRA 1TY0A 2RVLA 3CU7A 5IYBH 5M5YB 1EYCA 4QB4A 4C3JB 1QILA 1H9KA 3HOVB 4PG3A 1O80A 3U50C 4Q5VA 2MO1A 1YNJC 1EFWA 1HUMA 1II3A 5IWAL 3FRPB 3IRBA 3KBXA 1LTBD 1R9TB 4OONA 3RD4A 4IFDH 3DM1A 5DM63 2DGYA 1TS2A 1JR0D 3A5ZB 4ID6A 2JA8B 2FINB 4XXEA 4PMCA 5IGBA 2JYOA 3QWNA 3IFTA 2B2YA 3MEFA 1TQOA 3D31A 4KHVA 4X3KA 3GTKB 2EPBA 3K5LA 1X6OA 2CQAA 2VW9A 1U9RA 1GHKA 4HEDA 4C1NK 5M3FB 1M90C 5CORA 3F2BA 3MFGA 5DEHA 1C8CA 4OO1H 3CCLA 3CXCA 2VXWA 3S1RH 3J81c 3VA5A 4C2MB 4DR1Q 1TWCH 4K5WA 4A3CG 3W3AA 4KV6A 2R7ZB 1ML0D 1W6JA 5EPJA 2F0DA 4K14A 5I2YA 1K83B 2EXDA 1SYFA 1VQ8A 1TS4A 4JI8L 5KNCA 2O5IC 1B4OA 1FNWA 4DR3Q 4J6HA 1PTOF 3PIPA 4DR4L 2SNSA 2BA1A 3ULJA 3CW2C 2HT1A 5C4XB 2IW3A 2RDFA 3I8ZA 1C0AA 1EQQA 3JAMc 4A3FG 3J80c 5FOBB 2QDBA 4HN7A 1BDOA 3KDFA 3D4RA 2KHSA 1VQNA 1RODA 3OTOL 4KN7C 4A93B 1F9RA 4F7XA 1X9NA 2IX0A 2K75A 2WV6D 3HOYG 4G57A 1UAPA 1A2UA 3VA7A 3G48A 2NVYB 4OX9L 2HCCA 3R2TA 1EY5A 4YY3L 4ZUIA 2B2WA 1ASZA 4L5RC 2FFKB 3J80E 1X65A 1JCKB 4HTHA 4NW2A 3MAQA 1PH1A 2K03A 1HNXQ 5NUCA 1RCVD 3N52A 1BNZA 5C4JB 2LXJA 2Z4HA 3HOXG 3SEBA 2E2HH 4X3TA 1DD2A 3VR2A 1HNZL 4B9WA 1X55A 5I4DA 2VB3X 1PA6A 2JK8A 1KHIA 1X3FA 4ABNA 5M5XB 1LTID 2HCIA 1HA6A 2D5DA 1U4RA 2Z8LA 1GXDC 3F2DA 1CKNA 1F2YA 4P71A 1S5FD 3SHLA 1BBUA 4QUFA 4R1JA 3M4YA 2WB1E 3C3LA 2RDGA 4IJHA 3A56A 4YWLA 3GTGB 2EYHA 3A0JA 1TR5A 3HOUB 1ENAA 1ET9A 2QGQA 1E1OA 1Y1WB 4FF3A 1HHVA 3AEVA 1A15A 3V96A 1EL0A 4N9TA 4RGOS 4U673 4C56C 4EVOA 2B63H 1P16A 1STBA 2CWAA 1HR0L 1KL9A 4IUNA 3A8JE 3GD7A 3C1EA 1HZCA 3BVZA 2B3GA 1D1IA 4EQNA 5EKIA 2HIXA 1YNJD 3BU2A 3E6ZX 2PO4A 4JBJA 4FF4A 2TSSA 4O2DA 4A3IG 4NB3A 2DY7A 1QWYA 3UDFA 2NVXB 3CP0A 5J39A 2QF7A 3K58A 1UE6A 4C3HG 1WTRA 1NTGA 2ZJQA 1JWMD 1NMFA 5A35A 4DR2L 4NKLA 4X3SA 1M8AA 4A3MH 4R9WA 1QZHA 1SFOB 4JI8Q 5D3DA 2ALYB 3DEPA 1G91A 2UXDL 1Q1EA 3VR6A 5CR3A 1ZEQX 2EE1A 4WORA 3BG3A 1UEAB 3I70A 4C3IH 1NCVA 2M00A 1AP0A 1LT5D 2EJGC 1I50H 1NSNS 2E8GA 4XQQA 1WCMB 4L5TA 1U5KA 3CF5A 3H3VI 1B3QA 2A69D 3MZ5A 3CHBD 3UE1A 3VR3A 5TSSA 4DUYL 4A4IA 5JOBA 3CPFA 5BR8L 5J1ZA 4CHTB 2ES2A 2JEBI 2WKDA 1RHPA 3GO5A 4OX9Q 4BY1H 2F0LA 4J1MA 1LACA 2CQOA 3ITPA 5D65A 1PH4A 4HJAA 4TKOB 1GUTA 1H95A 3PUZA 1YJNA 3PO2H 4C3JG 1MKHA 3HFZB 1PTOD 3HOWH 5IP7G 1I3QH 1SBBB 3BZDB 1HNZQ 1CQFA 1BKBA 1D7QA 1A6XA 5FLMG 2A8VA 4DAVA 2SNMA 1TWHH 1W2BA 3BDLA 4JPBW 2E76C 5JPMC 4YWKA 3HOZB 1H9RA 3GTPH 5K36G 1F2LA 2AUKA 4A3GG 3I2ZA 2Z4IA 2CW0C 1IBLL 2IHEA 1VS0A 3HGBA 1LTRD 5BN3A 2JA8G 3FKIH 1PH7A 2IPKD 4KN4C 1PMRA 1AEXA 4GS3A 2JA6B 2E5LQ 2VB2X 1DGSA 5LMUL 1PTOH 4DNTB 4K6DA 2Y0SB 4IPDA 2DUDA 2PQAB 5EAYA 3KBGA 1I4QA 2I0QA 1PRTF 4FO2A 1CK1A 4DKAC 1O7LA 4X3UA 2OWOA 3OPOA 2A6HC 1SNCA 2R7ZG 2NVQB 3OHXC 3EBEA 1EQTA 5AJ3L 4ODGA 5D3IB 2OEOA 2IJ0A 5DLQE 1VQ4A 2P5ZX 3LWEA 1RKNA 2ASBA 3SVMA 4LJZC 4IUUA 4B3SL 3ERSX 2J7ZA 2F0EA 2VUMH 2WKCA 4K5XA 1FGUA 4JV5L 5C4XG 3RZDH 3NTHA 2XN9C 4X64L 4QIWB 1EY4A 4DR2Q 3F1ZA 1Q1BA 5C0XH 1AZPA 4POGA 4LUOA 4ZLTF 4A93G 3RNUA 1SNQA 1BQQT 4RAUC 4YWMA 1OXUA 2JA7H 4BY7B 1JT8A 4DAPA 2UXDQ 1I6HH 3QO2A 1VQ9A 1I6VC 3PF4A 3A54A 3TMEA 3S2DH 1MD2D 1VMPA 1VCIA 1ONLA 4RMFA 2PMZE 3W2DA 2A68C 1KTKA 4A3KB 1LLRD 3HRZC 2F0JA 5EBCA 1JB7A 3HP3A 1MJCA 3X3MA 4A3DB 2K5HA 3T53B 1JB3A 4DUYQ 3M4OB 1K9MC 5BR8Q 2E2JH 4M1UB 2XWBB 4JI7Q 1XNQL 4UP7A 4RA8A 2ZXPA 1A62A 1EEFD 3BYYB 1WVLA 1H9JA 1NE3A 1SNDA 3I4MB 1X54A 4H13C 3RLNA 4F88A 1EWIA 3BYTB 1N36L 1BCPC 2ICIA 2RDHA 3Q0AA 3MEHA 4KY5A 2HUGA 3KK7A 2ENBA 2L15A 3NWSA 3NK9A 4HIKA 2B39A 1E24A 1OXSC 4FYDA 1L0YB 1JC7A 2BDOA 4RHSA 1ICFB 1N34L 3J7ZC 3KJPA 4A3BH 2CH4W 4GZYC 3NTIA 2EYLA 3I55A 1YHQA 2EY2A 3Q24A 3W5OA 4HR7B 3S2HH 4AYBB 1IBLQ 1VQAA 4DR7Q 3CQZB 1QB5D 1Y1VH 3KLRA 1EEID 4CGYB 4DV0Q 1K28A 1TS3A 1G291 2K5VA 5IT9c 4DR5L 5FO7B 1TY2A 1S40A 3QG1A 5LMUQ 1PFSA 1NAPA 2KA7A 4BWGB 3TDQA 2TMPA 4JG2A 2YTXA 4IPCA 4CBVA 5LMNW 1BCPB 2MHVA 2L0CA 1STGA 1SJHD 1XNRL 4B3MQ 2F0UA 1B50A 4LF4L 1KXLA 4BXXH 4MIUA 1KD1C 5FLXL 4DUZL 4KTAA 1VMCA 2CW0D 3I4NG 3A7AB 3KF8B 1MHWC 5AJ3Q 2IWHA 3UDXA 3PUWA 3G71A 2JA9A 5I6YA 1EQVA 1QZGA 1D5ZC 4GLVB 4E6IA 3FHWA 1VQEA 2PQAA 4APVA 4DAYA 3RN2A 4B3SQ 4N9PA 5G3LF 2QCPX 2KHIA 2Z6KC 4OXPA 1MGSA 1VQPA 4JV5Q 3NBIA 2A6EC 2JSOA 1HCZA 4HIOA 2B29A 4Y52H 1G6ZA 1GKHA 1PRTD 2ZJPA 3F2UA 3VR5A 2A6HD 5M5WB 3GTMB 1WCMG 1Z9FA 4X66Q 4YHHQ 3K7AH 2C9OA 3OIPA 4DPGA 5HURA 3GTQH 1PFBA 1STHA 4IZ8A 5C44H 1B2TA 3KF6A 2NZ1D 4NXNL 1PH5A 2EIFA 4IN3A 3TP7A 3B6YA 1TWCB 1FGBD 5GAHC 1VQCA 2O2LD 3NWTA 5FO9B 2KCNA 3L3OC 2OCEA 2NBFA 4KJOA 5CMDA 1EUJA 1PFNA 4XDXA 3I72A 2F0WA 3I73A 3WDNA 1QNUA 3KUPA 4R4QA 4A3JH 2Z1CA 5EGTA 1ILPA 1XNQQ 1AFPA 2VZAA 1HA5A 4BBSG 3VYUA 5C4ZA 1GOZA 5GQOA 2J4XA 4IUQA 1BOSA 4JYAL 2AUJD 3HOZG 1XJVA 1FJGQ 4LF7L 4I65A 2YU9H 1EIYB 4WJWA 4IUPA 1IZ6A 2BDNA 1RDPD 2Q8TA 2JA6G 2XVSA 1ZXTA 2HD3A 5JEAJ 4GLXA 1N34Q 1WTOA 1EY9A 1KQSA 4QL5A 1FVIA 4IOAA 1CFMA 4DA2A 3I56A 4RGNA 2JN4A 2RCFA 5IGDA 5JEAG 3R2IA 4UPAA 3BVGA 4QF4A 2F3IA 2E2HB 1IXRA 2H1EA 5JJKA 3H0GG 2JP1A 3D3RA 2JA5B 2ATWA 4H44C 1ICWA 3E0JA 4LF4Q 2RKSA 1IYJB 2XIWA 2KENA 1V1PA 2LSSA 1HNXL 4DUZQ 2BOSA 2UUAL 1TWGH 3D4WA 2JQOA 2M9VA 2Q2UA 1E2WA 2H4OA 1OXTA 4ZK9B 1PH2A 5EBDA 1QVGA 4IUTA 2F0HA 3UDGA 3WOFA 4A3CH 1LT3D 1VDZA 2QILA 4RKLA 5IGGA 3M7NA 1SNMA 2L11A 5IGCA 2CWPA 2HQEA 3CCQA 4GOPC 4HCSA 2B63B 4FNFA 2F0SA 3SXHA 3KF8A 1EIHA 1PH6A 4P73A 4CKBA 4JI0Q 5CC4A 1SYEA 3PGZA 4QJFA 4DV4L 3N6RA 4DK6C 3DWAA 4KI0A 3PMFA 3FVQA 2IX1A 4NXNQ 5DNFA 1A3UA 2WB1G 3M7GA 2Q2IA 4A3FH 3NP8A 3I4MG 3VDYA 5JJZA 3S1MB 3GTJH 2A6ED 5G3LD 4IOCA 3HOYH 1G51A 2RBMA 1Q86C 2IL8A 4FXDA 3L7ZC 1I4PA 1NMGA 1AW7A 4DU9A 4A3MB 4KMUC 4GOPB 5HGTA 5KNBA 1YHBA 4IURA 3GP7A 3K6OA 4DK1A 5ELDA 4JYAQ 1VQGA 1V1QA 4UP8A 4OL7A 1EU4A 4LF7Q 2K4KA 2L12A 4C3IB 2Y0SE 1TWFH 1RTNA 3HOXH 4AYBG 3K5NA 1I50B 4B3TL 2A69C 4LUVA 3HKZB 1I5FA 5I2XA 1K0RA 1NUCA 1U4PA 3BDCA 3BZKA 4JW0A 4HJ9A 2DN8A 2IY5B 1K8MA 2Z6KA 3AFQA 3C46A 1Q12A 3K5OA 4OELB 3EVQA 3T56B 3J81E 2F0MA 4L5QA 1O78A 2G9DA 2LXKA 4BY1B 1U0LA 4PMBA 4GKJL 5A2QL 2X6LA 4HSPA 5HY6A 1QUQB 1XMQL 1KAWA 1PTOC 2OQ0A 3IKJA 1RIPA 1BXTA 5GROA 3DLLA 1CM9A 1JWSD 2E74C 3Q23A 1SEBD 2L4NA 5ELNA 4GN4B 4DAMA 2JJQA 2PNRC 4IFDJ 1TWHB 2DNEA 4QIWE 1I4GA 3CC7A 2ID0A 5C3EG 3ZJYC 3GTPB 3JAME 4PQXA 1S5ED 1GJXA 3PUVA 2EYFA 4HIMA 4KKSA 1L0WA 2LKVA 4BA2I 5CV9A 1ZYRD 3FKIB 2UUAQ 1ILQA 5AFWA 3S15B 3PO3B 5IGFA 1PTOB 3CRKC 4RGTA 5E3FA 2AQ3B 3DWQA 4A3IH 5C5MA 2SDFA 3A8IE 3MTSA 4FXGC 2R93G 5CBAE 2L5TA 4J8QA 1WTVA 3GV6A 1PYSB 2K5QA 2ZTDA 4C3HH 1EY8A 2AKWB 2K5DA 3E0EA 4R4OA 1IYUA 3S24A 5I6WA 3SK6A 4L5SA 1SXTA 3TN2A 3HZXA 3K7UC 4JI1Q 2E5LL 2RF4A 2PCFB 5IYCG 3CCRA 4DV4Q 2EY6A 2RSNA 2Z0SA 3SK4A 4X62L 3A8KE 1X32A 4IALA 1L1OC 4JK1C 1M1KC 2EYOA 3J7AV 3WWVA 1YJWA 1D2BA 1G2TA 2F3WA 2NYZD 2VUMB 2K7VA 2OF1A 2K14A 2V4DA 3RZDB 3FEWX 4CJ2C 3TQYA 5D14A 4DNRB 3CC4A 3I4OA 4A3EG 1WTWA 1RTOA 4RCNA 1AH9A 2DY8A 3LNNA 3EROA 1IBKL 2A73B 2A19A 1HPCA 1LYLA 3SR1A 4LFBL 4ZYSA 4AYBE 4LWCA 1Q90A 1T9HA 1XPOA 4UAIA 4JCVE 5JJIA 3S2DB 1H9SB 3NXWA 4C3JH 1WTHA 2MP1A 2WINB 5HGQA 5IP7H 4IPHA 1QE6A 1IYVA 3KJOA 3ICEA 4B3TQ 1L1OB 5FLMH 4DF7A 3M9BA 4WFN3 2B2UC 1Q81C 5IGEA 2QEXA 1PZKD 1JWUD 1D1KA 3OWEB 4GOPA 1R9TH 1E2VA 5K36H 4JI3L 1QCBD 1YHAA 2F0KA 3K81C 5LL6S 1KIXA 2YTVA 4GKJQ 2O5JC 4A3GH 4QGUA 5CV6A 2JA5G 1LV9A 5T1IA 2JA8H 1XMQQ 1TU2B 5T1GA 3L9AX 4R8IA 3SK5A 4UY8C 1JE4A 4LF9L 1EOTA 2CKZB 4MNOA 1ENCA 3GTKH 2GVAA 2K5NA 4UDUC 1SYGA 1HUNA 1IL2A 4OHJA 2GA4B 4HAEA 4JI7L 2XRSD 1UWVA 4A3BB 5LMNQ 1OO9B 2KJXA 3RR5A 3TEHB 2F0GA 4DXGA 1QUQA 2VL6A 5I9OA 3S2HB 3U9SA 1LM0A 1DOKA 2IHFA 4K2LA 1STYA 1Y1VB 3NPPA 4LF8L 4YIJA 3RMHA 4FXKC 1N32L 2I46A 2R92B 1EY7A 2PZUA 3HOVG 1Q7YC 1GUGA 3AQQA 3AYHB 2R7FA 1K73C 1IW7D 1CT1D 5M3MH 4H02A 2MO0A 4MN3A 3UI2A 1FR3A 3A55A 2IX3A 2K33A 5C4XH 1EOVA 1TWAB 1B53A 1SJED 4L63B 4DR7L 2K05A 3Q22A 5GAGC 4A93H 3AFPA 5KIXA 1PH9A 4HSVA 4DV0L 4JI4L 2BA0A 4G4KA 3OSOA 4EQOA 4X62Q 4HMJA 2NVYH 5M3FG 4A3MG 2E2IH 2GN5A 4DAYB 3CPWA 2N78A 5I9PA 4B3ML 4XQNA 1A63A 4CJ1B 2EJFC 1F2ZA 3F2CA 1PRTC 1UE5A 4ZKBB 1YIJA 5JJLA 1SNPA 4Y7NH 1BBXC 3EIVA 5LHY1 1IBKQ 1N8RC 3HKZG 3H94A 3K7AB 4LFBQ 1N9WA 1S5CD 3GTQB 1QJOA 1KABA 4LFAL 3K59A 1IHZA 1WJJA 5C44B 3KF6B 2BH8A 4ALPA 5K5PA 3TREA 2WAQB 4PZ6A 1UE1A 3I7FA 2YYZA 5KYIA 2NZOA 4RHRA 3R8BA 2NVTB 1Y8PB 3H3VH 1PH3A 2MPMA 2LFNA 1ZKOA 2N3SA 3GTGH 2VQFL 5JVG3 3ERQA 1X56A 4X66L 3G6JB 3TZUA 4YHHL 2KHJA 1PRTB 2RSOA 4CDFC 2FMMA 1VF5C 3GQBA 4A3JB 3A74A 5KGUA 1WTXA 3T13A 1WTPA 4JI3Q 2ZXOA 4FF1A 3P75A 4UP9A 1X3EA 4TQUS 4U68A 4LFCQ 2VNUD 4DR6L 1H9SA 3MXGA 3CC2A 1ESFA 3IAYA 4LF9Q 4L8JA 4XT3B 1L1OA 3H09A 1OXXK 2YU9B 1X3GA 1J5EL 3FKIG 3QIAA 1LO5D 2RA4A 3T1YL 2OQKA 3IL8A 3PO3G 3PF5A 4CKCA 4K6LA 3SGIA 1GHJA
chains in the Genus database with same CATH topology
2QW7A 4N8X1 2Z9HA 5L37A 4JVZA 2HD3A 2RCFA 4N8FA 4I7AA 4JW0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QW7 A;  4N8X 1;  2Z9H A;  5L37 A;  4JVZ A;  2HD3 A;  2RCF A;  4N8F A;  4I7A A;  4JW0 A; 
#chains in the Genus database with same CATH topology
 1U4L A;  1YZ6 A;  2WII B;  1SN8 A;  1TT2 A;  4QY7 A;  1VQH A;  3S14 H;  4R4I A;  1XWE A;  1AZQ A;  1ENF A;  1HH2 P;  1FJG L;  3I4N H;  1S5B D;  5CV4 A;  4LF8 Q;  1YVC A;  4KLK A;  1N32 Q;  4DV3 Q;  1S72 A;  3QOL A;  4B08 A;  5JVH 3;  3OOC A;  4CKE A;  2C5C A;  1CUK A;  5JAV A;  1SE4 A;  1KDC A;  2B2T C;  3I4L A;  5IOC A;  2F4V Q;  4ILW A;  3ZYY X;  3HOU G;  1YEZ A;  4WRD A;  1Y1W G;  4NDX A;  1RL2 A;  2K50 A;  4K5V A;  4HCE A;  3LWU A;  2B2U A;  3T1H L;  1IKM A;  5GAE C;  1EY6 A;  1V1P B;  1WCM H;  4K8I A;  5C0X J;  3M3Y H;  2YV5 A;  4BBR H;  4R4T A;  4JI4 Q;  1TWG B;  2ZXR A;  1X3P A;  1C9O A;  3OYY A;  3X3N A;  3HKZ E;  2AWN A;  3CCV A;  3J81 i;  3FDT A;  2AQ2 B;  3NSW A;  3SK8 A;  1SE2 A;  4HMI A;  1PLF A;  1MJE A;  4AIM A;  5IT9 E;  1EYA A;  3D8G A;  5C3X A;  2EVB A;  3DHQ A;  2OXP A;  5FLX c;  1FYC A;  5EKK A;  3R93 A;  2F03 A;  1SMX A;  4JI6 Q;  1VQ6 A;  4BBS H;  1DYQ A;  4LFA Q;  2L55 A;  1Z6H A;  1VQM A;  2PZT A;  2SEB D;  5EKL A;  3V2T A;  3CCU A;  3KFU A;  3D6C A;  1BBW A;  1UE7 A;  3MC0 B;  3NHH A;  1MBY A;  3JAM i;  3S1Q H;  2BCO A;  3J80 i;  1Z47 A;  2EYJ A;  1EYG A;  2JA6 H;  2N49 A;  1KDB A;  5IOD A;  2VQF Q;  3HOY B;  1H9M A;  1F9Q A;  3MXN B;  4Q0F A;  3L2P A;  4OWW B;  4JI0 L;  4R8N A;  1EZ8 A;  1HXY D;  5E7N A;  3QOJ A;  1TVX A;  1XMO L;  4DR6 Q;  3CAM A;  5IYD H;  3S1R B;  4A3B G;  3U9O A;  2G5D A;  1LTG D;  4KHP Q;  3TP5 A;  1K8A C;  1B70 B;  2M2L A;  2D9U A;  1TWF B;  1SYC A;  1J5E Q;  2RHS B;  3PQI A;  3AMU A;  4WJ4 A;  1K8G A;  1I4R A;  3VR4 A;  2NN6 I;  2VY3 A;  1F2M A;  1RD9 D;  5E1F A;  3H0G H;  2R61 A;  4MTK A;  3T1Y Q;  3CKI B;  1FD7 D;  1DON A;  4X65 L;  2R92 G;  5EJW A;  1PVO A;  1J9O A;  3NE5 B;  1WFQ A;  2HQL A;  5C4H A;  1RJT A;  3EFX D;  4POF A;  4DK3 C;  2HIV A;  2UXC L;  2D62 A;  2K32 A;  4UHV A;  1E7Z A;  1B9M A;  4OWT B;  1EU3 A;  4AQY L;  1V1O A;  3S17 H;  4GN3 B;  1A8V A;  4PZ8 A;  3GDE A;  1HRJ A;  1G8Z D;  1PFM A;  1DOM A;  2R6G A;  1MSG A;  3PUY A;  4V0B A;  2XWJ B;  1EFI D;  2MFI A;  4I7Z C;  3T16 A;  4C1N I;  3STB C;  1C48 A;  4DGZ A;  3G6E A;  3D0F A;  3M4Q A;  2Y0S G;  2K1B A;  4DFA A;  4RCO A;  1GM5 A;  4IFD I;  5E4X A;  4KKT A;  3T1H Q;  3HEJ A;  3TS0 A;  1ZYR C;  1DM0 B;  3CCJ A;  3EA6 A;  2B2V C;  4FVM A;  1PHJ A;  2F0P A;  3SE0 A;  3U4Z A;  2UU9 Q;  1R4Q B;  4YCV A;  1GUN A;  1EIG A;  5DM7 3;  5IP9 G;  4A3I B;  2NTT A;  1Q46 A;  2Z6B A;  4OO1 I;  4OWX B;  1L0X B;  2WAQ G;  1SLJ A;  3LGJ A;  4C3H B;  2RHQ B;  1E22 A;  1EWH A;  1SR3 A;  5COY A;  4KHZ A;  4P75 A;  4GKK L;  2EXZ A;  3K8A A;  1G2S A;  4BA1 I;  3E9H A;  2BE5 C;  2F52 A;  1I94 L;  1YNN C;  2OTJ A;  3DM3 A;  4A3J G;  4BY7 G;  3KYH C;  2J0T D;  2PW5 A;  1GVP A;  3CCE A;  2ZTC A;  4JC0 A;  4DV5 L;  1VQ5 A;  1B44 D;  1JOQ A;  1LT6 D;  2B2T A;  2WFW A;  4DK0 A;  3G7L A;  5IE8 A;  3CMA A;  4A3K G;  1XPR A;  2KOL A;  3NBH B;  1GUO A;  1KRS A;  5CBE E;  3M85 A;  1PV4 A;  3HS0 C;  3VYS A;  2Q2T A;  4A3D G;  4JI1 L;  1IBM Q;  1KDA A;  1D6E C;  3PIP 3;  3S1N H;  1XMO Q;  2KVM A;  2FHT A;  3OW2 A;  1JIC A;  3D4D A;  3P7J A;  1E1T A;  4ZAI A;  1SSO A;  4IQZ A;  3BJU A;  3S16 H;  1WI5 A;  2I5H A;  3OMG A;  5CV7 A;  5CYU A;  1SDF A;  4LF6 L;  3J81 j;  3FPP A;  4A3L G;  1HZ9 A;  4X65 Q;  3MXN A;  5FJ8 G;  1KRT A;  1EZ6 A;  2UUB Q;  1N33 L;  5FK9 C;  1ASY A;  2UXC Q;  1DXM A;  5C3E H;  1HJP A;  1VF7 A;  2I5L X;  4A3G B;  2N8N A;  3J7A 5;  2EYP A;  2Q2H A;  2EJM A;  4AQY Q;  4KK7 A;  2KBN A;  3NUC A;  2KEC A;  2E75 C;  3CRL C;  2FMC A;  1C4Q A;  3ND8 A;  4OIJ A;  3CME A;  5M5W H;  3GTM H;  1VQL A;  5M9O A;  3PV0 A;  2IT1 A;  5KND A;  2NN6 G;  2R93 H;  1KLG D;  3J81 L;  5BN5 A;  1KNE A;  1GUS A;  3ULP A;  4K0K Q;  1Q82 C;  2FXQ A;  3BVM A;  4HID A;  5IYB G;  3PO2 B;  1PXU A;  2WAC A;  3ONA B;  2F0T A;  2DJG C;  4R4C A;  5IYC H;  3HOW B;  1I3Q B;  1ET6 A;  2WAQ E;  5EQ0 A;  1WD1 A;  2H5X A;  3W1B A;  1CI3 M;  1IW7 C;  1LUZ A;  2N88 A;  1TS5 A;  4MZ9 A;  1VQB A;  4QMG A;  2A1A A;  1PZJ D;  1W6K A;  3STB D;  3GTO H;  5M3M B;  2HHH L;  3GTL H;  5A2Q E;  5LMN L;  3JAM L;  3MXU A;  4KD4 A;  3J80 L;  5IIF A;  1MI2 A;  2F4I A;  3NEL A;  4IFD G;  4F8M A;  1GD7 A;  1ESR A;  2G9H D;  4A3E H;  1DOL A;  1Y8O B;  4NP5 A;  5FKA C;  1RF2 D;  3PUX A;  4O0A A;  4IO9 A;  4GKK Q;  5EPL A;  3RZO H;  5H1S E;  2UUC L;  1K0S A;  3CD6 A;  1A3V A;  1O7Z A;  3NQT A;  1EY0 A;  2NZH A;  4GLA C;  1I94 Q;  3H15 A;  4ME3 A;  4P72 A;  1FNV A;  3H3V C;  2A74 C;  2E2I B;  1TKW B;  4OO1 G;  3EQL C;  4DV5 Q;  2PYK A;  3E5S A;  3T4A C;  2F0O A;  2RQX A;  2A5H A;  4B9X A;  3P20 A;  2B8G A;  4DV6 L;  1CHP D;  1SNO A;  4KY6 A;  2ICE C;  1E0B A;  4Y7N B;  1HFG A;  1PDQ A;  3OMC A;  5ELE A;  3C1F A;  2ZM6 Q;  1LTT D;  4NPS A;  4V19 0;  3QJY A;  2JA5 H;  2B2V A;  3UDI A;  2BE5 D;  1BO0 A;  1WOC A;  4JOI C;  1YNN D;  3DXJ C;  2V1C C;  3HKS A;  3MFY A;  4HJ5 A;  2PZW A;  1UUP A;  3EJI A;  3D6W A;  3PIO 3;  3NEM A;  1I4H A;  2OT2 A;  4XYQ A;  2EOT A;  2K01 A;  4JI2 L;  2QA4 A;  1STA A;  4BS9 A;  4GNX C;  4LF6 Q;  3NBH A;  5CV8 A;  3E3X A;  2KCC A;  5BN4 A;  1N33 Q;  5IWA Q;  2CCZ A;  4LW1 A;  5E4W C;  4CDC C;  2JA7 B;  1SMY D;  2D0P A;  2F1M A;  4ZCK A;  2ZT9 C;  1I6H B;  1K3R A;  4LF5 L;  5M5Y H;  2O4X A;  1IKL A;  4HJ8 A;  1LTA D;  3H91 A;  4N8X 1;  2PI2 A;  1HFN A;  4M8A A;  3HOV H;  3FP9 A;  1NR4 A;  1HQM C;  4YCU A;  2QW7 A;  2JXM B;  1WTQ A;  2JE6 I;  3MA2 B;  4X6A H;  4QQB X;  4JBK A;  2E2J B;  4GNX B;  1B9N A;  1TII D;  1GO3 E;  1CA5 A;  1A3T A;  4LFC L;  3VYT A;  1XTC D;  1NJI C;  4B3R L;  3S1M H;  1QG7 A;  1YJ9 A;  2WP8 J;  3S14 B;  4L6T B;  3I4N B;  1VQF A;  5GAD C;  2F3V A;  4PNY A;  4DV2 L;  5JPN C;  5M3F H;  2LS0 1;  3H6M A;  5KEE A;  3PCO B;  2F0I A;  1XYI A;  2AWO A;  1S4Z A;  1J8I A;  2PNH A;  3BDO A;  4FP5 D;  4DR4 Q;  1XX8 A;  2NTS A;  2HHH Q;  4C2M H;  2VS1 A;  3K80 C;  2K6A A;  1MSH A;  2KED A;  1HTL D;  5FO8 B;  2X6G A;  3K5M A;  1CSQ A;  1SYD A;  1TXY A;  3PIO A;  2R7Z H;  3I3C A;  3C2P A;  2E2D C;  2KCM A;  3OTO Q;  1KLU D;  2L1B A;  3M3Y B;  2EQS A;  4RH6 A;  2B63 G;  4BBR B;  1S5D D;  3FPU B;  4DV3 L;  1K83 H;  2UUC Q;  4IPG A;  1OXV A;  1VQI A;  5C0X I;  4PZ7 A;  3KLS A;  1KAA A;  4QCL A;  4RGM A;  2F4V L;  2CVR A;  4YY3 Q;  2NUC A;  1QVC A;  3GV3 A;  2F0V A;  4NMZ A;  4XT1 B;  4DV6 Q;  2EYM A;  4JVZ A;  1C7Y A;  1EYD A;  2QEJ C;  1Z7T A;  4OEM B;  3FMC A;  1LTL A;  2SOB A;  1V8Q A;  4BBS B;  2R3Z A;  3OIQ A;  1T5X D;  3M4P A;  1X3Q A;  2EZV A;  2Z9H A;  2R7D A;  4F87 A;  1B3A A;  1YBY A;  4H0L C;  4DV1 L;  4O42 A;  4KY7 A;  3J7A F;  4JI2 Q;  5C5L A;  2I5M X;  5C4J H;  4C3I G;  3S9W A;  2XSC A;  1XPU A;  3S1Q B;  1AE3 A;  1AE2 A;  4G7H C;  3S15 H;  1MIU A;  3PO3 H;  5M5X H;  2AMC B;  4XQJ A;  4JI6 L;  4CDE C;  4ULL A;  1IL8 A;  2JEA I;  1UNS A;  1UEB A;  4LF5 Q;  2XGT A;  3URY A;  3RN5 A;  1B1Z A;  2AHO B;  4BY1 G;  1G6P A;  1Q3L A;  1BF4 A;  3TZD A;  1KC8 C;  4FDB A;  3NQI A;  1HR0 Q;  3PO2 G;  2KCT A;  1DZ1 A;  1D5X C;  3HOW G;  2CHB D;  2DNC A;  1JOO A;  3H0G B;  4G7Z C;  3BS1 A;  3HOU H;  5KYL A;  1Y1W H;  2QDL A;  4LUZ A;  3OW7 A;  3KOJ A;  2B8F A;  2UXB L;  1I4X A;  4OIK A;  1JJ2 A;  5M3M G;  4JBW A;  2X69 A;  4B3R Q;  3NTK A;  4KHP L;  1SAP A;  3S17 B;  5CGK A;  1JQY D;  5DAU A;  4IJL A;  3RLO A;  4LNQ A;  5ELB A;  4JOI A;  4DV2 Q;  1O7I A;  4G7O C;  1L2F A;  2RCN A;  3K0Y A;  1PYW D;  1JE5 A;  4XYO A;  1OTC A;  4GNX A;  2PW7 A;  1F9P A;  5IY0 A;  3QR8 A;  4TVA B;  2NVX H;  2F0Q A;  2K28 A;  5ISR A;  3V05 A;  4MTN A;  4LMQ D;  2KQ3 A;  5EPK A;  2EY5 A;  4EQP A;  4I7A A;  4NXM L;  1E2Z A;  2F0F A;  3VYR A;  5L37 A;  1O7Y A;  4KD3 A;  1AN8 A;  1J6Q A;  3AU7 A;  1S3O A;  1SE8 A;  5LL6 X;  1SFO H;  3MVV A;  2DJF C;  2N55 A;  3DMU A;  3L0O A;  2PI2 E;  1HNW L;  3OWF A;  2WB1 B;  2XTI A;  3O13 A;  1CSP A;  1VQK A;  3E9I A;  1BCP F;  3ULL A;  1JOK A;  1STN A;  1FNU A;  2BH2 A;  2AQ1 B;  1VQJ A;  1QOH A;  2MQH A;  3JC6 6;  4J15 A;  2VUM G;  2K04 A;  5ELO A;  1QVF A;  4H7B A;  3LX0 A;  2PPB C;  2UU9 L;  3ND9 A;  5C0X G;  2VQE L;  2ZJR A;  4JI5 L;  2JA7 G;  1Y69 U;  1XTD A;  4IUV A;  4DV1 Q;  2CFM A;  3I90 A;  5CV5 A;  4WJ3 M;  2HDM A;  3K57 A;  1QNK A;  5IT9 L;  1LAB A;  1K3B C;  3TP8 A;  4QUC A;  4AH6 A;  2R92 H;  2XNA C;  4KJN A;  5C3W A;  1CHQ D;  1U4M A;  4GN5 A;  1YNX A;  1HZB A;  5KRU A;  4ZUJ A;  1T5E A;  3S1N B;  2FJ2 A;  3I91 A;  2B2Y C;  1NR2 A;  3HOZ H;  2EDG A;  1VQO A;  1EWC A;  3RUZ A;  1TWA H;  2XRQ D;  4A3F B;  1D8L A;  4RFB A;  1BR9 A;  3S16 B;  2ZTE A;  4DV7 L;  1XXG A;  2Q8I B;  4MHE A;  2NB0 A;  5FLX E;  3GTJ B;  1NBW A;  1Q8K A;  3TP6 A;  2MNA A;  4TRD A;  1B7Y B;  4OGQ C;  2HDL A;  3KLS X;  1F9S A;  3QB3 A;  5C6A A;  4CJ0 B;  4Z9C B;  1IBM L;  5ELC A;  2UXB Q;  4RKB A;  5C3E B;  5JEA H;  1WD0 A;  3WOE A;  3AB9 A;  2LMC B;  1PZI D;  2I07 B;  2KUM A;  1JOR A;  1JJG A;  1HQR D;  3CCM A;  2C35 B;  1BUV T;  4X64 Q;  1STE A;  2NWG A;  3HOX B;  2NVQ H;  4EQ5 A;  1Y14 B;  1GUW A;  1CZG A;  4YCW A;  4RG1 A;  1WYD A;  1Y1V G;  1YI2 A;  4CDD C;  2KEE A;  1E3P A;  2CH4 A;  5IP9 H;  3TRZ A;  4BBR G;  4KKU A;  2R93 B;  4P74 A;  2UUB L;  3PSI A;  1SYB A;  1YIT A;  3EN2 A;  3HG9 A;  1CKO A;  1FL0 A;  4ZKC B;  2NVT H;  4ZQ3 A;  4NXM Q;  2D2C C;  1HR0 W;  2GVB A;  4BXX G;  4K2K A;  1P8L A;  2B2W C;  1JJC B;  4PMW A;  5F2D A;  1A0I A;  3G4S A;  4BY7 H;  1LTS D;  1HNW Q;  2LY7 A;  4XIG S;  1R4P B;  3GTO B;  1SRU A;  3NEN A;  1DJR D;  3GTL B;  1SRO A;  4DR1 L;  2MUY A;  4ME5 A;  4K0K L;  4A76 A;  1CTM A;  4A3K H;  3MHB A;  3TBI B;  1HZA A;  1N36 Q;  4A3E B;  4ZRZ A;  2A68 D;  1HTP A;  4DNI A;  5J3B A;  3KDF B;  2L9H A;  3K0X A;  4A3D H;  1LT4 D;  1KNA A;  1NY4 A;  1A2T A;  3M4O H;  3MWY W;  3RZO B;  1BVS A;  5ELF A;  4LK1 C;  2PQE A;  4JBM A;  1DCZ A;  4O1N A;  4P2C B;  2VQE Q;  4N8F A;  1VQD A;  3W1G A;  4S3S A;  4DR3 L;  4JI5 Q;  2EY1 A;  1CZW A;  1V43 A;  5C44 G;  2OTL A;  3I4M H;  4A75 A;  5IYD G;  4FF2 A;  4TSS A;  1M4V A;  4A3L H;  2MGS A;  3TSS A;  1Y8N B;  4DR5 Q;  1PYB A;  5FJ8 H;  1BCP D;  2Q8R E;  1SE3 A;  1W3S A;  3F8T A;  3P1H A;  4RWS C;  3UE0 A;  1PH8 A;  3J7Y W;  2F0N A;  4XTC S;  3A5U A;  1Q8I A;  3Q8D A;  4PV1 C;  2MJ8 A;  1XNR Q;  3ER0 A;  3U4V A;  1B8A A;  1NNX A;  1CKN B;  3DUZ A;  1CKM A;  1V9P A;  4EGV A;  3KLW A;  3A7L A;  1F77 A;  3CQZ H;  4DV7 Q;  1K8O A;  4EX5 A;  3CCS A;  1CQV A;  2NN6 H;  3SDZ A;  3TS2 A;  1D5M C;  2K5W A;  3IFD A;  3DEO A;  1JMC A;  2K52 A;  4K8J A;  1EIF A;  4LAA A;  2PMZ B;  2YTY A;  2QKI C;  3BZC A;  5J22 A;  2D0O A;  4DN4 M;  2ZM6 L;  1SMY C;  1VQ7 A;  3T51 B;  3DWP A;  4DXF A;  3R3O A;  3Q6S A;  4HJ7 A;  3RLF A;  3MXP A;  3U58 A;  1CA6 A;  1EQR A;  1TY0 A;  2RVL A;  3CU7 A;  5IYB H;  5M5Y B;  1EYC A;  4QB4 A;  4C3J B;  1QIL A;  1H9K A;  3HOV B;  4PG3 A;  1O80 A;  3U50 C;  4Q5V A;  2MO1 A;  1YNJ C;  1EFW A;  1HUM A;  1II3 A;  5IWA L;  3FRP B;  3IRB A;  3KBX A;  1LTB D;  1R9T B;  4OON A;  3RD4 A;  4IFD H;  3DM1 A;  5DM6 3;  2DGY A;  1TS2 A;  1JR0 D;  3A5Z B;  4ID6 A;  2JA8 B;  2FIN B;  4XXE A;  4PMC A;  5IGB A;  2JYO A;  3QWN A;  3IFT A;  2B2Y A;  3MEF A;  1TQO A;  3D31 A;  4KHV A;  4X3K A;  3GTK B;  2EPB A;  3K5L A;  1X6O A;  2CQA A;  2VW9 A;  1U9R A;  1GHK A;  4HED A;  4C1N K;  5M3F B;  1M90 C;  5COR A;  3F2B A;  3MFG A;  5DEH A;  1C8C A;  4OO1 H;  3CCL A;  3CXC A;  2VXW A;  3S1R H;  3J81 c;  3VA5 A;  4C2M B;  4DR1 Q;  1TWC H;  4K5W A;  4A3C G;  3W3A A;  4KV6 A;  2R7Z B;  1ML0 D;  1W6J A;  5EPJ A;  2F0D A;  4K14 A;  5I2Y A;  1K83 B;  2EXD A;  1SYF A;  1VQ8 A;  1TS4 A;  4JI8 L;  5KNC A;  2O5I C;  1B4O A;  1FNW A;  4DR3 Q;  4J6H A;  1PTO F;  3PIP A;  4DR4 L;  2SNS A;  2BA1 A;  3ULJ A;  3CW2 C;  2HT1 A;  5C4X B;  2IW3 A;  2RDF A;  3I8Z A;  1C0A A;  1EQQ A;  3JAM c;  4A3F G;  3J80 c;  5FOB B;  2QDB A;  4HN7 A;  1BDO A;  3KDF A;  3D4R A;  2KHS A;  1VQN A;  1ROD A;  3OTO L;  4KN7 C;  4A93 B;  1F9R A;  4F7X A;  1X9N A;  2IX0 A;  2K75 A;  2WV6 D;  3HOY G;  4G57 A;  1UAP A;  1A2U A;  3VA7 A;  3G48 A;  2NVY B;  4OX9 L;  2HCC A;  3R2T A;  1EY5 A;  4YY3 L;  4ZUI A;  2B2W A;  1ASZ A;  4L5R C;  2FFK B;  3J80 E;  1X65 A;  1JCK B;  4HTH A;  4NW2 A;  3MAQ A;  1PH1 A;  2K03 A;  1HNX Q;  5NUC A;  1RCV D;  3N52 A;  1BNZ A;  5C4J B;  2LXJ A;  2Z4H A;  3HOX G;  3SEB A;  2E2H H;  4X3T A;  1DD2 A;  3VR2 A;  1HNZ L;  4B9W A;  1X55 A;  5I4D A;  2VB3 X;  1PA6 A;  2JK8 A;  1KHI A;  1X3F A;  4ABN A;  5M5X B;  1LTI D;  2HCI A;  1HA6 A;  2D5D A;  1U4R A;  2Z8L A;  1GXD C;  3F2D A;  1CKN A;  1F2Y A;  4P71 A;  1S5F D;  3SHL A;  1BBU A;  4QUF A;  4R1J A;  3M4Y A;  2WB1 E;  3C3L A;  2RDG A;  4IJH A;  3A56 A;  4YWL A;  3GTG B;  2EYH A;  3A0J A;  1TR5 A;  3HOU B;  1ENA A;  1ET9 A;  2QGQ A;  1E1O A;  1Y1W B;  4FF3 A;  1HHV A;  3AEV A;  1A15 A;  3V96 A;  1EL0 A;  4N9T A;  4RGO S;  4U67 3;  4C56 C;  4EVO A;  2B63 H;  1P16 A;  1STB A;  2CWA A;  1HR0 L;  1KL9 A;  4IUN A;  3A8J E;  3GD7 A;  3C1E A;  1HZC A;  3BVZ A;  2B3G A;  1D1I A;  4EQN A;  5EKI A;  2HIX A;  1YNJ D;  3BU2 A;  3E6Z X;  2PO4 A;  4JBJ A;  4FF4 A;  2TSS A;  4O2D A;  4A3I G;  4NB3 A;  2DY7 A;  1QWY A;  3UDF A;  2NVX B;  3CP0 A;  5J39 A;  2QF7 A;  3K58 A;  1UE6 A;  4C3H G;  1WTR A;  1NTG A;  2ZJQ A;  1JWM D;  1NMF A;  5A35 A;  4DR2 L;  4NKL A;  4X3S A;  1M8A A;  4A3M H;  4R9W A;  1QZH A;  1SFO B;  4JI8 Q;  5D3D A;  2ALY B;  3DEP A;  1G91 A;  2UXD L;  1Q1E A;  3VR6 A;  5CR3 A;  1ZEQ X;  2EE1 A;  4WOR A;  3BG3 A;  1UEA B;  3I70 A;  4C3I H;  1NCV A;  2M00 A;  1AP0 A;  1LT5 D;  2EJG C;  1I50 H;  1NSN S;  2E8G A;  4XQQ A;  1WCM B;  4L5T A;  1U5K A;  3CF5 A;  3H3V I;  1B3Q A;  2A69 D;  3MZ5 A;  3CHB D;  3UE1 A;  3VR3 A;  5TSS A;  4DUY L;  4A4I A;  5JOB A;  3CPF A;  5BR8 L;  5J1Z A;  4CHT B;  2ES2 A;  2JEB I;  2WKD A;  1RHP A;  3GO5 A;  4OX9 Q;  4BY1 H;  2F0L A;  4J1M A;  1LAC A;  2CQO A;  3ITP A;  5D65 A;  1PH4 A;  4HJA A;  4TKO B;  1GUT A;  1H95 A;  3PUZ A;  1YJN A;  3PO2 H;  4C3J G;  1MKH A;  3HFZ B;  1PTO D;  3HOW H;  5IP7 G;  1I3Q H;  1SBB B;  3BZD B;  1HNZ Q;  1CQF A;  1BKB A;  1D7Q A;  1A6X A;  5FLM G;  2A8V A;  4DAV A;  2SNM A;  1TWH H;  1W2B A;  3BDL A;  4JPB W;  2E76 C;  5JPM C;  4YWK A;  3HOZ B;  1H9R A;  3GTP H;  5K36 G;  1F2L A;  2AUK A;  4A3G G;  3I2Z A;  2Z4I A;  2CW0 C;  1IBL L;  2IHE A;  1VS0 A;  3HGB A;  1LTR D;  5BN3 A;  2JA8 G;  3FKI H;  1PH7 A;  2IPK D;  4KN4 C;  1PMR A;  1AEX A;  4GS3 A;  2JA6 B;  2E5L Q;  2VB2 X;  1DGS A;  5LMU L;  1PTO H;  4DNT B;  4K6D A;  2Y0S B;  4IPD A;  2DUD A;  2PQA B;  5EAY A;  3KBG A;  1I4Q A;  2I0Q A;  1PRT F;  4FO2 A;  1CK1 A;  4DKA C;  1O7L A;  4X3U A;  2OWO A;  3OPO A;  2A6H C;  1SNC A;  2R7Z G;  2NVQ B;  3OHX C;  3EBE A;  1EQT A;  5AJ3 L;  4ODG A;  5D3I B;  2OEO A;  2IJ0 A;  5DLQ E;  1VQ4 A;  2P5Z X;  3LWE A;  1RKN A;  2ASB A;  3SVM A;  4LJZ C;  4IUU A;  4B3S L;  3ERS X;  2J7Z A;  2F0E A;  2VUM H;  2WKC A;  4K5X A;  1FGU A;  4JV5 L;  5C4X G;  3RZD H;  3NTH A;  2XN9 C;  4X64 L;  4QIW B;  1EY4 A;  4DR2 Q;  3F1Z A;  1Q1B A;  5C0X H;  1AZP A;  4POG A;  4LUO A;  4ZLT F;  4A93 G;  3RNU A;  1SNQ A;  1BQQ T;  4RAU C;  4YWM A;  1OXU A;  2JA7 H;  4BY7 B;  1JT8 A;  4DAP A;  2UXD Q;  1I6H H;  3QO2 A;  1VQ9 A;  1I6V C;  3PF4 A;  3A54 A;  3TME A;  3S2D H;  1MD2 D;  1VMP A;  1VCI A;  1ONL A;  4RMF A;  2PMZ E;  3W2D A;  2A68 C;  1KTK A;  4A3K B;  1LLR D;  3HRZ C;  2F0J A;  5EBC A;  1JB7 A;  3HP3 A;  1MJC A;  3X3M A;  4A3D B;  2K5H A;  3T53 B;  1JB3 A;  4DUY Q;  3M4O B;  1K9M C;  5BR8 Q;  2E2J H;  4M1U B;  2XWB B;  4JI7 Q;  1XNQ L;  4UP7 A;  4RA8 A;  2ZXP A;  1A62 A;  1EEF D;  3BYY B;  1WVL A;  1H9J A;  1NE3 A;  1SND A;  3I4M B;  1X54 A;  4H13 C;  3RLN A;  4F88 A;  1EWI A;  3BYT B;  1N36 L;  1BCP C;  2ICI A;  2RDH A;  3Q0A A;  3MEH A;  4KY5 A;  2HUG A;  3KK7 A;  2ENB A;  2L15 A;  3NWS A;  3NK9 A;  4HIK A;  2B39 A;  1E24 A;  1OXS C;  4FYD A;  1L0Y B;  1JC7 A;  2BDO A;  4RHS A;  1ICF B;  1N34 L;  3J7Z C;  3KJP A;  4A3B H;  2CH4 W;  4GZY C;  3NTI A;  2EYL A;  3I55 A;  1YHQ A;  2EY2 A;  3Q24 A;  3W5O A;  4HR7 B;  3S2H H;  4AYB B;  1IBL Q;  1VQA A;  4DR7 Q;  3CQZ B;  1QB5 D;  1Y1V H;  3KLR A;  1EEI D;  4CGY B;  4DV0 Q;  1K28 A;  1TS3 A;  1G29 1;  2K5V A;  5IT9 c;  4DR5 L;  5FO7 B;  1TY2 A;  1S40 A;  3QG1 A;  5LMU Q;  1PFS A;  1NAP A;  2KA7 A;  4BWG B;  3TDQ A;  2TMP A;  4JG2 A;  2YTX A;  4IPC A;  4CBV A;  5LMN W;  1BCP B;  2MHV A;  2L0C A;  1STG A;  1SJH D;  1XNR L;  4B3M Q;  2F0U A;  1B50 A;  4LF4 L;  1KXL A;  4BXX H;  4MIU A;  1KD1 C;  5FLX L;  4DUZ L;  4KTA A;  1VMC A;  2CW0 D;  3I4N G;  3A7A B;  3KF8 B;  1MHW C;  5AJ3 Q;  2IWH A;  3UDX A;  3PUW A;  3G71 A;  2JA9 A;  5I6Y A;  1EQV A;  1QZG A;  1D5Z C;  4GLV B;  4E6I A;  3FHW A;  1VQE A;  2PQA A;  4APV A;  4DAY A;  3RN2 A;  4B3S Q;  4N9P A;  5G3L F;  2QCP X;  2KHI A;  2Z6K C;  4OXP A;  1MGS A;  1VQP A;  4JV5 Q;  3NBI A;  2A6E C;  2JSO A;  1HCZ A;  4HIO A;  2B29 A;  4Y52 H;  1G6Z A;  1GKH A;  1PRT D;  2ZJP A;  3F2U A;  3VR5 A;  2A6H D;  5M5W B;  3GTM B;  1WCM G;  1Z9F A;  4X66 Q;  4YHH Q;  3K7A H;  2C9O A;  3OIP A;  4DPG A;  5HUR A;  3GTQ H;  1PFB A;  1STH A;  4IZ8 A;  5C44 H;  1B2T A;  3KF6 A;  2NZ1 D;  4NXN L;  1PH5 A;  2EIF A;  4IN3 A;  3TP7 A;  3B6Y A;  1TWC B;  1FGB D;  5GAH C;  1VQC A;  2O2L D;  3NWT A;  5FO9 B;  2KCN A;  3L3O C;  2OCE A;  2NBF A;  4KJO A;  5CMD A;  1EUJ A;  1PFN A;  4XDX A;  3I72 A;  2F0W A;  3I73 A;  3WDN A;  1QNU A;  3KUP A;  4R4Q A;  4A3J H;  2Z1C A;  5EGT A;  1ILP A;  1XNQ Q;  1AFP A;  2VZA A;  1HA5 A;  4BBS G;  3VYU A;  5C4Z A;  1GOZ A;  5GQO A;  2J4X A;  4IUQ A;  1BOS A;  4JYA L;  2AUJ D;  3HOZ G;  1XJV A;  1FJG Q;  4LF7 L;  4I65 A;  2YU9 H;  1EIY B;  4WJW A;  4IUP A;  1IZ6 A;  2BDN A;  1RDP D;  2Q8T A;  2JA6 G;  2XVS A;  1ZXT A;  2HD3 A;  5JEA J;  4GLX A;  1N34 Q;  1WTO A;  1EY9 A;  1KQS A;  4QL5 A;  1FVI A;  4IOA A;  1CFM A;  4DA2 A;  3I56 A;  4RGN A;  2JN4 A;  2RCF A;  5IGD A;  5JEA G;  3R2I A;  4UPA A;  3BVG A;  4QF4 A;  2F3I A;  2E2H B;  1IXR A;  2H1E A;  5JJK A;  3H0G G;  2JP1 A;  3D3R A;  2JA5 B;  2ATW A;  4H44 C;  1ICW A;  3E0J A;  4LF4 Q;  2RKS A;  1IYJ B;  2XIW A;  2KEN A;  1V1P A;  2LSS A;  1HNX L;  4DUZ Q;  2BOS A;  2UUA L;  1TWG H;  3D4W A;  2JQO A;  2M9V A;  2Q2U A;  1E2W A;  2H4O A;  1OXT A;  4ZK9 B;  1PH2 A;  5EBD A;  1QVG A;  4IUT A;  2F0H A;  3UDG A;  3WOF A;  4A3C H;  1LT3 D;  1VDZ A;  2QIL A;  4RKL A;  5IGG A;  3M7N A;  1SNM A;  2L11 A;  5IGC A;  2CWP A;  2HQE A;  3CCQ A;  4GOP C;  4HCS A;  2B63 B;  4FNF A;  2F0S A;  3SXH A;  3KF8 A;  1EIH A;  1PH6 A;  4P73 A;  4CKB A;  4JI0 Q;  5CC4 A;  1SYE A;  3PGZ A;  4QJF A;  4DV4 L;  3N6R A;  4DK6 C;  3DWA A;  4KI0 A;  3PMF A;  3FVQ A;  2IX1 A;  4NXN Q;  5DNF A;  1A3U A;  2WB1 G;  3M7G A;  2Q2I A;  4A3F H;  3NP8 A;  3I4M G;  3VDY A;  5JJZ A;  3S1M B;  3GTJ H;  2A6E D;  5G3L D;  4IOC A;  3HOY H;  1G51 A;  2RBM A;  1Q86 C;  2IL8 A;  4FXD A;  3L7Z C;  1I4P A;  1NMG A;  1AW7 A;  4DU9 A;  4A3M B;  4KMU C;  4GOP B;  5HGT A;  5KNB A;  1YHB A;  4IUR A;  3GP7 A;  3K6O A;  4DK1 A;  5ELD A;  4JYA Q;  1VQG A;  1V1Q A;  4UP8 A;  4OL7 A;  1EU4 A;  4LF7 Q;  2K4K A;  2L12 A;  4C3I B;  2Y0S E;  1TWF H;  1RTN A;  3HOX H;  4AYB G;  3K5N A;  1I50 B;  4B3T L;  2A69 C;  4LUV A;  3HKZ B;  1I5F A;  5I2X A;  1K0R A;  1NUC A;  1U4P A;  3BDC A;  3BZK A;  4JW0 A;  4HJ9 A;  2DN8 A;  2IY5 B;  1K8M A;  2Z6K A;  3AFQ A;  3C46 A;  1Q12 A;  3K5O A;  4OEL B;  3EVQ A;  3T56 B;  3J81 E;  2F0M A;  4L5Q A;  1O78 A;  2G9D A;  2LXK A;  4BY1 B;  1U0L A;  4PMB A;  4GKJ L;  5A2Q L;  2X6L A;  4HSP A;  5HY6 A;  1QUQ B;  1XMQ L;  1KAW A;  1PTO C;  2OQ0 A;  3IKJ A;  1RIP A;  1BXT A;  5GRO A;  3DLL A;  1CM9 A;  1JWS D;  2E74 C;  3Q23 A;  1SEB D;  2L4N A;  5ELN A;  4GN4 B;  4DAM A;  2JJQ A;  2PNR C;  4IFD J;  1TWH B;  2DNE A;  4QIW E;  1I4G A;  3CC7 A;  2ID0 A;  5C3E G;  3ZJY C;  3GTP B;  3JAM E;  4PQX A;  1S5E D;  1GJX A;  3PUV A;  2EYF A;  4HIM A;  4KKS A;  1L0W A;  2LKV A;  4BA2 I;  5CV9 A;  1ZYR D;  3FKI B;  2UUA Q;  1ILQ A;  5AFW A;  3S15 B;  3PO3 B;  5IGF A;  1PTO B;  3CRK C;  4RGT A;  5E3F A;  2AQ3 B;  3DWQ A;  4A3I H;  5C5M A;  2SDF A;  3A8I E;  3MTS A;  4FXG C;  2R93 G;  5CBA E;  2L5T A;  4J8Q A;  1WTV A;  3GV6 A;  1PYS B;  2K5Q A;  2ZTD A;  4C3H H;  1EY8 A;  2AKW B;  2K5D A;  3E0E A;  4R4O A;  1IYU A;  3S24 A;  5I6W A;  3SK6 A;  4L5S A;  1SXT A;  3TN2 A;  3HZX A;  3K7U C;  4JI1 Q;  2E5L L;  2RF4 A;  2PCF B;  5IYC G;  3CCR A;  4DV4 Q;  2EY6 A;  2RSN A;  2Z0S A;  3SK4 A;  4X62 L;  3A8K E;  1X32 A;  4IAL A;  1L1O C;  4JK1 C;  1M1K C;  2EYO A;  3J7A V;  3WWV A;  1YJW A;  1D2B A;  1G2T A;  2F3W A;  2NYZ D;  2VUM B;  2K7V A;  2OF1 A;  2K14 A;  2V4D A;  3RZD B;  3FEW X;  4CJ2 C;  3TQY A;  5D14 A;  4DNR B;  3CC4 A;  3I4O A;  4A3E G;  1WTW A;  1RTO A;  4RCN A;  1AH9 A;  2DY8 A;  3LNN A;  3ERO A;  1IBK L;  2A73 B;  2A19 A;  1HPC A;  1LYL A;  3SR1 A;  4LFB L;  4ZYS A;  4AYB E;  4LWC A;  1Q90 A;  1T9H A;  1XPO A;  4UAI A;  4JCV E;  5JJI A;  3S2D B;  1H9S B;  3NXW A;  4C3J H;  1WTH A;  2MP1 A;  2WIN B;  5HGQ A;  5IP7 H;  4IPH A;  1QE6 A;  1IYV A;  3KJO A;  3ICE A;  4B3T Q;  1L1O B;  5FLM H;  4DF7 A;  3M9B A;  4WFN 3;  2B2U C;  1Q81 C;  5IGE A;  2QEX A;  1PZK D;  1JWU D;  1D1K A;  3OWE B;  4GOP A;  1R9T H;  1E2V A;  5K36 H;  4JI3 L;  1QCB D;  1YHA A;  2F0K A;  3K81 C;  5LL6 S;  1KIX A;  2YTV A;  4GKJ Q;  2O5J C;  4A3G H;  4QGU A;  5CV6 A;  2JA5 G;  1LV9 A;  5T1I A;  2JA8 H;  1XMQ Q;  1TU2 B;  5T1G A;  3L9A X;  4R8I A;  3SK5 A;  4UY8 C;  1JE4 A;  4LF9 L;  1EOT A;  2CKZ B;  4MNO A;  1ENC A;  3GTK H;  2GVA A;  2K5N A;  4UDU C;  1SYG A;  1HUN A;  1IL2 A;  4OHJ A;  2GA4 B;  4HAE A;  4JI7 L;  2XRS D;  1UWV A;  4A3B B;  5LMN Q;  1OO9 B;  2KJX A;  3RR5 A;  3TEH B;  2F0G A;  4DXG A;  1QUQ A;  2VL6 A;  5I9O A;  3S2H B;  3U9S A;  1LM0 A;  1DOK A;  2IHF A;  4K2L A;  1STY A;  1Y1V B;  3NPP A;  4LF8 L;  4YIJ A;  3RMH A;  4FXK C;  1N32 L;  2I46 A;  2R92 B;  1EY7 A;  2PZU A;  3HOV G;  1Q7Y C;  1GUG A;  3AQQ A;  3AYH B;  2R7F A;  1K73 C;  1IW7 D;  1CT1 D;  5M3M H;  4H02 A;  2MO0 A;  4MN3 A;  3UI2 A;  1FR3 A;  3A55 A;  2IX3 A;  2K33 A;  5C4X H;  1EOV A;  1TWA B;  1B53 A;  1SJE D;  4L63 B;  4DR7 L;  2K05 A;  3Q22 A;  5GAG C;  4A93 H;  3AFP A;  5KIX A;  1PH9 A;  4HSV A;  4DV0 L;  4JI4 L;  2BA0 A;  4G4K A;  3OSO A;  4EQO A;  4X62 Q;  4HMJ A;  2NVY H;  5M3F G;  4A3M G;  2E2I H;  2GN5 A;  4DAY B;  3CPW A;  2N78 A;  5I9P A;  4B3M L;  4XQN A;  1A63 A;  4CJ1 B;  2EJF C;  1F2Z A;  3F2C A;  1PRT C;  1UE5 A;  4ZKB B;  1YIJ A;  5JJL A;  1SNP A;  4Y7N H;  1BBX C;  3EIV A;  5LHY 1;  1IBK Q;  1N8R C;  3HKZ G;  3H94 A;  3K7A B;  4LFB Q;  1N9W A;  1S5C D;  3GTQ B;  1QJO A;  1KAB A;  4LFA L;  3K59 A;  1IHZ A;  1WJJ A;  5C44 B;  3KF6 B;  2BH8 A;  4ALP A;  5K5P A;  3TRE A;  2WAQ B;  4PZ6 A;  1UE1 A;  3I7F A;  2YYZ A;  5KYI A;  2NZO A;  4RHR A;  3R8B A;  2NVT B;  1Y8P B;  3H3V H;  1PH3 A;  2MPM A;  2LFN A;  1ZKO A;  2N3S A;  3GTG H;  2VQF L;  5JVG 3;  3ERQ A;  1X56 A;  4X66 L;  3G6J B;  3TZU A;  4YHH L;  2KHJ A;  1PRT B;  2RSO A;  4CDF C;  2FMM A;  1VF5 C;  3GQB A;  4A3J B;  3A74 A;  5KGU A;  1WTX A;  3T13 A;  1WTP A;  4JI3 Q;  2ZXO A;  4FF1 A;  3P75 A;  4UP9 A;  1X3E A;  4TQU S;  4U68 A;  4LFC Q;  2VNU D;  4DR6 L;  1H9S A;  3MXG A;  3CC2 A;  1ESF A;  3IAY A;  4LF9 Q;  4L8J A;  4XT3 B;  1L1O A;  3H09 A;  1OXX K;  2YU9 B;  1X3G A;  1J5E L;  3FKI G;  3QIA A;  1LO5 D;  2RA4 A;  3T1Y L;  2OQK A;  3IL8 A;  3PO3 G;  3PF5 A;  4CKC A;  4K6L A;  3SGI A;  1GHJ A; 
#chains in the Genus database with same CATH homology
 2QW7 A;  4N8X 1;  2Z9H A;  5L37 A;  4JVZ A;  2HD3 A;  2RCF A;  4N8F A;  4I7A A;  4JW0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...