4I7AA

Grpn pentameric microcompartment shell protein from rhodospirillum rubrum
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
88
structure length
84
Chain Sequence
MYLGKVIGTVVSTSKNESLSGTKLLVVARLTEKLIPDGSTQVVVDTVGAGNGEIVIVSCGSSARQSHSVIDAAVVGIVDTVETV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Bacterial microcompartment shells of diverse functional types possess pentameric vertex proteins.
pubmed doi rcsb
source organism Rhodospirillum rubrum
molecule tags Structural protein
molecule keywords Ethanolamine utilization protein EutN/carboxysome structural
total genus 12
structure length 84
sequence length 88
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2012-11-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.220 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) EutN/Ccml 4i7aA00
2HD3A 2QW7A 5L37A 2Z9HA 4I7AA 4N8FA 4JW0A 2RCFA 4JVZA 4N8X1
chains in the Genus database with same CATH superfamily
1IBMQ 1IBKL 1A62A 3E0EA 1N34Q 4A76A 1CA5A 4A3IB 3K81C 3OHXC 2A6EC 1RF2D 2K01A 3VYUA 3V05A 1TS2A 1HXYD 1JCKB 2A6HD 4KMUC 1IBKQ 3G7LA 5T1IA 2EJGC 1SYEA 4J1MA 3NBHA 1A3TA 4G7ZC 1MKHA 5I6YA 5IYBG 4X65Q 3QR8A 1IKLA 2VUMH 4GNXC 1DOLA 4R4OA 4LFCL 3Q22A 1KXLA 3PIP3 1KLUD 2JA5H 2YTYA 1PFSA 3KJPA 4X3SA 4WRDA 5H1SE 4CDFC 1KD1C 4POFA 3FMCA 5TSSA 4IFDG 2AUJD 5HGTA 1PMRA 2ICEC 4JI0L 3GTLB 4JI8Q 4DAYA 1UE5A 4CJ1B 2AQ2B 4LFBL 3KOJA 4XIGS 3J81E 1E3PA 1EOVA 3L3OC 3OPOA 2H1EA 5CR3A 1D1IA 1Y1WG 4LNQA 2NVYB 1U0LA 2ZXPA 3A56A 3H3VI 1MGSA 1EQVA 4IPGA 5CV5A 5CYUA 3SDZA 4OONA 4KHPL 3FRPB 1UWVA 5JJKA 1Z7TA 2QEXA 1C48A 4JV5Q 1V1PA 1O80A 1D2BA 1WOCA 1AE3A 1Q46A 5LL6S 1CT1D 4H0LC 1O7YA 1EWIA 1ILQA 3S1QH 3BDCA 4YHHL 2A6ED 3Q23A 1HUMA 4P2CB 3SHLA 1PTOD 1WTPA 3VA7A 2F4VL 1PYSB 4DV4Q 2F0UA 5AJ3L 5KEEA 2QW7A 1LUZA 3K0XA 1LT5D 4YHHQ 3AB9A 1SNDA 5GAHC 1MI2A 2QKIC 2BH8A 4DK3C 4RAUC 3NELA 4BBSH 1J5EL 3FKIH 2KUMA 4OL7A 4LFCQ 2HDMA 4LF7Q 1KTKA 4C3HG 2UXCL 4FXGC 4NKLA 1CHQD 4ILWA 1I4GA 1CFMA 2RA4A 2DY7A 1M1KC 1K0SA 4Q5VA 4ME5A 2I5LX 1JOOA 5LMUL 1I4XA 1MJEA 2BA0A 1G8ZD 1L2FA 2L15A 4LUZA 2EY1A 2LKVA 5C4XG 1W2BA 1U4MA 4CHTB 4A3GB 4X3KA 1I4HA 3CMAA 2JA8B 1V1QA 3KBXA 4OO1H 3F8TA 1PLFA 3KUPA 5JJIA 2PO4A 5IT9L 4HJ5A 5M3FB 3MC0B 3GTMH 4GNXA 5C4XH 2B2WC 5BN5A 1S5FD 4DV3Q 1VQ4A 5LMNL 3DWPA 3L0OA 4POGA 2YTXA 3PO3G 4ABNA 2K4KA 5T1GA 3A7AB 4TRDA 1HQRD 1JJ2A 4QF4A 4DN4M 3VR3A 3C2PA 4DR7L 3BZKA 3CCQA 5CBEE 4DV5L 2LSSA 3PUYA 3HOYH 1I50B 4JBWA 4LFAL 1UUPA 3IAYA 3UE1A 3RZDB 3KDFA 3RN2A 2WV6D 3AMUA 4KY5A 2EIFA 4OGQC 1EY5A 1VQIA 2A68C 1HZBA 3HKSA 4OWWB 1SNOA 1YVCA 1U4RA 3E3XA 4A3MB 4DR6Q 4A93B 4IPHA 4Y7NB 4E6IA 3VDYA 1I4QA 4A3KB 2F3WA 5F2DA 3QOJA 4PG3A 4CDCC 3VR4A 1IBLQ 3BZCA 3JAMi 1N9WA 3QIAA 3RLOA 1SN8A 4ULLA 4JI2Q 1VQGA 4R8NA 3CD6A 1U4PA 4OX9L 1PZKD 3K59A 5C0XH 5EKLA 2EJFC 4U68A 3HFZB 4XQQA 3HOUG 1HH2P 1EY0A 1LT3D 1EZ6A 3TDQA 2E2IB 2KCNA 2K7VA 1B70B 3LWEA 4C3HH 1B50A 3K7UC 2NVTH 2BDNA 1X3QA 3FEWX 5EBCA 2K03A 3CAMA 4QJFA 3GQBA 3U9OA 4XQNA 1SMYC 1N8RC 4BBSG 4WFN3 2E2IH 2V4DA 2J7ZA 3T4AC 1WTQA 5NUCA 4ZLTF 1STAA 1CUKA 3GTGB 2MO0A 4N9TA 5CV6A 5BR8L 3CPWA 2UU9Q 2ASBA 3S14H 1QILA 3GD7A 1I3QH 3J81i 1L0XB 1HNXQ 2IY5B 3TBIB 1RODA 2WB1B 2E75C 1Q81C 5JEAJ 1GUNA 4K14A 2KBNA 4Y7NH 4LF9Q 1NUCA 1C0AA 4KKUA 4BY7H 1TVXA 3MXUA 3R3OA 1QUQA 3DEOA 1EY8A 3S1RH 1JE4A 4LFAQ 2DJFC 3GTPH 1QVFA 1DOMA 1LTRD 1TWGB 4JI4L 1PVOA 1Q82C 1KRSA 2JJQA 1KABA 1EYGA 4JBKA 2Z6KC 1SYBA 4LWCA 4KKTA 4L8JA 1IKMA 1BNZA 3K5MA 5J39A 1VQ5A 3TS2A 5FLXL 4IFDI 1LACA 2B2WA 1FGUA 1JJCB 1SMXA 2HQEA 2K5QA 3ND9A 1K83B 2CQAA 3TMEA 4RCOA 5LMUQ 1R9TB 3HOXB 2JA5G 4A4IA 5A2QE 2R93G 1U4LA 2EXDA 2ZTCA 4ALPA 1EWHA 1F2YA 4KKSA 4HJ9A 2NVQH 2VUMG 1PH1A 2NWGA 1Y1VH 4K2KA 3GTJB 3DWAA 4K0KL 1ENAA 2E5LL 2B2VC 3MHBA 3TZDA 4V190 5C3EB 1IHZA 2R7ZB 1A15A 1QG7A 4L63B 4I7AA 4HIKA 3HOZB 4IUUA 1NR4A 3V2TA 1OXVA 4DV7Q 2V1CC 1LTSD 5L37A 2AQ1B 2RSNA 5COYA 5JEAG 1ZXTA 4DFAA 4X64L 2OTLA 5CORA 4UP7A 4DAVA 4K6DA 2IX1A 1CI3M 3EIVA 2MQHA 1O78A 4RGNA 1HRJA 4DAYB 2PMZB 2RQXA 1PH5A 1KHIA 1CQVA 3I72A 1K28A 1XPOA 1RHPA 1B4OA 3HOUH 4NDXA 3HOXG 1EIHA 1TWAB 3W1BA 3K8AA 4LF5Q 1NTGA 2F0PA 2JA6B 2F0SA 4KN4C 1LV9A 4K5WA 4C3JH 1NJIC 1PRTB 4V0BA 2N8NA 1K8OA 1HA6A 4JI8L 1BDOA 1AN8A 3FVQA 3JAME 3KBGA 4JC0A 2NVQB 3CC4A 1N32Q 1E2WA 4AQYQ 4RWSC 1W6JA 2WAQB 3TN2A 3WOEA 4XQJA 1RTNA 5JVG3 4PZ8A 2F0MA 4DR4Q 1K0RA 4IJLA 2DGYA 1Z47A 4B3ML 3CCUA 3DM3A 1TWFH 4KD3A 4QL5A 1DYQA 3TP8A 2ZXRA 2CWAA 5FJ8G 1F77A 3OSOA 2YV5A 1G6PA 1Q8KA 1HR0L 3MXNB 1GKHA 4AIMA 1TWHH 2B2YC 4C3IH 3J80E 3OW7A 3NE5B 1HNWL 2JEBI 4BA2I 1X3FA 4CKCA 4L5QA 3DWQA 2DJGC 2CH4W 4H13C 3U50C 3PO3H 3R8BA 1PTOH 1Q1EA 2EY6A 3D31A 4K0KQ 5M5YH 3SR1A 3I70A 4QUFA 5I9OA 1SE8A 2PQEA 2YYZA 2UXDQ 5KYLA 3KK7A 4J15A 1QZGA 4A3JH 2F0NA 1HPCA 4IUTA 3FHWA 3S14B 2N49A 4IJHA 1YHAA 1STNA 3ERSX 2SNMA 4JI3L 2UXBL 4JG2A 4A3KH 3MAQA 1VMCA 2A69C 3U4VA 3TP6A 4R1JA 2F52A 3J80L 1EQQA 1PH7A 3MZ5A 3PO2G 2DN8A 3CC2A 5I4DA 4DR2L 1N36Q 5FK9C 1PV4A 4JI4Q 4UDUC 1WCMB 3FKIG 4MTKA 1P8LA 2BOSA 2K1BA 3K7AB 1CA6A 1H9JA 4IURA 4APVA 3HGBA 1KAWA 1I4PA 1BCPD 4FF4A 2RDHA 3EFXD 4DUZQ 1K9MC 1SYDA 1ONLA 5E3FA 1Q12A 4DXGA 3I8ZA 4BY1B 1CSPA 1SAPA 3I4MG 3S15B 3M4OB 1K83H 5DM63 4L5TA 2UUBL 1PZID 3SK6A 3S1MB 4LF8Q 1LYLA 3VR2A 2HD3A 1PH3A 3RMHA 3NXWA 2JYOA 1G6ZA 1OTCA 1VQ6A 5IOCA 3TP5A 3BVMA 4BS9A 4F87A 3S1MH 1ESRA 3LX0A 1DJRD 1RL2A 2A68D 2MJ8A 4JBMA 2Q2UA 4OELB 2AHOB 2UUCL 2X6GA 2EJMA 4DV4L 2WAQG 4DV0L 4G4KA 2K33A 2NN6G 3CRKC 2JP1A 1EZ8A 1NNXA 5E4XA 1QCBD 3MXPA 4IO9A 5C44B 5EPKA 2C35B 4OX9Q 2HDLA 1X3PA 1LABA 4DAPA 1XNRL 3QG1A 3GTKH 5EGTA 2PZTA 5LHY1 4RHSA 3EROA 2BA1A 3VR6A 1GUOA 1Q3LA 1WVLA 3I3CA 3DMUA 4EX5A 3P1HA 3PCOB 4A3MG 1K8MA 2A19A 3S2DH 4X6AH 1KNEA 3HOWH 1WYDA 1IW7D 3NWTA 1II3A 1ZKOA 4N8X1 1VQKA 4PV1C 4A3KG 1Q7YC 5FLMG 3I4MB 1SR3A 2F3IA 2LFNA 1KL9A 4C2MB 2XWJB 3D4RA 1CQFA 2EQSA 3KF8A 1V1PB 4PNYA 1GO3E 4JI6Q 1EY9A 5FOBB 2KEDA 4A3DH 4EVOA 4F7XA 1A8VA 5IYCG 3HOZH 5DM73 3T1HQ 1KRTA 3ZYYX 1N36L 4DXFA 3HS0C 4X62L 1K3BC 1PRTD 4DR7Q 4RHRA 1WI5A 2B8GA 1T5EA 5CC4A 2VL6A 2PNHA 4RH6A 2X6LA 1UE1A 1KLGD 1RJTA 2IPKD 4DR1Q 1CZGA 4HTHA 1S5BD 1X54A 1XYIA 2RCFA 1HR0Q 1HFNA 2WP8J 5A35A 5IT9c 1VQOA 4KJOA 3KF6A 2K52A 1SJHD 3S1RB 3CPFA 3ER0A 3QJYA 4JBJA 1E22A 5HGQA 2B2TC 2BDOA 4GLAC 4DUYL 4JI3Q 3PUWA 1RKNA 2EYFA 1VS0A 1A2UA 1L1OA 4DNRB 1MSHA 4H02A 1JICA 4RKLA 3K58A 1HNZL 3D3RA 2QA4A 3PO2B 1EQTA 1GUTA 1R9TH 1EYDA 4DA2A 5C4XB 4X66Q 5IT9E 5IGEA 1J5EQ 1NSNS 2Z1CA 1I6HB 4HIMA 4N9PA 1EIGA 2EOTA 3KF8B 2JA8H 4NXNL 1VQJA 1FJGQ 2ZJPA 1VQHA 2QILA 1OXXK 3SEBA 1MBYA 1DM0B 3SK8A 3CCJA 1SYCA 2L9HA 4M8AA 1PH6A 2O4XA 1YNJD 3OWFA 2OEOA 1B7YB 2UUAQ 3SVMA 2NZOA 1TWAH 3RD4A 4XT1B 1VDZA 1Y1WB 1BBXC 4LF4L 3MEFA 3FKIB 1EWCA 2KJXA 4QB4A 1YIJA 1BBWA 1C4QA 2VXWA 4OWTB 2ZXOA 1ICFB 1VQCA 2E5LQ 2MGSA 5FLMH 4HIOA 1ASZA 1AH9A 1PFMA 1A6XA 2EYOA 2R7ZH 5C3WA 2Q2HA 3SXHA 1F2MA 1BO0A 1YNND 4A3MH 4Z9CB 3UDGA 3DM1A 4BXXG 3MA2B 1X65A 5G3LF 5KNBA 5C44G 1L0WA 2CQOA 2Z6BA 1K73C 5EKKA 4JI0Q 5CV4A 5C4JH 2NVTB 1YI2A 3AEVA 2K04A 3OTOL 4FNFA 2KCCA 2Y0SG 1F2ZA 2R7DA 1Y8OB 2ZTDA 1YJNA 5IYCH 2XVSA 1W6KA 2PW7A 1Q90A 3TQYA 4A3CG 3D6CA 1JOQA 1E2ZA 2H4OA 3T16A 3RLFA 3CF5A 1YNJC 2HIVA 1SMYD 4ZYSA 1M4VA 3HKZG 4IOCA 2XN9C 1S5DD 2PPBC 3CQZB 5IWAQ 2B2TA 1WD1A 3ULLA 3CCLA 3TP7A 1N33Q 1QZHA 1LT6D 4MN3A 1EIYB 3HOWG 1JE5A 4HAEA 2ZJRA 2VY3A 2BH2A 3I4MH 3CHBD 1A0IA 4HR7B 3DXJC 2HQLA 1DCZA 3T1YQ 1SEBD 2OQKA 1BQQT 2E8GA 1SBBB 2VW9A 1FYCA 3MFYA 4DF7A 3PUXA 5IGCA 2MP1A 3M4YA 3GTQH 1GVPA 1XNQL 4B3RQ 4IQZA 2ES2A 2I46A 4JVZA 4FVMA 1WD0A 4C3HB 2MNAA 5AFWA 2QDBA 1S4ZA 2B2UC 1I3QB 1KDCA 3T53B 1B53A 1ET6A 5ELDA 1QNUA 2FFKB 4LF7L 3S9WA 1S5CD 4O42A 4PMCA 1TS3A 3OMCA 2JA9A 1A2TA 3T56B 4A3JG 1STHA 2BE5D 2Z4HA 3AFQA 1BKBA 1I94L 1TIID 4CJ2C 2ID0A 2LMCB 1CK1A 1LTTD 3PF4A 3PMFA 2FXQA 1XMOL 2CHBD 2AMCB 1BF4A 1PXUA 4BBRG 2I5HA 4YCVA 2F0KA 2AKWB 3ULJA 1ESFA 2BCOA 3B6YA 3SK5A 4GN4B 4S3SA 2RSOA 5C44H 2VQFQ 5JPNC 3VYRA 1IBLL 2JXMB 1BCPB 3NQIA 4JI5Q 1VQFA 5D3IB 1PH8A 2K5VA 4LMQD 3J81c 3NUCA 4KHPQ 1MJCA 4B3MQ 1JWSD 1OXTA 4FXKC 1WTOA 4GNXB 1P16A 2ZJQA 5CGKA 1SXTA 1SNQA 4GS3A 1U9RA 1F9RA 1DONA 2J0TD 3GTLH 2WB1E 4X3UA 3K80C 1BVSA 3FPUB 1RIPA 1NMGA 1CKNA 3L2PA 3GTGH 4NP5A 1CM9A 2O2LD 2B2VA 1E0BA 4DV5Q 2D0PA 3EVQA 3L9AX 1AW7A 3P75A 5C6AA 1I4RA 3HOWB 4A3GH 3CCMA 2Z6KA 3LGJA 4G7HC 4C3IG 3N52A 1TWFB 3E6ZX 2N78A 3NK9A 3DUZA 1IYVA 2PYKA 4PZ7A 5JOBA 1XJVA 1BR9A 3NBHB 4GN3B 4B08A 1E1TA 3X3MA 5GROA 2I5MX 4LF6L 4A93G 2EY5A 4MIUA 4DV1Q 3LWUA 4LJZC 4DV2L 4OIJA 4ZKCB 2VQEQ 3S2HB 1X6OA 2D5DA 1GUGA 4A3IG 5EPLA 1B44D 1TWGH 1PYBA 4CDDC 2IWHA 5M3MB 1HNZQ 1J6QA 2D2CC 1NCVA 2B63B 4P75A 2WIIB 3DEPA 4DR4L 2R93B 1UNSA 4MTNA 2K5HA 2IX0A 1LM0A 3M85A 1X3EA 1QVGA 4JV5L 2Q2TA 3CKIB 2R93H 3I2ZA 2BE5C 1CZWA 5IGFA 4B9WA 5IGGA 2HCCA 1XTCD 3J7AF 4WJ3M 2PI2A 2Z8LA 2Z0SA 4DGZA 2UUAL 1X55A 4GKJQ 3E9IA 4KD4A 1CKNB 2CVRA 2KHSA 2EXZA 1PA6A 4JOIA 1EIFA 2A69D 4YWKA 4FDBA 2G5DA 3HEJA 4MNOA 4UPAA 1PFBA 5C4JB 2B2YA 2EYMA 4TSSA 1IYJB 3HKZB 5ELCA 2QF7A 3S1NB 5IP7H 1YHBA 1ASYA 2DNEA 4H7BA 5M5YB 4ZRZA 3A54A 2K28A 3M4QA 2IW3A 4DU9A 1TR5A 3CCVA 1G51A 3HKZE 1K8AC 2EPBA 4K2LA 4LK1C 1SDFA 3S15H 3M4OH 5M5XB 5EBDA 2QDLA 4NXNQ 2PCFB 3PSIA 3PO3B 1D6EC 4UHVA 1GM5A 4QMGA 3RNUA 3BU2A 1QB5D 1LTGD 3VA5A 4X66L 5IP7G 1SNPA 4L5RC 4LFBQ 1GJXA 3NTIA 2QCPX 1EFWA 1QOHA 1WJJA 2MFIA 1ML0D 4DR3L 2L55A 2L12A 1VQAA 1DOKA 1JB7A 3C46A 2R61A 4DV0Q 1B2TA 1B3QA 1B9MA 2LY7A 2K50A 3F2UA 2D62A 1EFID 3NEMA 4KV6A 4UAIA 2ICIA 1GHJA 3E5SA 4A3FG 3D4DA 3M3YB 4BY7G 2F0LA 2G9HD 4A3EH 4G7OC 3HP3A 3EJIA 1EL0A 3H3VC 2C5CA 3S16H 1X9NA 3T13A 1IBML 2B63G 1A63A 4IUNA 3KLSA 3IL8A 1C9OA 3TZUA 4RG1A 4BBRB 2OXPA 3S16B 3I4OA 1IZ6A 2SDFA 4KN7C 4G57A 2DUDA 3D8GA 4I7ZC 5C5LA 2OWOA 1KDBA 1B3AA 2PI2E 2FMMA 1FD7D 3ITPA 2JA7H 3OIPA 4B3TL 4C1NK 5M9OA 2MHVA 1SSOA 3G71A 2A1AA 2XRQD 1JJGA 1CKMA 1ZYRC 2IHFA 4HJ8A 5CMDA 2E2HB 4WJ4A 3UDFA 2F0VA 3KLSX 3CW2C 4K5XA 2NBFA 4EQNA 5C0XG 2CCZA 2K05A 3J81j 2F0DA 2VZAA 4A3GG 4AYBB 3OIQA 4QY7A 5GAGC 4XTCS 1U5KA 5GADC 3BDOA 4Y52H 1UE6A 4OIKA 5J3BA 3QOLA 4FF2A 2R92B 1VF7A 1HZCA 2WFWA 4HN7A 2EY2A 5J22A 2HCIA 2R6GA 3GO5A 2RHQB 3I90A 3BYYB 1VQEA 1JC7A 3OYYA 3RUZA 4JK1C 3H09A 1QWYA 4IZ8A 2NTSA 3J80i 4B3SQ 3MEHA 4C3JB 5IIFA 1HNWQ 2I0QA 2NZ1D 4LF4Q 4FF1A 1HR0W 1WTRA 4JYAL 5G3LD 3OW2A 2TMPA 3J7AV 5FJ8H 5E7NA 3CC7A 4XDXA 3MXNA 5D14A 4TVAB 4GKKQ 4IPDA 3NSWA 3A74A 4H44C 1TKWB 1XNQQ 2O5IC 4B3RL 1MHWC 1V9PA 4BY1G 2EE1A 3RLNA 4OO1I 1HQMC 5CV7A 2F1MA 5C4HA 4DV2Q 2WKCA 1A3UA 1VQ7A 2B3GA 2Y0SE 2B63H 3HOVB 1EEID 1X32A 4GLVB 4K8IA 3IRBA 5EQ0A 4ZKBB 1IXRA 1S3OA 4X64Q 3RZOH 3MTSA 1KC8C 3P7JA 5KYIA 2XTIA 5FLXE 1H9KA 4NXMQ 1EOTA 3GP7A 5ELBA 4IFDJ 3UDXA 1Y1VB 1D5XC 3U9SA 4KY6A 2ALYB 1Y1WH 2FHTA 3JAMc 4DV6L 2VQEL 4LAAA 4BA1I 3F2BA 2JA7G 1HUNA 2YTVA 3VYSA 3EBEA 3J81L 1VQLA 1Z9FA 1EY4A 1Q1BA 2B8FA 3E9HA 1KIXA 3EN2A 5E4WC 1KDAA 1IW7C 3I4NH 5FLXc 3KDFB 1JWMD 2WINB 2WKDA 1SNMA 3D0FA 3TREA 2EYPA 5ISRA 1EY7A 2GA4B 1XX8A 3AYHB 4DV1L 2O5JC 1TWHB 3HG9A 4KHVA 1NMFA 1HA5A 1QVCA 4C56C 1UEBA 1T5XD 1YHQA 1J9OA 3NENA 3UE0A 1D5ZC 1OXUA 2A5HA 2KHIA 3PIO3 1PTOB 5FO8B 4A3EG 2NB0A 4JYAQ 4JI6L 1PZJD 5EPJA 1V43A 2MO1A 2Q8IB 4TKOB 4A3JB 1FNWA 4NB3A 5J1ZA 3KF6B 2YU9H 3QO2A 4EQ5A 4GN5A 5JJLA 4GKJL 2PNRC 2KQ3A 3QB3A 5HY6A 1E2VA 1TY2A 1YJ9A 1TT2A 1CHPD 2XIWA 1BBUA 2MUYA 2YU9B 1EUJA 5DEHA 4PQXA 1RTOA 2KOLA 2F3VA 2NYZD 2SOBA 2FMCA 4IFDH 2EYHA 2QEJC 3WWVA 5E1FA 4P72A 2L11A 3VR5A 3DLLA 1WCMG 3U4ZA 5GQOA 3H94A 4RA8A 5KGUA 2I07B 1MD2D 3K5OA 3G48A 3G6JB 4Q0FA 1SYFA 5M3MG 1STBA 4F8MA 1HHVA 1AEXA 2KCTA 3MFGA 1QNKA 2GVAA 3K7AH 2K14A 3V96A 2R3ZA 2KECA 4A3EB 4X65L 1DD2A 1WTHA 4HMIA 1SRUA 4O0AA 3ICEA 4EQPA 4OHJA 1ZEQX 1D8LA 1FGBD 2PQAA 3X3NA 4DNIA 3Q0AA 3C3LA 3I4NG 3PV0A 5CV8A 4DV6Q 4U673 2IT1A 1I94Q 3N6RA 1D5MC 3W5OA 4A3IH 2E74C 1X3GA 2B2UA 1JR0D 1EU4A 3NWSA 2M2LA 1SE4A 2M9VA 5IYDH 5KIXA 3H0GG 1KQSA 4NXML 1XTDA 3A8JE 1FNVA 1JOKA 1K3RA 2A8VA 1KNAA 1VQBA 1LTLA 4FF3A 1W3SA 2RBMA 4DK1A 4DK6C 5IY0A 1N34L 1K8GA 5IGBA 3J7ZC 4HJAA 1SE3A 1HTLD 4A3BG 3TSSA 1IL8A 4J6HA 1JT8A 3A7LA 2Y0SB 2CH4A 4FO2A 4A3LH 4N8FA 1TWCH 1Y14B 1XPRA 5I6WA 5C0XI 2AWOA 3A0JA 1QE6A 4R4QA 3OTOQ 3I7FA 2KVMA 1CTMA 2G9DA 3T1HL 4J8QA 2SNSA 5IWAL 4BY1H 1R4PB 1PHJA 4QIWB 4HMJA 3BZDB 1PYWD 1PH2A 2PZUA 1OO9B 1RD9D 1XPUA 4L6TB 4HSPA 4AYBG 3FDTA 2ZTEA 1EYCA 3BVGA 3NTKA 4LW1A 4DR3Q 1HTPA 5M5WH 2D0OA 3STBC 1SJED 3HOYG 1SE2A 3R93A 2LXJA 4HIDA 4B9XA 1TS5A 5IP9G 5K36G 1L0YB 2NZHA 5EJWA 4BBRH 4RGOS 4YIJA 1VQNA 4NW2A 2Q2IA 1C7YA 1LTBD 1BXTA 5C3EH 3HOZG 1I6HH 5DAUA 2F4VQ 4CJ0B 4PMBA 3CCEA 2JA7B 4K8JA 1AZQA 3Q6SA 2OQ0A 1SFOH 2VB3X 2F0QA 1T9HA 2E2HH 1ET9A 1H9MA 2K5NA 2RVLA 4K5VA 3F1ZA 3S2HH 1O7LA 4GOPB 2PMZE 2F0HA 3AFPA 1STYA 1TQOA 2HHHQ 4ODGA 2KCMA 1DZ1A 1TY0A 5K5PA 1Q86C 4JOIC 1HZ9A 4LF5L 3GV3A 1VQMA 4EQOA 3H0GB 3R2TA 4L5SA 3PIPA 1JMCA 4XYQA 2XSCA 2JA6G 1L1OB 4DR5Q 4GLXA 1OXSC 3M7GA 3C1FA 2IHEA 2KENA 1H9SA 4JI5L 4YY3Q 2ZM6Q 2NVYH 2NN6H 3FP9A 4C2MH 4LUOA 2XNAC 1Y8PB 3F2CA 4FP5D 4CGYB 3K5LA 2WAQE 2B29A 4ME3A 4UP8A 3CU7A 3MXGA 2A74C 3IFTA 4X3TA 1SLJA 2R92H 5JVH3 2JA5B 5EAYA 2C9OA 1FL0A 3A5UA 1WTXA 3OMGA 2KA7A 3EQLC 4QGUA 4HSVA 4DKAC 4IALA 4ZUIA 1AZPA 5C3XA 1L1OC 2JE6I 4RFBA 4ZCKA 5FO9B 3M4PA 2RCNA 2CW0D 2NVXH 3I73A 3S17B 2X69A 1DGSA 1TU2B 5M5XH 1D7QA 1B1ZA 4WORA 4R4CA 3BJUA 3KLRA 2JA6H 2WACA 3E0JA 2AUKA 3AU7A 2UXCQ 1RCVD 3Q8DA 2H5XA 3TS0A 3M7NA 1F9QA 4RGTA 4YCWA 1X56A 3A8KE 4DAMA 4KY7A 1AP0A 3BDLA 4LF6Q 4AYBE 2AQ3B 4EGVA 3PO2H 1QJOA 1HFGA 2EYLA 4JW0A 3O13A 5IYBH 4DNTB 4PZ6A 3EA6A 3JAML 1RDPD 4NPSA 2NN6I 2CWPA 3ONAB 3HOVH 5M3FH 2GN5A 1Q8IA 4UY8C 4DR2Q 4DR5L 1GHKA 3KJOA 1IYUA 5ELFA 3KLWA 5FKAC 1HNXL 3ND8A 2CW0C 4ZK9B 3I4NB 2ZM6L 2VB2X 1FJGL 3JC66 3CP0A 1GUSA 1STGA 5C3EG 1QUQB 2VQFL 2UXBQ 3NTHA 2OCEA 3ULPA 1VF5C 4IUQA 5IP9H 1S40A 1H9SB 4JI7Q 4AH6A 1NY4A 1VQ8A 5DLQE 2TSSA 1XNRQ 2F0GA 2VS1A 4XYOA 3RN5A 2JA8G 2L1BA 1PFNA 2N88A 3W3AA 4BXXH 2RKSA 5HURA 3PUZA 2UUBQ 5JPMC 1G91A 1SYGA 1EU3A 1HJPA 5DNFA 5IE8A 2R7ZG 1Z6HA 2F0IA 1VQ9A 1ZYRD 4P74A 4XT3B 1E7ZA 2VUMB 1SNCA 4BWGB 1JORA 1I50H 1KAAA 5C4ZA 3S1NH 1ILPA 1G2SA 1LO5D 3S2DB 2PZWA 4LF8L 2P5ZX 5CV9A 4A3BB 2F0OA 3D6WA 4B3TQ 1Y8NB 1FNUA 4A93H 3WOFA 4X62Q 2MPMA 4UP9A 3HOXH 2EZVA 2RDFA 2OTJA 2RHSB 3I56A 2F0EA 2RDGA 2WB1G 4O1NA 3L7ZC 2J4XA 3G4SA 4JI7L 3W1GA 1ENCA 4R8IA 4KI0A 3BG3A 5JJZA 4FYDA 2FINB 3H0GH 2L4NA 3CQZH 4HCEA 4JI1Q 1GXDC 5IYDG 5GAEC 3H91A 1PH9A 1G291 4DUZL 3LNNA 1HCZA 5JEAH 4O2DA 3CCSA 4GOPA 5BN4A 4IPCA 4A3DG 3H3VH 5KRUA 3J7A5 1MSGA 3PUVA 5D3DA 4OWXB 5M3FG 4GOPC 3GDEA 4HEDA 2ATWA 2JN4A 2F4IA 3S1QB 1Y1VG 2F0WA 3BVZA 3ZJYC 3H6MA 1R4QB 1H9RA 2QGQA 1S5ED 1M8AA 2OT2A 1YBYA 4DV7L 4C1NI 5M3MH 5I2XA 5LL6X 1M90C 1WFQA 1C8CA 1GOZA 3IKJA 2UXDL 1I6VC 2A73B 4LUVA 3DHQA 3QWNA 4QCLA 1FVIA 4M1UB 1LT4D 4HCSA 5JAVA 1NE3A 1V1OA 2PW5A 2NVXB 3RZOB 4MZ9A 1YJWA 1ENFA 1B9NA 3WDNA 3T51B 4HJ7A 3M9BA 1VCIA 4CKBA 2EYJA 5I9PA 2F0JA 4XXEA 1PRTF 5ELNA 2LS01 3K0YA 3R2IA 2CKZB 3STBD 2EVBA 3W2DA 4A75A 3HOVG 2F03A 3GTJH 1O7ZA 5ELEA 1JB3A 2F0TA 4R4TA 1A3VA 1E1OA 2K5DA 3I55A 1N32L 3J80c 2IJ0A 3KFUA 3TEHB 2Z9HA 3VYTA 4YY3L 3I91A 1AE2A 1LTAD 2N55A 4ID6A 5I2YA 1EQRA 4CBVA 1H95A 2K6AA 3C1EA 3RR5A 3URYA 1MIUA 2HIXA 3PGZA 1NR2A 4LF9L 4YCUA 4FXDA 3FPPA 1WTWA 4BBSB 1PTOF 3J7YW 3ERQA 4JPBW 2KHJA 4PMWA 5FO7B 2D9UA 5M5WB 2FJ2A 3IFDA 2HHHL 4RKBA 4OEMB 4YWLA 2LXKA 3U58A 1J8IA 3PIOA 3CMEA 2DNCA 1GUWA 2XRSD 3A5ZB 4A3DB 1BCPC 1PDQA 4IUVA 4KJNA 1PTOC 2R92G 1LLRD 2HUGA 3SGIA 1CKOA 3OWEB 4I65A 3GTOH 5KNCA 4DUYQ 3GTMB 4P71A 1F2LA 1FR3A 1F9PA 1UE7A 2M00A 2E2JH 3MVVA 2K5WA 4A3CH 4NMZA 3NHHA 1UEAB 1BUVT 1E24A 1DXMA 2L5TA 3A8IE 3NBIA 5LMNQ 3GTOB 4K6LA 2VNUD 1SROA 2GVBA 1AFPA 4CDEC 1BCPF 1F9SA 1STEA 2B39A 4YWMA 2E2JB 3T1YL 1VQDA 2NTTA 1VMPA 1JWUD 3HOYB 2R7FA 5CBAE 4KK7A 4GKKL 2NUCA 4KLKA 4JI1L 1EEFD 2E76C 4C3IB 5BN3A 1N33L 1V8QA 3HOUB 2AWNA 4AQYL 4IOAA 2EDGA 4QIWE 1HZAA 2Q8RE 4ZAIA 4R9WA 2A6HC 3S24A 3K57A 3K6OA 3F2DA 1PH4A 4ZUJA 1O7IA 1XMQL 2CFMA 1LTID 2L0CA 3BYTB 3HZXA 2ENBA 5BR8Q 2UU9L 4B3SL 4DK0A 3H15A 3NPPA 2N3SA 1Y69U 2JEAI 1BOSA 1YEZA 3PQIA 1YNXA 3CXCA 2JK8A 3CRLC 1TWCB 1NAPA 2K75A 5EKIA 2E2DC 1TXYA 3K5NA 4OO1G 1YZ6A 4ZQ3A 3MWYW 1CSQA 4KHZA 4BY7B 1WTVA 2Q8TA 1XWEA 3I4LA 3M3YH 2KEEA 4DV3L 3BS1A 2IL8A 3P20A 2UUCQ 3GTPB 1G2TA 3SK4A 5LMNW 3UDIA 3AQQA 4KTAA 5K36H 4GZYC 2PQAB 1XMOQ 4A3BH 1YNNC 5IGDA 1I5FA 4R4IA 5IODA 3S17H 5C5MA 2JSOA 2HT1A 4RCNA 3KYHC 5C0XJ 1TS4A 2K32A 4MHEA 4QUCA 4TQUS 2XGTA 3D4WA 2IX3A 4F88A 3GV6A 1GD7A 4P73A 1IL2A 5D65A 4IN3A 1PRTC 4DPGA 2JQOA 5ELOA 1NBWA 4CKEA 2ZT9C 4JCVE 3UI2A 4DR6L 4QQBX 1EYAA 3NP8A 3SE0A 1B8AA 2RF4A 4RMFA 1EY6A 4JI2L 2F0FA 2XWBB 1ICWA 3NQTA 3CCRA 3TRZA 4DR1L 4C3JG 2SEBD 5AJ3Q 3HRZC 2DY8A 4OXPA 4A3LG 5KNDA 4A3FB 1D1KA 3Q24A 1VQPA 3GTKB 2OF1A 1XXGA 1S72A 4IUPA 4A3FH 3G6EA 3GTQB 1WCMH 4WJWA 3RZDH 1UAPA 4RGMA 3OOCA 1SFOB 1YITA 5A2QL 2Z4IA 1JQYD 1XMQQ 3A55A 3PF5A
chains in the Genus database with same CATH topology
2HD3A 2QW7A 5L37A 2Z9HA 4I7AA 4N8FA 4JW0A 2RCFA 4JVZA 4N8X1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HD3 A;  2QW7 A;  5L37 A;  2Z9H A;  4I7A A;  4N8F A;  4JW0 A;  2RCF A;  4JVZ A;  4N8X 1; 
#chains in the Genus database with same CATH topology
 1IBM Q;  1IBK L;  1A62 A;  3E0E A;  1N34 Q;  4A76 A;  1CA5 A;  4A3I B;  3K81 C;  3OHX C;  2A6E C;  1RF2 D;  2K01 A;  3VYU A;  3V05 A;  1TS2 A;  1HXY D;  1JCK B;  2A6H D;  4KMU C;  1IBK Q;  3G7L A;  5T1I A;  2EJG C;  1SYE A;  4J1M A;  3NBH A;  1A3T A;  4G7Z C;  1MKH A;  5I6Y A;  5IYB G;  4X65 Q;  3QR8 A;  1IKL A;  2VUM H;  4GNX C;  1DOL A;  4R4O A;  4LFC L;  3Q22 A;  1KXL A;  3PIP 3;  1KLU D;  2JA5 H;  2YTY A;  1PFS A;  3KJP A;  4X3S A;  4WRD A;  5H1S E;  4CDF C;  1KD1 C;  4POF A;  3FMC A;  5TSS A;  4IFD G;  2AUJ D;  5HGT A;  1PMR A;  2ICE C;  4JI0 L;  3GTL B;  4JI8 Q;  4DAY A;  1UE5 A;  4CJ1 B;  2AQ2 B;  4LFB L;  3KOJ A;  4XIG S;  3J81 E;  1E3P A;  1EOV A;  3L3O C;  3OPO A;  2H1E A;  5CR3 A;  1D1I A;  1Y1W G;  4LNQ A;  2NVY B;  1U0L A;  2ZXP A;  3A56 A;  3H3V I;  1MGS A;  1EQV A;  4IPG A;  5CV5 A;  5CYU A;  3SDZ A;  4OON A;  4KHP L;  3FRP B;  1UWV A;  5JJK A;  1Z7T A;  2QEX A;  1C48 A;  4JV5 Q;  1V1P A;  1O80 A;  1D2B A;  1WOC A;  1AE3 A;  1Q46 A;  5LL6 S;  1CT1 D;  4H0L C;  1O7Y A;  1EWI A;  1ILQ A;  3S1Q H;  3BDC A;  4YHH L;  2A6E D;  3Q23 A;  1HUM A;  4P2C B;  3SHL A;  1PTO D;  1WTP A;  3VA7 A;  2F4V L;  1PYS B;  4DV4 Q;  2F0U A;  5AJ3 L;  5KEE A;  2QW7 A;  1LUZ A;  3K0X A;  1LT5 D;  4YHH Q;  3AB9 A;  1SND A;  5GAH C;  1MI2 A;  2QKI C;  2BH8 A;  4DK3 C;  4RAU C;  3NEL A;  4BBS H;  1J5E L;  3FKI H;  2KUM A;  4OL7 A;  4LFC Q;  2HDM A;  4LF7 Q;  1KTK A;  4C3H G;  2UXC L;  4FXG C;  4NKL A;  1CHQ D;  4ILW A;  1I4G A;  1CFM A;  2RA4 A;  2DY7 A;  1M1K C;  1K0S A;  4Q5V A;  4ME5 A;  2I5L X;  1JOO A;  5LMU L;  1I4X A;  1MJE A;  2BA0 A;  1G8Z D;  1L2F A;  2L15 A;  4LUZ A;  2EY1 A;  2LKV A;  5C4X G;  1W2B A;  1U4M A;  4CHT B;  4A3G B;  4X3K A;  1I4H A;  3CMA A;  2JA8 B;  1V1Q A;  3KBX A;  4OO1 H;  3F8T A;  1PLF A;  3KUP A;  5JJI A;  2PO4 A;  5IT9 L;  4HJ5 A;  5M3F B;  3MC0 B;  3GTM H;  4GNX A;  5C4X H;  2B2W C;  5BN5 A;  1S5F D;  4DV3 Q;  1VQ4 A;  5LMN L;  3DWP A;  3L0O A;  4POG A;  2YTX A;  3PO3 G;  4ABN A;  2K4K A;  5T1G A;  3A7A B;  4TRD A;  1HQR D;  1JJ2 A;  4QF4 A;  4DN4 M;  3VR3 A;  3C2P A;  4DR7 L;  3BZK A;  3CCQ A;  5CBE E;  4DV5 L;  2LSS A;  3PUY A;  3HOY H;  1I50 B;  4JBW A;  4LFA L;  1UUP A;  3IAY A;  3UE1 A;  3RZD B;  3KDF A;  3RN2 A;  2WV6 D;  3AMU A;  4KY5 A;  2EIF A;  4OGQ C;  1EY5 A;  1VQI A;  2A68 C;  1HZB A;  3HKS A;  4OWW B;  1SNO A;  1YVC A;  1U4R A;  3E3X A;  4A3M B;  4DR6 Q;  4A93 B;  4IPH A;  4Y7N B;  4E6I A;  3VDY A;  1I4Q A;  4A3K B;  2F3W A;  5F2D A;  3QOJ A;  4PG3 A;  4CDC C;  3VR4 A;  1IBL Q;  3BZC A;  3JAM i;  1N9W A;  3QIA A;  3RLO A;  1SN8 A;  4ULL A;  4JI2 Q;  1VQG A;  4R8N A;  3CD6 A;  1U4P A;  4OX9 L;  1PZK D;  3K59 A;  5C0X H;  5EKL A;  2EJF C;  4U68 A;  3HFZ B;  4XQQ A;  3HOU G;  1HH2 P;  1EY0 A;  1LT3 D;  1EZ6 A;  3TDQ A;  2E2I B;  2KCN A;  2K7V A;  1B70 B;  3LWE A;  4C3H H;  1B50 A;  3K7U C;  2NVT H;  2BDN A;  1X3Q A;  3FEW X;  5EBC A;  2K03 A;  3CAM A;  4QJF A;  3GQB A;  3U9O A;  4XQN A;  1SMY C;  1N8R C;  4BBS G;  4WFN 3;  2E2I H;  2V4D A;  2J7Z A;  3T4A C;  1WTQ A;  5NUC A;  4ZLT F;  1STA A;  1CUK A;  3GTG B;  2MO0 A;  4N9T A;  5CV6 A;  5BR8 L;  3CPW A;  2UU9 Q;  2ASB A;  3S14 H;  1QIL A;  3GD7 A;  1I3Q H;  3J81 i;  1L0X B;  1HNX Q;  2IY5 B;  3TBI B;  1ROD A;  2WB1 B;  2E75 C;  1Q81 C;  5JEA J;  1GUN A;  4K14 A;  2KBN A;  4Y7N H;  4LF9 Q;  1NUC A;  1C0A A;  4KKU A;  4BY7 H;  1TVX A;  3MXU A;  3R3O A;  1QUQ A;  3DEO A;  1EY8 A;  3S1R H;  1JE4 A;  4LFA Q;  2DJF C;  3GTP H;  1QVF A;  1DOM A;  1LTR D;  1TWG B;  4JI4 L;  1PVO A;  1Q82 C;  1KRS A;  2JJQ A;  1KAB A;  1EYG A;  4JBK A;  2Z6K C;  1SYB A;  4LWC A;  4KKT A;  4L8J A;  1IKM A;  1BNZ A;  3K5M A;  5J39 A;  1VQ5 A;  3TS2 A;  5FLX L;  4IFD I;  1LAC A;  2B2W A;  1FGU A;  1JJC B;  1SMX A;  2HQE A;  2K5Q A;  3ND9 A;  1K83 B;  2CQA A;  3TME A;  4RCO A;  5LMU Q;  1R9T B;  3HOX B;  2JA5 G;  4A4I A;  5A2Q E;  2R93 G;  1U4L A;  2EXD A;  2ZTC A;  4ALP A;  1EWH A;  1F2Y A;  4KKS A;  4HJ9 A;  2NVQ H;  2VUM G;  1PH1 A;  2NWG A;  1Y1V H;  4K2K A;  3GTJ B;  3DWA A;  4K0K L;  1ENA A;  2E5L L;  2B2V C;  3MHB A;  3TZD A;  4V19 0;  5C3E B;  1IHZ A;  2R7Z B;  1A15 A;  1QG7 A;  4L63 B;  4I7A A;  4HIK A;  3HOZ B;  4IUU A;  1NR4 A;  3V2T A;  1OXV A;  4DV7 Q;  2V1C C;  1LTS D;  5L37 A;  2AQ1 B;  2RSN A;  5COY A;  5JEA G;  1ZXT A;  4DFA A;  4X64 L;  2OTL A;  5COR A;  4UP7 A;  4DAV A;  4K6D A;  2IX1 A;  1CI3 M;  3EIV A;  2MQH A;  1O78 A;  4RGN A;  1HRJ A;  4DAY B;  2PMZ B;  2RQX A;  1PH5 A;  1KHI A;  1CQV A;  3I72 A;  1K28 A;  1XPO A;  1RHP A;  1B4O A;  3HOU H;  4NDX A;  3HOX G;  1EIH A;  1TWA B;  3W1B A;  3K8A A;  4LF5 Q;  1NTG A;  2F0P A;  2JA6 B;  2F0S A;  4KN4 C;  1LV9 A;  4K5W A;  4C3J H;  1NJI C;  1PRT B;  4V0B A;  2N8N A;  1K8O A;  1HA6 A;  4JI8 L;  1BDO A;  1AN8 A;  3FVQ A;  3JAM E;  3KBG A;  4JC0 A;  2NVQ B;  3CC4 A;  1N32 Q;  1E2W A;  4AQY Q;  4RWS C;  1W6J A;  2WAQ B;  3TN2 A;  3WOE A;  4XQJ A;  1RTN A;  5JVG 3;  4PZ8 A;  2F0M A;  4DR4 Q;  1K0R A;  4IJL A;  2DGY A;  1Z47 A;  4B3M L;  3CCU A;  3DM3 A;  1TWF H;  4KD3 A;  4QL5 A;  1DYQ A;  3TP8 A;  2ZXR A;  2CWA A;  5FJ8 G;  1F77 A;  3OSO A;  2YV5 A;  1G6P A;  1Q8K A;  1HR0 L;  3MXN B;  1GKH A;  4AIM A;  1TWH H;  2B2Y C;  4C3I H;  3J80 E;  3OW7 A;  3NE5 B;  1HNW L;  2JEB I;  4BA2 I;  1X3F A;  4CKC A;  4L5Q A;  3DWQ A;  2DJG C;  2CH4 W;  4H13 C;  3U50 C;  3PO3 H;  3R8B A;  1PTO H;  1Q1E A;  2EY6 A;  3D31 A;  4K0K Q;  5M5Y H;  3SR1 A;  3I70 A;  4QUF A;  5I9O A;  1SE8 A;  2PQE A;  2YYZ A;  2UXD Q;  5KYL A;  3KK7 A;  4J15 A;  1QZG A;  4A3J H;  2F0N A;  1HPC A;  4IUT A;  3FHW A;  3S14 B;  2N49 A;  4IJH A;  1YHA A;  1STN A;  3ERS X;  2SNM A;  4JI3 L;  2UXB L;  4JG2 A;  4A3K H;  3MAQ A;  1VMC A;  2A69 C;  3U4V A;  3TP6 A;  4R1J A;  2F52 A;  3J80 L;  1EQQ A;  1PH7 A;  3MZ5 A;  3PO2 G;  2DN8 A;  3CC2 A;  5I4D A;  4DR2 L;  1N36 Q;  5FK9 C;  1PV4 A;  4JI4 Q;  4UDU C;  1WCM B;  3FKI G;  4MTK A;  1P8L A;  2BOS A;  2K1B A;  3K7A B;  1CA6 A;  1H9J A;  4IUR A;  4APV A;  3HGB A;  1KAW A;  1I4P A;  1BCP D;  4FF4 A;  2RDH A;  3EFX D;  4DUZ Q;  1K9M C;  1SYD A;  1ONL A;  5E3F A;  1Q12 A;  4DXG A;  3I8Z A;  4BY1 B;  1CSP A;  1SAP A;  3I4M G;  3S15 B;  3M4O B;  1K83 H;  5DM6 3;  4L5T A;  2UUB L;  1PZI D;  3SK6 A;  3S1M B;  4LF8 Q;  1LYL A;  3VR2 A;  2HD3 A;  1PH3 A;  3RMH A;  3NXW A;  2JYO A;  1G6Z A;  1OTC A;  1VQ6 A;  5IOC A;  3TP5 A;  3BVM A;  4BS9 A;  4F87 A;  3S1M H;  1ESR A;  3LX0 A;  1DJR D;  1RL2 A;  2A68 D;  2MJ8 A;  4JBM A;  2Q2U A;  4OEL B;  2AHO B;  2UUC L;  2X6G A;  2EJM A;  4DV4 L;  2WAQ G;  4DV0 L;  4G4K A;  2K33 A;  2NN6 G;  3CRK C;  2JP1 A;  1EZ8 A;  1NNX A;  5E4X A;  1QCB D;  3MXP A;  4IO9 A;  5C44 B;  5EPK A;  2C35 B;  4OX9 Q;  2HDL A;  1X3P A;  1LAB A;  4DAP A;  1XNR L;  3QG1 A;  3GTK H;  5EGT A;  2PZT A;  5LHY 1;  4RHS A;  3ERO A;  2BA1 A;  3VR6 A;  1GUO A;  1Q3L A;  1WVL A;  3I3C A;  3DMU A;  4EX5 A;  3P1H A;  3PCO B;  4A3M G;  1K8M A;  2A19 A;  3S2D H;  4X6A H;  1KNE A;  3HOW H;  1WYD A;  1IW7 D;  3NWT A;  1II3 A;  1ZKO A;  4N8X 1;  1VQK A;  4PV1 C;  4A3K G;  1Q7Y C;  5FLM G;  3I4M B;  1SR3 A;  2F3I A;  2LFN A;  1KL9 A;  4C2M B;  2XWJ B;  3D4R A;  1CQF A;  2EQS A;  3KF8 A;  1V1P B;  4PNY A;  1GO3 E;  4JI6 Q;  1EY9 A;  5FOB B;  2KED A;  4A3D H;  4EVO A;  4F7X A;  1A8V A;  5IYC G;  3HOZ H;  5DM7 3;  3T1H Q;  1KRT A;  3ZYY X;  1N36 L;  4DXF A;  3HS0 C;  4X62 L;  1K3B C;  1PRT D;  4DR7 Q;  4RHR A;  1WI5 A;  2B8G A;  1T5E A;  5CC4 A;  2VL6 A;  2PNH A;  4RH6 A;  2X6L A;  1UE1 A;  1KLG D;  1RJT A;  2IPK D;  4DR1 Q;  1CZG A;  4HTH A;  1S5B D;  1X54 A;  1XYI A;  2RCF A;  1HR0 Q;  1HFN A;  2WP8 J;  5A35 A;  5IT9 c;  1VQO A;  4KJO A;  3KF6 A;  2K52 A;  1SJH D;  3S1R B;  3CPF A;  3ER0 A;  3QJY A;  4JBJ A;  1E22 A;  5HGQ A;  2B2T C;  2BDO A;  4GLA C;  4DUY L;  4JI3 Q;  3PUW A;  1RKN A;  2EYF A;  1VS0 A;  1A2U A;  1L1O A;  4DNR B;  1MSH A;  4H02 A;  1JIC A;  4RKL A;  3K58 A;  1HNZ L;  3D3R A;  2QA4 A;  3PO2 B;  1EQT A;  1GUT A;  1R9T H;  1EYD A;  4DA2 A;  5C4X B;  4X66 Q;  5IT9 E;  5IGE A;  1J5E Q;  1NSN S;  2Z1C A;  1I6H B;  4HIM A;  4N9P A;  1EIG A;  2EOT A;  3KF8 B;  2JA8 H;  4NXN L;  1VQJ A;  1FJG Q;  2ZJP A;  1VQH A;  2QIL A;  1OXX K;  3SEB A;  1MBY A;  1DM0 B;  3SK8 A;  3CCJ A;  1SYC A;  2L9H A;  4M8A A;  1PH6 A;  2O4X A;  1YNJ D;  3OWF A;  2OEO A;  1B7Y B;  2UUA Q;  3SVM A;  2NZO A;  1TWA H;  3RD4 A;  4XT1 B;  1VDZ A;  1Y1W B;  1BBX C;  4LF4 L;  3MEF A;  3FKI B;  1EWC A;  2KJX A;  4QB4 A;  1YIJ A;  1BBW A;  1C4Q A;  2VXW A;  4OWT B;  2ZXO A;  1ICF B;  1VQC A;  2E5L Q;  2MGS A;  5FLM H;  4HIO A;  1ASZ A;  1AH9 A;  1PFM A;  1A6X A;  2EYO A;  2R7Z H;  5C3W A;  2Q2H A;  3SXH A;  1F2M A;  1BO0 A;  1YNN D;  4A3M H;  4Z9C B;  3UDG A;  3DM1 A;  4BXX G;  3MA2 B;  1X65 A;  5G3L F;  5KNB A;  5C44 G;  1L0W A;  2CQO A;  2Z6B A;  1K73 C;  5EKK A;  4JI0 Q;  5CV4 A;  5C4J H;  2NVT B;  1YI2 A;  3AEV A;  2K04 A;  3OTO L;  4FNF A;  2KCC A;  2Y0S G;  1F2Z A;  2R7D A;  1Y8O B;  2ZTD A;  1YJN A;  5IYC H;  2XVS A;  1W6K A;  2PW7 A;  1Q90 A;  3TQY A;  4A3C G;  3D6C A;  1JOQ A;  1E2Z A;  2H4O A;  3T16 A;  3RLF A;  3CF5 A;  1YNJ C;  2HIV A;  1SMY D;  4ZYS A;  1M4V A;  3HKZ G;  4IOC A;  2XN9 C;  1S5D D;  2PPB C;  3CQZ B;  5IWA Q;  2B2T A;  1WD1 A;  3ULL A;  3CCL A;  3TP7 A;  1N33 Q;  1QZH A;  1LT6 D;  4MN3 A;  1EIY B;  3HOW G;  1JE5 A;  4HAE A;  2ZJR A;  2VY3 A;  2BH2 A;  3I4M H;  3CHB D;  1A0I A;  4HR7 B;  3DXJ C;  2HQL A;  1DCZ A;  3T1Y Q;  1SEB D;  2OQK A;  1BQQ T;  2E8G A;  1SBB B;  2VW9 A;  1FYC A;  3MFY A;  4DF7 A;  3PUX A;  5IGC A;  2MP1 A;  3M4Y A;  3GTQ H;  1GVP A;  1XNQ L;  4B3R Q;  4IQZ A;  2ES2 A;  2I46 A;  4JVZ A;  4FVM A;  1WD0 A;  4C3H B;  2MNA A;  5AFW A;  2QDB A;  1S4Z A;  2B2U C;  1I3Q B;  1KDC A;  3T53 B;  1B53 A;  1ET6 A;  5ELD A;  1QNU A;  2FFK B;  4LF7 L;  3S9W A;  1S5C D;  4O42 A;  4PMC A;  1TS3 A;  3OMC A;  2JA9 A;  1A2T A;  3T56 B;  4A3J G;  1STH A;  2BE5 D;  2Z4H A;  3AFQ A;  1BKB A;  1I94 L;  1TII D;  4CJ2 C;  2ID0 A;  2LMC B;  1CK1 A;  1LTT D;  3PF4 A;  3PMF A;  2FXQ A;  1XMO L;  2CHB D;  2AMC B;  1BF4 A;  1PXU A;  4BBR G;  2I5H A;  4YCV A;  2F0K A;  2AKW B;  3ULJ A;  1ESF A;  2BCO A;  3B6Y A;  3SK5 A;  4GN4 B;  4S3S A;  2RSO A;  5C44 H;  2VQF Q;  5JPN C;  3VYR A;  1IBL L;  2JXM B;  1BCP B;  3NQI A;  4JI5 Q;  1VQF A;  5D3I B;  1PH8 A;  2K5V A;  4LMQ D;  3J81 c;  3NUC A;  4KHP Q;  1MJC A;  4B3M Q;  1JWS D;  1OXT A;  4FXK C;  1WTO A;  4GNX B;  1P16 A;  2ZJQ A;  5CGK A;  1SXT A;  1SNQ A;  4GS3 A;  1U9R A;  1F9R A;  1DON A;  2J0T D;  3GTL H;  2WB1 E;  4X3U A;  3K80 C;  1BVS A;  3FPU B;  1RIP A;  1NMG A;  1CKN A;  3L2P A;  3GTG H;  4NP5 A;  1CM9 A;  2O2L D;  2B2V A;  1E0B A;  4DV5 Q;  2D0P A;  3EVQ A;  3L9A X;  1AW7 A;  3P75 A;  5C6A A;  1I4R A;  3HOW B;  4A3G H;  3CCM A;  2Z6K A;  3LGJ A;  4G7H C;  4C3I G;  3N52 A;  1TWF B;  3E6Z X;  2N78 A;  3NK9 A;  3DUZ A;  1IYV A;  2PYK A;  4PZ7 A;  5JOB A;  1XJV A;  1BR9 A;  3NBH B;  4GN3 B;  4B08 A;  1E1T A;  3X3M A;  5GRO A;  2I5M X;  4LF6 L;  4A93 G;  2EY5 A;  4MIU A;  4DV1 Q;  3LWU A;  4LJZ C;  4DV2 L;  4OIJ A;  4ZKC B;  2VQE Q;  3S2H B;  1X6O A;  2D5D A;  1GUG A;  4A3I G;  5EPL A;  1B44 D;  1TWG H;  1PYB A;  4CDD C;  2IWH A;  5M3M B;  1HNZ Q;  1J6Q A;  2D2C C;  1NCV A;  2B63 B;  4P75 A;  2WII B;  3DEP A;  4DR4 L;  2R93 B;  1UNS A;  4MTN A;  2K5H A;  2IX0 A;  1LM0 A;  3M85 A;  1X3E A;  1QVG A;  4JV5 L;  2Q2T A;  3CKI B;  2R93 H;  3I2Z A;  2BE5 C;  1CZW A;  5IGF A;  4B9W A;  5IGG A;  2HCC A;  1XTC D;  3J7A F;  4WJ3 M;  2PI2 A;  2Z8L A;  2Z0S A;  4DGZ A;  2UUA L;  1X55 A;  4GKJ Q;  3E9I A;  4KD4 A;  1CKN B;  2CVR A;  2KHS A;  2EXZ A;  1PA6 A;  4JOI A;  1EIF A;  2A69 D;  4YWK A;  4FDB A;  2G5D A;  3HEJ A;  4MNO A;  4UPA A;  1PFB A;  5C4J B;  2B2Y A;  2EYM A;  4TSS A;  1IYJ B;  3HKZ B;  5ELC A;  2QF7 A;  3S1N B;  5IP7 H;  1YHB A;  1ASY A;  2DNE A;  4H7B A;  5M5Y B;  4ZRZ A;  3A54 A;  2K28 A;  3M4Q A;  2IW3 A;  4DU9 A;  1TR5 A;  3CCV A;  1G51 A;  3HKZ E;  1K8A C;  2EPB A;  4K2L A;  4LK1 C;  1SDF A;  3S15 H;  3M4O H;  5M5X B;  5EBD A;  2QDL A;  4NXN Q;  2PCF B;  3PSI A;  3PO3 B;  1D6E C;  4UHV A;  1GM5 A;  4QMG A;  3RNU A;  3BU2 A;  1QB5 D;  1LTG D;  3VA5 A;  4X66 L;  5IP7 G;  1SNP A;  4L5R C;  4LFB Q;  1GJX A;  3NTI A;  2QCP X;  1EFW A;  1QOH A;  1WJJ A;  2MFI A;  1ML0 D;  4DR3 L;  2L55 A;  2L12 A;  1VQA A;  1DOK A;  1JB7 A;  3C46 A;  2R61 A;  4DV0 Q;  1B2T A;  1B3Q A;  1B9M A;  2LY7 A;  2K50 A;  3F2U A;  2D62 A;  1EFI D;  3NEM A;  4KV6 A;  4UAI A;  2ICI A;  1GHJ A;  3E5S A;  4A3F G;  3D4D A;  3M3Y B;  4BY7 G;  2F0L A;  2G9H D;  4A3E H;  4G7O C;  3HP3 A;  3EJI A;  1EL0 A;  3H3V C;  2C5C A;  3S16 H;  1X9N A;  3T13 A;  1IBM L;  2B63 G;  1A63 A;  4IUN A;  3KLS A;  3IL8 A;  1C9O A;  3TZU A;  4RG1 A;  4BBR B;  2OXP A;  3S16 B;  3I4O A;  1IZ6 A;  2SDF A;  4KN7 C;  4G57 A;  2DUD A;  3D8G A;  4I7Z C;  5C5L A;  2OWO A;  1KDB A;  1B3A A;  2PI2 E;  2FMM A;  1FD7 D;  3ITP A;  2JA7 H;  3OIP A;  4B3T L;  4C1N K;  5M9O A;  2MHV A;  1SSO A;  3G71 A;  2A1A A;  2XRQ D;  1JJG A;  1CKM A;  1ZYR C;  2IHF A;  4HJ8 A;  5CMD A;  2E2H B;  4WJ4 A;  3UDF A;  2F0V A;  3KLS X;  3CW2 C;  4K5X A;  2NBF A;  4EQN A;  5C0X G;  2CCZ A;  2K05 A;  3J81 j;  2F0D A;  2VZA A;  4A3G G;  4AYB B;  3OIQ A;  4QY7 A;  5GAG C;  4XTC S;  1U5K A;  5GAD C;  3BDO A;  4Y52 H;  1UE6 A;  4OIK A;  5J3B A;  3QOL A;  4FF2 A;  2R92 B;  1VF7 A;  1HZC A;  2WFW A;  4HN7 A;  2EY2 A;  5J22 A;  2HCI A;  2R6G A;  3GO5 A;  2RHQ B;  3I90 A;  3BYY B;  1VQE A;  1JC7 A;  3OYY A;  3RUZ A;  4JK1 C;  3H09 A;  1QWY A;  4IZ8 A;  2NTS A;  3J80 i;  4B3S Q;  3MEH A;  4C3J B;  5IIF A;  1HNW Q;  2I0Q A;  2NZ1 D;  4LF4 Q;  4FF1 A;  1HR0 W;  1WTR A;  4JYA L;  5G3L D;  3OW2 A;  2TMP A;  3J7A V;  5FJ8 H;  5E7N A;  3CC7 A;  4XDX A;  3MXN A;  5D14 A;  4TVA B;  4GKK Q;  4IPD A;  3NSW A;  3A74 A;  4H44 C;  1TKW B;  1XNQ Q;  2O5I C;  4B3R L;  1MHW C;  1V9P A;  4BY1 G;  2EE1 A;  3RLN A;  4OO1 I;  1HQM C;  5CV7 A;  2F1M A;  5C4H A;  4DV2 Q;  2WKC A;  1A3U A;  1VQ7 A;  2B3G A;  2Y0S E;  2B63 H;  3HOV B;  1EEI D;  1X32 A;  4GLV B;  4K8I A;  3IRB A;  5EQ0 A;  4ZKB B;  1IXR A;  1S3O A;  4X64 Q;  3RZO H;  3MTS A;  1KC8 C;  3P7J A;  5KYI A;  2XTI A;  5FLX E;  1H9K A;  4NXM Q;  1EOT A;  3GP7 A;  5ELB A;  4IFD J;  3UDX A;  1Y1V B;  1D5X C;  3U9S A;  4KY6 A;  2ALY B;  1Y1W H;  2FHT A;  3JAM c;  4DV6 L;  2VQE L;  4LAA A;  4BA1 I;  3F2B A;  2JA7 G;  1HUN A;  2YTV A;  3VYS A;  3EBE A;  3J81 L;  1VQL A;  1Z9F A;  1EY4 A;  1Q1B A;  2B8F A;  3E9H A;  1KIX A;  3EN2 A;  5E4W C;  1KDA A;  1IW7 C;  3I4N H;  5FLX c;  3KDF B;  1JWM D;  2WIN B;  2WKD A;  1SNM A;  3D0F A;  3TRE A;  2EYP A;  5ISR A;  1EY7 A;  2GA4 B;  1XX8 A;  3AYH B;  4DV1 L;  2O5J C;  1TWH B;  3HG9 A;  4KHV A;  1NMF A;  1HA5 A;  1QVC A;  4C56 C;  1UEB A;  1T5X D;  1YHQ A;  1J9O A;  3NEN A;  3UE0 A;  1D5Z C;  1OXU A;  2A5H A;  2KHI A;  3PIO 3;  1PTO B;  5FO8 B;  4A3E G;  2NB0 A;  4JYA Q;  4JI6 L;  1PZJ D;  5EPJ A;  1V43 A;  2MO1 A;  2Q8I B;  4TKO B;  4A3J B;  1FNW A;  4NB3 A;  5J1Z A;  3KF6 B;  2YU9 H;  3QO2 A;  4EQ5 A;  4GN5 A;  5JJL A;  4GKJ L;  2PNR C;  2KQ3 A;  3QB3 A;  5HY6 A;  1E2V A;  1TY2 A;  1YJ9 A;  1TT2 A;  1CHP D;  2XIW A;  1BBU A;  2MUY A;  2YU9 B;  1EUJ A;  5DEH A;  4PQX A;  1RTO A;  2KOL A;  2F3V A;  2NYZ D;  2SOB A;  2FMC A;  4IFD H;  2EYH A;  2QEJ C;  3WWV A;  5E1F A;  4P72 A;  2L11 A;  3VR5 A;  3DLL A;  1WCM G;  3U4Z A;  5GQO A;  3H94 A;  4RA8 A;  5KGU A;  2I07 B;  1MD2 D;  3K5O A;  3G48 A;  3G6J B;  4Q0F A;  1SYF A;  5M3M G;  1STB A;  4F8M A;  1HHV A;  1AEX A;  2KCT A;  3MFG A;  1QNK A;  2GVA A;  3K7A H;  2K14 A;  3V96 A;  2R3Z A;  2KEC A;  4A3E B;  4X65 L;  1DD2 A;  1WTH A;  4HMI A;  1SRU A;  4O0A A;  3ICE A;  4EQP A;  4OHJ A;  1ZEQ X;  1D8L A;  1FGB D;  2PQA A;  3X3N A;  4DNI A;  3Q0A A;  3C3L A;  3I4N G;  3PV0 A;  5CV8 A;  4DV6 Q;  4U67 3;  2IT1 A;  1I94 Q;  3N6R A;  1D5M C;  3W5O A;  4A3I H;  2E74 C;  1X3G A;  2B2U A;  1JR0 D;  1EU4 A;  3NWS A;  2M2L A;  1SE4 A;  2M9V A;  5IYD H;  5KIX A;  3H0G G;  1KQS A;  4NXM L;  1XTD A;  3A8J E;  1FNV A;  1JOK A;  1K3R A;  2A8V A;  1KNA A;  1VQB A;  1LTL A;  4FF3 A;  1W3S A;  2RBM A;  4DK1 A;  4DK6 C;  5IY0 A;  1N34 L;  1K8G A;  5IGB A;  3J7Z C;  4HJA A;  1SE3 A;  1HTL D;  4A3B G;  3TSS A;  1IL8 A;  4J6H A;  1JT8 A;  3A7L A;  2Y0S B;  2CH4 A;  4FO2 A;  4A3L H;  4N8F A;  1TWC H;  1Y14 B;  1XPR A;  5I6W A;  5C0X I;  2AWO A;  3A0J A;  1QE6 A;  4R4Q A;  3OTO Q;  3I7F A;  2KVM A;  1CTM A;  2G9D A;  3T1H L;  4J8Q A;  2SNS A;  5IWA L;  4BY1 H;  1R4P B;  1PHJ A;  4QIW B;  4HMJ A;  3BZD B;  1PYW D;  1PH2 A;  2PZU A;  1OO9 B;  1RD9 D;  1XPU A;  4L6T B;  4HSP A;  4AYB G;  3FDT A;  2ZTE A;  1EYC A;  3BVG A;  3NTK A;  4LW1 A;  4DR3 Q;  1HTP A;  5M5W H;  2D0O A;  3STB C;  1SJE D;  3HOY G;  1SE2 A;  3R93 A;  2LXJ A;  4HID A;  4B9X A;  1TS5 A;  5IP9 G;  5K36 G;  1L0Y B;  2NZH A;  5EJW A;  4BBR H;  4RGO S;  4YIJ A;  1VQN A;  4NW2 A;  2Q2I A;  1C7Y A;  1LTB D;  1BXT A;  5C3E H;  3HOZ G;  1I6H H;  5DAU A;  2F4V Q;  4CJ0 B;  4PMB A;  3CCE A;  2JA7 B;  4K8J A;  1AZQ A;  3Q6S A;  2OQ0 A;  1SFO H;  2VB3 X;  2F0Q A;  1T9H A;  2E2H H;  1ET9 A;  1H9M A;  2K5N A;  2RVL A;  4K5V A;  3F1Z A;  3S2H H;  1O7L A;  4GOP B;  2PMZ E;  2F0H A;  3AFP A;  1STY A;  1TQO A;  2HHH Q;  4ODG A;  2KCM A;  1DZ1 A;  1TY0 A;  5K5P A;  1Q86 C;  4JOI C;  1HZ9 A;  4LF5 L;  3GV3 A;  1VQM A;  4EQO A;  3H0G B;  3R2T A;  4L5S A;  3PIP A;  1JMC A;  4XYQ A;  2XSC A;  2JA6 G;  1L1O B;  4DR5 Q;  4GLX A;  1OXS C;  3M7G A;  3C1F A;  2IHE A;  2KEN A;  1H9S A;  4JI5 L;  4YY3 Q;  2ZM6 Q;  2NVY H;  2NN6 H;  3FP9 A;  4C2M H;  4LUO A;  2XNA C;  1Y8P B;  3F2C A;  4FP5 D;  4CGY B;  3K5L A;  2WAQ E;  2B29 A;  4ME3 A;  4UP8 A;  3CU7 A;  3MXG A;  2A74 C;  3IFT A;  4X3T A;  1SLJ A;  2R92 H;  5JVH 3;  2JA5 B;  5EAY A;  2C9O A;  1FL0 A;  3A5U A;  1WTX A;  3OMG A;  2KA7 A;  3EQL C;  4QGU A;  4HSV A;  4DKA C;  4IAL A;  4ZUI A;  1AZP A;  5C3X A;  1L1O C;  2JE6 I;  4RFB A;  4ZCK A;  5FO9 B;  3M4P A;  2RCN A;  2CW0 D;  2NVX H;  3I73 A;  3S17 B;  2X69 A;  1DGS A;  1TU2 B;  5M5X H;  1D7Q A;  1B1Z A;  4WOR A;  4R4C A;  3BJU A;  3KLR A;  2JA6 H;  2WAC A;  3E0J A;  2AUK A;  3AU7 A;  2UXC Q;  1RCV D;  3Q8D A;  2H5X A;  3TS0 A;  3M7N A;  1F9Q A;  4RGT A;  4YCW A;  1X56 A;  3A8K E;  4DAM A;  4KY7 A;  1AP0 A;  3BDL A;  4LF6 Q;  4AYB E;  2AQ3 B;  4EGV A;  3PO2 H;  1QJO A;  1HFG A;  2EYL A;  4JW0 A;  3O13 A;  5IYB H;  4DNT B;  4PZ6 A;  3EA6 A;  3JAM L;  1RDP D;  4NPS A;  2NN6 I;  2CWP A;  3ONA B;  3HOV H;  5M3F H;  2GN5 A;  1Q8I A;  4UY8 C;  4DR2 Q;  4DR5 L;  1GHK A;  3KJO A;  1IYU A;  5ELF A;  3KLW A;  5FKA C;  1HNX L;  3ND8 A;  2CW0 C;  4ZK9 B;  3I4N B;  2ZM6 L;  2VB2 X;  1FJG L;  3JC6 6;  3CP0 A;  1GUS A;  1STG A;  5C3E G;  1QUQ B;  2VQF L;  2UXB Q;  3NTH A;  2OCE A;  3ULP A;  1VF5 C;  4IUQ A;  5IP9 H;  1S40 A;  1H9S B;  4JI7 Q;  4AH6 A;  1NY4 A;  1VQ8 A;  5DLQ E;  2TSS A;  1XNR Q;  2F0G A;  2VS1 A;  4XYO A;  3RN5 A;  2JA8 G;  2L1B A;  1PFN A;  2N88 A;  3W3A A;  4BXX H;  2RKS A;  5HUR A;  3PUZ A;  2UUB Q;  5JPM C;  1G91 A;  1SYG A;  1EU3 A;  1HJP A;  5DNF A;  5IE8 A;  2R7Z G;  1Z6H A;  2F0I A;  1VQ9 A;  1ZYR D;  4P74 A;  4XT3 B;  1E7Z A;  2VUM B;  1SNC A;  4BWG B;  1JOR A;  1I50 H;  1KAA A;  5C4Z A;  3S1N H;  1ILP A;  1G2S A;  1LO5 D;  3S2D B;  2PZW A;  4LF8 L;  2P5Z X;  5CV9 A;  4A3B B;  2F0O A;  3D6W A;  4B3T Q;  1Y8N B;  1FNU A;  4A93 H;  3WOF A;  4X62 Q;  2MPM A;  4UP9 A;  3HOX H;  2EZV A;  2RDF A;  2OTJ A;  2RHS B;  3I56 A;  2F0E A;  2RDG A;  2WB1 G;  4O1N A;  3L7Z C;  2J4X A;  3G4S A;  4JI7 L;  3W1G A;  1ENC A;  4R8I A;  4KI0 A;  3BG3 A;  5JJZ A;  4FYD A;  2FIN B;  3H0G H;  2L4N A;  3CQZ H;  4HCE A;  4JI1 Q;  1GXD C;  5IYD G;  5GAE C;  3H91 A;  1PH9 A;  1G29 1;  4DUZ L;  3LNN A;  1HCZ A;  5JEA H;  4O2D A;  3CCS A;  4GOP A;  5BN4 A;  4IPC A;  4A3D G;  3H3V H;  5KRU A;  3J7A 5;  1MSG A;  3PUV A;  5D3D A;  4OWX B;  5M3F G;  4GOP C;  3GDE A;  4HED A;  2ATW A;  2JN4 A;  2F4I A;  3S1Q B;  1Y1V G;  2F0W A;  3BVZ A;  3ZJY C;  3H6M A;  1R4Q B;  1H9R A;  2QGQ A;  1S5E D;  1M8A A;  2OT2 A;  1YBY A;  4DV7 L;  4C1N I;  5M3M H;  5I2X A;  5LL6 X;  1M90 C;  1WFQ A;  1C8C A;  1GOZ A;  3IKJ A;  2UXD L;  1I6V C;  2A73 B;  4LUV A;  3DHQ A;  3QWN A;  4QCL A;  1FVI A;  4M1U B;  1LT4 D;  4HCS A;  5JAV A;  1NE3 A;  1V1O A;  2PW5 A;  2NVX B;  3RZO B;  4MZ9 A;  1YJW A;  1ENF A;  1B9N A;  3WDN A;  3T51 B;  4HJ7 A;  3M9B A;  1VCI A;  4CKB A;  2EYJ A;  5I9P A;  2F0J A;  4XXE A;  1PRT F;  5ELN A;  2LS0 1;  3K0Y A;  3R2I A;  2CKZ B;  3STB D;  2EVB A;  3W2D A;  4A75 A;  3HOV G;  2F03 A;  3GTJ H;  1O7Z A;  5ELE A;  1JB3 A;  2F0T A;  4R4T A;  1A3V A;  1E1O A;  2K5D A;  3I55 A;  1N32 L;  3J80 c;  2IJ0 A;  3KFU A;  3TEH B;  2Z9H A;  3VYT A;  4YY3 L;  3I91 A;  1AE2 A;  1LTA D;  2N55 A;  4ID6 A;  5I2Y A;  1EQR A;  4CBV A;  1H95 A;  2K6A A;  3C1E A;  3RR5 A;  3URY A;  1MIU A;  2HIX A;  3PGZ A;  1NR2 A;  4LF9 L;  4YCU A;  4FXD A;  3FPP A;  1WTW A;  4BBS B;  1PTO F;  3J7Y W;  3ERQ A;  4JPB W;  2KHJ A;  4PMW A;  5FO7 B;  2D9U A;  5M5W B;  2FJ2 A;  3IFD A;  2HHH L;  4RKB A;  4OEM B;  4YWL A;  2LXK A;  3U58 A;  1J8I A;  3PIO A;  3CME A;  2DNC A;  1GUW A;  2XRS D;  3A5Z B;  4A3D B;  1BCP C;  1PDQ A;  4IUV A;  4KJN A;  1PTO C;  2R92 G;  1LLR D;  2HUG A;  3SGI A;  1CKO A;  3OWE B;  4I65 A;  3GTO H;  5KNC A;  4DUY Q;  3GTM B;  4P71 A;  1F2L A;  1FR3 A;  1F9P A;  1UE7 A;  2M00 A;  2E2J H;  3MVV A;  2K5W A;  4A3C H;  4NMZ A;  3NHH A;  1UEA B;  1BUV T;  1E24 A;  1DXM A;  2L5T A;  3A8I E;  3NBI A;  5LMN Q;  3GTO B;  4K6L A;  2VNU D;  1SRO A;  2GVB A;  1AFP A;  4CDE C;  1BCP F;  1F9S A;  1STE A;  2B39 A;  4YWM A;  2E2J B;  3T1Y L;  1VQD A;  2NTT A;  1VMP A;  1JWU D;  3HOY B;  2R7F A;  5CBA E;  4KK7 A;  4GKK L;  2NUC A;  4KLK A;  4JI1 L;  1EEF D;  2E76 C;  4C3I B;  5BN3 A;  1N33 L;  1V8Q A;  3HOU B;  2AWN A;  4AQY L;  4IOA A;  2EDG A;  4QIW E;  1HZA A;  2Q8R E;  4ZAI A;  4R9W A;  2A6H C;  3S24 A;  3K57 A;  3K6O A;  3F2D A;  1PH4 A;  4ZUJ A;  1O7I A;  1XMQ L;  2CFM A;  1LTI D;  2L0C A;  3BYT B;  3HZX A;  2ENB A;  5BR8 Q;  2UU9 L;  4B3S L;  4DK0 A;  3H15 A;  3NPP A;  2N3S A;  1Y69 U;  2JEA I;  1BOS A;  1YEZ A;  3PQI A;  1YNX A;  3CXC A;  2JK8 A;  3CRL C;  1TWC B;  1NAP A;  2K75 A;  5EKI A;  2E2D C;  1TXY A;  3K5N A;  4OO1 G;  1YZ6 A;  4ZQ3 A;  3MWY W;  1CSQ A;  4KHZ A;  4BY7 B;  1WTV A;  2Q8T A;  1XWE A;  3I4L A;  3M3Y H;  2KEE A;  4DV3 L;  3BS1 A;  2IL8 A;  3P20 A;  2UUC Q;  3GTP B;  1G2T A;  3SK4 A;  5LMN W;  3UDI A;  3AQQ A;  4KTA A;  5K36 H;  4GZY C;  2PQA B;  1XMO Q;  4A3B H;  1YNN C;  5IGD A;  1I5F A;  4R4I A;  5IOD A;  3S17 H;  5C5M A;  2JSO A;  2HT1 A;  4RCN A;  3KYH C;  5C0X J;  1TS4 A;  2K32 A;  4MHE A;  4QUC A;  4TQU S;  2XGT A;  3D4W A;  2IX3 A;  4F88 A;  3GV6 A;  1GD7 A;  4P73 A;  1IL2 A;  5D65 A;  4IN3 A;  1PRT C;  4DPG A;  2JQO A;  5ELO A;  1NBW A;  4CKE A;  2ZT9 C;  4JCV E;  3UI2 A;  4DR6 L;  4QQB X;  1EYA A;  3NP8 A;  3SE0 A;  1B8A A;  2RF4 A;  4RMF A;  1EY6 A;  4JI2 L;  2F0F A;  2XWB B;  1ICW A;  3NQT A;  3CCR A;  3TRZ A;  4DR1 L;  4C3J G;  2SEB D;  5AJ3 Q;  3HRZ C;  2DY8 A;  4OXP A;  4A3L G;  5KND A;  4A3F B;  1D1K A;  3Q24 A;  1VQP A;  3GTK B;  2OF1 A;  1XXG A;  1S72 A;  4IUP A;  4A3F H;  3G6E A;  3GTQ B;  1WCM H;  4WJW A;  3RZD H;  1UAP A;  4RGM A;  3OOC A;  1SFO B;  1YIT A;  5A2Q L;  2Z4I A;  1JQY D;  1XMQ Q;  3A55 A;  3PF5 A; 
#chains in the Genus database with same CATH homology
 2HD3 A;  2QW7 A;  5L37 A;  2Z9H A;  4I7A A;  4N8F A;  4JW0 A;  2RCF A;  4JVZ A;  4N8X 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...