4I7AA

Grpn pentameric microcompartment shell protein from rhodospirillum rubrum
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
88
structure length
84
Chain Sequence
MYLGKVIGTVVSTSKNESLSGTKLLVVARLTEKLIPDGSTQVVVDTVGAGNGEIVIVSCGSSARQSHSVIDAAVVGIVDTVETV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Bacterial microcompartment shells of diverse functional types possess pentameric vertex proteins.
pubmed doi rcsb
source organism Rhodospirillum rubrum
molecule tags Structural protein
molecule keywords Ethanolamine utilization protein EutN/carboxysome structural
total genus 12
structure length 84
sequence length 88
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2012-11-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.220 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) EutN/Ccml 4i7aA00
4I7AA 2HD3A 4JVZA 2QW7A 2RCFA 4N8X1 4JW0A 2Z9HA 5L37A 4N8FA
chains in the Genus database with same CATH superfamily
5CV5A 2HQLA 3D8GA 2F0MA 4NXNL 4A3IB 2EYMA 4A3JH 1KDAA 4JI1L 1AE3A 2RSNA 2E2IB 2I0QA 1CQVA 2K4KA 1BDOA 2X6GA 3NTIA 3JAME 1LTGD 4H13C 1ICWA 3NBIA 1QB5D 2UUCL 3T1YL 3PF5A 1EQQA 2O5IC 1A6XA 1VS0A 1LT4D 4LFBL 2E2HB 3QOLA 2QILA 2J7ZA 1Y1VH 4K0KQ 4Z9CB 3OPOA 4X66Q 1PRTD 4X62Q 1CA6A 3S2HH 1WTQA 4DK3C 3H3VH 3NSWA 2PI2E 5GADC 2A6HC 1HTLD 4PZ6A 1LM0A 1LTSD 2AQ2B 1TWHB 2QA4A 1PTOC 2F0IA 4EQPA 1GKHA 3QIAA 1M1KC 1KNAA 3W3AA 1GHKA 4R1JA 1NUCA 3BU2A 2O2LD 3MXUA 3SR1A 4F8MA 4ILWA 2A8VA 1O78A 4A3BB 4X3KA 5M3FB 2EZVA 1I50B 1LACA 4JW0A 3VR3A 5JJKA 5TSSA 1XPOA 2DUDA 1Y14B 4DU9A 4ZRZA 2JK8A 1HPCA 2FMMA 3DM1A 1CTMA 2UXBQ 3SK5A 3Q24A 4GOPA 1CZWA 1ET9A 3H6MA 4A3LH 1M90C 1Q3LA 5ELFA 1B50A 3KLSX 1AH9A 2LMCB 2F0LA 3S1MH 4DUYL 1X65A 5JPMC 3VR4A 4LF6L 1N9WA 4IFDJ 2F0UA 1QOHA 1XWEA 3S14H 1X3GA 1CHQD 2RA4A 4IPGA 1PTOB 3DEPA 1VQAA 3R3OA 2F0OA 2R7FA 4B3MQ 1EZ6A 5D3DA 3ER0A 3KBGA 3GTLH 1B3QA 5C4XH 1STNA 4HIMA 3OW7A 4BY1B 3HKSA 4UP9A 2B2YC 4GLAC 3CCRA 2BDOA 2A73B 2O4XA 1EY9A 3NBHB 1N33Q 1Y1WB 3I56A 2JYOA 4DAYA 2I5LX 2G9HD 2NUCA 5GQOA 1X3PA 2DNEA 1STEA 3PUWA 1MKHA 3NHHA 3CMEA 2PPBC 3G4SA 2NN6H 1WYDA 5EJWA 3N52A 5IE8A 2B8FA 2MO1A 2E5LL 4AH6A 3BZCA 3WOFA 5EKKA 3R2TA 4GLVB 1Y1WG 1HA6A 1BVSA 4X66L 1I6HB 4IUNA 5I6YA 4A3KB 5C4JB 1S5DD 1Y69U 1OO9B 3PO2G 5I9OA 3RZDH 1PH5A 2A19A 2Q2HA 4N9TA 1RKNA 4H44C 2K7VA 2AMCB 1EY8A 4QMGA 2IWHA 1YJ9A 2HT1A 2UUCQ 4HMJA 2KHJA 3SK6A 1WOCA 2YV5A 5IYBG 2B39A 1ENCA 2DN8A 5C0XI 4X3TA 3CC4A 3PCOB 4LWCA 4A3EB 4BBRG 4HJ9A 4EQNA 1NSNS 1KC8C 4A3JB 2KQ3A 4KJNA 2MFIA 5C3EB 1SE4A 1SNDA 3CHBD 1SE3A 3UDXA 3RN5A 1CZGA 1YHBA 5T1IA 1EEFD 1RDPD 3PMFA 5M5YB 4OHJA 4KKSA 3VR5A 4JI6L 1S72A 4ZK9B 2VQFL 1A15A 3T1HL 2MGSA 2N8NA 2PO4A 5LMNW 2RDGA 3J7YW 4DK0A 4DV2L 4KI0A 1V9PA 3R2IA 1TWFB 1K9MC 1CFMA 2PW7A 2IX0A 3CCJA 1LYLA 3M4OB 3RLNA 3K0YA 3J80c 2YTYA 3EBEA 3IKJA 2F0FA 5IOCA 4IJHA 4KHZA 2B2VA 5KGUA 3DUZA 3MZ5A 5C0XH 5JEAG 4L5SA 4CJ0B 3DWAA 1EU4A 1KRSA 4IPHA 4DV1L 4C3IH 1XX8A 2KVMA 2PNHA 3FHWA 4A3BH 3J7AV 4DR4L 1G2SA 1D1IA 3D4DA 4HR7B 1YBYA 1AW7A 1BCPC 3HOXH 4KN4C 4MN3A 3SK8A 5C3EG 4C3IG 4NP5A 2OTLA 1U4RA 1Q82C 2CQOA 3KOJA 1TWAB 2R7DA 4GNXB 3X3NA 1F2LA 4DK1A 1N34L 4E6IA 3NK9A 2B2YA 1W2BA 3LGJA 1BXTA 2QDLA 1VQKA 4R8IA 3S1RB 1PYBA 1HJPA 4BA1I 2NZHA 4H7BA 2I46A 3CAMA 4IURA 1STHA 1A63A 2KCTA 4MIUA 2RBMA 1PTOH 3X3MA 2ALYB 1C0AA 1LTRD 1TS2A 4LK1C 3M3YH 3CQZH 1GUSA 3G71A 2Z6KA 4JI7L 2KCCA 1WI5A 1GUGA 3S9WA 4R4CA 1JOQA 4DV6Q 4DV2Q 4IUVA 4RGOS 1Y8PB 4OXPA 5JEAH 4QY7A 2PI2A 1NE3A 5C0XJ 3F2BA 3FKIG 3KJPA 2JA7B 3S15B 1TS5A 4JOIC 1FYCA 3STBD 4EX5A 2LXKA 1R9TH 5C3EH 1JT8A 2VUMH 3FKIH 3T1HQ 2IT1A 5GAEC 1GUWA 1I4RA 2B2TA 2JEAI 4JI2Q 1BQQT 1F9QA 5CV9A 4DXFA 1AEXA 2F0HA 4I65A 3J81c 2B2WA 1SYFA 4HAEA 4J15A 2L15A 5C3XA 2KCNA 3ND8A 3MEFA 1DOLA 4WRDA 3RN2A 1PXUA 5EPJA 3A7AB 2EY5A 1WD1A 1D5ZC 5ELBA 3K58A 2NTSA 2RQXA 4IZ8A 5K36H 3QG1A 2F0JA 2NZOA 4EQ5A 3FP9A 4HTHA 2OWOA 4DR2Q 2QW7A 1ZKOA 4F7XA 2IX1A 4ZUIA 4NB3A 2PZTA 4FO2A 1H9SB 1LABA 2EJFC 4QJFA 5K36G 4CJ2C 1E22A 2VW9A 4DF7A 2YU9H 5HGTA 3MXNA 4O0AA 3U58A 3I91A 5EPLA 2OF1A 4YY3L 2E2IH 4JPBW 1ML0D 1SE2A 1SLJA 3WOEA 5C4XB 4A3IH 4RKLA 2NVTH 4R4QA 3NBHA 1EUJA 3JAMi 3K59A 1PTOD 2C35B 2DJGC 4C2MB 1F9RA 3CCUA 3LX0A 2F1MA 3HP3A 1N8RC 1B9MA 3HOZG 1Q46A 3KLRA 3HOYG 2F3WA 5KYLA 1STAA 5DM73 1VQNA 1E1TA 3KF8B 4ODGA 1XYIA 3BVGA 1VQ7A 4CGYB 5FLXc 3SEBA 3C1EA 3S15H 3PUYA 5IP9G 2HQEA 4UAIA 4H02A 1WJJA 4LF6Q 4K6LA 1X32A 4GKKL 1EIYB 5BR8Q 1Q90A 4DR7Q 2Q2IA 2WKCA 1YVCA 1HFGA 2Z0SA 3URYA 5IT9L 2R7ZG 1PH3A 3BZDB 2K5VA 2IHFA 4JI8Q 3KUPA 2X69A 4PMCA 1G51A 3M7GA 3TBIB 1XPUA 2NVQB 1EY7A 1F2MA 1TWCB 4A3MH 3SVMA 3A56A 1SSOA 1TKWB 2KA7A 4BA2I 4DAPA 5M3MH 4BWGB 1STYA 2B2TC 4DV7Q 3SXHA 2BH2A 1PTOF 2PQEA 1L0YB 1LT5D 3D3RA 3GTOH 2NVXH 1IW7D 1NY4A 4HEDA 2OQKA 2QCPX 1DOMA 4P72A 4UHVA 3N6RA 4XXEA 1LT3D 4DUZL 4RH6A 4X62L 1HA5A 2VQEQ 4P2CB 2OT2A 3PF4A 1XTCD 2G9DA 1JCKB 4A3EH 3A8KE 3CRLC 3TS2A 3S1NH 4IFDG 2G5DA 3NEMA 4YY3Q 2XRSD 5IYCH 2UUBQ 1O7IA 1AZPA 4IOAA 1CKNB 2P5ZX 3K5LA 1IBKL 1SYEA 1NMGA 1F9SA 4G7HC 2JA7G 5EBCA 5BN3A 1A3TA 1XJVA 1JWUD 3HOWB 4YWKA 1KHIA 4WJ3M 4DR6Q 4RMFA 2B63H 4OX9L 4DAVA 5M5YH 4YCUA 1L1OA 4BY1G 2E75C 1JR0D 1WTPA 4C56C 5F2DA 1SXTA 1SJHD 1ENAA 3PO3G 2RDFA 4BBSB 4OL7A 1FJGL 5KEEA 5FKAC 1JJ2A 5IYCG 1KRTA 4B9XA 1EWCA 2PQAB 4XT3B 2AQ3B 3E9HA 3MC0B 5A2QE 4DR3Q 5I4DA 4IFDH 2JJQA 1C4QA 5E4WC 2Q8RE 2FMCA 2Y0SE 1N34Q 1I6HH 4LFAL 1I4XA 3H0GH 5IYDH 1O7YA 3TDQA 1X6OA 1VQ5A 4YCWA 2D0OA 3FRPB 4L5RC 4DR1Q 4HJ8A 1Y1VG 1EL0A 1VMPA 1A3UA 4ZCKA 2EJMA 1E1OA 3PGZA 4AYBB 4DN4M 1QE6A 2HDLA 2F52A 4P75A 1B70B 2MUYA 2ENBA 1ILPA 3CP0A 2DNCA 4BY1H 1DZ1A 1B2TA 4DKAC 1IBML 1JB3A 4XT1B 1FNVA 3FKIB 3KLSA 1FJGQ 3GTLB 3E9IA 2NZ1D 5IODA 3I4MH 3GTMB 2F0PA 3EVQA 3F1ZA 3G6JB 4LF5L 4XTCS 3J7AF 4JYAL 2HHHL 1PH7A 3AEVA 3C46A 4QQBX 2EDGA 1JOOA 2TSSA 5E1FA 1VQGA 4JI2L 4R4OA 3EFXD 4AQYL 3UE0A 1GXDC 4LFAQ 3HOZB 2OCEA 2B2UC 3STBC 3H94A 5IGDA 4EQOA 1K83H 2JEBI 2E2HH 4GKKQ 2JA9A 2F0SA 3HRZC 3S1RH 4BXXG 1OXUA 1S5FD 4NDXA 3GTGB 1SAPA 2ATWA 1D5MC 4JI3Q 4TKOB 1ZEQX 1OXXK 5DEHA 1TWFH 3U9OA 3C3LA 3FMCA 3HOVH 4CKCA 4DFAA 4X3SA 1HR0L 4A3GG 1D1KA 2RHSB 4QUFA 1QWYA 2OEOA 1IW7C 2HHHQ 3PUXA 4PZ8A 1SYBA 2D0PA 3S17B 4A3FG 3B6YA 1X55A 5CYUA 3FDTA 1K8MA 3K8AA 1PH8A 1HNWL 3IFTA 3T56B 4ZYSA 3EN2A 4CKEA 2VB2X 1TR5A 2L1BA 2Z8LA 1PFNA 1JJGA 1EIHA 4A3DB 3NE5B 4HJ7A 2F0VA 4HJAA 2HCIA 3J80L 1AZQA 3HOXG 1LLRD 3S24A 4B3ML 5FLXL 2BE5C 1GUTA 3PQIA 5IGGA 1VQ4A 2WKDA 3ZJYC 2RHQB 3L9AX 4IPCA 1UEBA 2WIIB 3J81E 1G8ZD 1W6JA 4B3TL 4A3GH 5A2QL 3ULLA 1A3VA 5IWAQ 4K5WA 5IIFA 2AUJD 2PYKA 1DD2A 1GUOA 3E3XA 4LF9Q 4IQZA 3MXGA 4X3UA 5E4XA 3QO2A 3GTGH 1HH2P 3J81i 4X65L 3TREA 4QUCA 1SNPA 4QL5A 4JBMA 3L0OA 2CCZA 1CK1A 2WB1G 1O80A 3K7AB 3K6OA 3I4MG 3M4PA 3PIP3 1XMQQ 3TMEA 1PH1A 4JI1Q 4RWSC 3P1HA 1B53A 2D2CC 1E2ZA 1N32Q 1UWVA 1O7ZA 4EVOA 2R92H 3NELA 3PUVA 3BJUA 4WJWA 1V1OA 2XRQD 5CBEE 5JJIA 1HCZA 4BBRH 3I3CA 3RMHA 5BN5A 5EKIA 3HOWG 3S1MB 4A93G 2KJXA 1R4QB 1BO0A 3K5NA 1RIPA 1H95A 2Y0SG 5IP7H 1A2TA 5IWAL 3I73A 5AFWA 3FPUB 1XNRL 3CCVA 2EPBA 2I5MX 2ZJQA 1L1OC 4ME3A 1ASYA 2K5HA 4OO1I 4NKLA 1EOVA 1SYDA 5C4ZA 3T51B 1HZAA 3TP5A 3W1GA 4RGMA 2Q8IB 1PZJD 4G4KA 2BOSA 3ZYYX 2B29A 1IBMQ 4JOIA 4G7OC 3DWQA 1IKLA 1XNQL 4B3RL 3D0FA 1F9PA 3NWTA 1JORA 2K5QA 4DV3L 3SHLA 2JA6B 3S2HB 4RCOA 4RAUC 2K05A 1B9NA 1SYGA 1TXYA 4LF7L 4NW2A 5JEAJ 4C3JH 4V190 2E2JH 3AFPA 2JA5G 2EYFA 2B2WC 2KECA 5IT9E 1SJED 1YNXA 4DR5Q 2JE6I 4Q0FA 1SFOH 4FYDA 2ZXRA 5DNFA 4HIOA 1SNQA 5LHY1 4BBSH 4RA8A 2YTXA 1LT6D 2H1EA 1VF7A 2VB3X 4DR3L 4FF4A 1LUZA 3JAML 2XGTA 4DR5L 5CMDA 4IFDI 1NCVA 5CC4A 1WTXA 3F8TA 2N49A 3A0JA 3BG3A 4TVAB 4OGQC 4JC0A 4LUZA 1SNMA 4M1UB 2DGYA 3K5MA 3OIQA 3DXJC 3PO3H 1HRJA 5FLMH 1UE1A 3TZUA 2Y0SB 1J8IA 2CWPA 4KD3A 5C0XG 4MTNA 4GNXA 5EQ0A 1J5EL 4DR6L 5E3FA 2LFNA 4A3IG 1TS3A 3M7NA 1V43A 3BYYB 3LWEA 2N3SA 1G291 1PRTB 2RVLA 2UU9Q 4KHVA 4WJ4A 1I94Q 5FO7B 5ELEA 1NR4A 4G7ZC 1LO5D 1TIID 5C4XG 4GNXC 3IRBA 3M3YB 4P71A 3DEOA 5EPKA 1D5XC 1PA6A 1D7QA 1BCPB 1WTRA 5CBAE 4Y7NB 2BDNA 2H4OA 2K32A 4HMIA 1ASZA 4LFCQ 4FF3A 1W3SA 2L0CA 4GS3A 5LMUQ 1Z47A 4CBVA 5T1GA 3K5OA 4ZKBB 1CSPA 2K14A 2YTVA 4A76A 3WDNA 3GTOB 3RLFA 1JB7A 3HOUB 2VZAA 4GKJQ 3OMGA 5LMNQ 3JAMc 1IYUA 4JVZA 4A3EG 2BE5D 5CV7A 3I72A 2NVQH 1TVXA 5J22A 5AJ3L 5FJ8G 1DOKA 2EYLA 4JI3L 1YJWA 4KHPQ 3L2PA 4PG3A 2WACA 4GN5A 3QJYA 1TWCH 4MHEA 2E8GA 1VDZA 4PNYA 1J5EQ 2JA8B 1EY4A 3A7LA 4CHTB 4R8NA 5HY6A 2JQOA 1VMCA 3V05A 3HOZH 3NQIA 1NJIC 1S3OA 1YNND 4A4IA 1VCIA 2EQSA 2AUKA 4HSPA 3MVVA 3HG9A 2R6GA 2ES2A 3H91A 5JJLA 1H9JA 2VUMG 4FP5D 2NWGA 3KDFB 4KY7A 4QIWB 1ONLA 1U5KA 3GTPB 2M00A 1XPRA 1K8OA 5C5LA 3GTQB 2K03A 5LMUL 1X56A 2GVAA 1QVFA 1QVCA 3HOUG 2KOLA 1MIUA 2A69C 4GN3B 1NTGA 3SGIA 4C3HG 1EOTA 2CH4W 2EVBA 2R61A 4C2MH 2ZT9C 5I2YA 2PZUA 4IPDA 4DV4Q 1XNQQ 2JA5H 3EIVA 3GQBA 2KEEA 4C1NI 2VXWA 2GN5A 2R7ZH 4KHPL 1MSHA 3OMCA 1N36Q 4N8FA 4XQJA 3K57A 2EYHA 3EROA 1SFOB 2MQHA 1D2BA 3NTKA 1KLGD 3DMUA 1K73C 5M5WB 2UXCL 4KY5A 1G2TA 3KK7A 4LF5Q 1ET6A 1CKMA 2X6LA 2Z9HA 1SRUA 3KFUA 5J3BA 2CW0C 2JA5B 2KBNA 1VQ9A 4WORA 5LL6S 3OSOA 1DXMA 1KXLA 5EAYA 1BF4A 2LY7A 1QCBD 4WFN3 1YIJA 1WCMH 3ND9A 2NVYB 4A3FH 2VY3A 3P75A 2AHOB 1HNZQ 3M4YA 5IY0A 4C3HH 4UY8C 3KF8A 3A74A 4OO1G 3OOCA 3LNNA 1Z9FA 3U50C 1DCZA 2PQAA 2DY7A 2WP8J 1IL8A 2WAQE 1HUMA 1P16A 4DAYB 2HUGA 4K2LA 3KBXA 1I5FA 4OEMB 2QF7A 5HURA 3RZOB 3MXPA 3W5OA 1WTWA 4J1MA 1B44D 2QEXA 4BXXH 5IGEA 3UE1A 2A68D 1LTAD 1KDBA 4A3JG 4KV6A 3S1NB 1QNUA 4TSSA 1QZGA 1PH4A 1UE5A 1DJRD 1LTTD 5A35A 2IHEA 2E76C 2CWAA 3BDCA 1I94L 3I8ZA 2MNAA 4JV5L 2NTTA 4F88A 3GTKB 5C3WA 4HN7A 4A3CH 3BDLA 2ICEC 4A93B 3H0GG 3WWVA 2B2UA 3J80E 1FGBD 4ZUJA 3H09A 1RJTA 1ZYRD 1N36L 2EXZA 2F0EA 2A69D 2HCCA 2MHVA 4MZ9A 3M9BA 2WAQG 2KENA 2SNMA 1BBWA 4KLKA 4A93H 1S5ED 1GUNA 2F0KA 4KMUC 1QILA 3CD6A 1Y1VB 1XXGA 4KKTA 5IYBH 4DR1L 2K5DA 3J80i 1WVLA 3P7JA 3M4QA 1Z6HA 1HQRD 2VQEL 1JC7A 3IL8A 1DGSA 2IJ0A 4JI4Q 2HDMA 3GV3A 2VS1A 4KK7A 4JK1C 1TY2A 4ZLTF 1Q8IA 1LV9A 2N78A 4FXGC 3RZOH 1K8GA 3CCMA 4LF9L 1CUKA 4KTAA 4UPAA 2JSOA 2WV6D 1II3A 4FVMA 1CSQA 2K28A 1C9OA 4L8JA 4P73A 4LF4L 4RHRA 2NN6G 3OTOL 5JOBA 1PFMA 1R4PB 2HD3A 4OONA 5DLQE 3PO2B 4O42A 3R93A 1EYDA 3J7ZC 1E3PA 3CCQA 1X9NA 2A6HD 2BA1A 1CQFA 2R93H 1Q1BA 4RG1A 1UUPA 3H3VC 3KJOA 2EE1A 1AE2A 5C4JH 3MHBA 5ELOA 1B1ZA 2HIVA 1U4LA 2F0DA 2ID0A 1JWMD 1VQ6A 3GV6A 3FVQA 3NUCA 4PV1C 4ALPA 1LTLA 2NBFA 3PIO3 2B8GA 2C9OA 1VQPA 5M3MG 5G3LD 2K52A 1DONA 4K0KL 4A3DG 3U9SA 4DR2L 2L11A 4K8IA 1I4QA 2ZXPA 1T9HA 3TP6A 1AN8A 2SNSA 1NBWA 1KDCA 1Y1WH 4B3TQ 5H1SE 1YHQA 1V1QA 1KLUD 3HKZE 4IO9A 4AYBE 2AWNA 1UNSA 4JI8L 2V1CC 1SBBB 1YEZA 5IGCA 4JBJA 2CVRA 1YNNC 1E0BA 4HIKA 3W1BA 2F0TA 3ICEA 4GOPC 5ELNA 4HCSA 1RCVD 1HNWQ 4MTKA 2F0WA 1R9TB 3G48A 1L2FA 4NXML 4JG2A 1I4HA 1VQBA 2Z4HA 3ULPA 2Q8TA 3CPFA 5ELCA 2B3GA 4GN4B 1E24A 3GTPH 4XQQA 4XYOA 4HCEA 1XMOQ 1MD2D 1SYCA 4GOPB 2CQAA 3UDFA 3D6CA 3E0JA 4K5VA 1I3QB 3SDZA 4IUQA 4HJ5A 1IKMA 4L5QA 2BH8A 2R92B 4UP7A 1CHPD 3CQZB 1VQLA 3I4NB 1EWIA 1RTOA 3NXWA 4JI7Q 1I4GA 4CKBA 3RR5A 1HNZL 2JXMB 4LUOA 5D65A 3K7AH 3VA5A 4BY7H 2LSSA 3I2ZA 3I4OA 1TWHH 2L55A 4LF8Q 2QGQA 3KLWA 2K33A 1HZCA 2L12A 1SR3A 4DV5Q 2RCNA 3UDGA 2R3ZA 1S40A 5IYDG 1PV4A 2WINB 4DV0Q 1P8LA 1XTDA 1TT2A 3MA2B 4Q5VA 3CW2C 1EY0A 2WFWA 1Q12A 1GO3E 1MI2A 4DR4Q 4A3MG 4QF4A 4DPGA 3H0GB 4B08A 4G57A 1F77A 3AMUA 3GP7A 1GHJA 4CDDC 1CI3M 2K5WA 1RHPA 1VQJA 2PMZE 1PVOA 1N33L 1ZXTA 2AKWB 3HOYH 2GA4B 2L5TA 3V2TA 2PCFB 1GM5A 1BBXC 1U4MA 5CV4A 2B63G 3HOYB 3QR8A 3TSSA 2Z1CA 3U4ZA 2VNUD 1VQDA 2K6AA 3JC66 2UXDQ 1KNEA 2XIWA 3D31A 1QUQA 2J4XA 1YITA 1S5BD 1ESFA 3AYHB 1H9MA 2E2DC 4P74A 4X64Q 5JVH3 2ZTDA 1BOSA 5K5PA 4M8AA 4LMQD 4A3GB 2I5HA 1C7YA 2NVXB 4X64L 1RTNA 5EKLA 4QIWE 4IOCA 1GVPA 1XMOL 1EZ8A 4C3JG 3NTHA 4QGUA 1G6PA 1QG7A 3KF6B 5EBDA 5KNDA 2D9UA 1HZBA 2F4VL 4GZYC 4A3BG 1UEAB 2L9HA 1PLFA 4AIMA 4A3KH 1A2UA 1GD7A 4JI0Q 2RDHA 5JPNC 2AQ1B 4IUUA 3TN2A 2F0QA 5C5MA 5DM63 1KTKA 1Q1EA 4F87A 3NWSA 4CDEC 3OWEB 1DYQA 1EEID 4MNOA 1RD9D 1UE6A 4RKBA 3C2PA 3PIOA 1I4PA 1SE8A 3DHQA 4JBKA 3MFGA 2EYPA 2Z6BA 1E2WA 3UI2A 2EYJA 3T16A 4XDXA 5M3MB 2Z6KC 1J6QA 2FFKB 3EQLC 3T13A 1H9RA 1PMRA 1FR3A 1G6ZA 2RF4A 2CH4A 2R93G 2TMPA 2A74C 3QWNA 1K3BC 3M85A 4JV5Q 3Q23A 3S2DB 4ABNA 3GD7A 3CXCA 1T5XD 3NPPA 3MEHA 4OWTB 5FOBB 1A62A 1ZYRC 1CKOA 3VR6A 3Q8DA 1VQHA 1PH9A 5CV6A 4XQNA 3TEHB 3HGBA 3G7LA 3PUZA 4FXDA 2K5NA 1IYJB 1FD7D 4NMZA 2A68C 4KY6A 1I6VC 1FL0A 1PH6A 2N55A 1EIFA 2ZXOA 3VR2A 2EOTA 1ENFA 2SOBA 3MXNB 1PYSB 2EIFA 1BKBA 1K3RA 2Q2UA 1WCMB 4LUVA 3A5ZB 4I7AA 1SNCA 3NP8A 4J6HA 1B3AA 5FJ8H 1OXTA 2LS01 3CCSA 4CDCC 4NPSA 5I6WA 3J81j 4DR7L 3OWFA 5BR8L 4KKUA 1SEBD 4I7ZC 2QEJC 5LMNL 1MSGA 2KHIA 1CT1D 3V96A 1BCPF 1IBLQ 4DV6L 2K50A 5IT9c 2Z4IA 3HOVG 3BVMA 3VYUA 2E2JB 4DV7L 1PRTF 4RGTA 3HFZB 2JP1A 3KF6A 1RF2D 3AFQA 5JAVA 1JOKA 5C44B 2RKSA 1Y8NB 3LWUA 3Q6SA 1LTID 3P20A 1STGA 4R4TA 1M8AA 4A3LG 4A3CG 2WB1B 2OQ0A 5M3FG 2KUMA 3ULJA 2VL6A 3HEJA 2F3IA 1VQCA 3ERQA 3F2CA 1XNRQ 2SEBD 4ZAIA 4FF2A 3AB9A 3S16H 3ITPA 4JI5L 4FF1A 4DXGA 2K01A 5KNBA 4L63B 2EYOA 4O2DA 4A3MB 1IBLL 4PMWA 5CORA 1G91A 1OXVA 1PZKD 1W6KA 2F03A 3FEWX 1RODA 3PSIA 1F2ZA 4YWLA 1K8AC 2ZTEA 3IFDA 1N32L 2AWOA 1TY0A 2ZM6L 3TQYA 4YIJA 1HNXQ 3BVZA 3CMAA 4UP8A 5M5XB 4POGA 3RD4A 2IPKD 2NN6I 1WTHA 1K83B 1MJCA 3RLOA 3OIPA 1STBA 2F0NA 4LF4Q 5FK9C 4K8JA 3HOUH 3K0XA 1VQOA 1WTVA 3S1QB 3ONAB 2EY6A 2C5CA 2JA6H 3GDEA 3H3VI 1HHVA 1IBKQ 1SMYD 4LFCL 2LXJA 1EWHA 3AU7A 4KJOA 3R8BA 3G6EA 2WAQB 3A8JE 1BCPD 4K5XA 1ESRA 4APVA 3K7UC 2JN4A 4BY7B 3DLLA 1QNKA 5IGBA 4JI4L 3GTKH 3TS0A 3GTJB 2H5XA 1Z7TA 5LL6X 2EY1A 4PZ7A 1U4PA 3IAYA 2NVTB 4A3FB 5E7NA 4IUPA 1UAPA 3K80C 4QCLA 4NXNQ 4A3KG 5IP7G 3CCEA 2FXQA 1YJNA 1EFID 1BUVT 1I3QH 1H9KA 2PMZB 4DAMA 4K14A 1V1PB 1FNUA 1EYCA 5C44H 3H15A 4K2KA 3K81C 2YU9B 1HZ9A 1HXYD 1T5EA 2A6EC 2LKVA 1KIXA 3I4NG 1L0XB 4BBRB 4LF8L 3QB3A 1TWGB 1SN8A 3HZXA 2XWJB 3TZDA 2UUAL 1J9OA 4Y52H 1CKNA 1EU3A 1PFSA 2MPMA 4BY7G 2M2LA 5G3LF 4YHHQ 3E6ZX 1C8CA 1B8AA 1MGSA 2JA6G 5NUCA 1LTBD 4RHSA 1F2YA 3F2UA 3CF5A 1FVIA 2R93B 3SE0A 2NVYH 4IN3A 1X3QA 5FLMG 3T4AC 3CC2A 1U0LA 4ME5A 3NENA 3VYRA 3NQTA 3A54A 4X65Q 4NXMQ 1B7YB 5FO9B 4DA2A 1EYGA 2F0GA 1K28A 3U4VA 3I55A 1OXSC 3OHXC 4KN7C 3RZDB 3DWPA 3L3OC 2MO0A 2UXDL 1VQFA 5KYIA 3RNUA 1DM0B 1TWGH 1K0SA 2OXPA 1EYAA 2CFMA 4QB4A 3S14B 4DK6C 4O1NA 3ERSX 5J39A 1S5CD 3BDOA 3EA6A 3CCLA 1V1PA 4J8QA 2IY5B 1MBYA 3RUZA 4A3DH 1SROA 3A55A 1EQTA 1VQEA 2ASBA 3L7ZC 1M4VA 4X6AH 3PIPA 3BS1A 4JI0L 1PZID 3GTMH 3I4MB 2YYZA 5C4HA 1KL9A 1HTPA 2ZTCA 1PHJA 3DM3A 5COYA 2F4VQ 1D6EC 1S4ZA 2IX3A 1KAWA 1I50H 3PV0A 5CGKA 1TU2B 1X54A 4U673 5I9PA 3CU7A 5M9OA 1MJEA 5J1ZA 4POFA 1EFWA 2JA7H 4LFBQ 2PZWA 3VA7A 2WB1E 3MTSA 1TQOA 3HOVB 1JWSD 3F2DA 1BBUA 2V4DA 3I90A 1O7LA 3Q22A 1HR0Q 4JI6Q 2BA0A 1Q8KA 1YHAA 4DUYQ 1EIGA 4DV5L 1A0IA 5KRUA 3S1QH 1VF5C 2ZM6Q 1U9RA 5C44G 4IUTA 1EQVA 1HFNA 1YNJC 3SK4A 2D5DA 1AP0A 4ID6A 4C1NK 4BBSG 2EJGC 3OTOQ 5CV8A 4LW1A 5M5XH 5IP9H 1NR2A 1HR0W 4LAAA 4L6TB 1HQMC 4XIGS 5M3FH 3M4OH 4TRDA 4UDUC 1VQMA 1HNXL 3CPWA 2F3VA 3MWYW 4FNFA 2PNRC 3A5UA 2JA8G 2XTIA 5GROA 4R4IA 3S16B 1SNOA 5CR3A 2E5LQ 3VYSA 2R92G 2RCFA 2NYZD 3CRKC 2KCMA 2A1AA 1CM9A 1BR9A 1BNZA 1IYVA 2CW0D 1L0WA 4DNTB 1PRTC 1EY5A 5JJZA 5KNCA 2UUAQ 4ZKCB 1IL2A 3PO3B 4GLXA 1SMXA 4LF7Q 3E0EA 3HOWH 1NMFA 5EGTA 3CKIB 4RFBA 2QKIC 2K04A 2HIXA 2UXBL 4LNQA 3OYYA 2ZJPA 4B3RQ 1RL2A 3VDYA 4BS9A 4LJZC 2L4NA 1EQRA 2NB0A 2MP1A 4OIKA 4FDBA 2EXDA 1X3EA 4PQXA 4A75A 1Q81C 2FJ2A 4ULLA 5ELDA 4IJLA 2FHTA 2BCOA 2XSCA 1TS4A 1QZHA 1NNXA 1JJCB 3TP7A 2UXCQ 1V8QA 1WD0A 2Q2TA 2RSOA 1Y8OB 2ICIA 1E2VA 1MHWC 2KHSA 4AYBG 1QUQB 2J0TD 1PDQA 2K75A 3D4RA 4DNIA 4C3HB 1YI2A 5IGFA 1AFPA 1ILQA 1KD1C 1VQIA 1PH2A 1FNWA 1OTCA 3D4WA 3C1FA 2R7ZB 3A8IE 3CC7A 4B3SL 2XNAC 2XWBB 1A8VA 1B4OA 3KDFA 4FXKC 1GOZA 2CHBD 1PFBA 1KABA 2GVBA 1SMYC 3TP8A 1WFQA 2KEDA 3EJIA 2FINB 4V0BA 3MAQA 4IALA 5I2XA 4OWWB 2I07B 3I7FA 2B63B 4ZQ3A 1XMQL 3GO5A 3OW2A 4CJ1B 4AQYQ 4S3SA 1JQYD 5M5WH 2VQFQ 2VUMB 4YHHL 3I4NH 2CKZB 4CDFC 2OTJA 3HS0C 1E7ZA 1QVGA 3HKZB 4XYQA 4JYAQ 3E5SA 4C3JB 3J7A5 5FO8B 2N88A 1JMCA 1ICFB 1L1OB 4JI5Q 1CA5A 4R9WA 1HUNA 4YWMA 5C6AA 1Q7YC 5D3IB 2QDBA 1WTOA 4JBWA 2UUBL 1IZ6A 3S2DH 2IW3A 2IL8A 1C48A 2JA8H 3T1YQ 4B3SQ 1D8LA 1H9SA 3BYTB 5JVG3 3HKZG 3W2DA 2PW5A 3GTJH 4OWXB 2XN9C 3I70A 4DUZQ 5DAUA 3GTQH 5AJ3Q 1IHZA 2UU9L 4YCVA 2MJ8A 4L5TA 5D14A 4GKJL 3MFYA 4DV0L 1EY6A 1Q86C 4DNRB 1SDFA 5BN4A 5GAGC 3BZKA 4H0LC 1K0RA 3Q0AA 1VQ8A 5GAHC 4DV1Q 1TWAH 2A6ED 4B9WA 3KYHC 4OIJA 5KIXA 3UDIA 3TRZA 2D62A 2EY2A 3HOXB 1KAAA 2F4IA 1FGUA 4DV4L 1GJXA 1UE7A 1JICA 4RCNA 4TQUS 3QOJA 1YZ6A 2SDFA 1NAPA 2XVSA 4HIDA 4EGVA 4C3IB 4PMBA 1WCMG 3O13A 5HGQA 1KQSA 3FPPA 3VYTA 4OO1H 3D6WA 2ZJRA 1JE4A 1X3FA 4K6DA 1JE5A 2O5JC 4DGZA 3T53B 2B2VC 4N9PA 2E74C 4OX9Q 3AQQA 2M9VA 3PO2H 4HSVA 3J81L 3I4LA 1QJOA 5ISRA 4RGNA 2DY8A 1YNJD 4U68A 1PYWD 1IXRA 4N8X1 2A5HA 4JCVE 5FLXE 5L37A 3S17H 4OELB 2K1BA 2DJFC 4KD4A 4Y7NH 4DV3Q
chains in the Genus database with same CATH topology
4I7AA 2HD3A 4JVZA 2QW7A 2RCFA 4N8X1 4JW0A 2Z9HA 5L37A 4N8FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I7A A;  2HD3 A;  4JVZ A;  2QW7 A;  2RCF A;  4N8X 1;  4JW0 A;  2Z9H A;  5L37 A;  4N8F A; 
#chains in the Genus database with same CATH topology
 5CV5 A;  2HQL A;  3D8G A;  2F0M A;  4NXN L;  4A3I B;  2EYM A;  4A3J H;  1KDA A;  4JI1 L;  1AE3 A;  2RSN A;  2E2I B;  2I0Q A;  1CQV A;  2K4K A;  1BDO A;  2X6G A;  3NTI A;  3JAM E;  1LTG D;  4H13 C;  1ICW A;  3NBI A;  1QB5 D;  2UUC L;  3T1Y L;  3PF5 A;  1EQQ A;  2O5I C;  1A6X A;  1VS0 A;  1LT4 D;  4LFB L;  2E2H B;  3QOL A;  2QIL A;  2J7Z A;  1Y1V H;  4K0K Q;  4Z9C B;  3OPO A;  4X66 Q;  1PRT D;  4X62 Q;  1CA6 A;  3S2H H;  1WTQ A;  4DK3 C;  3H3V H;  3NSW A;  2PI2 E;  5GAD C;  2A6H C;  1HTL D;  4PZ6 A;  1LM0 A;  1LTS D;  2AQ2 B;  1TWH B;  2QA4 A;  1PTO C;  2F0I A;  4EQP A;  1GKH A;  3QIA A;  1M1K C;  1KNA A;  3W3A A;  1GHK A;  4R1J A;  1NUC A;  3BU2 A;  2O2L D;  3MXU A;  3SR1 A;  4F8M A;  4ILW A;  2A8V A;  1O78 A;  4A3B B;  4X3K A;  5M3F B;  2EZV A;  1I50 B;  1LAC A;  4JW0 A;  3VR3 A;  5JJK A;  5TSS A;  1XPO A;  2DUD A;  1Y14 B;  4DU9 A;  4ZRZ A;  2JK8 A;  1HPC A;  2FMM A;  3DM1 A;  1CTM A;  2UXB Q;  3SK5 A;  3Q24 A;  4GOP A;  1CZW A;  1ET9 A;  3H6M A;  4A3L H;  1M90 C;  1Q3L A;  5ELF A;  1B50 A;  3KLS X;  1AH9 A;  2LMC B;  2F0L A;  3S1M H;  4DUY L;  1X65 A;  5JPM C;  3VR4 A;  4LF6 L;  1N9W A;  4IFD J;  2F0U A;  1QOH A;  1XWE A;  3S14 H;  1X3G A;  1CHQ D;  2RA4 A;  4IPG A;  1PTO B;  3DEP A;  1VQA A;  3R3O A;  2F0O A;  2R7F A;  4B3M Q;  1EZ6 A;  5D3D A;  3ER0 A;  3KBG A;  3GTL H;  1B3Q A;  5C4X H;  1STN A;  4HIM A;  3OW7 A;  4BY1 B;  3HKS A;  4UP9 A;  2B2Y C;  4GLA C;  3CCR A;  2BDO A;  2A73 B;  2O4X A;  1EY9 A;  3NBH B;  1N33 Q;  1Y1W B;  3I56 A;  2JYO A;  4DAY A;  2I5L X;  2G9H D;  2NUC A;  5GQO A;  1X3P A;  2DNE A;  1STE A;  3PUW A;  1MKH A;  3NHH A;  3CME A;  2PPB C;  3G4S A;  2NN6 H;  1WYD A;  5EJW A;  3N52 A;  5IE8 A;  2B8F A;  2MO1 A;  2E5L L;  4AH6 A;  3BZC A;  3WOF A;  5EKK A;  3R2T A;  4GLV B;  1Y1W G;  1HA6 A;  1BVS A;  4X66 L;  1I6H B;  4IUN A;  5I6Y A;  4A3K B;  5C4J B;  1S5D D;  1Y69 U;  1OO9 B;  3PO2 G;  5I9O A;  3RZD H;  1PH5 A;  2A19 A;  2Q2H A;  4N9T A;  1RKN A;  4H44 C;  2K7V A;  2AMC B;  1EY8 A;  4QMG A;  2IWH A;  1YJ9 A;  2HT1 A;  2UUC Q;  4HMJ A;  2KHJ A;  3SK6 A;  1WOC A;  2YV5 A;  5IYB G;  2B39 A;  1ENC A;  2DN8 A;  5C0X I;  4X3T A;  3CC4 A;  3PCO B;  4LWC A;  4A3E B;  4BBR G;  4HJ9 A;  4EQN A;  1NSN S;  1KC8 C;  4A3J B;  2KQ3 A;  4KJN A;  2MFI A;  5C3E B;  1SE4 A;  1SND A;  3CHB D;  1SE3 A;  3UDX A;  3RN5 A;  1CZG A;  1YHB A;  5T1I A;  1EEF D;  1RDP D;  3PMF A;  5M5Y B;  4OHJ A;  4KKS A;  3VR5 A;  4JI6 L;  1S72 A;  4ZK9 B;  2VQF L;  1A15 A;  3T1H L;  2MGS A;  2N8N A;  2PO4 A;  5LMN W;  2RDG A;  3J7Y W;  4DK0 A;  4DV2 L;  4KI0 A;  1V9P A;  3R2I A;  1TWF B;  1K9M C;  1CFM A;  2PW7 A;  2IX0 A;  3CCJ A;  1LYL A;  3M4O B;  3RLN A;  3K0Y A;  3J80 c;  2YTY A;  3EBE A;  3IKJ A;  2F0F A;  5IOC A;  4IJH A;  4KHZ A;  2B2V A;  5KGU A;  3DUZ A;  3MZ5 A;  5C0X H;  5JEA G;  4L5S A;  4CJ0 B;  3DWA A;  1EU4 A;  1KRS A;  4IPH A;  4DV1 L;  4C3I H;  1XX8 A;  2KVM A;  2PNH A;  3FHW A;  4A3B H;  3J7A V;  4DR4 L;  1G2S A;  1D1I A;  3D4D A;  4HR7 B;  1YBY A;  1AW7 A;  1BCP C;  3HOX H;  4KN4 C;  4MN3 A;  3SK8 A;  5C3E G;  4C3I G;  4NP5 A;  2OTL A;  1U4R A;  1Q82 C;  2CQO A;  3KOJ A;  1TWA B;  2R7D A;  4GNX B;  3X3N A;  1F2L A;  4DK1 A;  1N34 L;  4E6I A;  3NK9 A;  2B2Y A;  1W2B A;  3LGJ A;  1BXT A;  2QDL A;  1VQK A;  4R8I A;  3S1R B;  1PYB A;  1HJP A;  4BA1 I;  2NZH A;  4H7B A;  2I46 A;  3CAM A;  4IUR A;  1STH A;  1A63 A;  2KCT A;  4MIU A;  2RBM A;  1PTO H;  3X3M A;  2ALY B;  1C0A A;  1LTR D;  1TS2 A;  4LK1 C;  3M3Y H;  3CQZ H;  1GUS A;  3G71 A;  2Z6K A;  4JI7 L;  2KCC A;  1WI5 A;  1GUG A;  3S9W A;  4R4C A;  1JOQ A;  4DV6 Q;  4DV2 Q;  4IUV A;  4RGO S;  1Y8P B;  4OXP A;  5JEA H;  4QY7 A;  2PI2 A;  1NE3 A;  5C0X J;  3F2B A;  3FKI G;  3KJP A;  2JA7 B;  3S15 B;  1TS5 A;  4JOI C;  1FYC A;  3STB D;  4EX5 A;  2LXK A;  1R9T H;  5C3E H;  1JT8 A;  2VUM H;  3FKI H;  3T1H Q;  2IT1 A;  5GAE C;  1GUW A;  1I4R A;  2B2T A;  2JEA I;  4JI2 Q;  1BQQ T;  1F9Q A;  5CV9 A;  4DXF A;  1AEX A;  2F0H A;  4I65 A;  3J81 c;  2B2W A;  1SYF A;  4HAE A;  4J15 A;  2L15 A;  5C3X A;  2KCN A;  3ND8 A;  3MEF A;  1DOL A;  4WRD A;  3RN2 A;  1PXU A;  5EPJ A;  3A7A B;  2EY5 A;  1WD1 A;  1D5Z C;  5ELB A;  3K58 A;  2NTS A;  2RQX A;  4IZ8 A;  5K36 H;  3QG1 A;  2F0J A;  2NZO A;  4EQ5 A;  3FP9 A;  4HTH A;  2OWO A;  4DR2 Q;  2QW7 A;  1ZKO A;  4F7X A;  2IX1 A;  4ZUI A;  4NB3 A;  2PZT A;  4FO2 A;  1H9S B;  1LAB A;  2EJF C;  4QJF A;  5K36 G;  4CJ2 C;  1E22 A;  2VW9 A;  4DF7 A;  2YU9 H;  5HGT A;  3MXN A;  4O0A A;  3U58 A;  3I91 A;  5EPL A;  2OF1 A;  4YY3 L;  2E2I H;  4JPB W;  1ML0 D;  1SE2 A;  1SLJ A;  3WOE A;  5C4X B;  4A3I H;  4RKL A;  2NVT H;  4R4Q A;  3NBH A;  1EUJ A;  3JAM i;  3K59 A;  1PTO D;  2C35 B;  2DJG C;  4C2M B;  1F9R A;  3CCU A;  3LX0 A;  2F1M A;  3HP3 A;  1N8R C;  1B9M A;  3HOZ G;  1Q46 A;  3KLR A;  3HOY G;  2F3W A;  5KYL A;  1STA A;  5DM7 3;  1VQN A;  1E1T A;  3KF8 B;  4ODG A;  1XYI A;  3BVG A;  1VQ7 A;  4CGY B;  5FLX c;  3SEB A;  3C1E A;  3S15 H;  3PUY A;  5IP9 G;  2HQE A;  4UAI A;  4H02 A;  1WJJ A;  4LF6 Q;  4K6L A;  1X32 A;  4GKK L;  1EIY B;  5BR8 Q;  1Q90 A;  4DR7 Q;  2Q2I A;  2WKC A;  1YVC A;  1HFG A;  2Z0S A;  3URY A;  5IT9 L;  2R7Z G;  1PH3 A;  3BZD B;  2K5V A;  2IHF A;  4JI8 Q;  3KUP A;  2X69 A;  4PMC A;  1G51 A;  3M7G A;  3TBI B;  1XPU A;  2NVQ B;  1EY7 A;  1F2M A;  1TWC B;  4A3M H;  3SVM A;  3A56 A;  1SSO A;  1TKW B;  2KA7 A;  4BA2 I;  4DAP A;  5M3M H;  4BWG B;  1STY A;  2B2T C;  4DV7 Q;  3SXH A;  2BH2 A;  1PTO F;  2PQE A;  1L0Y B;  1LT5 D;  3D3R A;  3GTO H;  2NVX H;  1IW7 D;  1NY4 A;  4HED A;  2OQK A;  2QCP X;  1DOM A;  4P72 A;  4UHV A;  3N6R A;  4XXE A;  1LT3 D;  4DUZ L;  4RH6 A;  4X62 L;  1HA5 A;  2VQE Q;  4P2C B;  2OT2 A;  3PF4 A;  1XTC D;  2G9D A;  1JCK B;  4A3E H;  3A8K E;  3CRL C;  3TS2 A;  3S1N H;  4IFD G;  2G5D A;  3NEM A;  4YY3 Q;  2XRS D;  5IYC H;  2UUB Q;  1O7I A;  1AZP A;  4IOA A;  1CKN B;  2P5Z X;  3K5L A;  1IBK L;  1SYE A;  1NMG A;  1F9S A;  4G7H C;  2JA7 G;  5EBC A;  5BN3 A;  1A3T A;  1XJV A;  1JWU D;  3HOW B;  4YWK A;  1KHI A;  4WJ3 M;  4DR6 Q;  4RMF A;  2B63 H;  4OX9 L;  4DAV A;  5M5Y H;  4YCU A;  1L1O A;  4BY1 G;  2E75 C;  1JR0 D;  1WTP A;  4C56 C;  5F2D A;  1SXT A;  1SJH D;  1ENA A;  3PO3 G;  2RDF A;  4BBS B;  4OL7 A;  1FJG L;  5KEE A;  5FKA C;  1JJ2 A;  5IYC G;  1KRT A;  4B9X A;  1EWC A;  2PQA B;  4XT3 B;  2AQ3 B;  3E9H A;  3MC0 B;  5A2Q E;  4DR3 Q;  5I4D A;  4IFD H;  2JJQ A;  1C4Q A;  5E4W C;  2Q8R E;  2FMC A;  2Y0S E;  1N34 Q;  1I6H H;  4LFA L;  1I4X A;  3H0G H;  5IYD H;  1O7Y A;  3TDQ A;  1X6O A;  1VQ5 A;  4YCW A;  2D0O A;  3FRP B;  4L5R C;  4DR1 Q;  4HJ8 A;  1Y1V G;  1EL0 A;  1VMP A;  1A3U A;  4ZCK A;  2EJM A;  1E1O A;  3PGZ A;  4AYB B;  4DN4 M;  1QE6 A;  2HDL A;  2F52 A;  4P75 A;  1B70 B;  2MUY A;  2ENB A;  1ILP A;  3CP0 A;  2DNC A;  4BY1 H;  1DZ1 A;  1B2T A;  4DKA C;  1IBM L;  1JB3 A;  4XT1 B;  1FNV A;  3FKI B;  3KLS A;  1FJG Q;  3GTL B;  3E9I A;  2NZ1 D;  5IOD A;  3I4M H;  3GTM B;  2F0P A;  3EVQ A;  3F1Z A;  3G6J B;  4LF5 L;  4XTC S;  3J7A F;  4JYA L;  2HHH L;  1PH7 A;  3AEV A;  3C46 A;  4QQB X;  2EDG A;  1JOO A;  2TSS A;  5E1F A;  1VQG A;  4JI2 L;  4R4O A;  3EFX D;  4AQY L;  3UE0 A;  1GXD C;  4LFA Q;  3HOZ B;  2OCE A;  2B2U C;  3STB C;  3H94 A;  5IGD A;  4EQO A;  1K83 H;  2JEB I;  2E2H H;  4GKK Q;  2JA9 A;  2F0S A;  3HRZ C;  3S1R H;  4BXX G;  1OXU A;  1S5F D;  4NDX A;  3GTG B;  1SAP A;  2ATW A;  1D5M C;  4JI3 Q;  4TKO B;  1ZEQ X;  1OXX K;  5DEH A;  1TWF H;  3U9O A;  3C3L A;  3FMC A;  3HOV H;  4CKC A;  4DFA A;  4X3S A;  1HR0 L;  4A3G G;  1D1K A;  2RHS B;  4QUF A;  1QWY A;  2OEO A;  1IW7 C;  2HHH Q;  3PUX A;  4PZ8 A;  1SYB A;  2D0P A;  3S17 B;  4A3F G;  3B6Y A;  1X55 A;  5CYU A;  3FDT A;  1K8M A;  3K8A A;  1PH8 A;  1HNW L;  3IFT A;  3T56 B;  4ZYS A;  3EN2 A;  4CKE A;  2VB2 X;  1TR5 A;  2L1B A;  2Z8L A;  1PFN A;  1JJG A;  1EIH A;  4A3D B;  3NE5 B;  4HJ7 A;  2F0V A;  4HJA A;  2HCI A;  3J80 L;  1AZQ A;  3HOX G;  1LLR D;  3S24 A;  4B3M L;  5FLX L;  2BE5 C;  1GUT A;  3PQI A;  5IGG A;  1VQ4 A;  2WKD A;  3ZJY C;  2RHQ B;  3L9A X;  4IPC A;  1UEB A;  2WII B;  3J81 E;  1G8Z D;  1W6J A;  4B3T L;  4A3G H;  5A2Q L;  3ULL A;  1A3V A;  5IWA Q;  4K5W A;  5IIF A;  2AUJ D;  2PYK A;  1DD2 A;  1GUO A;  3E3X A;  4LF9 Q;  4IQZ A;  3MXG A;  4X3U A;  5E4X A;  3QO2 A;  3GTG H;  1HH2 P;  3J81 i;  4X65 L;  3TRE A;  4QUC A;  1SNP A;  4QL5 A;  4JBM A;  3L0O A;  2CCZ A;  1CK1 A;  2WB1 G;  1O80 A;  3K7A B;  3K6O A;  3I4M G;  3M4P A;  3PIP 3;  1XMQ Q;  3TME A;  1PH1 A;  4JI1 Q;  4RWS C;  3P1H A;  1B53 A;  2D2C C;  1E2Z A;  1N32 Q;  1UWV A;  1O7Z A;  4EVO A;  2R92 H;  3NEL A;  3PUV A;  3BJU A;  4WJW A;  1V1O A;  2XRQ D;  5CBE E;  5JJI A;  1HCZ A;  4BBR H;  3I3C A;  3RMH A;  5BN5 A;  5EKI A;  3HOW G;  3S1M B;  4A93 G;  2KJX A;  1R4Q B;  1BO0 A;  3K5N A;  1RIP A;  1H95 A;  2Y0S G;  5IP7 H;  1A2T A;  5IWA L;  3I73 A;  5AFW A;  3FPU B;  1XNR L;  3CCV A;  2EPB A;  2I5M X;  2ZJQ A;  1L1O C;  4ME3 A;  1ASY A;  2K5H A;  4OO1 I;  4NKL A;  1EOV A;  1SYD A;  5C4Z A;  3T51 B;  1HZA A;  3TP5 A;  3W1G A;  4RGM A;  2Q8I B;  1PZJ D;  4G4K A;  2BOS A;  3ZYY X;  2B29 A;  1IBM Q;  4JOI A;  4G7O C;  3DWQ A;  1IKL A;  1XNQ L;  4B3R L;  3D0F A;  1F9P A;  3NWT A;  1JOR A;  2K5Q A;  4DV3 L;  3SHL A;  2JA6 B;  3S2H B;  4RCO A;  4RAU C;  2K05 A;  1B9N A;  1SYG A;  1TXY A;  4LF7 L;  4NW2 A;  5JEA J;  4C3J H;  4V19 0;  2E2J H;  3AFP A;  2JA5 G;  2EYF A;  2B2W C;  2KEC A;  5IT9 E;  1SJE D;  1YNX A;  4DR5 Q;  2JE6 I;  4Q0F A;  1SFO H;  4FYD A;  2ZXR A;  5DNF A;  4HIO A;  1SNQ A;  5LHY 1;  4BBS H;  4RA8 A;  2YTX A;  1LT6 D;  2H1E A;  1VF7 A;  2VB3 X;  4DR3 L;  4FF4 A;  1LUZ A;  3JAM L;  2XGT A;  4DR5 L;  5CMD A;  4IFD I;  1NCV A;  5CC4 A;  1WTX A;  3F8T A;  2N49 A;  3A0J A;  3BG3 A;  4TVA B;  4OGQ C;  4JC0 A;  4LUZ A;  1SNM A;  4M1U B;  2DGY A;  3K5M A;  3OIQ A;  3DXJ C;  3PO3 H;  1HRJ A;  5FLM H;  1UE1 A;  3TZU A;  2Y0S B;  1J8I A;  2CWP A;  4KD3 A;  5C0X G;  4MTN A;  4GNX A;  5EQ0 A;  1J5E L;  4DR6 L;  5E3F A;  2LFN A;  4A3I G;  1TS3 A;  3M7N A;  1V43 A;  3BYY B;  3LWE A;  2N3S A;  1G29 1;  1PRT B;  2RVL A;  2UU9 Q;  4KHV A;  4WJ4 A;  1I94 Q;  5FO7 B;  5ELE A;  1NR4 A;  4G7Z C;  1LO5 D;  1TII D;  5C4X G;  4GNX C;  3IRB A;  3M3Y B;  4P71 A;  3DEO A;  5EPK A;  1D5X C;  1PA6 A;  1D7Q A;  1BCP B;  1WTR A;  5CBA E;  4Y7N B;  2BDN A;  2H4O A;  2K32 A;  4HMI A;  1ASZ A;  4LFC Q;  4FF3 A;  1W3S A;  2L0C A;  4GS3 A;  5LMU Q;  1Z47 A;  4CBV A;  5T1G A;  3K5O A;  4ZKB B;  1CSP A;  2K14 A;  2YTV A;  4A76 A;  3WDN A;  3GTO B;  3RLF A;  1JB7 A;  3HOU B;  2VZA A;  4GKJ Q;  3OMG A;  5LMN Q;  3JAM c;  1IYU A;  4JVZ A;  4A3E G;  2BE5 D;  5CV7 A;  3I72 A;  2NVQ H;  1TVX A;  5J22 A;  5AJ3 L;  5FJ8 G;  1DOK A;  2EYL A;  4JI3 L;  1YJW A;  4KHP Q;  3L2P A;  4PG3 A;  2WAC A;  4GN5 A;  3QJY A;  1TWC H;  4MHE A;  2E8G A;  1VDZ A;  4PNY A;  1J5E Q;  2JA8 B;  1EY4 A;  3A7L A;  4CHT B;  4R8N A;  5HY6 A;  2JQO A;  1VMC A;  3V05 A;  3HOZ H;  3NQI A;  1NJI C;  1S3O A;  1YNN D;  4A4I A;  1VCI A;  2EQS A;  2AUK A;  4HSP A;  3MVV A;  3HG9 A;  2R6G A;  2ES2 A;  3H91 A;  5JJL A;  1H9J A;  2VUM G;  4FP5 D;  2NWG A;  3KDF B;  4KY7 A;  4QIW B;  1ONL A;  1U5K A;  3GTP B;  2M00 A;  1XPR A;  1K8O A;  5C5L A;  3GTQ B;  2K03 A;  5LMU L;  1X56 A;  2GVA A;  1QVF A;  1QVC A;  3HOU G;  2KOL A;  1MIU A;  2A69 C;  4GN3 B;  1NTG A;  3SGI A;  4C3H G;  1EOT A;  2CH4 W;  2EVB A;  2R61 A;  4C2M H;  2ZT9 C;  5I2Y A;  2PZU A;  4IPD A;  4DV4 Q;  1XNQ Q;  2JA5 H;  3EIV A;  3GQB A;  2KEE A;  4C1N I;  2VXW A;  2GN5 A;  2R7Z H;  4KHP L;  1MSH A;  3OMC A;  1N36 Q;  4N8F A;  4XQJ A;  3K57 A;  2EYH A;  3ERO A;  1SFO B;  2MQH A;  1D2B A;  3NTK A;  1KLG D;  3DMU A;  1K73 C;  5M5W B;  2UXC L;  4KY5 A;  1G2T A;  3KK7 A;  4LF5 Q;  1ET6 A;  1CKM A;  2X6L A;  2Z9H A;  1SRU A;  3KFU A;  5J3B A;  2CW0 C;  2JA5 B;  2KBN A;  1VQ9 A;  4WOR A;  5LL6 S;  3OSO A;  1DXM A;  1KXL A;  5EAY A;  1BF4 A;  2LY7 A;  1QCB D;  4WFN 3;  1YIJ A;  1WCM H;  3ND9 A;  2NVY B;  4A3F H;  2VY3 A;  3P75 A;  2AHO B;  1HNZ Q;  3M4Y A;  5IY0 A;  4C3H H;  4UY8 C;  3KF8 A;  3A74 A;  4OO1 G;  3OOC A;  3LNN A;  1Z9F A;  3U50 C;  1DCZ A;  2PQA A;  2DY7 A;  2WP8 J;  1IL8 A;  2WAQ E;  1HUM A;  1P16 A;  4DAY B;  2HUG A;  4K2L A;  3KBX A;  1I5F A;  4OEM B;  2QF7 A;  5HUR A;  3RZO B;  3MXP A;  3W5O A;  1WTW A;  4J1M A;  1B44 D;  2QEX A;  4BXX H;  5IGE A;  3UE1 A;  2A68 D;  1LTA D;  1KDB A;  4A3J G;  4KV6 A;  3S1N B;  1QNU A;  4TSS A;  1QZG A;  1PH4 A;  1UE5 A;  1DJR D;  1LTT D;  5A35 A;  2IHE A;  2E76 C;  2CWA A;  3BDC A;  1I94 L;  3I8Z A;  2MNA A;  4JV5 L;  2NTT A;  4F88 A;  3GTK B;  5C3W A;  4HN7 A;  4A3C H;  3BDL A;  2ICE C;  4A93 B;  3H0G G;  3WWV A;  2B2U A;  3J80 E;  1FGB D;  4ZUJ A;  3H09 A;  1RJT A;  1ZYR D;  1N36 L;  2EXZ A;  2F0E A;  2A69 D;  2HCC A;  2MHV A;  4MZ9 A;  3M9B A;  2WAQ G;  2KEN A;  2SNM A;  1BBW A;  4KLK A;  4A93 H;  1S5E D;  1GUN A;  2F0K A;  4KMU C;  1QIL A;  3CD6 A;  1Y1V B;  1XXG A;  4KKT A;  5IYB H;  4DR1 L;  2K5D A;  3J80 i;  1WVL A;  3P7J A;  3M4Q A;  1Z6H A;  1HQR D;  2VQE L;  1JC7 A;  3IL8 A;  1DGS A;  2IJ0 A;  4JI4 Q;  2HDM A;  3GV3 A;  2VS1 A;  4KK7 A;  4JK1 C;  1TY2 A;  4ZLT F;  1Q8I A;  1LV9 A;  2N78 A;  4FXG C;  3RZO H;  1K8G A;  3CCM A;  4LF9 L;  1CUK A;  4KTA A;  4UPA A;  2JSO A;  2WV6 D;  1II3 A;  4FVM A;  1CSQ A;  2K28 A;  1C9O A;  4L8J A;  4P73 A;  4LF4 L;  4RHR A;  2NN6 G;  3OTO L;  5JOB A;  1PFM A;  1R4P B;  2HD3 A;  4OON A;  5DLQ E;  3PO2 B;  4O42 A;  3R93 A;  1EYD A;  3J7Z C;  1E3P A;  3CCQ A;  1X9N A;  2A6H D;  2BA1 A;  1CQF A;  2R93 H;  1Q1B A;  4RG1 A;  1UUP A;  3H3V C;  3KJO A;  2EE1 A;  1AE2 A;  5C4J H;  3MHB A;  5ELO A;  1B1Z A;  2HIV A;  1U4L A;  2F0D A;  2ID0 A;  1JWM D;  1VQ6 A;  3GV6 A;  3FVQ A;  3NUC A;  4PV1 C;  4ALP A;  1LTL A;  2NBF A;  3PIO 3;  2B8G A;  2C9O A;  1VQP A;  5M3M G;  5G3L D;  2K52 A;  1DON A;  4K0K L;  4A3D G;  3U9S A;  4DR2 L;  2L11 A;  4K8I A;  1I4Q A;  2ZXP A;  1T9H A;  3TP6 A;  1AN8 A;  2SNS A;  1NBW A;  1KDC A;  1Y1W H;  4B3T Q;  5H1S E;  1YHQ A;  1V1Q A;  1KLU D;  3HKZ E;  4IO9 A;  4AYB E;  2AWN A;  1UNS A;  4JI8 L;  2V1C C;  1SBB B;  1YEZ A;  5IGC A;  4JBJ A;  2CVR A;  1YNN C;  1E0B A;  4HIK A;  3W1B A;  2F0T A;  3ICE A;  4GOP C;  5ELN A;  4HCS A;  1RCV D;  1HNW Q;  4MTK A;  2F0W A;  1R9T B;  3G48 A;  1L2F A;  4NXM L;  4JG2 A;  1I4H A;  1VQB A;  2Z4H A;  3ULP A;  2Q8T A;  3CPF A;  5ELC A;  2B3G A;  4GN4 B;  1E24 A;  3GTP H;  4XQQ A;  4XYO A;  4HCE A;  1XMO Q;  1MD2 D;  1SYC A;  4GOP B;  2CQA A;  3UDF A;  3D6C A;  3E0J A;  4K5V A;  1I3Q B;  3SDZ A;  4IUQ A;  4HJ5 A;  1IKM A;  4L5Q A;  2BH8 A;  2R92 B;  4UP7 A;  1CHP D;  3CQZ B;  1VQL A;  3I4N B;  1EWI A;  1RTO A;  3NXW A;  4JI7 Q;  1I4G A;  4CKB A;  3RR5 A;  1HNZ L;  2JXM B;  4LUO A;  5D65 A;  3K7A H;  3VA5 A;  4BY7 H;  2LSS A;  3I2Z A;  3I4O A;  1TWH H;  2L55 A;  4LF8 Q;  2QGQ A;  3KLW A;  2K33 A;  1HZC A;  2L12 A;  1SR3 A;  4DV5 Q;  2RCN A;  3UDG A;  2R3Z A;  1S40 A;  5IYD G;  1PV4 A;  2WIN B;  4DV0 Q;  1P8L A;  1XTD A;  1TT2 A;  3MA2 B;  4Q5V A;  3CW2 C;  1EY0 A;  2WFW A;  1Q12 A;  1GO3 E;  1MI2 A;  4DR4 Q;  4A3M G;  4QF4 A;  4DPG A;  3H0G B;  4B08 A;  4G57 A;  1F77 A;  3AMU A;  3GP7 A;  1GHJ A;  4CDD C;  1CI3 M;  2K5W A;  1RHP A;  1VQJ A;  2PMZ E;  1PVO A;  1N33 L;  1ZXT A;  2AKW B;  3HOY H;  2GA4 B;  2L5T A;  3V2T A;  2PCF B;  1GM5 A;  1BBX C;  1U4M A;  5CV4 A;  2B63 G;  3HOY B;  3QR8 A;  3TSS A;  2Z1C A;  3U4Z A;  2VNU D;  1VQD A;  2K6A A;  3JC6 6;  2UXD Q;  1KNE A;  2XIW A;  3D31 A;  1QUQ A;  2J4X A;  1YIT A;  1S5B D;  1ESF A;  3AYH B;  1H9M A;  2E2D C;  4P74 A;  4X64 Q;  5JVH 3;  2ZTD A;  1BOS A;  5K5P A;  4M8A A;  4LMQ D;  4A3G B;  2I5H A;  1C7Y A;  2NVX B;  4X64 L;  1RTN A;  5EKL A;  4QIW E;  4IOC A;  1GVP A;  1XMO L;  1EZ8 A;  4C3J G;  3NTH A;  4QGU A;  1G6P A;  1QG7 A;  3KF6 B;  5EBD A;  5KND A;  2D9U A;  1HZB A;  2F4V L;  4GZY C;  4A3B G;  1UEA B;  2L9H A;  1PLF A;  4AIM A;  4A3K H;  1A2U A;  1GD7 A;  4JI0 Q;  2RDH A;  5JPN C;  2AQ1 B;  4IUU A;  3TN2 A;  2F0Q A;  5C5M A;  5DM6 3;  1KTK A;  1Q1E A;  4F87 A;  3NWS A;  4CDE C;  3OWE B;  1DYQ A;  1EEI D;  4MNO A;  1RD9 D;  1UE6 A;  4RKB A;  3C2P A;  3PIO A;  1I4P A;  1SE8 A;  3DHQ A;  4JBK A;  3MFG A;  2EYP A;  2Z6B A;  1E2W A;  3UI2 A;  2EYJ A;  3T16 A;  4XDX A;  5M3M B;  2Z6K C;  1J6Q A;  2FFK B;  3EQL C;  3T13 A;  1H9R A;  1PMR A;  1FR3 A;  1G6Z A;  2RF4 A;  2CH4 A;  2R93 G;  2TMP A;  2A74 C;  3QWN A;  1K3B C;  3M85 A;  4JV5 Q;  3Q23 A;  3S2D B;  4ABN A;  3GD7 A;  3CXC A;  1T5X D;  3NPP A;  3MEH A;  4OWT B;  5FOB B;  1A62 A;  1ZYR C;  1CKO A;  3VR6 A;  3Q8D A;  1VQH A;  1PH9 A;  5CV6 A;  4XQN A;  3TEH B;  3HGB A;  3G7L A;  3PUZ A;  4FXD A;  2K5N A;  1IYJ B;  1FD7 D;  4NMZ A;  2A68 C;  4KY6 A;  1I6V C;  1FL0 A;  1PH6 A;  2N55 A;  1EIF A;  2ZXO A;  3VR2 A;  2EOT A;  1ENF A;  2SOB A;  3MXN B;  1PYS B;  2EIF A;  1BKB A;  1K3R A;  2Q2U A;  1WCM B;  4LUV A;  3A5Z B;  4I7A A;  1SNC A;  3NP8 A;  4J6H A;  1B3A A;  5FJ8 H;  1OXT A;  2LS0 1;  3CCS A;  4CDC C;  4NPS A;  5I6W A;  3J81 j;  4DR7 L;  3OWF A;  5BR8 L;  4KKU A;  1SEB D;  4I7Z C;  2QEJ C;  5LMN L;  1MSG A;  2KHI A;  1CT1 D;  3V96 A;  1BCP F;  1IBL Q;  4DV6 L;  2K50 A;  5IT9 c;  2Z4I A;  3HOV G;  3BVM A;  3VYU A;  2E2J B;  4DV7 L;  1PRT F;  4RGT A;  3HFZ B;  2JP1 A;  3KF6 A;  1RF2 D;  3AFQ A;  5JAV A;  1JOK A;  5C44 B;  2RKS A;  1Y8N B;  3LWU A;  3Q6S A;  1LTI D;  3P20 A;  1STG A;  4R4T A;  1M8A A;  4A3L G;  4A3C G;  2WB1 B;  2OQ0 A;  5M3F G;  2KUM A;  3ULJ A;  2VL6 A;  3HEJ A;  2F3I A;  1VQC A;  3ERQ A;  3F2C A;  1XNR Q;  2SEB D;  4ZAI A;  4FF2 A;  3AB9 A;  3S16 H;  3ITP A;  4JI5 L;  4FF1 A;  4DXG A;  2K01 A;  5KNB A;  4L63 B;  2EYO A;  4O2D A;  4A3M B;  1IBL L;  4PMW A;  5COR A;  1G91 A;  1OXV A;  1PZK D;  1W6K A;  2F03 A;  3FEW X;  1ROD A;  3PSI A;  1F2Z A;  4YWL A;  1K8A C;  2ZTE A;  3IFD A;  1N32 L;  2AWO A;  1TY0 A;  2ZM6 L;  3TQY A;  4YIJ A;  1HNX Q;  3BVZ A;  3CMA A;  4UP8 A;  5M5X B;  4POG A;  3RD4 A;  2IPK D;  2NN6 I;  1WTH A;  1K83 B;  1MJC A;  3RLO A;  3OIP A;  1STB A;  2F0N A;  4LF4 Q;  5FK9 C;  4K8J A;  3HOU H;  3K0X A;  1VQO A;  1WTV A;  3S1Q B;  3ONA B;  2EY6 A;  2C5C A;  2JA6 H;  3GDE A;  3H3V I;  1HHV A;  1IBK Q;  1SMY D;  4LFC L;  2LXJ A;  1EWH A;  3AU7 A;  4KJO A;  3R8B A;  3G6E A;  2WAQ B;  3A8J E;  1BCP D;  4K5X A;  1ESR A;  4APV A;  3K7U C;  2JN4 A;  4BY7 B;  3DLL A;  1QNK A;  5IGB A;  4JI4 L;  3GTK H;  3TS0 A;  3GTJ B;  2H5X A;  1Z7T A;  5LL6 X;  2EY1 A;  4PZ7 A;  1U4P A;  3IAY A;  2NVT B;  4A3F B;  5E7N A;  4IUP A;  1UAP A;  3K80 C;  4QCL A;  4NXN Q;  4A3K G;  5IP7 G;  3CCE A;  2FXQ A;  1YJN A;  1EFI D;  1BUV T;  1I3Q H;  1H9K A;  2PMZ B;  4DAM A;  4K14 A;  1V1P B;  1FNU A;  1EYC A;  5C44 H;  3H15 A;  4K2K A;  3K81 C;  2YU9 B;  1HZ9 A;  1HXY D;  1T5E A;  2A6E C;  2LKV A;  1KIX A;  3I4N G;  1L0X B;  4BBR B;  4LF8 L;  3QB3 A;  1TWG B;  1SN8 A;  3HZX A;  2XWJ B;  3TZD A;  2UUA L;  1J9O A;  4Y52 H;  1CKN A;  1EU3 A;  1PFS A;  2MPM A;  4BY7 G;  2M2L A;  5G3L F;  4YHH Q;  3E6Z X;  1C8C A;  1B8A A;  1MGS A;  2JA6 G;  5NUC A;  1LTB D;  4RHS A;  1F2Y A;  3F2U A;  3CF5 A;  1FVI A;  2R93 B;  3SE0 A;  2NVY H;  4IN3 A;  1X3Q A;  5FLM G;  3T4A C;  3CC2 A;  1U0L A;  4ME5 A;  3NEN A;  3VYR A;  3NQT A;  3A54 A;  4X65 Q;  4NXM Q;  1B7Y B;  5FO9 B;  4DA2 A;  1EYG A;  2F0G A;  1K28 A;  3U4V A;  3I55 A;  1OXS C;  3OHX C;  4KN7 C;  3RZD B;  3DWP A;  3L3O C;  2MO0 A;  2UXD L;  1VQF A;  5KYI A;  3RNU A;  1DM0 B;  1TWG H;  1K0S A;  2OXP A;  1EYA A;  2CFM A;  4QB4 A;  3S14 B;  4DK6 C;  4O1N A;  3ERS X;  5J39 A;  1S5C D;  3BDO A;  3EA6 A;  3CCL A;  1V1P A;  4J8Q A;  2IY5 B;  1MBY A;  3RUZ A;  4A3D H;  1SRO A;  3A55 A;  1EQT A;  1VQE A;  2ASB A;  3L7Z C;  1M4V A;  4X6A H;  3PIP A;  3BS1 A;  4JI0 L;  1PZI D;  3GTM H;  3I4M B;  2YYZ A;  5C4H A;  1KL9 A;  1HTP A;  2ZTC A;  1PHJ A;  3DM3 A;  5COY A;  2F4V Q;  1D6E C;  1S4Z A;  2IX3 A;  1KAW A;  1I50 H;  3PV0 A;  5CGK A;  1TU2 B;  1X54 A;  4U67 3;  5I9P A;  3CU7 A;  5M9O A;  1MJE A;  5J1Z A;  4POF A;  1EFW A;  2JA7 H;  4LFB Q;  2PZW A;  3VA7 A;  2WB1 E;  3MTS A;  1TQO A;  3HOV B;  1JWS D;  3F2D A;  1BBU A;  2V4D A;  3I90 A;  1O7L A;  3Q22 A;  1HR0 Q;  4JI6 Q;  2BA0 A;  1Q8K A;  1YHA A;  4DUY Q;  1EIG A;  4DV5 L;  1A0I A;  5KRU A;  3S1Q H;  1VF5 C;  2ZM6 Q;  1U9R A;  5C44 G;  4IUT A;  1EQV A;  1HFN A;  1YNJ C;  3SK4 A;  2D5D A;  1AP0 A;  4ID6 A;  4C1N K;  4BBS G;  2EJG C;  3OTO Q;  5CV8 A;  4LW1 A;  5M5X H;  5IP9 H;  1NR2 A;  1HR0 W;  4LAA A;  4L6T B;  1HQM C;  4XIG S;  5M3F H;  3M4O H;  4TRD A;  4UDU C;  1VQM A;  1HNX L;  3CPW A;  2F3V A;  3MWY W;  4FNF A;  2PNR C;  3A5U A;  2JA8 G;  2XTI A;  5GRO A;  4R4I A;  3S16 B;  1SNO A;  5CR3 A;  2E5L Q;  3VYS A;  2R92 G;  2RCF A;  2NYZ D;  3CRK C;  2KCM A;  2A1A A;  1CM9 A;  1BR9 A;  1BNZ A;  1IYV A;  2CW0 D;  1L0W A;  4DNT B;  1PRT C;  1EY5 A;  5JJZ A;  5KNC A;  2UUA Q;  4ZKC B;  1IL2 A;  3PO3 B;  4GLX A;  1SMX A;  4LF7 Q;  3E0E A;  3HOW H;  1NMF A;  5EGT A;  3CKI B;  4RFB A;  2QKI C;  2K04 A;  2HIX A;  2UXB L;  4LNQ A;  3OYY A;  2ZJP A;  4B3R Q;  1RL2 A;  3VDY A;  4BS9 A;  4LJZ C;  2L4N A;  1EQR A;  2NB0 A;  2MP1 A;  4OIK A;  4FDB A;  2EXD A;  1X3E A;  4PQX A;  4A75 A;  1Q81 C;  2FJ2 A;  4ULL A;  5ELD A;  4IJL A;  2FHT A;  2BCO A;  2XSC A;  1TS4 A;  1QZH A;  1NNX A;  1JJC B;  3TP7 A;  2UXC Q;  1V8Q A;  1WD0 A;  2Q2T A;  2RSO A;  1Y8O B;  2ICI A;  1E2V A;  1MHW C;  2KHS A;  4AYB G;  1QUQ B;  2J0T D;  1PDQ A;  2K75 A;  3D4R A;  4DNI A;  4C3H B;  1YI2 A;  5IGF A;  1AFP A;  1ILQ A;  1KD1 C;  1VQI A;  1PH2 A;  1FNW A;  1OTC A;  3D4W A;  3C1F A;  2R7Z B;  3A8I E;  3CC7 A;  4B3S L;  2XNA C;  2XWB B;  1A8V A;  1B4O A;  3KDF A;  4FXK C;  1GOZ A;  2CHB D;  1PFB A;  1KAB A;  2GVB A;  1SMY C;  3TP8 A;  1WFQ A;  2KED A;  3EJI A;  2FIN B;  4V0B A;  3MAQ A;  4IAL A;  5I2X A;  4OWW B;  2I07 B;  3I7F A;  2B63 B;  4ZQ3 A;  1XMQ L;  3GO5 A;  3OW2 A;  4CJ1 B;  4AQY Q;  4S3S A;  1JQY D;  5M5W H;  2VQF Q;  2VUM B;  4YHH L;  3I4N H;  2CKZ B;  4CDF C;  2OTJ A;  3HS0 C;  1E7Z A;  1QVG A;  3HKZ B;  4XYQ A;  4JYA Q;  3E5S A;  4C3J B;  3J7A 5;  5FO8 B;  2N88 A;  1JMC A;  1ICF B;  1L1O B;  4JI5 Q;  1CA5 A;  4R9W A;  1HUN A;  4YWM A;  5C6A A;  1Q7Y C;  5D3I B;  2QDB A;  1WTO A;  4JBW A;  2UUB L;  1IZ6 A;  3S2D H;  2IW3 A;  2IL8 A;  1C48 A;  2JA8 H;  3T1Y Q;  4B3S Q;  1D8L A;  1H9S A;  3BYT B;  5JVG 3;  3HKZ G;  3W2D A;  2PW5 A;  3GTJ H;  4OWX B;  2XN9 C;  3I70 A;  4DUZ Q;  5DAU A;  3GTQ H;  5AJ3 Q;  1IHZ A;  2UU9 L;  4YCV A;  2MJ8 A;  4L5T A;  5D14 A;  4GKJ L;  3MFY A;  4DV0 L;  1EY6 A;  1Q86 C;  4DNR B;  1SDF A;  5BN4 A;  5GAG C;  3BZK A;  4H0L C;  1K0R A;  3Q0A A;  1VQ8 A;  5GAH C;  4DV1 Q;  1TWA H;  2A6E D;  4B9W A;  3KYH C;  4OIJ A;  5KIX A;  3UDI A;  3TRZ A;  2D62 A;  2EY2 A;  3HOX B;  1KAA A;  2F4I A;  1FGU A;  4DV4 L;  1GJX A;  1UE7 A;  1JIC A;  4RCN A;  4TQU S;  3QOJ A;  1YZ6 A;  2SDF A;  1NAP A;  2XVS A;  4HID A;  4EGV A;  4C3I B;  4PMB A;  1WCM G;  3O13 A;  5HGQ A;  1KQS A;  3FPP A;  3VYT A;  4OO1 H;  3D6W A;  2ZJR A;  1JE4 A;  1X3F A;  4K6D A;  1JE5 A;  2O5J C;  4DGZ A;  3T53 B;  2B2V C;  4N9P A;  2E74 C;  4OX9 Q;  3AQQ A;  2M9V A;  3PO2 H;  4HSV A;  3J81 L;  3I4L A;  1QJO A;  5ISR A;  4RGN A;  2DY8 A;  1YNJ D;  4U68 A;  1PYW D;  1IXR A;  4N8X 1;  2A5H A;  4JCV E;  5FLX E;  5L37 A;  3S17 H;  4OEL B;  2K1B A;  2DJF C;  4KD4 A;  4Y7N H;  4DV3 Q; 
#chains in the Genus database with same CATH homology
 4I7A A;  2HD3 A;  4JVZ A;  2QW7 A;  2RCF A;  4N8X 1;  4JW0 A;  2Z9H A;  5L37 A;  4N8F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...