4I7EA

Crystal structure of the bacillus stearothermophilus phosphofructokinase mutant d12a in complex with pep
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
319
structure length
319
Chain Sequence
MKRIGVLTSGGASPGMNAAIRSVVRKAIYHGVEVYGVYHGYAGLIAGNIKKLEVGDVGDIIHRGGTILYTARCPEFKTEEGQKKGIEQLKKHGIEGLVVIGGDGSYQGAKKLTEHGFPCVGVPGTIDNDIPGTDFTIGFDTALNTVIDAIDKIRDTATSHERTYVIEVMGRHAGDIALWSGLAGGAETILIPEADYDMNDVIARLKRGHERGKKHSIIIVAEGVGSGVDFGRQIQEATGFETRVTVLGHVQRGGSPTAFDRVLASRLGARAVELLLEGKGGRCVGIQNNQLVDHDIAEALANKHTIDQRMYALSKELSI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords 6-phosphofructokinase
publication title Redefining the Role of the Quaternary Shift in Bacillus stearothermophilus Phosphofructokinase.
pubmed doi rcsb
source organism Bacillus stearothermophilus
total genus 117
structure length 319
sequence length 319
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.11: 6-phosphofructokinase.
pdb deposition date 2012-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00365 PFK Phosphofructokinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.450 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4i7eA01
3.40.50.460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4i7eA02
2F64A 4KXNA 4WL0A 2Q4DA 2IZ7A 1T35A 4JEMA 4P5EA 6PFKA 2A0KA 4I36A 4OHRA 2PFKA 4JELA 1S2LA 3OPYB 3SBXA 3O8OB 5AJTA 3O8LA 1S2DA 1F8XA 4FYIA 4RH3A 3PFKA 4HX9A 4PFKA 3OPYA 3UQZA 1S3FA 4P5DA 1WEKA 1PFKA 3F5MA 4A3SA 4MEJA 4I7EA 1S2IA 1ZXXA 1F8YA 5ITSA 2HIGA 1WEHA 3K2QA 2KLHA 2NX2A 4FYKA 4LJRA 4LJKA 2PMBA 3EHDA 4LJLA 2KHZA 3U39A 2A33A 5AJUA 3O8OA 4U1RA 3HNOA 4KXLA 2F2TA 4I4IA 2F67A 4FYHA 1MTOA 4NPAA 3BQ9A 3IMKA 2F48A 3GH1A 3MAJA 4OHBA 3QUAA 2IZ5A 1S2GA 2Q4OA 1RCUA 1YDHA 2IZ6A 1KZHA 4JENA 3O8NA 2F62A 4MCJA 4KXMA
chains in the Genus database with same CATH superfamily
3IHKA 3D8SA 4EWLA 4DLVA 1QRUA 1F1JA 2JFQA 2V55B 3W9UA 4ENVA 5LQNA 1XJ0A 4OUDA 3WWOA 1T5HX 4I5GA 4KBFA 3HA2A 2NSDA 4KI7A 3TSCA 1E2EA 1SEVA 5FJIA 4K81B 4C5BA 4BV2A 3H2ZA 4GVLA 5KU1A 2F6RA 3TVYA 1ONOA 4UZSA 1YRWA 3TSYA 5E3IA 3C15C 1E9FA 4EX7A 4P3NA 4FZ5A 4EGSA 4F9FA 1HL3A 3L04A 3V1YA 4A6XA 2X4GA 1IXZA 4BFSA 2EGGA 2PFKA 4FSXA 5ILQA 4DG5A 2QVZX 4BVGA 5KYYB 3CUEF 4AJ2A 1RWVA 4TTJA 3T6KA 3TJRA 4KVGA 4ND4A 5DWVA 1PR4A 4NARA 1IWOA 4NNPA 4CBVA 4LXHA 5LUAA 4D6XA 2E4ZA 5CAEA 5K09A 1S1CA 1QGUA 3AR4A 1JEYA 1E89A 1KZ6A 2G82A 1DJPA 3QOWA 4D4GA 2FSVA 4Q01A 2N75A 1AK9A 3COYA 4EM6A 1CJCA 4EVSA 5JAPA 2NXCA 1B0AA 1D0IA 3CU5A 3W8EA 3NETA 1DQSA 3NASA 1CK4A 1EVIA 1LNSA 2FX5A 4JB2A 4CZ2A 1C1YA 3DV9A 3D3KA 1VCHA 2MYNA 3FOCA 3PWKA 2A88A 4QRDA 1VBKA 2YYSA 3CLKA 2JS7A 4K88A 4Z0PA 2W83A 1ZWKA 2JD1A 5F5XA 2CDNA 3U3JA 3FZNA 4KLCA 3X0DA 3GEHA 4GG1A 4YH1A 3PQ7A 5LA6F 3SXJA 3UOAB 3CZ9A 4KR0A 4JS0A 4N7BA 3ZPXA 4LDAA 4FZRA 3OA0A 4LJ8A 2O2EA 4NWIA 5BSTA 5EZ6B 1DOZA 1I80A 3THYB 5IW8A 3IPLA 3QLVC 4ZGWA 4X7PA 4F4DA 4IRUB 1MIOA 3FGZA 3KSUA 1ZONA 3N39C 5EZQA 2VUUA 2HPVA 3TW6A 3EVEA 2POQX 4TMKA 5B57C 1VMDA 2FQXA 4F9EA 2WMOB 5LYYA 3AJ9A 1XLUA 2A0YA 1DMRA 1SEPA 3D59A 3EARA 4UCQA 3D3NA 2HNAA 4U39A 1D0SA 4FGJA 2WM3A 4GM0A 3RJMA 3TL6A 3WLMA 4YYEA 3C3KA 4C89A 3JZIA 5HA5A 2E9SA 3DZBA 2GN2A 4CDNA 2W2VA 3PQ6A 2H9IA 5K3OA 2A33A 5E2IA 3QK7A 4KBYA 4TLAA 1N57A 4WE3A 2EFYA 3B2EA 3L7KA 3JYHA 1LJLA 4RV5A 4XJXA 2QLLA 1M5UA 2VP2A 1M2VA 2NO7A 4ILKA 1FC0A 5B7GA 2DFNA 1GTRA 3L6EA 3E70C 5AVOA 3GEPA 4ZXFA 3T35A 3VHLB 2ZR8A 3SZGA 4JASB 2C9BA 2DCMA 3GG9A 2R6DA 4A26A 3E7WA 1U8YA 3RAPR 3OQ6A 3ZJYA 2PTGA 3WGIA 3WLLA 1H8HA 2J7PD 2Q5CA 1RLJA 3C5CA 1GTMA 1KVRA 2ZJBA 2ZWAA 4GE3A 4XYMA 4CKCB 2VLBA 3DC7A 4MRRA 5EI5A 4TM8A 4J94A 1UR5A 4BE7B 4PPYA 1RQXA 1JQ3A 3KG2A 1SVIA 1FFDA 4H6XA 3RO7A 2VKTA 3M5CA 2B7BA 3PEVA 4GX0A 4OQQA 5DM1A 2OV4A 2DY0A 2WAYA 1I1NA 5BWOA 1B0UA 4IFIA 2JARA 4P3PA 5EJ2A 2XIJA 1MVOA 3DSRA 3PQ8A 3QNUA 4MR7B 3UMVA 1NU6A 1LA2A 1GQSA 3CH7A 3T9CA 4GZ3A 4PTLA 4KNYA 4EGFA 2H31A 1GAWA 3WLIA 2AJLI 3BMQB 3C1TA 3ZWAA 4BQIA 1XZKA 1XEXA 2DOKA 4FGUA 2YN0A 2R96A 5G41A 4DMMA 3RJTA 5FBVB 4IH1A 6PFKA 5ADWA 3AESA 3C3YA 5L6MB 1Y8ZA 1F1BA 2X5XA 2VK4A 1AT1A 4CEIB 3SFZA 2PZBA 4RVDA 5FOUA 5THKA 2AMLA 3ZHTA 4W5QA 3IUMA 5JXJA 2CXTA 3WL7A 4BZXA 1X13A 1OFGA 3DOOA 2BFOA 2BM8A 3RVLA 4NCAA 3LPAA 4IL5A 3QEOA 4LE0A 1AXGA 1BYIA 1TJ3A 8ADHA 2NUAB 3W6NA 3WO1A 2XBMA 3BIWA 4L4XA 4QYMA 1BFKA 4GNKA 3NNDA 1QF7A 3G49A 5FXMA 4GI1A 3HJBA 2HU7A 2XCIA 4EABA 4KCGA 2NACA 4ER5A 4B32A 3FTNA 1LPPA 1E2HA 1PQPA 1O58A 2YY5A 3MB8A 4IDNA 4AKIA 3F2VA 3NEJA 5LP6B 3OD5A 4DR3B 5DCYA 5HF6A 3FW1A 5TNXA 2V9PA 3NR2A 4RPKA 2AX3A 1YNOA 3R7DA 5JMTA 1PW7A 3MMSA 4N5DA 2EJTA 5ERYA 3W4IA 1Q50A 4R1LA 3O4RA 3RWOA 2XMDA 1DKPA 1DO0A 5B36A 1DXOA 4ENPA 1ENOA 1PIWA 4FTWA 3SJBA 1E62A 4OHWA 4MJXA 4MEJA 4DTCA 1KETA 1S89A 2JJMA 3C3PA 4RV4A 1MABB 4REQA 3AHJA 1XV5A 4Y1RA 3WLOA 5IM5A 3OLCX 3JR3A 4W5JA 3IKJA 2OCLA 3IEKA 4O4IA 3KJEA 4QGGA 1AXRA 5ALLA 5T5QA 2PXCA 1ZISA 3BB3A 1I7LA 4P80A 4DUGA 3GCZA 4BQPA 4PQRA 1WLSA 3KCQA 1KEEB 4Q7QA 3HJFA 1QNLA 2XOKD 3P2YA 1EFVB 5EL0A 3V9AA 4MVWA 4PG7A 1EJ6A 4TS9A 1JEAA 4RD0A 4PGAA 2PMBA 1Q0QA 4IXMA 3DDZX 3FDZA 3FYTA 3HY3A 5TC4A 3ZHQA 2JVJA 3PC8C 4OQZA 2X0IA 2KHZA 2VDNB 3T1NA 2DC1A 2ZSHA 4KQHA 4ZZ0A 2EJUA 3QVKA 2OK8A 4TUYA 2QG9A 5L3SB 4MO9A 3B8EA 3WJ7A 1I4OA 3AUAA 3OPVA 1RYBA 5EE3A 5HTOA 2XV1A 1GNLA 1UFVA 1QG2A 3OM0A 2BY4A 1EFUA 2I4MA 3GZ4A 4OMFG 3BDAA 4TQAA 1MAAA 4H1VA 4WKOA 3MELA 2DLDA 3FMIA 4FZ3A 4OLHA 1F8UA 5AW9A 3W5SA 3H2GA 1H94A 2JD0A 3OFJA 1IYZA 1L0BA 5H5JA 1E1RA 5T8KC 5KWEA 3KAQA 1ZD2P 3PGKA 4I1YA 4RF4A 2FF7A 2R7KA 5A3SA 1QHYA 1CJUC 3LCUA 1OPXA 3X1ZA 4B83A 2DERA 1LD3A 1CUDA 3E9QA 1QDUA 5B64A 4DL9A 3MERA 1FSGA 1G1MA 1P4HA 4IRXA 5JNWA 1C1HA 1PT8A 2GJSA 4M1WA 3RFXA 3H8JA 3W6OA 4EI8A 1CS0B 1U3TA 1PP4A 5EEGA 1XAIA 1NKVA 1FP4B 1B15A 1L7QA 3HACA 3PV0A 1P81A 3VXKA 1E0AA 3VZQA 4Q3LA 3AFNA 1NBAA 2WKWA 1PL8A 3GI1A 2B37A 3SC4A 3SD7A 4ZJPA 1KPGA 2XCSB 1TE2A 4A8JA 5EIEA 1NVMB 3ASZA 5DDIP 1DC3A 4MIOA 4YALA 2B78A 4FVTA 4KC0A 5GGYA 2W6PA 3HR7A 3AM4A 5ALUA 4NJMA 3NKLA 1HURA 4FMBB 3CM0A 3LX4A 1IZ8A 2P27A 3FA2A 1HG1A 4MAMA 1KEWA 4KMSA 1KH2A 2XITA 3GNQA 2AFIE 2C4WA 4KAFA 2Y99A 4LBVA 5CPFA 5DGXA 1SRRA 4ENRA 4YV1A 4GM4A 1KIFA 1XZBA 3H05A 1QYRA 3IEIA 1E2UA 3WSVA 1UMBA 5A5FA 1KMQA 2YYZA 2EW8A 3IV6A 4ZO4A 5IK2D 4CI9A 4MV0A 1L5HA 1JMVA 3DWGA 3GEIA 4UD2A 4J1TC 1TQHA 4GPIB 2F9FA 2VP0A 3ISVA 3KQOA 5IEBA 4IFBA 2AD1A 3LDHA 2FSUA 3SSMA 1FCJA 1XWWA 1ULUA 4RO0A 2GOYA 2WVHA 4M8LA 1ZK1A 3FCAA 4N82A 4EYOA 3HWRA 5L95A 4AKGA 3IHLA 3BE4A 3WMEA 3E9MA 4A2QA 2FX2A 3OZUA 4CQLB 2JZOA 1E66A 1LDNA 4JL8A 4EHLA 5AVRA 4NQZA 4WXHA 1NRJB 3D2LA 2XUOA 4YB8A 2HR1A 2QMUA 3C6QA 3NVDA 1W5TA 3N7TA 4C1BA 1T5LA 2IX3A 2I7TA 1L8XA 1GXSB 1VBNA 2D0DA 1MB4A 3H7IA 4ZU6X 2YUTA 2AB0A 4J4TA 2W6ID 1UT5A 5DHSA 5M3BA 3LYLA 4O6VA 1E3WB 1ML3A 4UM8B 3EIFA 4LHVA 3GN1A 4TXHA 5IBCA 3R9XB 1HF3A 2O50A 2VZ9A 4E31A 1HGXA 2XNJA 3ZLTA 3FFTA 3L6UA 5EXEA 4DB2A 4K6CA 2ZTLA 2G67A 3WXBA 3NDRA 3HKBB 2EW2A 4ALKA 3AKCA 4HAWA 5EKXA 4B84A 5KYKA 3K70B 4LY0A 4PANA 3LK7A 2YV1A 4TMVA 3A1DA 4DJFC 1JJ7A 1YA6A 1SK8A 2JGFA 2VUIB 2EL7A 3PGJA 5TR9A 2PKYX 2OCIA 2FPPB 3VZBA 1GILA 2ZSAA 2ANCA 4MWTA 3FMOB 1Q57A 3C7KA 3MPOA 3BF7A 4TS4A 2H0AA 5CJJA 5AI0A 1G20B 2X0NA 3WRVA 1A5SB 3LUPA 2VTBB 3O8OA 2NM0A 3MOIA 3AEYA 4B8ZA 3WLEA 5LFAA 4E5KA 3RK4A 3K9QO 4HK4A 4QWWA 5M04A 3LBHA 4W1QA 3ZYCA 3RIYA 5AW2A 2GJ4A 1VGRA 2VHWA 1NZJA 4MJ3A 3T5TA 3VPCA 1C1DA 2AE1A 1F4VA 3N70A 1ZH2A 4H35A 1H8EA 4EKNB 1S2NA 2HI0A 2OGUA 3L5KA 4YAGA 3RGWS 2HLDA 2VG8A 3TB6A 3Q12A 3VGPA 1UBSB 2P9YA 1CUHA 1Z4OA 2E0IA 5LKAA 4S04A 3KSBC 5EYPA 1XRJA 4BVAA 4YAKA 1K5GA 5JZVA 4WCDA 1Q16A 1N3BA 3KVRA 1M10A 3L02A 3M2PA 3QMVA 3VTZA 5HK9A 2MYTA 1RTKA 3IEUA 3KKMA 1DKRA 2IIVA 1K92A 1D03A 3K9WA 1YDEA 2GBLA 4JLOA 1DTEA 3FUXA 3SMQA 1BMQA 3CA8A 3ORRA 3V8RA 4F3CA 2EFEB 1OWLA 2GAFA 3EY4A 3INRA 3PCXA 3U7GA 1W0KA 1QCZA 2NP7A 3ZWVA 4LX0A 5C32A 1EJBA 1M2HA 1NT2A 3B1FA 4FLFA 3TI9A 1HFEL 3P2OA 1Z6QA 1NXSA 2BPOA 2QVCA 2FSHA 3CF4A 3DAFA 1RYDA 4OXNA 4C21A 5JVDA 4RTRA 1WKCA 1Y8RB 2I87A 1J0CA 2ZYGA 1VL0A 4ZDWA 3PHJA 3QY0A 2MSKA 1YDGA 4ZGBA 1XTIA 1QE3A 1NFRA 2VJLA 4HPWA 4TKUA 4DPLA 2QENA 2ZRIA 3C0KA 2XUAA 1SZPA 3MJCA 3JQBA 4ML3A 1W1IA 3UWDA 1ARZA 2C2XA 3O7MA 3M6LA 1B1CA 3NHKA 3OY7A 3LCMA 4NYJR 1QB7A 1DKQA 1PR2A 2R8YA 2FETA 1L5OA 1XEAA 3KYCB 2IU6A 4HNHA 4IZ6A 4Q9LA 4DILA 2IPMA 3LL4A 1VPVA 3SXUA 4FGKA 2FEXA 5BT9A 4PZZA 2AK3A 3HCRA 4BAUA 1ZD9A 1NI3A 221PA 2YASA 4FYPA 3IHTA 4PG4A 1I01A 2G88A 3FYUC 3IXQA 3ZVMA 1T2VA 2D1QA 1M34E 5ELLA 3AOEC 3PDJA 3E9NA 4PCLA 3CB2A 4R1UA 4MAFA 1OXUA 4YUZA 4HDKA 1DG1G 1JNXX 5FOVA 3C3AA 4Z9AA 3SJAA 5A3RA 2Y1FA 2ZRFA 4JXZA 3KQKA 1NVUQ 1MH1A 2RG7A 4EQ6A 4J43A 1ZPDA 2WFZA 3Q88A 1DG9A 3JWHA 2P0EA 4FM9A 1ESMA 2O8CB 4IHJB 1L6IA 3ITDA 1JFFA 3NKFA 4IIEA 3T54A 2O2ZA 5IVPA 4TMXA 3FM9A 4BJ1A 3K2QA 2CKDA 2DVMA 1YS4A 4EJSB 5IFLA 4WGGA 2AOWA 2ISSD 3JAKB 1NPYA 1PUJA 3OCUA 4D79A 3FXAA 4DPMA 3EQ6A 2JI8A 1I0LA 1W5FA 3LPNA 3MZ0A 4G5FA 4QM6A 3L6RA 2XHZA 3B6EA 4LJLA 1UXHA 1GZ5A 3DWFA 4O2BB 5JCZA 4X62B 1DLIA 1RIFA 2NO1A 5HR5A 1FFSA 1V0JA 1WHSB 4MKXA 2J0EA 2A5DA 1V3QE 1FZQA 1UKBA 5EE1A 2OD2A 3H83A 3KWMA 3LM8A 4DXDA 1Q7RA 1Z2PX 3GJRA 4RCVA 3WQQA 4YJ3B 1DSSG 4NENB 3ZV3A 1Q11A 2PEYA 4GR4A 1R2QA 3H13A 4BFYA 3QVTA 4TXNA 4L4ZA 4J2HA 4CW7A 1Z16A 2IBMA 4OK6A 3LRTA 4OI2A 2NXWA 4MEBA 5EPOA 3DVAA 4JB3A 4RQTA 4Q3DA 4JX9A 3QYAA 4U4AA 4B82A 3OBBA 4ZI3A 5JQWA 3EQ8A 1H3EA 1XWIA 3BGOS 4HG2A 4WDQA 5CITA 1H4QA 5A06A 1PEDA 1QZTA 1VJTA 1V8FA 2GNOA 3P2EA 1Y4SA 2CNWA 4RTMA 2CV2A 2D8MA 2JGMA 1RXIA 4Q1DA 3R7FA 4CM1A 1R37A 2ORVA 3PJFA 3ECCA 3G5UA 3L43A 3PUWA 4IJWA 4JLMA 1M8JA 1E9DA 3I2KA 5FL7D 1HKHA 4MVJP 1KTIA 3CX3A 5G4LA 3O73A 1JTVA 2D2FA 3JPWA 3RS7A 1P4JA 1OXKB 4FUTA 1O95A 1OXVA 4YAWA 3P71T 3IBSA 2FW7A 2VDQB 3T3MB 2QM7A 1QAOA 4F6LA 3GZNA 2IDMA 3DBLA 4EATA 1Z7GA 3PNVA 4ZYUA 3WFJA 1P39A 1E20A 2OOKA 2RI6A 2VHVA 2IHJA 2RGXA 1KBOA 4HWKA 2JCGA 1AQ6A 1EUZA 4IEIA 2ZS8A 4WZAB 4NJEA 1OT5A 2IC5A 5E6SB 5C46F 4BNYA 4RFVA 1PDOA 5G0SA 3OOSA 3BWCA 2BOVA 1O54A 3WK5A 5ENDA 3C43A 2PLFA 5GZ3A 3OE4A 4XEHA 3HB1A 4FDVA 5PNTA 2ES4A 2JIQA 2OCYC 1P0CA 4JBWA 3L07A 3WGHA 2C82A 2XWJI 4WK6A 4Z7JA 1JDNA 1EFPB 2ZE5A 1ZAYA 1ACMA 3WQSB 4RDIA 4YV0A 1OBHA 4H0FA 1O57A 2BGJA 2RDMA 2XGOA 2YVLA 4G85A 4LYFA 1C14A 4DFDA 4N3CA 1ZUNB 2OZVA 2PEZA 1NVDA 2RSLA 5AKYA 2AFRA 4Z9BA 3Q5DA 2PMEA 3O8CA 2W5UA 3W6PA 4BV3A 4D9BA 2ZAGA 3E5HA 2V3WA 4P3YA 2P0YA 3MBKA 3UFXB 3P96A 1MENA 2KMLA 2HQ1A 3CZMA 3LO8A 1UMDB 3VOSA 1Z4IA 3SGLA 3PL1A 4CKBB 3QKTA 1F5NA 3T41A 1Z75A 2CNLA 4DCSA 3NTRA 3U4AA 2Z9BA 1URPA 3JQAD 1PQ4A 2NYVA 3GRYA 3ZV6A 5LQCA 1EE1A 5CDFE 2B1QA 4CDMA 2TRSB 1G4UR 2IUUA 2F3RA 4UQLA 1AF7A 3G0HA 3FTFA 3VMFA 3T7KA 3NCHA 5AVUA 1DAOA 1VIMA 1LVHA 3M1IA 4Z8YA 3RV3A 3OU7A 4RACA 1P7VA 2PLAA 5F7ZA 5BSEA 5AHOA 3GLGA 1WMBA 4BEWA 2F59A 1UBTS 1W4RA 2NTVA 2J6BA 4CM4A 2GCGA 2QMOA 3O75A 4Q9KA 1WY7A 3V00A 3W5AA 2YZKA 3AEUB 2QIOA 3VH2A 4BQOA 3PVZA 3K0SA 4BMCA 1SCQA 3WZMA 2IBTA 2HHJA 4RNCA 5E9JA 2UV8A 4RV9A 1U7WA 3LKZA 1QK5A 5LLDA 5BWCA 4DV7B 4WNIA 1YRLA 3MINA 3ON5A 4FYHA 5KJEA 1QP0A 3D3WB 2W90A 4U63A 4Y67A 4OQDA 5GADl 1AGRA 3N2ZB 4E2XA 2FPGB 3BYZA 2GPNA 3I4LA 1UP6A 2WVJA 4OMCA 3T3NA 4F38A 1Y1KE 1MEOA 1Z3IX 1K97A 2UUAB 3NWOA 1NOKA 2IZ0A 2GCNA 1Z25A 2ASEA 2UZ0A 3N2LA 3SYLA 1M33A 1JMKC 1FFWA 1KU0A 1BEEA 2FHPA 2XYQA 4QBFA 4QUIA 3GUCA 1M66A 5EKDA 1N7HA 4DAEA 2JLQA 4O4HF 4U7TB 5LQKA 3EXFB 3FLAA 4P36A 3NDJA 821PA 4MCJA 2FZEA 4PG6A 1P17A 4PZ0A 3DFMA 4PAGA 2YJ6A 5IJ9B 2W00A 5D7BA 2O5EA 4CQMA 5DNEA 4UHHA 3B3FA 2V0GA 3ZKWA 3E1GA 3IH5A 3IPXA 1NVTA 1U5CA 4HNSA 5H4GA 2ZPUA 3R8FA 3TSAA 1WR8A 1NC3A 1F0YA 4B3BA 1GEGA 2OMEA 1WUYA 3M1LA 3RSCA 5B4TA 3NMUF 5JJLA 1IZ7A 3B1VA 3NIWA 4IIUA 4E2ZA 3BT7A 2ZUCA 4XASA 2O07A 1SA0B 2IEZA 4TWZA 3ILYA 4BLTA 3FCUB 1OWOA 4YJ2A 4CIDA 3TXXA 2FR8C 2YVAA 4WY8A 4JR0A 1R74A 1I1HA 2QYOA 3AUFA 3CRZA 2YJ4A 1FNBA 4URHA 3SZMA 2DQSA 1P45A 1CJVC 1R00A 3BRWD 4F45A 1JKMA 4QM7A 1SXJA 1Y3CE 2IYOA 1CV2A 2JJYA 2IU3A 3DFUA 1B74A 3ODPA 3HL4A 5C2JB 1A96A 2EEPA 1XAJA 4FBMA 1TEXA 4BKQA 3DKPA 5TMDA 2J3LA 3M7IA 2ADFA 1OZFA 3CX7A 3M81A 3PDCA 4IQ8A 3UTDA 2IW3A 2DFLA 4QUBA 1FSPA 2PUGA 3QBVA 2C03A 4NAHA 1CRLA 4M49A 5FBZA 2CC2A 1SNYA 4CIAA 3UATA 4JU9A 1ZYUA 3K2IA 2H1CA 4DEXA 3A04A 5L3RA 2GF0A 2H2FA 4FS3A 4QNMA 2HN9A 4E07A 2DUJA 1NI4A 4JJAA 5EIOA 3CZRA 4W9RA 2AUMA 4FLMA 4EH1A 3IMCA 1FU4A 3CNHA 1N2CA 2F3SA 1AUQA 2VF8A 4X7RA 1R4NB 3ELBA 5G53C 5SICE 5J43A 3C6MA 4H7PA 2XVAA 1EWTA 3FOAA 1ZJ5A 4C6TB 1C4XA 5BW8A 4TSFA 2PUVA 2RCNA 3SBEA 2YWDA 4GS5A 4JQYA 5BNIA 2LDBA 4AKEA 4M1YA 4R01A 5I9TA 3PEUA 2X14A 3WBKA 4EPTA 3FUWA 5IHXA 4GPEA 1ORWA 1XNGA 4HGYA 3PYMA 2W2LD 1T9CA 3U48A 4EBBA 3PR2B 1N5JA 1PBNA 2XBUA 4JJZA 4G3XA 3FTCA 5HCUA 2VJMA 2GHIA 3UGTA 5A02A 2V3CC 3L9XA 2EP7A 2J3JA 2EZ4A 1GPLA 3Q7QA 1N2EA 3OTQA 3WWDA 1NC1A 1E9EA 4ATNA 2CFIA 5HF5A 1ZP6A 5KHLB 1KK2A 2G5GX 2UYQA 3I92A 5KTKA 2CN1A 2F7SA 3K0FB 3WDKA 1R88A 5JS2A 4H27A 1EHYA 1W8IA 3OE1A 4HYTA 4EP1A 2I1LA 2O0JA 4Q4LA 1OQAA 2QUIA 2WU1A 2CFRA 1JJIA 2POCA 2VDKB 4E4YA 2TMYA 3ROMA 2OE2A 3PL5A 4OHBA 4OOFA 4B4KA 2F4VB 4DLXA 3GRCA 2H4HA 3DAPA 1NPDA 3BZBA 2WPDA 3I1JA 3IP8A 1XAGA 1HYHA 4YYZA 1KPIA 4U2DA 4ZCRA 1CKEA 3FKSD 2V7VA 4DGQA 2XQIA 3H9GA 1FYDA 2P75A 3LHDA 4IQ0A 5AK5A 5FBHA 2QVLA 4P54A 4WXYB 3KQNA 1AQYA 3FNGA 3QLJA 1FDVA 3F3YA 3BMXA 3L0ZA 2YFYA 5KVCA 4HTAA 4BFZA 1QRDA 3HWX1 5A4AA 2OFXA 3T9FA 2ZLBA 3AIKA 2P9CA 2AUNA 2R6CA 2XZOA 1EA7A 1E6CA 1FRFS 1O94A 3CRMA 5P8WA 4KREA 2RC5A 2V54A 1BH6A 3B1WA 3BGIA 2VCYA 3PUJA 2HLPA 5FEMA 2CVHA 1Q1GA 3GNTA 3CLTD 1TQ8A 3K9GA 4M0PA 4W1RA 1XC7A 2Z5GA 2ZW9A 5C0OE 4UHBA 2YWFA 3M5WA 3MT7A 4E32A 1ODSA 1YTLA 2CXOA 1PV2A 4QARA 1RFLA 3F3SA 5JTUA 4NEGA 1IZ0A 3BMNB 4EO9A 2CYAA 5HRUA 3LRPA 3X1MA 4BZZA 4QQNA 3NOQA 1JKJA 3K5WA 3O9ZA 4HNTA 1B6RA 2WWYA 3QFHA 3S2FA 5KBYA 1FDUA 1QLWA 1EM6A 3QU9A 1PR0A 3HNRA 4AZWA 1ISFA 3CVXA 1QE0A 4G5QA 5D8DA 2PD3A 2FMXA 2Q0XA 3W5VA 3QVSA 1AKQA 3V8EA 4B4WA 3BAZA 3TMKA 2Q3HA 1PK9A 4HNAA 4ZO7A 2GRUA 2C61A 2ZQZA 4MUMA 1NNSA 4CMHA 5JSZA 4Q4DA 3BWYA 4L85A 5M29A 4I1SA 5IKPA 3MT9A 1GA6A 5H4HA 2XDQA 4I99A 3SDZA 1A77A 1N1MA 1LBTA 1K63A 3UM9A 1E1YA 2X8BA 3CJRA 4RENA 3SICE 1WB4A 1UJNA 2IYAA 4PYRA 4D42A 1IM8A 3GMDA 3O3MB 4QXRA 5H83A 1RJFA 3WGVA 2BLNA 1R0WA 1TCAA 5JNRA 4BMPB 2W6ZA 2PUCA 1H4TA 1UDRA 3O2SB 3PA6A 2HO5A 2ET6A 4IDDA 5F5LA 1SURA 1BIFA 2A9OA 1T8WA 4OQEA 4Y6QA 5JI3E 4P38A 4YC7A 2N3ZA 3ABOB 6ABPA 2ILTA 2OB2A 5CJ2A 3HU3A 2C04A 4FKBA 2OVBA 4MQ5A 4FDLA 4XJSA 5CXXA 2QAIA 4G65A 2NU8A 3R8CA 2P6MA 1KKLA 4MIYA 1NYTA 5DGTA 2J41A 3BTOA 3BXFA 3R3VA 4CCWA 4L2IB 4MLZA 2P2YA 2FQWA 4J6EA 1THGA 2ZAIA 3IUQA 4OK5A 5TRTA 3L79A 1REQB 1ZQ1A 2R7LA 1IHDA 3VR5H 2ZT7A 1XJCA 2PCJA 1L5VA 3IO3A 4Y6OA 1T2UA 2VT7A 3EAGA 3AI7A 3V8NA 4D0GA 4ZCIA 1V1MB 2VYVD 4GI3A 3VDXA 4P3XA 1WBBA 2V98A 1ST3A 5KKNB 1LC0A 2GPWA 1KKUA 1NURA 3DP9A 3EGIA 3EH1A 3OJ0A 3GPDG 4ZYVA 1AA6A 3ETGA 1G7SA 1PU2A 2CL0X 3IKVA 3TLYA 3QW4B 5BXYA 4X84A 2NZ2A 3DOFA 1OROA 4OKSA 3RROA 3EPRA 3U7RA 2M1ZA 3VYSB 1QMPA 2MWMA 4HBGA 3IVRA 1S96A 1QG0A 2BT4A 3QIVA 4ZU1X 1XYGA 3TQTA 3LECA 1TUBA 3IESA 4ZT6A 1XHFA 3OX1A 4MGIR 1H2AS 1UWVA 2DQZA 3EYWA 4F97A 3G2PA 3QUTA 4GOKA 2Q99A 3PSHA 4LCJA 1RCUA 4OG2A 1I5OA 2R68A 1KYZA 4YTEA 1JHVA 2YN4A 5DNWA 1XCLA 1K08A 3G8AA 5JLAA 5A9SB 3DB2A 2DKNA 3TM4A 4UCFA 3ZIUA 2YJZA 2P91A 2XWQA 1JG4A 3LF2A 1YBMA 5HTKA 3KZNA 4PSVA 4EA6A 4R2KA 4ZVVA 4RETA 4YMHA 1J2TA 5M7EA 3ZWWA 4ESOA 4UHJA 5A7FA 1V39A 4DADA 1PR5A 2V96A 4ZCTA 3GFSA 2VNHA 3OZ7A 4JI6B 1WG8A 2XTNA 4J75A 4AMBA 4GDFA 5FI0B 1FRZA 3W3AA 4Z4FA 1LDEA 2VJBA 3TLJA 3N2YA 4M0KA 5F5NA 1OH7A 1JVNA 1RHRA 1TK9A 2ZRAA 3Q2KA 2GLTA 3GBSA 4IX9A 4JLPA 4AURA 4ZYYA 4DLKA 1J49A 1F6WA 4IXNA 2C3YA 2VQSA 4MMYB 4MRAA 3QKRA 3DULA 5JD4A 4IUDS 4Q82A 1DGQA 1UBLS 3HI6A 2IGTA 5AUQA 3GVHA 1KJNA 3VI3B 3H6HA 1NJ5A 1A4XA 1WUTA 2FXVA 1LQUA 1NV9A 5CNJA 1DVRA 4XW2A 1Y3BE 1Z2NX 3DZJA 5LCXA 3BWBA 1UK6A 4AG3A 1J8DA 1QIJA 2H7YA 5K8JB 1PZFA 1USWA 1SH7A 1T36A 3WICA 3SP1A 3H6GA 2UZ3A 3WG9A 3ZGYA 4ER7A 3E5NA 4KQGA 5CXQA 2HF2A 4JZYA 1RM5A 2CNNA 3NTXA 3C4JA 2JBAA 3LKVA 4J0FA 5K51A 3DDWA 4MQEB 1PR1A 1JDUA 1K8RA 3KKKA 2IYTA 4MJ7A 3MA0A 4FEAA 3FB1A 4OQNA 5CIYA 5B6PA 2GZ1A 3T7RA 1RC1A 4JUAA 5E6UA 4A6DA 4DABA 4EO4A 4GPTA 4Z7QB 3B38A 4GM1A 3RBVA 3B7PA 4FR5A 3MT0A 4OB7A 1XALA 4S35A 2VQFB 3U40A 4TYPA 3FWKA 3D8UA 2GEUA 1P1JA 1V2HE 5JXIA 2ZG6A 5C1BA 1E1CA 1NBMA 5IDYA 1SUCA 5CFZA 5A0VA 4LA4A 4DMLA 3AY7A 1R9GA 3EBPA 1UK9A 2C9YA 1IVYA 1DADA 5IH7A 2IXFA 4QBHA 5K9ZA 3LUAA 3TSOA 2W9XA 3RU3A 3FHOA 2OCAA 4WFKA 5AP9A 5KSOA 1YS7A 4KPUB 4NBSA 4LYYA 4M1MA 3V4SA 3O6VA 1GSHA 3A1SA 2NZUG 1M1YB 1CZNA 2IYPA 3LBYA 3UW3A 4UBIA 2XRZA 5DTQA 1ZVKA 4YCNA 4QT4A 1J25A 3GD7A 2A5YB 4U2GA 3EVBA 4DUPA 1M7HA 4IQFA 1IXRC 3OJEA 1KO8A 3C98A 1G8AA 1UEJA 1WV0A 2C0PA 3A1VA 2XXBA 1ZBDA 2FPUA 2CCKA 3DBHA 3HCPA 3JVEA 5FPSA 5B1SA 2Z6AA 2QRGA 1F2UB 3KOUA 1WB9A 1QH9A 4M54A 1OPRA 3TE7A 4M0CA 3PA8A 4IF4A 2O14A 3GMTA 1W6RA 4N0PA 1UDWA 2HC9A 2PANA 2RIPA 4NCHA 4P6VF 2CD7A 5LB2A 3KKEA 1GPH1 2RHHA 1T6ZA 4EGCB 4B3GA 3CYFA 1ZUHA 2WTMA 3QE4A 3DMFA 4LGMA 2WWFA 3I3OA 4GLLA 4N6OA 4BQSA 1XP8A 1NUSA 3BSFA 3JTEA 4D0NA 4U7PB 1DB3A 1J70A 4G0OA 1CYEA 1K89A 3ZXUB 2C2ZA 5AMXA 3H5OA 1JB1A 1AN0A 3GNSA 2WIBA 4MV7A 4WBXC 3QOYA 1RJ9A 3VQTA 1Q1BA 1YRAA 3IB3A 4IGEA 5G0UA 5CA1F 1GFSA 2PUJA 1G6HA 2B4AA 2JJ1D 2GAJA 1H2BA 1O5OA 1ZZEA 5G40A 1DJNA 1I14A 3ESQA 5IRCD 1KAHA 1E18A 4X65B 2X58A 1E6LA 1XNJA 2XXAB 3PQCA 1YQ9A 3T7CA 4CFSA 2QL5A 4CM8B 4U2KA 4F12A 1VRCA 3C5HA 1H1LA 4P86A 1GL6A 1E2FA 1V26A 1L4HA 2G04A 3FNBA 5A4IS 4L51A 3F6YA 3HEMA 3QTLA 3V46A 7AT1A 1U3VA 4N3GA 4QTUB 4A10A 1FTQA 5YASA 4C2AA 4MICA 4URFA 4DUZB 4HEJA 4UKDA 4S2UA 1Z33A 3FGPA 2YJTD 4QYTA 3GF4A 5EQFA 5G02A 3PIIA 4GWGA 4YDHB 3SS9X 4GXQA 4N5NA 3D1LA 3ND9A 3A3PA 3PQDA 3ESCA 5F3WB 3AJ8A 4N65A 1PJTA 3HJGA 4QU5A 5H7XA 3O47A 2WD7B 4HVAA 4IDGA 1OXXK 1JAHA 5CH3A 2F4NA 3T0FA 3I9LA 3SE7A 4O1HA 4QDXA 2QOEA 3ECSA 4ZQEA 3H8VA 3H86A 4YCCA 3HK2A 3P0FA 2Z9CA 1PT6A 1TRHA 2ZYAA 4Y0VA 3KLPX 3O95A 1JG3A 4MW1A 4Z9XA 4UNSA 1XL1A 1LF5A 1SVKA 4W7HA 3VFDA 1BVHA 4J3FA 1L4LA 4IV5A 1JJVA 1GHTA 1V1RB 1VJ5A 3L8EA 3SSOA 5JCPA 5DTIA 1L5YA 1CF9A 5DTJA 3ITEA 1PTKA 4HAXA 5ALDA 1E1QD 3LFUA 4LZWA 3CF6R 2O2GA 2ZIWB 3PGA1 1LQTA 2B6NA 1U4NA 5DE3A 3I2IA 4KFRA 4NG5A 3U62A 1J7JA 2TMDA 4IJMA 4QOGA 3RSGA 2C57A 5C5CA 1T2FA 2I6UA 2NSYA 4RUKA 3LUGA 3QYFA 3T7EA 3G68A 4A0HA 1CUFA 2EWMA 2R66A 3R4VA 4N49A 3QKSB 4S0ZA 3AM5A 3KVVA 4ZQBA 3A9CA 3DUFB 3VKGA 1BFUA 3UHFA 4CF7A 1VRWA 2Q7XA 3KSAC 4FYXA 4O2AB 4P22A 4B17A 1GPJA 4I55F 1YVRA 3CIFA 3VYVA 1M76A 2ZS9A 1CE8B 3UCEA 4PWZA 2CEAA 1BX0A 3UAGA 3VC7A 5K6TA 2HJVA 1Z56C 1TNDA 3DE6X 4TPKA 1Y7HA 1QOZA 4HADA 4R1TA 3X3HA 4JI2B 5TPZD 2K6GA 4UDYX 9MHTA 1DCTA 1XVUA 2R60A 5HWSA 3OKFA 4PVCA 1XSEA 4UTXA 5IT0A 1D2HA 1TLFA 4PC2A 4XUEA 5DLYA 3UYLA 4YWJA 3TZLA 1FLDA 1PYGA 1M0WA 2XKJE 4QGFA 4LJAA 4QU9A 1GU7A 1JYSA 1RZUA 3OIYA 3FRHA 1XZHA 2SECE 2Q4OA 5GJCA 1U90A 3TMYA 4XYBA 3ZNNA 2AG6A 3K9LA 4O2LA 1S4QA 5DI3B 4XWAA 3DQPA 2YICA 5B1DA 3V8QA 5AKKA 1QJ4A 4WUTA 1SBIA 2CHVA 1W85B 2WOOA 4X1YA 1M6NA 1A27A 1JHAA 2PGAA 4JC4A 1P33A 2NTNA 3PHCA 4V2IA 1NE2A 2G1KA 3ZTYA 5L6LB 2AG8A 1ZMOA 2PKCA 4F71A 3EMVA 2G6TA 3I3SR 4HDRA 1E3LA 4O3FA 3T34A 2J09A 5KNBA 1X7XA 2VHQA 4LBWA 1NKSA 3AIOA 5EE9A 5G4KB 2HMVA 4WSOA 1R3UA 3NYWA 2ZZMA 4TRJA 2EGHA 3B85A 3KJXA 3TCNA 2D7CA 1Y3HA 3C7CB 1SVWA 3HR8A 4R2IA 2VPTA 2FWIA 4RDHA 1I0IA 5JSUA 3HDQA 3BICA 1SU7A 3PNBA 5BV8A 3V1NA 3PDIA 5J2UA 3HJCA 4X6XA 4X97A 3V4PB 4F2DA 3U1VA 4D9CA 1BRMA 4JVMA 1YQWA 3EC7A 3TEFA 1U2DA 1OFUA 3L6BA 1XQ1A 3CLUD 4CL2A 4IXTA 4A16A 4BL5A 5GJBA 4DSOA 4PG5A 4GZLA 5C34B 3T7AA 4TL7A 1BDMA 1FUUA 3ZLVA 2Y4OA 4JYCA 3IIIA 4YLYA 4E88A 1L7BA 2PFSA 1EI9A 1KC1A 3EGDB 3FMFA 3K4QA 4AZ3B 4MP6A 2WICA 4BB5A 2Z30A 8LDHA 2R00A 2C78A 1S8OA 3KXIA 1CIPA 4LFAB 1GUBA 4HT3B 3CVUA 1JWAB 1SELA 1B6TA 2ID4A 3T7TA 2IHZA 2XYHA 1I4TD 1CHDA 1Z8FA 2Z2IA 3PUXA 5CT8A 3B1YA 4KGZA 3I9KA 4RFSA 3F8TA 3MJDA 3V97A 2ZUEA 3PEYA 4EHNA 2WR8A 1B6SA 1M6VB 2YIJA 3EDCA 1RXUA 2BEKA 3BFPA 4V0QA 2FP3A 1OGJA 1OV4A 3LWDA 1YKGA 1C9YA 2M32A 2XMGA 1GKLA 3FSGA 2Q9CA 3SDBA 2R87A 3W6ZA 1SXPA 3NEYA 2A9RA 3VYRB 4WY5A 4EGJA 2RK4A 4TYMA 4D4HA 2ODQA 1KEPA 4UULA 3FPEA 1XTZA 3R5XA 4LY9A 4QHYA 5JZMA 3PC6A 2VDOB 1VI2A 2G7ZA 2QRVB 4RCYA 3T7IA 4ZJZA 3B5JA 1EFRD 1NRIA 4KHPB 4PXSA 1FSFA 1GSIA 2GH1A 3KLBA 3QJ5A 3L9WA 1TCBA 1RFGE 2BBOA 2FZKA 4JI4B 3CWZA 1Q0UA 2Z2XA 4F11A 4UPEA 3HPRA 3R6TA 4E12A 1RHMA 3GV0A 3PBKA 3L1VA 2BGWA 2EFDB 3EZGA 1ODJA 3H9UA 1X7ZA 1D5WA 1U9IA 5CUQA 2AFHB 1VC2A 2F90A 3GLHE 3AEQA 3EPJA 3K09C 1NR7A 2ZZNA 3IAUA 5FUXA 2WHPB 1KVSA 3JCZA 4QBTA 3AVUA 3UANA 5GINE 3AW9A 1PV4A 4MVJD 4J0HA 5BSMA 3KTOA 2FPSA 1OA0A 3HDJA 1J8FA 1YCDA 1QDLB 1LVGA 1NONA 1RRKA 1VJDA 2WFLB 3GCDA 5EHGA 1SQ6A 2ZJ5A 5HF8A 3VR4H 5ELXA 2PVPA 1XP5A 1C3OA 3KYDA 2ZATA 1HZZC 2EDCA 3EWSA 4M0FA 4P7FA 2QUAA 4BASA 5JADA 2SCUB 2P11A 1KY2A 1VI6A 2WU8A 2HHLA 4XARA 4PRKA 2Q49A 2ZBDA 5DT2A 1VMKA 1J2YA 2CLDX 2CLFB 3UJHA 3ER6A 2AJDA 2ZWPA 3PHBE 1OB5A 4LOHA 3SY8A 3ZGXA 5LQDA 3U7HB 4JJGA 3EZFA 1KI9A 2B2NA 1CS4C 3INYA 3V48A 2I6GA 1CFZA 2TECE 4G1CA 3JQGA 1W76A 4ZVPA 4L9SA 3ZN2A 1A5AB 2VPWA 2J67A 4RVUA 4F4JA 3STVA 4CHGA 2GNAA 2ZJOA 2NU7A 4B4DA 3RT9A 3GXOA 4BNTA 2PM8A 3A4LA 2IXEA 3V7UA 1K1EA 4IMRA 4BNDB 3DEIA 2VWPA 5COQA 3LD9A 4WHMA 1PJRA 2V03A 2XA2A 3RYHB 2N9UA 3DEAA 4L73A 4ON9A 1WCIB 3OZAA 1SXIA 3PFCA 3HSYA 3NAQA 3DEKA 3O4JA 3PHLA 1RQ7A 4GKVA 1M3SA 4WLVA 3ZWMA 5FULA 4Q1VA 4FFBB 2BGTA 2C2KA 2L42A 3MCWA 3QFFA 1CC1S 3LXMA 5KOHA 1XVLA 1HFWA 1DO2A 1C7EA 2OO3A 2QD2A 5LZ8A 2YWXA 2D62A 4G07A 1QQTA 2O1XA 2R5NA 5K0GA 5CA0A 4J0QA 1AUVA 3H2HA 2H52A 4UUMA 3M6WA 4DLRA 2C4VA 2FK7A 3DEHA 5ESRA 4EL5A 1L5LA 2P2SA 2VRBA 4KDCA 5EZ5A 2DY1A 4WESB 2FJ0A 5IN5A 2R62A 1C9EA 2X3YA 3VUFA 1CZOA 7MDHA 4FOSA 5AHWA 1T4CA 3ZU6A 1DKUA 3U3ZA 1MX1A 3CKLA 3KB8A 4M0LA 5BO5A 1A9RA 2OAP1 2QB5A 4HY3A 1LPBB 3WL3A 2RHBA 3MWDA 2JI7A 2Z43A 4RGYA 2NVBA 4HLCA 1SUBA 2OWDA 2YNMD 4LHZA 4ZAZA 1DPFA 1ICEA 2QR2A 2B21A 3I6YA 1L3CA 4KPGA 5DSXA 2B5WA 4M55A 2Z6UA 2BF7A 4OI4A 1XTSA 2JKZA 4EUKA 4HWOA 2J9GA 5FBKA 2H7CA 2ZBFA 2BUCA 2GHRA 4MJLA 3QLTA 3QPBA 4WOJA 5A0FA 1PS0A 3THRA 4MGYR 5BV2P 3ER8A 5KQSA 5D5PA 1SWWA 5L53A 1MB2A 3W2IA 1XXHB 4AYXA 2E3JA 1KI7A 3TAHA 1KAOA 5FUQA 1K88A 4J4BA 3U7EB 1PJLA 5JH7A 3G9ZA 3QVVA 1RWQA 2DKFA 5CTAA 4PHCA 4I8XA 1V8BA 3HCAA 2QVGA 5J4KA 3SYMA 3L7OA 5DBGA 4D4JA 1U3WA 2MR5A 2E6KA 1N8TA 1PNVA 2PZEA 2F17A 4ZCSA 3TLGB 1RW4A 3EXHA 3STWA 2PMCA 3AR9A 4DRXA 4PS0A 3LDUA 4HDSB 4P4TA 3DZFA 3B13B 4M9UA 3X43A 1BKDR 1U9JA 4MW4A 1P4RA 2BW0A 3DYBA 4ZKDA 4Z3OA 4KE7A 4XGRA 2GEJA 4CMCA 4P84A 1IXSB 3Q98A 4N0QA 4XI9A 1M5TA 1KO4A 1P73A 3K70C 1T8PA 2DHCA 2NYAA 5C3UA 1BJKA 1W46A 2DB3A 3DDSA 1J09A 1DAHA 1FXSA 3CZCA 4RIHA 4AY3A 4BZQA 2V97A 3QOFA 4S24A 2WF6A 3BXHA 3A2MA 4DMGA 3BQNB 3IAS1 3TAUA 4B6JA 3LOUA 2KB0A 1BWRA 4WPGA 4JBYA 1G21A 4X3CA 1J2UA 2BISA 4YA6A 4N5HX 3W1WA 2BF4A 1QUEA 1OREA 2E82A 3J7AC 2NSHA 4B71A 4DCTA 3HVKA 5DOVA 3HVHA 2RMKA 3T4EA 1A04A 1NY5A 1OLSB 2WQZA 3I32A 4FFMA 1C8KA 1QHSA 2J07A 1ZXBA 1QQ7A 1T9HA 2XIQA 2FHSA 2PWZA 2OSBA 3NH9A 4QHTA 4BP1A 2XB6A 3IEPA 3OEHA 5ULLA 3JYPA 2PHZA 4KXVA 3B5IA 4OB8A 5ECWA 4YRBA 1U1IA 3EVNA 4YMGA 1K2VN 3IT2A 2IQIA 2XLBA 2ZITA 3UYKA 3NQ41 2Y71A 4O4LB 3U49A 1DUIA 1HSZA 1QKJA 3N9IA 1CBUA 4KEAA 1FVOA 1BX3A 1DUSA 1SU4A 1MNQA 4UAUA 3CT4A 3E3OA 1FJGB 3HLKA 1F06A 2B3TA 2NXNA 3KYIB 4YBZA 1HQYE 4GMKA 5IKOA 1JWLA 3V1MA 3FR8A 4C0LA 3PNOA 5JNLA 1L7AA 3UV3A 3RU9A 3IERA 5B7PA 1ZOIA 3W79A 5JYCA 4K1XA 5DNDA 3UKOA 3WHPA 1QOPB 4QVGA 4Z99A 1IN5A 2PAFA 4RC9A 2I91A 1BHSA 3X1KA 2NMVA 3NXSA 1S2DA 3B1XA 2RK3A 4NU5A 1CVLA 3T0IA 4HLUA 3N3AC 4EY4A 4I1OA 3ZLBA 2FMUA 4KLAA 3BAFA 2Y1XA 3GRKA 4NDAA 3ZE8A 3ZI0A 3TFOA 1ST2A 5EPEA 2JEYA 3GOHA 4B40A 4B81A 1RACA 3A27A 3KK0A 4EL0A 1SUIA 1Y80A 5C1OA 2BBSA 4KUEA 4M1ZA 2HSDA 1RBZA 3I34X 1JIJA 3H1GA 4PZPA 1CJSA 3VH3A 4DUYB 1XF1A 3ZDAA 2WHXA 5IS2A 1WMFA 2EJBA 2OTCA 2SICE 3LS2A 3IDQA 2EJVA 1HRDA 3CMCO 5B3LA 2CLEB 4YXWD 2Q6IA 1A1VA 1D2EA 1JSRA 4E51A 3FPKA 2OZLB 1GKUB 1MO3A 2ON6A 3PB3A 3CZ4A 3ZK7A 4ARBA 1APBA 4NONA 1D4AA 3C8ZA 1DOAA 2WDZA 5PGMA 2Q7OE 3VPAA 4X1IB 1ZR4A 1UPFA 3KVYA 3GGPA 5CXSA 1FW6A 2CEKA 4ZXPA 5JNVA 5AI4A 1GQOA 1ZSYA 4E6PA 4BPBA 4DLZA 2PO5A 1SCUB 1VHDA 3F49S 3RUIA 5F78A 4PNHA 4GW3A 4N7MA 3UG6A 3KKOA 1F3LA 1G2PA 1P80A 2NV6A 3AF4A 3JSAA 3CLUC 1P4GA 5FEUA 4Y1GA 1C0EA 2C7QA 3L40A 4NPAA 5HKKD 3AJDA 4M46A 5BW4A 3SX4A 5JZBA 1M54A 2OECA 2VWGA 4DAOA 5B5SA 2BMJA 4EJSC 1E0DA 2HMYB 1P31A 3G0DA 4Y7DA 5CA1A 1EUCA 3D3JA 3KHSA 1NMZA 4OQYA 1NW3A 4UEKA 3ZBUA 1EWYA 4RBNA 1G38A 2QVYX 3RS4A 2DECA 3CV3A 4HUQB 3TZ6A 3AKZA 2XA9A 1M67A 1OYWA 1QX3A 4G0WA 1HE8B 3M1YA 5IBPA 1KEZA 1VYTA 4LYAA 1TAUA 4U8HA 1IM2A 2O2YA 1W4AA 2WD9A 1HI9A 3COZA 1ESNA 3GK3A 1SUFA 3R5SA 4KYUA 3FYDA 3SCZA 1WXDA 3DE2X 5CYFA 5DRYA 3ZVNA 4TLMB 3G8BA 4HMPA 2V74B 1Z9BA 2PL5A 2WMYA 3O0TA 3RAGA 4ZK2A 2WU0A 2KYRA 2PDAA 2XRYA 3MQ2A 3NT2A 3QQ5A 2OBBA 2ZANA 4G0PA 2HSWA 4JB0A 3R6WA 2JL1A 2IPAB 4YMSA 2QRHA 3T5DA 5CG1A 1VSBA 3RKRA 2E37A 1ZGCA 2X8LA 2AHRA 2D00A 5GV7A 1NBWB 1I2CA 1C41A 3FYCA 3QE3A 1KE2A 3UMFA 4EG3A 2BHLA 3ODGA 1VP9A 2Y1OA 4LF5B 1ZD1A 3ZIDA 4XD7D 3GDWA 5DYGA 2HQSA 2AYXA 3DBOB 1CQJA 4A03A 1ZD3A 1IEVA 4D26A 5JAMA 4ID9A 4Q03A 3VPGA 4DJTA 2UYOA 4MP8A 1NM5C 2PPVA 3G1TA 4ZT5A 5KVAA 2X0KA 4QASA 3FUVA 4CTKA 4EECA 2EIXA 2W2NA 1VKHA 3IJRA 1XCJA 3A4TA 3OM1A 5DX0A 5A4MS 6AT1A 2XCOA 1HT2E 3JATA 2Q2NA 2LKCA 3TMAA 4F3TA 2XQKA 1U1DA 3M83A 4X94A 3UBTA 5F4ZA 1NQAO 1P2UA 4LMAA 4ZCQA 3N6VA 2ZWOA 2QBYA 1KK1A 4RPGA 4XTRA 5HILA 4LTMA 1DQNA 4NPCA 4ISCA 3GGOA 1E3JA 1E96A 3ICVA 3IURA 4TV8A 3MMPA 3MF4A 3LO5A 5JD6A 1E7SA 3MN1A 4ZTZB 5FHRA 4FMPA 5U1PA 1VI5A 3REQB 2IY9A 3H4TA 4OFZA 2P9GA 3ILXA 4BY9E 3I73A 4X90A 1XE3A 1Y8AA 2B34A 1F14A 2COKA 4IILA 3RBXA 2BGMA 3BSWA 1C7QA 4KBGA 4X44A 4EG1A 2WYUA 4CLRA 2GUGA 3MRTA 4I7EA 3QF4B 4AULA 2ZXUA 5BN5A 4HTFB 1P2VA 1F8YA 2WSSA 1Y9EA 4LRQA 5IUJC 3TJMA 1RZVA 2HM7A 5B6JA 2DWPA 4P0TA 3SF0A 4BVBA 1KAGA 4QC2A 3UMMA 1CJKC 1U98A 5BV7A 2Q3DA 2K2QB 3C3JA 3MWEB 3MTGA 3TK1A 4LPSA 3ZU5A 1FFBA 4BJHB 3TOVA 1CUAA 2P9EA 1U0HC 2ZIFA 1IVNA 3QKIA 4XCVA 1W4BA 4JC5A 3LYHA 3ZDXB 3WBBA 1VCOA 4KQCA 3QWBA 3ST7A 1E9AA 3D0QA 1W9HA 3G85A 5CM8B 2CSUA 2PN1A 1IRXA 3NALA 2PKQP 3G9XA 3OAAA 4IF6A 5D84A 1TM3E 5EJ8A 1TVKB 2QTVB 3IUSA 3DZIA 4FT2A 4PRYA 4R0NA 3QVJA 5I4IA 2GD2A 4UUBA 2PD6A 2GMWA 2IK8A 1DCMA 1Y8QB 3AETA 3D7SA 4GD3Q 1WABA 3C8DA 4KV7A 5CHEA 4DC0A 1T9KA 1O96A 5IJ0A 1TZ2A 3KZOA 1DIAA 2W6JA 5HJEA 4GPBA 3WKAA 2J48A 3S99A 4DA8A 4G36A 4TKLA 6REQA 3QUAA 4S1WA 3O3OB 1JIKA 5DNAA 1LY1A 1Q1EA 4HFMA 4NCIA 4PR3A 4XGIA 3PUYA 4IH4A 4E4TA 5LBTA 4EKDA 4FB5A 3V2HA 3PGXA 4IOLA 5TF4A 3ZOKA 4D96A 1ZLYA 4HDNB 5IH3A 2ZJ8A 1DQPA 3G23A 4WOKA 1OAKA 2YNMC 3A1TA 2PVSA 3DKRA 4FHEA 3E22B 1M6HA 5DSZA 4W7SA 1S8FA 3NUQA 4I66A 2BFCB 4X7MA 3PGLA 4FGZA 1M1NA 4L5IA 4AF6A 1CDDA 1O08A 1VSQA 3GAMA 4TS1A 4U0KA 5K3SA 1FJHA 2QZZA 2HJSA 1SO8A 4QBGB 4O02B 3MMNA 1KEVA 2IITA 5C35A 2SNIE 3OSZA 3X1JA 1NDHA 5AM1A 3ZTTA 2H54A 4IGKA 3SIWA 3T7JA 5KOIA 2GWRA 4ZCLA 5JS6A 1E4OA 1YJ5A 2C2GA 1TAHA 3IELA 3MJTA 2YJGA 4BDSA 1GZ6A 1P9LA 4JUDX 4I1VA 3ZHYA 4AD8A 3I8SA 3CH6A 3KHTA 4UREA 2CZGA 1A5TA 3TQCA 1OFHA 3D3EA 3BERA 2DJIA 5KSYA 2E5LB 4B6OA 1UXGA 3DOEA 3DBVO 2VRCD 1YFJA 5LP1A 2IP4A 1DBSA 2WTAA 2IDZA 1QQBA 3URKA 2UVPA 2XNKA 3IDZA 2W2PA 3DMYA 2IL1A 3EGXB 4MV1A 2AF3C 3WWZA 2PRSA 1M74A 2O8BB 4HH3C 3OCCA 1DQRA 4RA6A 3AU8A 3EQ9A 1XCBA 3B7WA 1IUOA 2J1LA 3IO5A 3NYIA 4O8CA 1T4GA 1YJ8A 4GP7A 2FFQA 3E9EA 3G8CA 1XMQB 2J3IA 2QRPA 3DB1A 3THWA 1DO8A 2YHSA 1V7QA 4JP5A 2NVUB 3DJFA 3DL2A 1II8A 4RZ3A 3A05A 4PZUA 3H11B 5KX5F 1XWFA 1EKXA 1XMXA 4FDMA 5TJ9A 1CVIA 1DFGA 2D7JA 2QLFA 3G7NA 5E9AA 4OF4A 2II6A 4CEJA 2ZSFA 2PUBA 3RABA 3RYIB 3CGGA 2HOQA 3EIWA 2OSVA 1HDGO 3SYRA 5JTTA 2LIPA 4U7DA 2BR4A 4JX8A 3G1WA 3V8PA 5H9WA 2HMUA 4TOIA 2NX2A 1GPYA 2HPAA 5EJEA 3FUTA 3RVPA 2XUPA 1PNTA 2UYHA 1JQAA 4Q3KA 4OEHA 1E9SA 3DCNA 1N4DA 2ZI3A 4M4SA 4MQMA 4U9UA 5KQLA 4E5MA 1Q2UA 3HGMA 3OZIA 1KWKA 1OZAA 1QIGA 1SC3A 2XHEA 4MKZA 1O3YA 1EUQA 4XTCS 2Y1WA 2RIRA 4I5IA 1IOVA 5IJWA 2CKMA 1WUHS 1GGJA 1PS9A 3AINA 4IVNA 2XUJA 3CEPB 3R7LA 4DJ5X 1U81A 4I4IA 5BMVB 3IE1A 2X2FA 1TT5A 4C29A 2QMEA 2OR3A 2PZKA 1KFEB 3H04A 1FYVA 4LVUA 4O5OA 5GTDA 1YV9A 3MQ4A 1SUDA 3RDPA 2P9JA 3KZCA 1JDZA 5LZ2A 2VQ6A 4IYRA 4CR8A 4GRIA 3GA5A 3GT0A 1A4RA 3NAMA 2W7TA 1RVDA 2JGAA 2JIDA 2X9QA 3ICWA 1NMQA 2FUKA 2PWYA 3V5NA 1RC8A 4IDEA 4EKGA 1BXKA 2YMLA 4DCOA 4E2YA 4J4HA 2YXBA 3QU5A 3BHJA 4I50F 5BSFA 4CKZA 1G2OA 2ZJZA 1NR1A 4FHFA 4HI0E 2MJLA 4MVXA 2P4SA 4UW9A 3RG8A 2A78A 3TTVA 1Z63A 2WAOA 4J03A 4OQLA 2XECA 1P6QA 3TX2A 3BA6A 2V65A 3I0ZA 2CMFA 5K0SA 4JA2A 5JVDF 4F3YA 1UK8A 3DG9A 2I4TA 1S6YA 5CAEB 1V16A 2G09A 1QGUB 1ODFA 3BMCB 3BWDD 3ASUA 3N86A 1SXHA 4JB8A 5K3FA 1PX2A 2I2BA 3WLHA 5BV1A 4PYJA 3OQNA 3NCTA 1JXQA 1W75A 2EP8A 2QTRA 2M1XA 4YN3A 4V0OA 1UMCB 3ZY5A 2ZPTX 3COPA 1ZH6A 2FNAA 2ONYA 5LXTA 1P29A 2OBFA 4LOKA 2J0VA 1GYQA 4R41A 1E9VA 3RHFA 3A1EA 1N6HA 2XF8A 1G8MA 5EHNA 4JELA 2WJWA 2XPCA 3PE3A 4KV9A 2GAIA 1YJAA 3D5QA 2B4YA 3UT5A 1Z47A 4XVCA 2RHMA 3JALA 1Y3DE 1UWCA 3T3OA 1KOGA 3F90A 3ZD9A 4DR6B 1FYFA 1M2EA 3E9RA 4MVCA 4RF3A 3G59A 3WIOA 3OOYA 2RC6A 4RKQA 2PJRA 1Z17A 3I37X 1I5RA 1G7TA 1MIOB 1O7JA 4DDVA 2BMVA 4BOYA 3LQ4A 1Q91A 3DGEC 2X8WA 2B3DA 2XQGA 2J46A 2DULA 2ZB4A 2C9ZA 2QTCA 3ZZMA 2VS1A 4M6WA 4WNAA 5HUHA 2QN1A 4QATA 3HA3A 3R9WA 5EEHA 1H2EA 2AR9A 2W71A 4XXHA 2NSJA 4WFIA 3JYNA 1YE8A 4J0CA 4AX4A 2FN8A 2J0SA 1Y82A 1BD3A 3P27A 4KXYA 1SG9A 1BSVA 1MRSA 2CMKA 2WJ3A 1DC6A 5IYZF 5JATA 3TNJA 4JC8A 5HQJA 5IXSA 3H9CA 3GQBA 5GGXA 1R64A 2I4OA 3M70A 4AZVA 3OLWA 1SKBA 3EC2A 2I99A 4OBXA 2V9ZA 3AB3A 1L5KA 2QTWB 3ZJ5A 3FSEA 2WAAA 1JR3D 3GWZA 1IATA 2C5HA 2QP9X 4P0QB 4ZVLA 5AJUA 1V41E 1P18A 3STTA 3KR2A 4BNZA 4OLFA 2G5PA 2D1FA 1L6RA 1Q0ZA 2Z08A 3VKVA 4OGLA 2JIPA 4NECA 5CVUA 3ZJVA 2FP4A 3ZV4A 2F67A 2OHIA 2X1VA 4XVHA 1L5MA 1SU8A 4FEYA 5CP8A 1FB5A 2ICAA 3KUKA 4J9UE 4MYCA 3LDAA 4PIMA 4BMSA 4B76A 2VDRB 3SHQA 1LV8A 3RRXA 2PIDA 2QP3A 2Z56A 4IJUA 4YO8A 4GEKA 4RM2A 3SR0A 3ZK8A 2OV1A 1O6BA 2IYYA 5ALHA 1XEXB 1CZHA 1XTUA 3AUYA 4H7KA 3S2IA 5JHGB 1DUVG 4PCAA 4JITA 2VA8A 1GWNA 3GPLA 1N8SA 3AEKB 1NWHA 3HPQA 1D09A 4IDHA 2XKBA 2FEOA 5ENZA 3ZCVA 1QQAA 1KS2A 4Q16A 1EP1B 3IDFA 3CVOA 1X80A 1ZMRA 1TZKA 2I6XA 3S1AB 4B5KA 4ZIRA 4MKIA 1Y7LA 2CXQA 3W34A 1BDBA 2PV7A 2VJPA 3GJQA 3OLXA 1SVSA 3ZBPA 4JGIA 1UODA 3I76A 1JQ5A 4K9PA 5LB4A 5FNVB 4URXR 5JCJD 1ND5A 3ZE1B 3DF9A 4P2GA 1U0LA 2XKKA 2X9NA 4JD5A 3HYLA 4X66B 2P35A 2H1OA 2RONA 4RZHA 1T6BY 5HCIA 3Q8KA 1JG7A 2D4HA 5LDGA 4ZC1A 4HWPA 3ZS9A 1T1GA 3C48A 4EVQA 2VP6A 4FR0A 3P9RA 3UH1A 4ESEA 1TTQB 2IHTA 2YIMA 1NOJA 4FFPA 5FPHA 1K7FB 3L92A 5DHQA 2Z98A 1J00A 2PAAA 1BW9B 2WT4A 4KIJA 4R1NA 4IG4A 4Q34A 4W1PA 4BV8A 3IP3A 4DC9A 1SY7A 1YS1X 1N75A 3LGAA 5KC9A 5KJ6A 1GG2A 2HSJA 3A6GA 2FCAA 5AK4A 4C4OA 1A0OA 1I6LA 5HBGA 1ZHHA 1E59A 1LX7A 3UJ6A 1M0SA 1YAHA 2G9ZA 1J1ZA 2WTXA 2XQJA 5FCDA 3WNZA 3ZHCA 4CMIA 1EP9A 3VAAA 4PHFA 2YYYA 1N2OA 4R31A 4KUHA 4AYWA 1ID8A 1TT7A 4YRRA 4DXHA 1A9TA 2HFKA 2EKDA 3SM9A 1GVHA 2RHOA 2GCIA 3ETLA 3T52A 1TO2E 2CVFA 1QTQA 2XXJA 2ESRA 2VSFA 3I01A 2AR7A 4CN9A 4NV3A 4QDJA 1XDSA 1I2BA 4G4GA 3DAOA 1QNFA 4D82A 2AH5A 3JVUA 2GS9A 1QF6A 1RP7A 3WNVA 1CHNA 2EFGA 1R6TA 2WKQA 3HBNA 4HZUB 3UUEA 1I33A 2GA9A 3P2IA 3NDBB 4PAOA 3RC9A 3OHPA 1LPAB 3L4BC 3PFFA 3RYFB 3ZWYA 2IZ1A 4MITA 1OE0A 2OV3A 3A6KA 1UADA 3ZIAD 1CY1A 4H7FA 4DLTA 7MHTA 2FZLA 1XRSB 3AZPA 1SZDA 2H07A 3UK6A 5H82A 1Z0UA 1H85A 4F3KA 1TZJA 1FUEA 3H1EA 1D9ZA 2OBYA 3M3HA 4D9EA 4DVGA 3F0TA 2C3PA 3JD0A 4JP1A 3ET5A 1Q1AA 1CUXA 3KJNA 3OZRA 4M0UA 3AHEA 4U1RA 3T5CA 4BEVA 3N6RA 5EMKA 2WNHA 3E05A 1PBTA 1A9ZA 1I4EB 3G89A 3HMKA 3LVFO 3HU1A 3PNYA 3UAVA 3W7BA 3NFRA 3QVMA 2A1UA 3S5JA 1O0BA 3Q3IA 3CEJA 4UEQA 3QLVA 1GG9A 2DUUA 1SBYA 4GP6A 5JAOA 3EYAA 5A6SA 3OEYA 3OO1A 1GZ3A 4RULA 4G4SP 1GL9B 2B8JA 3WYCA 3IE2A 1BD4A 4G2NA 1E2QA 1YI0A 3EF0A 1GZSA 3E7DA 1M1UA 1M6EX 1XELA 2IHUA 4Y2JA 2M6RA 2OC9A 3AKEA 3EGOA 5C1DA 3ADOA 5IUKC 5U4XA 5J40A 1N36B 1LJ8A 2FDRA 1NIPA 2GXUA 5FAXA 2Q3EA 1TJYA 3HSSA 1MA0A 4B8YA 1CY4A 2WFMA 1RE0A 1LNQA 4LVCA 2COEA 4XWYA 4YUYA 5HUQA 4XOUA 4UUAA 1M2OA 1L7PA 1Z28A 2ODBA 1UMBB 3AR6A 4DCVA 1G6Q1 1QYVA 4DQUA 1TYBE 4UHEA 4Y9TA 3BBPA 4MB6A 1DC5A 3CZPA 3L8YA 1X9GA 4IGFA 1L8LA 2NUBA 2JDIA 4ZZ2A 3UIEA 4DZZA 3R3HA 1JLRA 2DT5A 1HY3A 4JUBA 4W8GA 4ZOBA 5IDXA 2H00A 1QDEA 1YQQA 4BFXA 1EG2A 1D2AA 1P2SA 5J9FA 3BL8A 1NW8A 3JASA 5KYTA 3GJYA 1GU0A 3LPCA 4LSMA 2PKQO 5B3JC 1NRWA 1Y89A 4JBIA 5EXDA 5JV5A 1SOMA 2Y8EA 1ODKA 1AY0A 3AJEA 3OZEA 1EFHA 3U3OA 5E3HA 3E8XA 4RJTA 1RRFA 2Z1NA 4U00A 3H1BA 4MK4A 2ODWA 2EKZA 3JD3A 3QXSA 1HM5A 2DXIA 1IBSA 1GLNA 1D1TA 1QO9A 1T6XA 3LQFA 2I80A 2AXQA 3PLRA 3MFYA 4WQMA 1NQWA 3DCJA 2JW5A 1XQXA 4D92A 3D8RA 1E8NA 4HB4A 4WXRA 3ZWDA 1BA3A 3QELA 1FVFA 4HRVA 4KWEA 4WA7A 3ZCUA 4ZYLA 1U8ZA 3BJZA 3ETHA 1QP4A 1NHGA 1H1DA 1M5RA 2XSZD 4DCNA 1SR8A 4JNCA 3Q5EA 4HCJA 3HZZA 1H2ZA 4JBHA 5KDDA 4ZDJA 2DH6A 2P2ZA 3EZXA 4CF4A 4PC1A 4NI5A 4L3OA 4LSZA 2DAPA 4OREX 4W5RA 4DN6A 1Z0AA 3IODA 4Y2SA 4RQAA 1TD9A 1ZXLA 3ET4A 1R0XA 2MSNA 1T8YA 2KS6A 1HYGA 1FE8A 1DIRA 1IOWA 2EQBA 3R7WA 5TIIA 2QMYA 1NBEA 3RW9A 4L8VA 1ETHA 1BGXT 1IIBA 4WTOA 3KCNA 2HBQA 4NS1A 2JB9A 5IAJA 5B30A 2AR0A 3ZDBA 1C1DB 5IASA 1NVFA 2GEVA 1V2GA 1DXQA 1ISGA 1WSDA 2QGNA 4EPRA 5J1SB 1S4MA 2HWUA 4ZO8A 1RTTA 5HXAA 1J6UA 5KNDA 3IRVA 1W34A 4R5HA 1N0HA 2YV4A 2PGOA 3PC4A 4P7JA 3AY0A 1I7QB 4X7BA 1PJ8A 2ZUWA 1FQWA 3L7LA 1AA9A 3P26A 5FV7A 3CVJA 1ZH0A 3M4ZA 4CE6A 2PWAA 2QG6A 4FYMA 3W90A 2VJNA 4EHBA 3DEZA 4NOLA 5EIFA 1X9HA 3QSGA 1PJAA 2XDAA 1LB1B 3EG5A 1YUBA 4INOA 4UE6A 3BDVA 3OG9A 4YRDA 3ZE7A 3GJ0A 3MTIA 1H3NA 1HUQA 3HYNA 3L41A 3LCRA 4RD6A 3WWCA 4U6NA 1MC1A 2AGVA 4MWSA 5K7SA 4JWKA 1J06A 1G8KA 1EFKA 1KU6A 3KQSA 4IOMA 2V8BA 5CR9A 3LKBA 1A88A 4QOIA 2QKYA 3QPUA 2FQ1A 2ZIGA 3JARB 3NZEA 1RQRA 2X9GA 3I01M 4JH0A 5JSYA 3RVQA 2YWHA 3ZDRA 1QIKA 5JVDB 4C2UA 3PC8A 2PGNA 5KMGA 1MJ5A 1MPXA 1XLWA 4ZARA 3ZX4A 5A05A 4ALMA 4KIFA 5C31A 4B80A 4BU1A 4YRSA 3GGSA 2QU7A 1I6KA 3B8HA 2Z2KA 2ZIXA 4Y6SA 2OZPA 2YCLA 2Q50A 2BFDA 5AHKA 4UBJA 4AICA 2P69A 1X74A 1Y5MA 3CN7A 3MC1A 5EZSA 1OH8A 4BFLA 4Q05A 4MXDA 2G8NA 1RWXA 3EAFA 4Y98A 1CR4A 1P0MA 2C58A 4OGGA 3W78A 3WYBA 5L7TA 3E9DA 1U3UA 3LVRE 3DVLA 3SHWA 1ZM2A 1QPBA 3PYXA 3RPEA 3UWSA 3WIVA 4YMVA 3ZUGA 4YRQA 4BNGA 4QYWA 5T8KA 4BMYA 3OJOA 4R8LA 1ZU5A 3EISA 2OAEA 4MPDA 4COOA 4BX2A 3LMKA 3IDAA 2V0CA 3SXUB 3VR3D 1W25A 2QZ4A 2G76A 2HRDA 3B52X 5EHIA 2VQDA 1ZC4A 2Y93A 5KOYA 4NIMA 5DHPA 2R6GA 3IQGX 4M88A 1UQUA 3LAWA 1ULTA 4X0EA 2I29A 4KQJA 1S2MA 1HE3A 1M75A 3WGLA 1KJ9A 2YHIA 4N47A 3SZUA 4BMDA 2EHJA 5EIBC 1FJ2A 4V0SA 4BNHA 3GFPA 1WW8A 2QN8A 4GICA 3ZDYB 5JMPA 4D9JA 4CTMA 1U4SA 3JW8A 1C8LA 1CIJA 2Q9AA 4MZXA 3KT8A 3UXMA 5KNCA 1COZA 4LF9B 5HIMA 3IOBA 1WE2A 3PFKA 2G77B 1R5BA 4QPPA 3VV3A 2PBRA 4HX9A 1XPOA 5I48A 5TMBA 2IEDA 2MOKA 5DHAA 3W1EA 3QQPA 4RZSA 9GPBA 3UO8B 2YXPX 1QGED 3ZI4A 1OJLA 2VHCA 4JJ8A 3WIBA 4H18A 3HB9A 3USES 4BFVA 4H0CA 4MARA 1ISIA 3AL2A 5AVVA 3PITA 3EPPA 3DPSA 3Q8WA 3S4YA 1BH2A 1VIAA 3H75A 2PX3A 5EJ4A 3U44B 1EK6A 4LWZA 4AZTA 2VTVA 2B83A 4IV0A 4L4YA 4HGOA 1TF7A 5E2AA 2YOHA 5K20A 1TUEA 2X9VA 2AJ8A 4O0LA 4ZT3A 3UJ9A 4GKJB 4EHAA 1ZI8A 1PSWA 5BN1A 1HDRA 2I6SA 2DR2A 4YGYA 1I4LD 3KQHA 2VYQA 4BKPA 2AOTB 3HU5A 3P19A 3EDYA 3FH0A 3OZGA 1MRZA 3W5IA 3FIJA 2HZBA 1KEUA 4E1VA 1KAMA 2CNDA 3DVAB 2UXBB 1HETA 5LMNB 3BH0A 1S7CA 1S5PA 2NVOA 2C8VA 4ZVMA 1JJBA 2V7UA 2XTAA 2WKPA 2W6NA 3E2MA 3DHWC 1D0VA 1QANA 1TECE 3K9NA 4FNGA 1YZYA 3D1JA 1XRPA 3AXTA 1PEYA 4ACBA 3WGNA 3IYLW 4MUBA 2HNKA 4BMZA 4ENTA 2VTDA 4E5DA 4I50A 4ZMBA 4RCZA 5J2UB 4OQ4A 4RH0A 3LBNA 1KO1A 1U7OA 4W9NA 5D51S 2WWTA 3MQFA 3MHTA 2AG5A 1AO3A 2HK9A 2QMZA 3X1DA 4URVR 1QMGA 2O6LA 3CRQA 4K28A 4M1OA 4WAUA 2RGCA 5ALSA 1DC7A 3ZGNA 4IIJB 1Y4DE 4DWOA 3NHZA 1DWUA 1J07A 2ORED 2Q3FA 3WP1B 1RM3A 5IEJA 3GZNB 2BVNA 1GUDA 3DBLB 5H68A 4JJ7A 3STXA 1ZRHA 5C8XA 3WIDA 2DQYA 5FPYA 3ZZ1A 1SD1A 3DKIA 1OFUX 2WAMA 4CMJA 1D3AA 1Z36A 4OQXA 1UQTA 2AVNA 4NJEB 4URZR 5IMBA 4DLAA 4CEHB 2V59A 4MKHA 4GL4A 4OD0A 4N8DA 5IFKA 1UPAA 4K8RB 1RXEA 3GYGA 2VFAA 5BYKA 4UXHA 4I6JA 1XRNA 2Z57A 3IAEA 4ZMRA 1BCSA 3A28A 3ZQ6A 1XZGA 1WMDA 3DDNA 2PMDA 2A9PA 2G4LA 2G08A 4W5TA 2AN3A 3LT5A 4F6RA 3H5AA 3PXGA 3H5WA 2JK0A 3CC8A 1WIWA 1PWHA 4QGBA 1GFZA 2Q21A 1QH8B 4BNWA 4DSUA 3BDIA 2H5IA 1RXCA 3ITNA 4P4UA 5JR3A 4YDSA 3O4FA 3FBTA 4A73A 1OFIA 4RLSA 1XMIA 2I4RA 1NVGA 1TVEA 3O8RA 1F4PA 2F1RA 4L6IA 4PLFA 3WKCA 1T9BA 1M2NA 2QD5A 2FSPA 1WMAA 1UFRA 2I1WA 1Q44A 1W1WA 2VNAA 3I2GA 5IBRA 4KR2A 1P61B 3ND5A 1H6DA 1O6GA 1BYUA 2DMRA 4FWBA 1P5HA 3G9TA 4FYIA 1CUEA 5FPPA 3E1SA 3IA2A 4EX6A 1GZ7A 5IYZA 3BHNA 4D8UA 4BUCA 3VMMA 2VAMA 1KZ9A 1BWPA 3C5WP 3BH6A 5DIZA 4F04A 2GFIA 3KOYA 3W5DA 1IQUA 3A2NA 3SWWA 4W99A 4JEHA 2QD4A 3F1KA 3EH2A 4FYJA 2WJ4A 2GXQA 4FMCF 3PRJA 1HH4A 3TQSA 3ZWNA 2FB9A 2ERYA 2HMAA 4CM4B 2J9ZB 1HLPA 3L4JA 4F91B 4H77A 5E9QA 3BE5A 3AZOA 3GAAA 1AG9A 3GRPA 1G4AE 2YJ5A 2O20A 3D6AA 4ODIA 4RA9A 3LWNA 4ZOLF 4POAA 3RNOA 3W8NA 3WL4A 1ZVJA 2NG1A 4R7TA 4L4UA 3UTCA 4K40A 2XOEA 3AT1A 3W5CA 3MINB 3H17A 3ZEIA 3C4QA 2OCBA 4I1PA 4W9MC 2XEXA 1DEOA 1VE7A 4N54A 1ZN9A 3IIKA 2EEZA 5CFRA 1BJRE 3FYUA 2G25A 1T9AA 3MCTA 1ACJA 2QA5A 3AOEA 3NLLA 1X42A 3FPGA 1K9VF 2HLHA 4NBNA 4PYNA 6YASA 1ZR2A 2AEEA 1MF7A 3BCSA 1W94A 4UNQA 3T8YA 3U56A 3U3DA 3V6MA 5A03A 5CFMA 1Z5PA 2OZKA 4QDZA 5E4JA 4EUNA 1T15A 2XE7A 2GK6A 2HX1A 3Q6MA 3FPJA 1XA3A 2QYSA 2KWIA 1EVQA 2AYYA 1ZGJA 1J42A 2H63A 4E11A 3G88A 2ST1A 2CE7A 2IOYA 2OHVA 1A2OA 3I2HA 3K15A 4QNRA 1ECJA 3WL8A 1LPNA 2ADOA 5F3RA 3RVNA 3UNXA 1EHIA 3ZKWB 1GSOA 1MEJA 3H4VA 2J3HA 5JMWA 1GPUA 3P20A 3OFND 4I1IA 2ZWIA 3PVSA 1UKVY 4BAGA 1SCIA 3ETCA 2PZLA 3I53A 4HFNA 2G7MC 2X0JA 1JJAA 4WKCA 1RMYA 5I7SA 1AB5A 5F12A 4EG5A 3ANYB 3TFQA 3TINA 2E21A 5SV2A 3V33A 2K5UA 1VBMA 4A5SA 1P44A 4MKGA 3MPUA 4YJ2B 5AW8A 1AQIA 4NBTA 3LBAA 2LWIA 3BL6A 3MLBA 4IIVA 1QOQB 4MWZA 2F3UA 2ZI5A 3O4IA 2P41A 5ED4A 1SHJA 1VIVA 5DU2A 3QPWA 4C7JA 1SXJB 3AB7A 4HSEA 1Q83A 5TV2A 4BLOA 3R3UA 4KMOA 2HLNA 2CLSA 4BEJA 1GN9A 2P3LA 4DQXA 4B3SB 1VE9A 2K7ZA 1OZ0A 4BN0A 3PFNA 2WMDA 3B6JA 1O6CA 3KJIA 4QTZA 3FSRA 3SJZA 1UBEA 2WA1A 3BFKA 4RE5A 3A7EA 3U60B 4C7XA 1UJMA 2XRMA 5HKBA 2ZDGA 4EB8A 4MCHA 4P7GA 1V4VA 2WHQA 1AGXA 4G4SO 1T3ZA 3OE5A 4JDUA 1NQTA 1G20E 2BM9A 2FWRA 4NK4A 4CU5A 1KTVA 4GZMA 5I8ZA 4XPZA 1NI4B 3QHPA 3LTNC 1U1CA 5CDTA 4BO4A 1KOLA 2OLEA 1SFRA 3LUCA 4D74A 2HIMA 1N2CB 4P35A 5LMUB 5BSHA 2P5SA 2J5BA 2Q45A 4UZEA 3TN7A 1WSAA 3CNEA 2HSZA 4NYIR 4PM4A 1UPCA 2Z1DA 1MAVA 4JLSA 3RREA 3FSJX 4ETIA 4TV9A 1RJEA 4R68A 1LSOA 4Y8VA 2M6LA 4S05A 2PTHA 1B2RA 2PPLA 2Z2JA 1ZA1A 1QIFA 1MB9A 5D01A 2ZJ4A 1XJQA 1TZBA 5JJBA 5KJ1A 4FYYA 1YGPA 2VJMB 3ANMA 4JBNA 1Y48E 1FBTA 4MGZR 2QPLA 3SIPA 3SZLA 1CQIA 4DR1B 3PKZA 2KE5A 3RVMA 1SHTX 5KNDH 3ZJ4A 2TYSB 4P4SA 3LUDA 4WN9A 3U09A 1SUWA 3T9EA 1DAEA 1PAUA 2BH2A 3C6YA 2DSNA 4P7KA 1DL5A 1OX4B 4PGHA 3IQZA 2ZJ7A 1NG1A 1JPUA 4J07A 2X2PA 3KVNA 2J4FA 3LOPA 2FFJA 3IR6A 4I4TA 1YL7A 4Y2UA 5ETJA 2VATA 4PZEA 3OETA 4N9QA 2G1AA 4QU0A 3SQWA 4ZAWA 4JDPA 3TTWA 3F74A 1Z5NA 2CY0A 3CRRA 4P08A 3OQBA 1DIOB 2X5KO 4Z7NB 1TIPA 2C4KA 3T1VA 4KFSA 1YU9A 1WDMA 1XFDA 4TWAA 3AGPA 3JWGA 3K1AA 2HTFA 4CKYA 4EB6A 5IJZA 1TCCA 5A4FS 4MQFB 2ZYWX 2Q1WA 2ZZKA 1S1MA 3ELUA 3R5HA 1FW8A 1ZEMA 7REQA 4IINA 2QVXX 1GVNB 2V45A 1U2QA 3R9IA 2IP1A 5J5VA 3W4JA 1PJZA 3L93A 1M0EA 4GRDA 4UTNA 2AEFA 3VVBA 3GFVA 1LRJA 2CLKB 3DOIA 3G6KA 3O4GA 2BEVB 4KQXA 5HDQA 5ALYA 5DBEX 1YB4A 3OMWA 4JQCA 3LHIA 1ZM7A 1VPDA 1OCEA 2O7SA 3TE6A 3WK4A 3GRZA 3K1TA 1B4DA 2GCOA 3CBGA 3KYBA 1V9LA 4YMIA 1YIAA 3Q3CA 3GT4A 1SZJG 1HE1C 1NT4A 1UT6A 1WL8A 1F9EA 1JRLA 2P78A 2QUZA 3FDXA 4MVJH 3HCBA 2NWQA 2XE4A 5IK2A 5IZCC 1FDWA 4JP2A 4GOXA 2OORC 1JKJB 3GC6A 2ETVA 2A9FA 4M7WA 4XKJA 3AHHA 4W8HA 5C8YB 1JEQA 1MOZA 4G4IA 3UOGA 4PAQA 2WK1A 1EUYA 4KQIA 1BOOA 1U8XX 4S2EA 3V7YA 4BFCA 3I72A 3UT0A 4NZYA 5KJFA 1DTWA 3LIIA 4HNAB 3OU2A 1MGOA 1E60A 3IBGA 4QBIA 1PT9A 3RSQA 4CM5A 4YRFA 3VR0A 2BM0A 1KQGA 2J0UA 2N42A 4RIEA 4UQOA 2HV9A 1MT0A 3DZDA 2MDTA 3MYRA 1RAEA 1X7HA 4MI1A 1D6NA 1NAHA 3E0XA 4TT3A 2VXOA 5CDUA 3P9XA 3QVGB 4BUZA 4DJDC 3GVXA 4MIEA 4LPKA 1YB6A 4KFTA 1RMTA 2ISCA 2N1MA 3L18A 3KD2A 3NWJA 4Z0HO 3PQ5A 3LX8A 4KE8A 1NVAA 5JECA 1UFQA 4E5YA 3HXQA 3LY9A 3PUIA 2WPNA 3C3MA 3RRNA 2BMFA 1XQ9A 1DBQA 1FMCA 1LDMA 5F9HA 1BGVA 1VLQA 1JW9B 2AMJA 1WUKS 3L06A 4K03A 2NU8B 1MFPA 3LQ1A 3JQRA 4NMHA 3CVYA 1BC5A 4LN1A 5JO0A 1N9GA 3LLSA 3W8FA 1UKYA 4AP9A 2FR8A 3A1FA 2BFPA 4GYJA 1ORIA 5JQGB 4BXOA 3ELDA 3NOXA 5E4FA 2B8EA 1T0BA 3AONB 4XSVA 1ZNZA 1CEYA 4BKRA 3AIMA 1P4SA 3BEOA 3HV2A 1IAVA 4N5LA 5FPKA 5JBNA 2JEOA 4XIFA 3LYUA 5GWXA 2ZUUA 4ND1A 3BFJA 2ALJA 3LH5A 5H16A 2QQEA 3KP1A 3GFTA 4PHHA 3P4YA 3OCWA 1TEZA 4NS4A 4HS9A 4BQQA 3UT6A 1RM0A 3EZ7A 1H4VB 1ZD8A 3D8NA 4HUJA 4MUYA 4KX5A 2NNLD 1WDLA 4WLEA 3UJAA 4A9AA 2GD1O 1KBQA 1L4UA 2VSNA 4LZAA 4DVJA 5EMNA 5FWNA 1QR2A 1RADA 4PXAA 1E7QA 4HN9A 1J8VA 1PR3A 3F6EX 1QIHA 3I28A 4KQ2A 2M98A 2NYRA 1TUBB 1ZUIA 1BTOA 3W7VA 4EY8A 4MVJE 1HFJA 1ACLA 1K6EA 4DANA 3SDSA 4UTPA 2QYTA 1MN6A 4ALIA 1K8ZB 3WGMA 2ZVQX 2CDCA 3NONA 4UFNA 4B34A 1QS0A 4L3VA 5AJYA 1Q1NA 2GHQA 4YRAA 4WZAE 3HXMA 1YDMA 1QV7A 1PK7A 3OT5A 4WECA 4BCCA 1Y1LA 3PXAA 2E6UX 5C80A 1TA9A 5DN6D 5AH0A 3GEGA 2X40A 2GYUA 1PTJC 3DZHA 4BUJA 2BZ0A 3IKLA 3DV0B 4JJ4A 1UM8A 4NBRA 5AKXA 3MFQA 3BHIA 2EU8A 1TEVA 3SHTA 1UPXA 2BTQA 2PYIA 2RH5A 2YY6A 4ZRMA 4CGYA 4P53A 3OE7A 1TJ4A 3LBFA 2MYPA 2XY4A 3DMGA 1Q1ZA 5E1DA 4KQKA 2IPOA 2P79A 3N1UA 2DSTA 4F9TA 2FMKA 1Y6QA 2WLSA 2GEDA 4HEQA 1GGKA 2JFZA