4I88A

R107g hsp16.5
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
113
structure length
113
Chain Sequence
b'IQISGKGFMPISIIEGDQHIKVIAWLPGVNKEDIILNAVGDTLEIRAKRSPLMITESERIIYSEIPEEEEIYRTIKLPATVKEENASAKFENGVLSVILPKAESSIKKGINIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Small heat shock protein HSP16.5
molecule tags Chaperone
source organism Methanocaldococcus jannaschii
publication title Changes in the quaternary structure and function of MjHSP16.5 attributable to deletion of the IXI motif and introduction of the substitution, R107G, in the alpha-crystallin domain.
pubmed doi rcsb
total genus 17
structure length 113
sequence length 113
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2012-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17886 ArsA_HSP20 HSP20-like domain found in ArsA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4i88A00
4YLBA 2CR0A 2RH0A 4ZJ9A 3AABA 4FEIA 3Q9PA 5LUMA 2BOLA 4JUSA 5DS1A 1RL1A 2Y1ZA 3EUDA 2WJ7A 2CG9X 3L1EA 2Y1YA 2KMWA 2N3JA 2KLRA 3QORC 4I88A 4M5TA 4RZKA 3VQLA 1X5MA 2O30A 3Q9QA 2K8QA 1WH0A 3AACA 3GUFA 4YDZA 2WJ5A 3IGFA 3L1GA 2MNWA 2XCMC 3L1FA 1EJFA 2N0KA 3J07A 2JKIS 4M5SA 1SHSA 3GT6A 3QORA 4PBDA 1GMEA 3QORB 4ELDA 3N3EA 2Y22A 4YL9A 4MJHA 4YE0A 3GLAA 3VQMA 3QORD 5DS2A 3W1ZA 1WFIA 4YLCA 4PCKA 4JUTA 1WGVA
chains in the Genus database with same CATH superfamily
2Y72A 1QWHA 2Y25A 2K1MA 2ZJSH 3MRBB 4IBYA 3MRMA 4BK5C 1SQMA 3ZQWA 1T89A 2TSAA 2IBZY 3VI4F 3LQZB 1A47A 1QI5A 1VRSA 2N3JA 4DSYA 5JPMC 2VDRL 1ITBB 2B39A 3FB8A 5AG9A 2HPOA 1GGCL 5SX4H 5LBSH 2C1OA 3LEXB 4EQ3A 4AYFB 2YS4A 4JY5L 4XBMA 4HGMA 4BA0A 4QHKI 2AXWA 5JOFA 4QNPF 4IIZA 1MKFA 3TASA 4PJ5B 1NGYB 2FWLB 1IAIM 1BXXA 4MX7B 3IB4A 3IDMA 3KCPB 4WY7L 1IM9B 1SQ2N 4G82A 3TEYA 1MCNA 5AOMA 5I1GL 1JERA 1R3KA 5HGDB 1IC1A 4K5PA 4OLZL 2WXIA 4P49A 4PJEF 1HH6A 3ZE1E 3L3HB 4XMXA 3FCSA 5DFTA 4PTTA 3MCYA 3GXMA 2EDYA 2MCG1 1OQXA 4OF7A 4UCFA 1WZ1L 3ZLQC 5CJ8A 3OAZK 4ZNCD 1AC6A 3KS0H 3K4ZA 1IUZA 3DVGA 5FDWB 3QHTC 4H8QA 1FNFA 4P4KB 3GXUB 4G6KL 4G5ZH 4WU7A 1EGJL 2K70A 3TZVD 5ESQB 4AVJA 4HK0A 2EIZA 2YEVB 4Y9BA 2FEJA 4X5RA 4G80B 1MPAL 3KJ4B 5T1MB 4Z7UE 2AV7B 3AG1B 2C9AA 4BQ6A 1S6NA 1XB6A 4PRHE 4AUJA 2FECI 4N2EA 4P5RA 5KOMC 3GBNL 4H88L 1U42A 4PI0A 3RG1C 3H7BA 2W5PA 3TFKC 4POYA 5B39A 3NBNA 2J6WA 1WWCA 3F64A 5DFVC 2YAEA 1B2WH 35C8H 3IRZA 3D08A 1ERNA 3IGUA 4E5XB 2MRYA 4KY2A 4NQQA 4ZFGH 3UPCA 5GQBA 5E5MA 4HG4K 5H37H 4M8QA 3DTDA 4AGLA 1ZA3A 1P4BL 2EO9A 3SY0B 2UWEF 1L6ZA 5C2BH 3IFLH 3TN0A 4JRXE 4NHUB 4XOCA 1S9VA 2A6JA 2IDFA 3ARPA 3D07A 1NGQH 1ID2A 1KYOJ 4F8TA 4XP5H 2NX5D 3IU4H 1YC8A 3GBDA 3N9GH 1DQJA 5I76B 5HYSA 1TYRA 3ES6B 1KTKE 1G7JA 2XV6B 1QQDA 3SPHA 3FRPB 1LK3H 5JOPE 1I1AC 3ZHDA 1UZ6E 4K3DH 3JXAA 2WNWA 3Q0HA 1GZPB 5E8EB 2HMID 2R1WB 3WJJA 4ZW7A 1T0MB 4WF7A 1F6LL 1J8RA 3VRJB 4I0PA 5MEQB 3GI8H 3W0WD 2P46B 3OAUL 2BINA 1X7SA 3BD3A 3FB7A 4FCHA 3VCLA 4ZUTB 5L4FA 1BYPA 5BOJA 1JFQH 4JKKA 4E9VA 4N26A 2EUZA 4J39A 4NUJA 3AQYA 3BN9D 1HU8A 3A24A 4IDJL 5HHOB 4LEOB 3GHEH 1MVYA 3TH4T 3PHQB 4P2OD 5IOPA 2NQCA 4PW4A 5IB1B 1OF0A 5EOCH 2J5LC 4AUUA 3MOAH 3GRWA 4ZUVB 3CBKB 3SPVA 1QSEE 4AQAB 4LSQH 5HSFA 3LH2H 5G55A 5DZOA 1GYCA 3BVUA 5K39A 3UL4A 2A83A 3MV8B 5K33A 3HR5B 4TUOA 4NRZA 4BBWA 1Q9WA 3BIKA 4OJFH 1OP3H 1L9RA 4FL4C 4UTBH 3U7AA 3CZJA 3MMEA 3GJFA 2EIBA 3IMVA 4F2FA 2CHZA 3CFEB 4CC4A 3LPOA 5B1JA 3TBBA 2NW3A 1ETZA 5D8JL 3QSKB 2H1LM 1ND0B 2BPBA 1HS6A 1X5FA 3UP1A 1VFAA 1VEOA 1J9SA 2NW2A 5HD8C 1MVUB 4Q9BA 3FF8A 4G8GA 1HOCB 3TVMD 4N3TA 4KOBA 4FFZA 3KPMB 3NTCL 2ARJA 2R1YB 2OCCB 1IGYA 3W81A 3T8XA 3RWDB 5LGHH 4ZXBD 2JI1A 2J5LB 3KDPB 1YHPA 3DV6B 3CMOL 3CPUA 3F6LA 1NL0H 4LB8A 3S96A 3QJHB 2B1OA 1G9MH 3L16A 4MBOA 4NQEB 5JPNC 5AL0A 4FLHA 2ATKA 4XODA 4H20L 4C55A 5L0QB 2N7AA 4M1DH 1H6EA 4UMGA 3VH8G 1AIFA 1QNZH 3FQ1A 3WN5A 5J56B 1A21A 3I6LD 1BFSA 2GI0A 2YD4A 3QAQA 1G7JB 1QQDB 4QO1A 5F88A 5JR1H 4M3HA 4I1PA 3QUZA 3NCFB 4TNVK 2V9TA 5C8JA 2XA3A 3JTTA 2J1XA 2X12A 1G9HA 1QFOA 3O8XD 3CE1A 3I3EA 2A9NL 3VD1A 1N0LA 4KXZI 2HTKD 2CKBH 1SXCA 1AD9B 4MCZB 4KJPD 4ZS7L 1OP5H 3V0VA 3V4PL 2ZOLB 4MJ6B 3WFZA 5BVPL 2TAAA 1NKOA 1A6UH 1QYGH 3L4CA 4ZW6A 2QT6A 1BMZA 2FO4A 1F8TL 3QDMA 3ILDA 3I6LE 3T0ED 1CN4A 1F3RB 2Z93B 2GK2A 3WS3A 1SVZA 4NB7A 1YMHA 3QFDB 4JRFA 2BY2A 4YXKL 1D6VH 2EH7H 2D7NA 3OVUB 1GZHC 2AEOA 2V2WB 3NAAH 4I5BA 5EUOF 1ORSA 3OSKA 2NQ3A 1N26A 3MJ9H 4AYMC 1XGRB 3JZYA 3MUUA 3WIAA 5GGVH 3U1QA 3RWHB 2WYIA 5EIIG 1NAMA 1CXLA 4PVNA 3QHZL 5AZEH 2FSEB 2VDLH 4S1QH 5I0ZA 2WTOA 3OMAB 4FG0A 4GSRA 3VWJA 1LM8V 1H8NA 2EDLA 3CIAA 1O5PA 4K7PH 1RVFH 4YFEA 5JHDD 4FXTA 3SE9H 1PFCA 1TETL 1T1ZA 1EZVY 1OGPA 3GBML 3P4NB 4OFYD 2F1AA 1XDTT 4QHMA 5EZJB 1FYTB 1VSCA 3UYPB 4Z7UB 2XKNB 3GEWB 4M7ZB 4XVTL 3KLQA 1LMIA 4FFTA 2KS0A 4F15C 5DVMA 1INDH 3W5MA 5FCUH 2DEXX 3PAVA 3DNKA 4L9LB 4XNQA 5K9QG 5G4MA 2F18A 3MOBH 1I3UA 1U21A 1YO4A 4HCRL 4JFQA 4JDZA 2FRGP 2XZQL 3MRKA 3TBYA 4ZD3L 5CEZH 5GS2H 1XZWA 2X1PA 5F7BA 3V0AC 1MSPA 3VSQA 3IETA 5ANME 4WKZA 2MMXA 3KYMB 4HH8A 5IHUH 3QCTL 2X10A 2VZUA 4YHPB 4BZ1L 4HCGA 3B7UX 5L8JB 2HWZH 4GKZB 1BVLA 3H53A 4WI4A 3UZVA 5J12B 3SDDB 4PRPD 4MZIA 2DMBA 3APDA 4K5LA 4RGNB 5E8PA 1VESA 4A2HA 4JPIA 3QO1B 4G9DB 4XPBL 3LS5L 5DMGC 3VG0L 1E6JH 3GSNL 4ZOAA 4OZ4B 5E8DL 3VXUD 4OCWL 3HAEG 3L4ZA 4Q6IB 3WMSA 2YK1H 1GC1L 4DOHE 5ADOL 3LSOB 1HVXA 5TE6H 3L5IA 1NC4B 4XBPA 2XTSA 2MCPL 2WMPA 3S35H 5CHNB 4LLQA 4DK3A 1RHHA 3P3RA 1NC4D 1T3FB 1D9KA 4PR5B 5TDPB 2IAMC 3ELQA 1E4WL 2ITFA 5ITFB 1IL1A 4Y5XC 5D4QA 4KNQA 4RRPM 2V2TB 3AS2A 4HJGB 1V3LA 3G6DH 3NZHL 1PX3A 4RQQB 4AENA 1Q0YL 3KWWA 2H1PL 4MXWL 1FE8L 3AS1A 3WHXB 3UX9B 3KL5A 4Y16B 3US0A 3CK0L 2FYYA 5AOZA 3AWEA 1HL4A 1SJHA 3SDDD 5B3JF 2JKTM 1OAXH 3GSNB 5KSBA 3UJIL 3SDXE 3QUML 4KC3B 1QSEB 1OOWA 4WKZB 3ULVH 3WN5B 3NCYP 3J8F7 3BUBA 1PG7W 2WHVA 1OT1A 3CVHL 1FC1A 4MGXA 1JZ5A 1CD9B 1N6VA 1ORQB 4QPEA 3JT2A 4I0PC 2IV9A 2UZIH 5EIQA 5KSBB 3QEQA 3N91A 2BMKA 1QLEB 3MLSL 5B8CC 1MVFA 2V5YA 2VUKA 1GTFA 1AY1L 3WHE1 1CURA 2RR3A 2YBRB 2D4DA 4WUUE 5EN2A 1SY6A 4ONFH 4HWUA 2V17L 3GRWH 4MWFB 4OU3A 1OCRB 1XCQA 3PV6A 1FYTD 1DQQB 1RI8A 4KQ4L 4NP9A 2VDPL 1IAIL 3RZCA 1ONQA 3SZKC 2EDQA 2WMPB 5C1MB 5CGMA 5HHQB 5I1DA 1CO1A 1XXDC 3MRNB 1I9JL 1A7BA 2E27H 4G1MA 3Q13A 1DN2A 3V79C 3M7OA 4HH9A 3BFQG 1CE1L 3KPRD 4P9HL 2LFEA 4HS8L 3RFZB 1YG9A 1AKJD 1T4KB 2X3CA 3FQUA 1U41A 1YECL 3UZVB 1CPUA 2FVNA 1HHHA 5HHVH 2A9DA 4JFPA 4N2IA 1BZ8A 1AMXA 4CC4C 4G70B 4Z76B 3TVMA 1OSYA 3MCKB 4YSPA 2CLVB 3VFRB 5CZKA 4JMXA 4E0RB 4JFHE 4IOFD 4PJ6A 4GJTB 3U25A 1QBML 1FG2B 4GMSH 3O6FC 4NCC2 4PJEA 4R4FH 3CFDB 1DBJL 1P4LB 1X5AA 1ZLEA 4XRCA 3I50L 2RTTA 3TBTB 4MAYC 4NQSA 4YDNA 3F7PC 3O8XB 4ADIA 4L8CB 1QBMH 4KMLB 4KKNA 2AJ3A 5FO7B 1S3RA 3QQDA 3FQWB 1QABA 1M57B 2AJZA 3O3DB 5E1HB 5KVEH 4ACPA 2BHFA 2OTWB 5TD4A 3MRHB 4KKCC 4JFFE 2W9DL 1S5HB 4L4TB 4AENB 5TH2B 5CEXA 2IQAB 4QRRA 4JN2A 5CJXA 4BE6A 4OV6F 3HB3B 2Q76A 4NUGL 3DVFA 4EUPB 4Z78B 4KQ0A 2WLKA 2AJZB 2X40A 3O3DA 3UBFA 4B9FA 1CFNB 5GRVL 1HJBC 1F58L 4PV9B 4F2MB 1B4RA 3DO3A 3QUXC 4N9GB 4M93C 4A68A 2E27L 1OT2A 4OZ4A 1UD6A 4PW3A 5IP4A 2FH6A 4OCRL 3HPLA 3TCLA 4I88A 3ETTA 3ZMRA 5JXEC 4MHHI 1G7IA 4PV8B 2HLAA 1ASPA 2ICES 3MBWB 4XP6L 2ADFL 3TVMB 3VFRA 3QI9C 2IDQA 4JY6A 1G1OA 1FHGA 4UUJA 1EFXA 2DL9A 3Q44A 1TSRA 4IEFB 4A2EA 3BSGA 2FO4B 1A22B 5I2IA 4G1EB 3UFIA 2AQNA 3JSSA 2E7LC 2HLAB 3FU6A 4OCYH 4X9YA 4EQ2A 2OZ4H 3UDWA 2I24N 2JCWA 1C12B 3PY9A 1NUGA 2GK0B 4DFHA 4Z7OF 5J1AB 1EAQA 2HFGL 1LO3L 4X6CE 3IDJB 3IRPX 5HI4C 5E7BA 4Y88A 4FXGC 1RURL 2FO1A 1U8JB 1WZAA 2YD3A 5I8EB 1JGDA 4K07A 2E3VA 2CKBB 2VXSH 2DF3A 2NYZA 2D2CC 3IS1X 3MV8D 3QUMH 4I85A 2ITDB 1CLYH 4FZ8L 3QUZC 5C0FA 4HA1A 4HC1L 4EEEA 2I60L 3Q7JA 4XMLL 4AVKA 4MXWH 4AGQA 4HP5A 4LDLB 3PIQB 1UM5H 3KLHC 2ROXA 1JUFA 2G75B 4Y1AA 3UPRA 1FP5A 4TOYH 1SMDA 1UM5L 2QPFA 1B3IA 2ITDA 4X4ZA 1J0IA 2AK4A 5BCAA 3FB5A 1KT2A 3D7PA 1C16B 2LT9A 3BZ4A 4G83A 5ICXA 1SF3A 1P1ZB 3X12A 1TVBB 4IBTA 5L4IA 6PAZA 3WNLA 3ESMA 4Y16D 1FG9C 1WWAX 3TP4A 1QFWH 5ADOH 5DZLA 1N68A 1XD1A 1R5VA 5CJ5A 2ENSA 4NBZB 5E4AA 5HYJE 4IYKA 1YEDB 2Y5EA 4KTDH 4FQXB 5D1XC 1FVEA 1AGFB 1INEL 1NBVH 4G1MB 1HYSC 2H3KA 2DI8A 4FJYA 3PAZA 4OSUL 4U1IA 2F5AL 4ERSL 2KZWA 1PW3A 1XGQA 3PS6A 2UY6B 4EXKA 1DL7H 4A2DA 3EOAB 3DROA 3RX7A 4WIQA 1NPJA 1FH5H 3F5WB 4P23D 1S7SB 5E2WH 1FL5B 3SO3B 1PG7H 4JVUA 1A7PL 1NIEA 2ADFH 3ZKXB 4D0CB 3PWVA 2F19H 1DUYA 2OMWA 4K7PX 2FIRT 3KM2A 4PGDA 3DBSA 1N59B 3DOSB 5E2UH 4M5ZL 1M1XA 4ZX3A 1AHKA 2BHYA 1P4IH 5H37A 3K3QA 4Z77B 4LCWB 4JM4H 5F7EL 3NFPA 2DLEA 3FONB 4LHUG 4XNUH 5KS9F 2GBVA 3T6WA 4NUJB 1CFSB 4LIQL 5HHOA 1C16A 3BC9A 3EJZD 3QCUL 4GMTL 4JFXA 3LX9A 5KBDA 4IKNA 5F9DC 2V5RA 4UIKL 2DQJH 2VM3A 4WV1A 5DZJA 3L2NA 3U9UA 2ENQA 2AAVA 2XWJB 2FK9A 2BFVH 1E4KC 2C3WA 4P06A 5F1OB 3JT0A 5J8OA 1OY3B 1PTZA 1DSYA 3HA0A 5IF0A 3E9TA 2QVKA 2VDKB 2VDPB 5TK4A 2VISB 2IQ9H 5L88L 3NJHA 3IDXL 4NZRL 4HMCA 1A4JA 2DMHA 3BO8B 3QG7L 1UB6B 5KVFE 1RZKH 5IJVB 4B5ZA 1TCMA 3BQUD 5DR5L 1FRGL 3DMMB 4FLQA 4HAFA 1UZ6F 1KIPA 4MZ3A 1KN4H 4U3XA 3DMMD 1IBFA 5FGRA 2FQDA 4QT5A 4P2RE 3FFCA 2BO0A 12E8L 2F7RA 3W56A 3FSAA 3ELAT 4FYQA 2PP9A 1NGYA 4ZFQA 4WJ5B 2YD1A 4MAUH 2WB7A 4WHDA 3VD0A 4M6OL 2WAQA 4XP1H 5D1ZC 2R4RH 1ZLSL 1KJ2L 3F85A 3VD3A 1FQ9C 1EVTC 1OOAA 1RD6A 3POCA 2ZPKL 5FUZH 5C0BB 1JTPA 3H85A 4KVCH 3H54A 1NFAA 1HI6A 3E3QC 1ZHLB 3QXAB 2XJKA 4WV1B 4HFUL 2AXFB 3B3IB 1QHOA 2R2HB 5ESVB 1JRHI 5J6GB 2J6EH 1MUJB 2EIZB 1MY5A 4WK0B 4WW1A 4U1NA 1IBBA 4KRPD 3ECVA 1U4FA 1VFUA 3L5HA 1CF8H 1GW0A 3N1GC 3TNNB 1JZ4A 3RTQC 4W9FC 3VFSA 3PIQA 4LDCA 5HJBA 3FONA 3W3BA 3CMOH 2FATH 2YN5A 4GKLA 4NQTA 3SKMA 5A43C 1K5NA 1OB1A 3UIYA 5E5UB 4F3FA 1N8OE 3HFML 3GSUB 4LASL 3NTCH 4XX1E 4KKAD 4NENB 3KLHD 3O3BA 3QO0A 2D4FA 2F8VA 3UJTL 1MHCA 4L4TE 4S11A 1BD2E 2EO1A 3GI9L 2P8MB 1EHNA 4L1HA 3QJTB 3REVB 1R3HA 1MRDH 2WINA 3ZO9A 2EXYC 1WK0A 4FQCH 1GC1C 2Q8AH 1O6VA 1CFTB 4ZXBB 4A66A 1P7BA 2FH8A 2WXJA 4BFKA 2ED8A 2XV2A 1JOIA 5BRZA 2XWEA 4IRSD 1UEYA 3RVUD 3TFBA 3MNDA 5EU7E 5B7EA 3RDTA 4UOJA 1IAKB 3ZL2A 3N40F 5T33H 1YY8B 2MH4A 3HS0B 2MHAA 3UTZB 2WJ7A 4PJ5A 4KTEL 2AXGA 2NY4C 4XMKL 4B60A 3SCMA 2MQGA 2J43A 3C9NB 4J8RA 4NHCL 3HRZA 2VDQB 4OGYL 1I31A 1JDDA 2EKSB 2EH8H 3WFHA 1VAHA 3QQ4A 4HWBA 3IMWA 5AW3B 5A7BA 3SJVB 3F2LA 3VRIA 3KE0A 2F8XC 3C6LD 1RK1A 3KPRE 3PU7A 2Q7YB 5KSVB 1P5VB 1C5DA 1U8OB 2E75C 2AP2A 1XSOA 4NHCH 5GRUH 4JHUA 1NUDA 2EEXA 4GY4A 1NGWB 4KTEH 3VXQB 2X0UA 4FXKC 2HT2C 3T6XA 3X1FA 1L6PA 4XAWL 2VZ3A 5F7UA 5K9KA 5T33L 2Y5TA 2W94A 1O7DE 5E4EC 2ODHA 3TV3L 1X4XA 1KXTA 3WU1A 2H2PD 3C08H 5C0IB 4X4XB 3MNWA 4OCLC 3QCTH 3X14B 2PWGA 2HH0L 4ZNEA 4P2OB 4FQCL 4QY8A 1MUJA 2APFA 4K3DL 4BQ9A 1SM3H 3WTYA 1UASA 3MVSA 4PRPE 4Y2DB 2ZE0A 2LTQC 5FA3B 3S96B 1G1KA 4HLZG 4ZD3H 3CG8A 5CEZL 2FECL 3GI9H 4KNUA 5BV7C 1FORH 4D9RE 5J1TC 1XBDA 4GW1B 1C1EH 2A9ML 1S9XA 3D0VB 3BKJL 3MRPA 3BRDA 3T0EA 4ZSOA 4BKLB 3JZ7A 2A4ZA 5CP7B 3D0LA 1U8LA 2DBJA 1KLGA 3MR9A 3MYZA 3K2UL 1N2RB 2JTYA 3FB7B 4TQ8A 4XWOC 5AYTA 2QTEA 2VWEC 3VCLB 3ZK0A 2XIBA 1P4BH 2NY6B 5FOJA 4ZDHA 2QTVA 4HF5L 4QT5B 4MMXC 4XB3A 1BAFH 1H3PL 2ROYA 5AFAA 3TBSA 1CFTA 4ZXBA 4EIZC 4OW6A 5F8RC 1LO4L 5AZUA 4ZS6C 3V7AE 4OCSH 4Y1SA 1CICD 1FLRL 3APFA 3BPLB 3S97C 1ETJA 1KNOA 3DV4A 1YYMH 4ZQTA 3B7YA 2EINB 2X9YA 4X8JB 1LEKA 3TPKA 4RMSA 3BZEB 4X4MA 3EG9A 2IOOA 1UYWH 3H2PA 4O2CB 2HVBA 3NIFE 2KDYA 5JW5B 4UINL 1MFDH 4FQ1L 2QSTA 4FX5A 3EFDL 1KYOK 3QI9D 1UA3A 2HCZX 4HSCX 3VMOA 1FSKB 3WUWB 4ZTOL 3Q48A 5CEZE 1HZHL 2VL4A 5EBWB 1UWGL 2D7QA 2P42B 1NDMA 1Z5LB 2VKWA 3K71A 5I5RA 3MV11 5ECGA 3EFDH 1H8LA 3DSNB 4UINH 3IN2A 2BOLA 4QRTA 4YR6B 4BUQA 1O7SA 5AW8B 2GJ6E 1C8QA 1RJLB 3FT1A 5EUOE 5JDSA 4ACTA 4F27A 2XWBB 2QADB 3FCBA 4DKDC 1L9PA 3NA4A 3V6ZB 5TQ0H 2EUVA 3S34L 1Y1UA 1GYAA 3KDMB 1RZIA 5CSZB 2R2CA 4EVNA 2E76C 4KTYA 4MFHA 1NBYB 1LO4H 1AKJB 4L9LA 3IJYA 2BFVL 4HEPG 1HHJA 1VB9A 1G7HA 2XKSA 3MGTA 4XVSL 4ABWA 2DQGL 5JLZA 2X4OA 1M2VB 3MV7A 2ADGA 3PG2A 5IBLD 1QLFA 4C8XA 1D2OA 3GXNA 5IM7B 5J12C 2AMGA 4DGVH 3BIKB 5J13B 3TIEB 1X9UA 1MLCA 1E50A 4UIMB 1CDGA 3B3BA 5CMAA 3RY5A 4CVWA 2XQBH 5EF0A 2BCKA 3QUGA 2P5EA 1BVOA 1KSRA 1OSPH 1U33A 1ETZB 2VAJA 3AG2B 3R8BB 3MI6A 1TVHA 1CR9L 3BUIA 3VFPA 4Y2LA 2MTAA 4F92B 1AACA 5E8OA 3AITA 1FIGH 5LDSA 4XX5A 1U3NA 3K6IA 2HVKB 2CM6A 2NY3B 2Y07L 3Q6FB 4JUTA 3GXDA 4ODHL 4OJAA 5LCVH 1OGAD 3Q9PA 3K5RA 4U6TA 1X5GA 3OM3B 5GRYA 1KGJA 3MRQB 1N70A 2OSLB 4HQQH 3W9DA 4OJFL 5F96L 1N5YL 2APVA 1O5DT 3JV0A 2H26A 5IT2H 2GFBB 1VFBA 4NI6A 2QZ5A 3GNML 1XFPA 5EC2B 4AJWA 2PXYA 3EAKA 3QQ9D 1OCWL 5SX5H 3GJFK 3D4CA 4DIXA 2BSRA 1EDQA 1HWWA 5I17B 3ZRCC 3ARBC 1HHJB 5J13C 1CLVA 2X4PB 3DRTA 4TUUA 1JD7A 2EH8L 3CLEL 4U3SA 4A7QA 2NY0C 4NPJA 5T3ZH 5IHLB 3MLTA 4GRLB 1U6AH 1UB5B 5B3SB 2WBXA 3FS9A 1IVLA 1PEWA 4C47A 2V5SA 4XNYH 1YVLA 1OAKH 3GI8L 4LHUD 4OLXL 3GK8L 4JPKL 3KJ6H 1C5CH 1B9ZA 4BFBD 3WFBL 1QZNA 5TE7L 4TTDC 4EIUA 3DX0A 1TQCB 3ZZQA 4PY8J 4RGND 4JFZL 4ZUUB 2HVKA 1OANA 1Z9LA 1BXUA 4JB9L 1ORSB 1RULL 2BDNH 5FF6B 3Q8EA 2JCCB 2YXWA 2ZXCA 3MUGB 4A2FA 2NW2B 3VTAA 4PJ8A 2GTQA 3I9GH 3OZ9H 4UB0H 2BCKB 1GHFL 4RAUB 5D1ZI 1JPTL 2G9KA 4J6RL 1IAMA 3OC8A 5DHXB 2DWTA 3Q8BA 3QBTB 5CILH 5KTEL 2H8PA 4NSKA 5IB3A 3EH1A 5I1AB 1SPDA 4POZC 4UV7H 1AQ8A 1HCFX 3LRGA 3U4EA 5CINH 1VF5C 4JDEA 3B9KC 3IDGB 2CDFB 2WAHA 2WZAA 2GSIB 3EKCA 3O45A 3MU3A 1PZ5B 3D3VD 1TU2B 3U30C 4U1HB 5D6CA 4XCNB 5EU3A 4KO9A 2CJTA 1ZVHA 4NLAA 4D0BA 5KS9E 4X0NA 4LQFL 1KGCE 2X6BA 2XWCA 3N40P 2V3DA 3BPNB 3GLZA 3V9FA 5LKNA 2CHWA 1SHWA 2PO6D 1HXKA 1ZSDB 5JHDB 3NFNA 3QDGD 1E90A 4S1SL 3LPFA 1QW8A 3DSFL 2EDTA 5CIPB 5KSAA 1MFCL 5DC0A 4IBZA 4NGHH 3FO9A 1JWMB 3T8XB 5C0EB 5C7XH 4O02B 1GXEA 1UXMA 4HALA 4EZLA 3WY2A 5F0JB 1DJZA 3QT2A 3I50H 4PJDF 4WFGE 2VN3A 4QRUA 3I84A 5C09E 1RUPL 1ECZA 1YUHB 3SKNB 5E1QA 5DWUH 3MBXL 4F2MA 5FECB 1X7TA 2YJLA 4MQSB 5I1GH 5KEZA 3F5WA 4APQA 2PNDA 2OW6A 4IK7A 4JG1H 4G6AD 2J25A 2KBGA 4LMQE 3Q2CA 2DPKA 2G2NA 4PGCA 1B0RA 3ZOAA 2N7BA 1GJWA 1P5UB 2QQLL 4LSDA 3EW3B 4MNGB 5EU6E 4HOXA 4JDVA 2ARWA 1FZJA 3ESVF 2YAPA 2BW5A 3RUGF 3L5WB 4P9HH 4XNUL 1GGCH 2FJFB 1EHXA 3GS0A 4QRRD 4M7LL 4KROB 3CIQA 1K6QL 5GZOD 1IFHH 1KFAH 3C60C 3FN9A 1AZVA 3P30H 1EAOA 3LKOA 1P4LA 2CRZA 1ZLVH 1PD0A 3P02A 3TNMB 1ZWIA 4LPCA 3RVTC 2YWZA 1NEZB 3B6SA 3VXRE 2W07B 1PKQE 1KTCA 3TA3A 2J8UE 3VGFA 1I3VA 5DJDA 3SD2A 2QFPA 4LBEA 5D6CB 4KJYB 4ZUSA 5ISZA 4F9LA 2GJ6B 4O2EB 4RZKA 2ZUUA 2WN3A 3JQOB 3IDGA 2NY4D 2Y3AA 4X80L 2F74B 3KG5A 4DPCX 1GIGL 4NO0D 4HS3B 1CDYA 1B9KA 4XCCL 4MJHA 3F8UB 1FLTX 4HK3N 3NVQA 5IEHA 2BSSB 2OL3H 2QFRA 5JYLA 2PPFA 1K85A 3N06B 1U2YA 5KSUA 4E41D 1EGJA 1KNOB 1LK2A 1KG0A 3WE6B 5I19L 5TF1H 1SXNA 5DQDL 5BZZA 3HI5L 1KUMA 3DUUA 2Y2YA 2K8QA 3S5LA 2ENYA 4XXWC 1C7TA 3FT2B 3MV8E 1Q0YH 3ETSA 5IQNA 2PPDA 1WLHA 3D8MA 4TNWF 2MKWA 4NQVA 4HWEL 4ODUA 1R5IA 3DYOA 1K9TA 2V6HA 3MJ6A 3OLDA 3HJEA 4XMLH 4H8WH 2F8OA 2VXTH 3KYMA 1R3JA 4H7VA 4QIRA 3LZFH 4HOMA 1TMCB 4NQEE 2NY4B 4U05A 2VITB 4YL4A 1FSKC 3RGHA 5LVEA 5HHOD 3QIBC 1MFAH 2X88A 2FLRT 3VFPB 4OQTA 1UOLA 2GJ6D 4LVOC 2C1PB 4QGTA 1KF9B 2DLIA 3BZFB 4OIIH 1W0WA 2IIJA 1BQSA 3W0WB 2LAGB 5K1VA 2IG2L 2G9HA 2F6AA 3MKGA 2EVIA 2DMGA 2KQNA 1M3JA 2BC4A 4YJZL 1H15A 5DHMC 3WKQA 3US1A 1LILA 1RQ5A 1SJVA 2YIHA 4GO8A 5HGBB 4IU3B 1U3HA 2WTPA 3CZKA 4QRRB 5EUKA 5TDPA 3GMOA 2WKOA 4AM0B 3BVDB 5F9OL 3LIZL 3TO4A 5FAAA 4AT6B 1BPLB 1KBWA 2P1YA 3HVNA 1IKFH 1MAMH 4M5YL 4NP4L 3HZMA 4WW2A 4Y7MA 3DARA 2RCSL 1QSFE 4LPTA 4A39A 3P2BA 3L1FA 3DX4A 3SEPA 5AKVA 2NXYB 4PJHE 1VA9A 3QORA 4PJCE 3J2PA 2MCMA 2DY2A 5I0DA 15C8L 3QRFM 2QL1A 4GXFA 5D2NA 1RJZB 3H55A 4EDXA 2XTJE 3F65A 4IBLT 4A38A 2PW1B 4YDMA 3PCYA 3ZDYE 5CD3A 1J0JA 4OJYA 4PRDB 1NAML 2YN3A 3ETBF 4NUGH 3HZYA 1PSKH 3MBEC 1E27A 4K8RC 1S46A 1DZ0A 1QUNB 4AITA 1P2CB 2MFNA 3DUUB 2Z8SA 2AEIT 2YXFA 3U1SL 3X13A 4XP9L 5BOPA 1CBJA 1OGTB 4QOKD 1HKLH 3E8UH 1Q1PA 2HYMA 4ZUUA 2FJSA 2HTLD 3QRLA 1RMFH 1A14H 4JANB 4JRXD 2FR4A 1D7CA 4MASA 2H6OA 5DRWB 3S5ZA 1DBJH 4KQ3H 4M48H 4QKXB 4LP5A 4FFVD 4WK2B 4GAYA 2BXYA 5IVZA 3RPBA 3TESA 1CC3A 3E3QE 1TZAA 3G6JB 4CL7A 5CSBA 4AEHH 2DN7A 3F7LA 4HEPA 2M2DA 3UBXB 4PPTA 1Q0XH 3ECBA 3R7RA 3A6BH 3RVUC 4WTWA 3ULVF 4YGAB 3MLTB 3DVGB 1FF5A 4GRLA 4JHVA 5AKSA 5EO9B 3RJOA 3MAWA 3ZDYF 4Z8FL 2JXMB 3MRHA 5T3XE 4ZW3A 4IHOA 4ZS7H 3WGUB 2FEEL 4AVHA 2BNQB 3FRUA 2AXFA 1PBYA 2CR6A 1NIFA 2R1XA 1OE1A 1XF5A 1YA5A 4PB9H 2H4EA 3ECBB 3HG4A 4MZRA 2GEEA 1AJ7L 3LHPL 1BBJB 1PLBA 4LIQE 4Q7DA 1YQVL 4XRCB 2BJML 5DQ9A 5GGSA 5AVXB 5K59E 4JFEA 4FADA 4X4YB 3TO2A 3VE0B 1IM9D 3NSYA 1F1DA 3K72A 4N8VA 4BGDA 1J9RA 4HJEA 3IXAB 1XMEB 4QRSA 1GAFH 3CMGA 1RZGB 4JGJA 3A4DA 1A3RL 2PYFB 3K6NA 4OGXH 4QXUL 3SPJA 3WTVA 4ELKA 4ES8A 3TXAA 3D25A 3KLAA 1TT6A 4QXTA 1BD2A 3I85A 5D7HA 3CFNA 5FO9A 1JG9A 1A8ZA 2VR3A 3BMVA 2CIKA 3PNWA 2F61A 3KPNB 3EGSA 1I8IB 3L95B 3QC6X 4JZJA 5L9DH 3OJMB 5LGHL 4UOZA 3B2XA 3UO8B 2DKSA 3KLAB 2ZXWB 3S3DB 5I6XC 4YGVB 3OHXB 1YN6A 1PNDA 2VCOA 4LLYA 4APXA 1T0OA 3STLB 1P9MA 5A2FA 2XPGB 4PJIA 4YDVB 4DGYL 5CM1A 5JZ7C 3EJQA 5HP5A 1AG0A 4GAAA 4OZFG 3ZRFC 2C9QA 4JY4B 5T3XD 2ZF8A 1VGKA 3A0OA 3G5VA 4PS3A 3VFOB 4N2MA 5A7EA 5IV2B 3TNNA 3WUZA 5MI0B 2YSSB 1KPUA 1ES0A 4JCLA 1PSKL 1QA9A 3IFOB 5J5EA 5EULV 1OGAE 3B1TA 3LN4A 4KNTA 4BRVA 2A0LD 3ISRA 4Z7NE 4KK5D 4Y2DC 1R3HB 4MDIB 3TBYB 5ABZA 2DQ6A 2FB4H 1L0QA 1QR1A 4YHYC 4CU8A 5EOCL 5IVZB 2A74A 1BCIA 2CRMA 3QJOA 4NZDA 2E6PA 1G7LA 3QDHA 4HEMA 3D30A 4ZPVB 4DFIA 1MCDA 1OQOA 1MXDA 3CPLB 4RRPA 4FQQA 4QAWA 1FN4A 4J3WA 4XNDA 5C09A 3ZSTA 4E36A 2WBJD 2YMTA 4HOWA 5GZOC 4NAMA 2XZZA 3KPOA 3KR3H 1GKEA 2VQ4A 1WZMA 2EXWD 1JZDC 5DVKA 1CIUA 3ATEA 4MMXB 2VLKB 5H2BA 4A7SA 2IWKA 4HWZB 5HGAB 1WA2X 4N2FA 4JDTL 1HSAA 1Y0LB 4PJ9B 4L5FL 4JQIH 1RLBA 1W0YT 1BF8A 1T7YA 1NANH 3UAJD 3L45A 4NNPH 4U1LB 5T1KD 4RNRA 5BV7H 3OKMB 3B2DC 2HT3C 2Y23A 3O6FA 3IE4A 4XP5L 3VH8A 1E9QB 2WO2B 3NSJA 2XN1A 3SOBH 2V5TA 2Q5BA 3U2SB 4UQIM 4XPAH 3SE4A 2R0ZL 1P1ZA 1SJEA 1INDL 3RURA 1GMIA 4JFDE 4YLCA 5KN5A 3FCGA 2BSEA 1XB8A 5CO1A 4QY8B 2PCFB 2QADD 2WXHA 2WIMA 4PJBF 4YFDB 2ZSWB 2EICA 2Z3FA 3R1GL 2YGPA 5KJ4A 3I9AA 5D1QC 4H8WC 4P4KA 3T0AA 2IV8A 1HYSD 4K7PL 4BIKA 2ZUXA 2CK2A 1BQHG 1Q9LB 2YA2A 3HZVB 5E2TL 1N3NA 3QG6B 4NC1C 4UTBA 4KWUA 3GBNH 4H88H 5I24A 1HNGA 2IXQA 3WKYA 4YHOH 4TV3A 1OPOA 2AK1H 2VDNL 1DE4A 1FL5A 2FIKB 4XC3L 1CZ8H 3MJWA 4RSVA 3BPOB 4YXLH 1IKNC 2XFGB 1OF2B 2Y5TB 1BXAA 1J9CT 1U3HC 3NCJH 3ULUH 1QWUA 1F8TH 3O2WL 5CCGE 2WWNA 4EUPG 3CBRA 2LU5A 4JR9H 4XPTL 3PDDA 4FKEA 3CFKA 4ODWA 3B9KD 4BA8A 3ZE2F 2J2ZB 3OBAA 5I5IA 4Z7OE 5ICZA 3ZGHA 1AGFA 1WUNT 1F18A 1KTDA 2KYIA 3WFEL 5FLVA 4PLKC 4U6VL 2SEBA 4ISVB 5HI4D 1H8OA 5JR1L 2VE6A 5JHBA 1XD0A 3E1ZA 3FU8A 2XLLA 4FL4B 4A6YA 5I18H 4LKCA 4DQAA 2PW2B 4NOBA 4QRPD 1AGCA 1WTLA 5CMAB 4E9WA 2OAAA 2EJ1A 1RFDL 3TN0D 2BIIA 4NWTH 4QEGA 3Q1SH 2P5ED 2Y5QA 5SWSE 2VXUH 3DX8B 2CJ3A 4R6UA 3P73B 4AIOA 4PLJC 3O0LA 4ZPTA 5I1CL 5FM5O 1NL0L 4YC2B 2C4FT 4NWUL 4YHIB 1U8IB 1QFWM 3G5XB 4J23A 1TZGL 1Q9KA 4HBCL 4JG1L 3CDCA 3O8XA 5D1XB 3RKDD 3MBED 4BFGA 3V4PB 2O6DA 3QNXB 1ZSDA 3AY4A 3ARFD 3ZU8A 1CFSA 4MNQB 4YBLC 4HKXA 1A8JH 3AWGA 5EC2A 2H32A 3VRLE 2N0KA 3GMLB 4MMYB 4GRLC 5D1XA 1JTOA 3IFNH 5EOTB 5FA4A 3MV9E 1LDPL 4R97C 2B15A 4UTBL 3A4FA 1XGTB 2VYRE 4G6MH 4PJCA 3V9CA 5E6IC 4Z95H 4N6RA 3SJVD 3UTTB 1LE5A 5LBSA 4Z7VA 1S7TB 5FYKL 3A67H 5IEKA 4IGBD 1HI6B 4AZ8B 3EO1A 4WFED 3RVVC 2DV6A 2C9UA 4I4WA 3UYOD 1F2QA 2ICCA 2YD6A 4AIZB 4LPVA 4NNYA 4YBQD 2VQUA 3CD4A 3D85B 1IO4C 4JEGB 3UIZA 2Q3AA 1HL5A 2UXFA 3L1GA 1CK0H 3MOAL 1QASA 4V1DE 3ML9A 1CDJA 3UPAA 5BZWB 4G7YL 2IJ0C 4IKLA 5KVFL 2H6PB 1QACA 2CM5A 1KGIA 1OD9A 1ECYA 1DBML 4ONHB 4Y9GA 1OCCB 1YEHH 4HHWA 3CFTA 4HJ0D 4UU9B 4M7KL 1TXKA 5D7JB 1J5OH 3LYRA 1QW9A 1IEAA 4FNLL 5GHWH 4HIHB 4NKOB 2VDKL 1A1OB 2YPLB 5DC2A 3VB9A 4NO5A 2H32B 1GHFH 3ZT5A 4IIQA 3TIDA 2YFNA 3P0GB 1JNNL 5JIHA 4HIEB 3IJHB 4KRPB 2BDNL 3ZYZA 1JYXA 1YLBB 1HHKB 5FV1L 1THCA 3BWAA 3CTTA 1TLKA 3COOA 3OG6B 3QUZB 1URLA 1TITA 2YJQA 4CC1A 2VDKH 3MACL 3BWSA 5A40E 1MCWM 1OB1B 2XWTA 4FNLH 1QD0A 2LAAA 2J72A 4JKMA 5BW7C 2OQJB 1G1CA 4YX2L 3RL2A 3CN0A 4CILA 5DK3A 1KXTB 1E7VA 2K3TA 1WWWX 1PZBA 4OVVA 5D1ZB 4ETQB 4FD0A 2EUWA 2P80A 4LCWA 1YEHL 4G9FD 5DLLA 4YZWA 3F83A 3MFGB 1D5XA 4AEIL 1DBMH 1NFKA 1EPFA 4KK8C 3T3PE 1J5IA 3FT3B 3DWTA 1UACL 5DD6A 3QUYC 2J4WH 3WEAA 3VI3E 1M2OA 3UTQA 1Q9OB 5LDUA 3IJ9A 4KO5A 3UO1H 2Z31D 1XSKA 1KB5A 5T3ZE 3TL5A 2VXVL 2KZKA 4YSAA 4OY9A 4B3EA 5JPNB 1GJIA 2GI7A 4E9YA 2NXYC 3OF6A 4LLAA 5EB9A 1MCWW 3VQ1C 1AZUA 3ERXA 4JJ5A 4F58L 5D9SB 5FYKU 1B4JH 4LLMA 3IDMB 4N0CC 3PP3H 3HE6C 2HG5B 4BJLA 3A6CH 1J1OH 2Q1EA 1TQTA 1KB5L 7PCYA 5MENE 4JE0A 1FFPA 1S9WA 2EQDA 3GZKA 1U8LB 5HHPA 3GFUA 1KULA 2DLFL 5B4MD 1LDPH 3W1ZA 1XGUB 4UANA 1BA9A 1HN1A 1AD9A 1HOEA 4NQDD 1XSJA 1A6ZA 4J3VA 4PJDE 2X09A 4NRYB 3WENA 2WC7A 2ZCHH 1T5KA 4R4BB 4QHKJ 4Y2DA 5KG9A 3FUNA 1CXKA 4NXSA 1A0QH 1EO8L 4N8PA 1U8PB 2O30A 2ZUQB 5AVRB 4GI8A 2JMRA 1YMMB 2IAAC 1DUZB 1TEYA 1U92B 4MD5A 3RB7A 1JD9A 1Z9NA 2AJSL 3K46A 4HK0B 4M6NH 5IFJA 1AHWA 2AABL 1AS6A 5T5NG 5KBPA 4R5XA 2FD6L 2ZSWA 3CSGA 3L08A 1J8HE 3O2DL 5FDWA 4N5ED 4FNQA 3K71B 3O2DH 1ZHNA 4JY5H 1GS7A 2CGRH 2E74C 1RH8A 3BXNB 3C5XA 1MCRA 2W38A 1EA9C 4P23B 2BNQE 4HHGA 1G5AA 1F6FB 1M42A 3VXUE 2YGQA 3E2HC 5ECJE 2W0FA 1AGEA 3L3OB 4XGZA 5DMJB 3HRZC 2LU3A 3DX7A 4L29A 1EO8H 4R7DA 5D7IE 4RNRB 3N85H 1FBIL 1NIBA 9CGTA 3ZR5A 1I8LA 5C07E 5E6UB 1OZTG 1XF4A 4WU5A 4FQXD 4JDVB 4TYUA 5CNHA 5A16A 3MMEB 5B1AB 4JY6B 1S7RB 1NGPH 4OIFA 4N5UA 3KGSA 4FXKA 5CJQH 5CXPA 2AJYH 2QV4A 2A0LC 2ZNWA 1HNFA 4F8LA 4PMFA 3VXTA 2V2XB 3CHRA 4Z0BH 4OZIB 3TJEL 1WBYA 5AVVB 3MV8A 5I15L 4HJSA 5CEYA 1CQKA 5A16B 4TUOB 2I25N 4IRSC 1DHKA 4F58H 5EU4B 4HMDA 1MDTA 3P0VH 4HLJA 1M9SA 1OE3A 2EXYD 3VW3L 4ZMOA 4OIBA 5FDYA 2B14A 5HDBF 5IBUG 1ZGLM 5LGJA 4MXQD 3VXSD 3CDGA 4LVNC 2R1XB 3FTUA 4AJYV 4YR6A 1I7UB 3IVKA 3NYKA 1EAJA 1I7TA 3SDCB 1MRCH 2GJ6A 3SYCA 3DHUA 1IIKA 1OCZB 4BUGA 5F7HA 4YHIA 3O8XC 1ZV9A 1JUFB 1KENL 2G75A 3SE8H 4YHLL 4YX2H 1IX2A 3SKJL 5LGYA 1NBQA 2NTFB 1OSZA 1AHWB 3F6IA 1JK8A 4M00A 1TZ8A 1KJMB 3ILQC 3GPEA 3UBGA 5ACZA 4KZEL 3HZKB 2O26U 1X7QA 3L4UA 1NFDE 3KPSE 1ZDQA 2EDNA 4XN5A 2QQQA 3DETC 2CD0A 3MV7E 2ZKXA 4ODVH 4NNPL 2J44A 2J71A 2Y06L 1MF2H 5ERWB 3IU3B 1F4XL 3P2TA 1BJMA 3G7TA 5E1AA 2MJWA 4TUKH 4DW2L 1QSFA 1R6VA 4DZBB 3QO1A 2B4CC 2X4QA 3CDZB 4F91B 1B0RB 1MREL 1MWAA 1GPOH 5E9AA 1YEGH 2B4CL 5C0AA 2FYVA 5IIEA 4MCNA 2BP8B 2GC7C 1R5IB 3HI6H 1D9KD 1TTUA 3T2QA 2PW1A 4HLZH 4OT1L 5CD3B 4HUKB 4JJOA 1SFHA 5F88B 2XY1A 3HB3D 4R7DB 4PJAB 1OKEA 3LMJL 2JKWA 2DTSA 1RSYA 2HKFH 3HG1A 3C2SA 1QLEH 1TCRA 2PKDA 5F9AC 1T1XA 3UTOA 4QHNB 4B7IA 1JJUA 4K9EL 1W80A 3MRDA 3PLYA 1T66D 4P2OA 3T2OA 2JWYA 4K2UH 2GIYA 2HT2D 1R47A 4FP8L 4Z7IA 1RHFA 1UWYA 2EILB 2D9CA 5C0CA 1KELH 1E7UA 3HKZA 3CPLA 1FO0B 1WAPA 2AJVL 1LD9B 4FQ2L 2YAQA 2ALWA 5EU3B 1NCCL 2VR7A 3QEUA 4UM8A 4E2OA 3LNFA 4WNQA 5FHAH 1ZGLA 3DRQA 3PHOA 1EERB 3GJEB 1PZ2A 3ZMEA 4AW7A 4MTMA 3MA9H 4LT7A 3IJSA 4HPYL 4Z7UA 5HGDA 2WY3B 4V1DA 3KJ4C 1CG9A 1KYAA 3W9EA 4YHKH 4NWUH 2D7TH 4PB0H 4HHAA 8FABB 2Z31A 4N8CH 3OSVA 2H9GA 1FNHA 2JJSA 3CH8A 3P1VA 3ARGD 3QARA 1HNYA 4JCMA 3U2SA 4HFWB 3RP1A 3PGDA 4DZBA 1GL4B 4R90H 2XG5A 2FE0A 3PV7A 4GW5A 3IPEA 4BFEA 1NKGA 3MRKB 1UT1A 3I02A 4Z7AA 3KPLB 1QEWB 3PDOA 3V5HB 3MLPA 3JUYA 3U2IA 5LXGL 2IGLA 1KJ2H 4PGEA 4FA7B 1CXIA 5E9DD 1BFOA 2O5YH 4BDVA 4YAQA 4U1SB 5I8KH 3WIHH 4MAUL 4IS6B 2V3FA 1N3NB 2FO8A 1A4KA 4MJIA 1EO5A 2C9PA 3EYSL 3L3DB 5DEGA 4Q9QH 12E8H 3WELA 3QPQC 5JNYA 2CG9X 4XXDB 2ZAHA 2OMVA 1SN0A 2ZONA 2ZICA 2ADJB 2AQ3A 2OMUB 2G2RA 2E4TA 1UVQB 2NNAB 2ZYSA 3A6BL 4LCIL 4OLWH 2WJ5A 2V7HB 1OAYL 1AS7A 1N6UA 3FTXA 4PIBA 5HHPB 2R7EA 4L8CA 4LVHC 4PVLA 4H8VA 4V1DD 3N3EA 3KLLA 3L2MA 1RZKL 2BWQA 3Q3GA 2AK1L 1CL7H 4H4NA 4X6DB 1XBRA 4Y1AD 4HIIB 1SOSA 3TBWB 4CGTA 4UNVA 4OKDA 1FCCA 4JL1A 1P6WA 4O2FB 2E59A 5HYQB 1S8DB 1CCZA 3VXUB 1HILB 3HC3H 3Q6GL 4MS8C 1PKOA 3OXRB 4G43B 4J1UA 4PRNB 5GXBB 2IBZX 2DH3A 3KPNA 2ESVB 4KH9A 4ICWA 3U79A 5F3BA 2R4SL 3QFJB 1NC2A 4PY7B 4PW9A 3FCTB 3CXDL 4OBSA 4APQB 1RHHB 1EFQA 4XPAL 3E6FA 5KSUB 3ZQ9A 3OHXA 1LO2H 2IH1B 1J9TA 3VXRD 3GB7A 2XRAL 1OWRM 4AQOA 3OR7A 4ZAKA 2XTLA 1OK0A 2YWYA 2Y7LA 1XIWD 2PYEA 1JDAA 4JX0A 4PY7A 5J3HC 5CSGA 3CH1B 5EU6A 1J7VR 3BWUF 5IB1A 1RIUH 4MCZA 4JDTH 5AVYB 2FUTA 3QUXD 4X7DC 1BF5A 2J21A 3QDJA 1ZPUA 3HC2A 4FDWA 4O2EA 4YFLF 3VFTB 3RB5A 4PUBL 5FUOL 4YSDA 4YBHA 3K2MC 3EF4A 3SBRA 4B9JA 4BZYA 3V5KB 3TBTA 4FABH 4HT1L 2RQEA 3G5ZB 1NOLA 3QJFB 2IG2H 2YPLE 3BP6B 2R0LL 5A2IH 1HCVA 1IGIL 4PJGB 5F2FA 1BBJA 1PIGA 3FT0A 1KXHA 4C56E 2VLLA 5AW9B 2D7PA 3PHOB 2E7CA 4FFWC 3M17A 4P23C 1F00I 4WFFD 5L0QC 4NPYA 4I3RL 3QZWA 4J6IA 1AO7B 2WXLA 1PZ5A 4FEMA 1ZV2A 4FJ6A 4F33A 2P49B 1L9MA 3QRGH 1T4WA 2KC0A 3O6FD 2V9RA 4ENED 3BUQA 3IWUA 5C07A 4LNVA 1J8SA 3V0DA 2WUCL 2QZQA 1UA6H 3HC3L 3E8VA 3KPMA 3S3PA 4Y4FC 3T3PF 2CIKB 4GXUM 4ODSL 3D05A 3P3UA 3EYFA 4NNXA 2CLZA 1U8MB 2XPYA 1E27B 3Q5TA 4ZAKD 1HHIA 2YPVH 4B9IA 2HAZA 4NZTH 5IKCA 3NJNA 5F0LB 4LP4A 3V4LA 3S37L 5FCSH 4RX4D 2CH8A 4H8PA 4RAUA 3PL6C 1MCJA 1G7MA 3UZQB 5CCKH 1E9QA 1VERA 4AQEB 2P47B 3D9AH 3NJMA 2FHFA 1SLVA 3VSVA 4U3CA 4ZMQA 1ZIBA 1CTMA 1NCOA 2CJSA 3SDXF 3VO0A 5B39G 1HYRC 4J1UB 1J86A 2EYRB 1JGIA 1X5LA 2BFGA 2XV0A 2VM9A 5EBMB 1N9PA 4NS0A 1BVLB 3HBPA 4EN3C 5I1EL 1DQMH 5CZXD 4O9HH 2X28A 5GZNC 5TFSH 4TNGA 4DTGH 1OARH 1S9YA 4DCQA 3O3EA 4NEHB 1NEUA 2EKJA 2G60H 2CMRL 5DZNA 4XP6H 2FX8H 3UCQA 4P07A 1DVSA 4FQIH 1BHGA 5E4EB 6FABH 4MJ5B 1MIEH 2BIQA 4XNQB 2QVIA 2XTJD 3DDGA 3J7HA 3QCVL 2LLNA 4HUWA 4UV4L 2ZZUT 1ZS8B 2ADIA 2WXOA 3LEYL 1R24A 2FT7A 3WNJA 1RZIB 2DM3A 4UT6L 3SOTA 3MJ9A 4KRMB 3VVWA 3MUZ1 3IDJA 5D55A 1P7QB 3MJ8B 3AY2A 4N1CA 1J0ZA 1UUSA 1HEZB 1UM4H 1OTUC 5EU5A 4PRID 4Y5VC 1NMBH 3RVTD 3HZYB 1E4XH 4OLEA 2N1TE 1RUMH 4BXVA 4A6YB 1ET7A 4NUMA 4XO3A 4KJWD 4PJHA 4A6YL 2X2JA 2C8NA 1D5BB 3DVNA 3FU7A 3MJ7A 5D9SA 3HVDA 3TV8A 3MBWA 1A3LH 3CLFL 1EJ8A 4KKQA 1SEQL 3ETBJ 4E9QA 3MA9L 1IQDB 5GJTL 5F7NC 2YC1A 3F12A 4JPIB 1VGEH 3LKSA 1EBPA 3LN9A 5JXAH 1DVZA 5J11B 2YD8A 1WS8A 5C3LD 4APXB 5CUSH 2IAMB 3UAEA 3MBEA 3RLSA 3GM0A 3AWFA 4PJAE 3CJJA 5M94B 1HCZA 4MCYA 3JWOL 1RIHL 1JMXA 1NMAL 4F7MA 2XYBA 1CTNA 3C6LA 3L95A 1QFPA 2I27N 4PSRA 3RVXD 2KDGA 3RWGB 4NJAL 1YECH 2DQHL 4W4NA 3JWDL 2WXPA 4LL9A 3TH2T 2XICA 1KEGL 2Z35A 4NO3B 1BD2B 3DTXA 1JZ2A 1T89C 1YQ2A 3LNHA 1F1AA 2CBOA 4DN4L 5L6YH 1WYJA 4UT9L 3WO4C 4JRYA 1H9DA 4WSGA 4PVMA 4JKNA 2Q9OA 3DJTA 2OCFD 3SYQA 4JN1H 1I1AB 4ORGA 3HCVA 1IAIH 2VDPH 5DUML 4G8EA 4UDTA 3VFUB 3AU1B 1P7QD 2BP0B 4KTGA 3PWPB 2DDQH 5DZPA 4UV7L 4GBXD 2D3LA 2QKIA 2XQ0A 2BS9A 4S2SB 4Q58C 2EZ0C 4JFEE 4JY4A 4R4NC 5CILL 5KTEH 4J6RH 4LEBA 3G5VB 2Z31C 2O5ZL 4RSYA 4OCXH 2EVFA 4JQIA 4D8OA 2UZIL 2G5RA 4M1GL 2HFTA 2GW5A 3QRBA 5DRXB 1R34A 3T0DA 2OJ1A 4MCYB 1KCUL 3LNDA 4UAOC 4U6YB 3X17A 3RIFF 1MOEA 4YK4C 1KBPA 2RA1A 4BZ2A 2VE6B 3H0TB 2GYSA 1QEWA 5TE7H 2XQYA 1OAXL 4PLOB 5EOCJ 1V7NL 2WWMC 3LKQA 2Q8BH 3EGDB 7FABH 3CCHB 1UKTA 3O9WB 4QHPA 2O5XL 4IMLA 4HUXB 4TUJB 3ZDYB 2WSPA 5EU7C 2KPNA 2G3ZA 3BAYA 1B0GA 4LCUB 3BKMH 3GMNB 5I1JH 1DQDH 1AR1C 4JL2A 5AYQA 2X44D 5EU6D 2C9XA 2AHIA 5T3ZL 3QXWA 1KGYE 2B9BA 3S35L 1KCSH 2H2SD 2H45A 3U7YH 5IFAL 1NM9A 2XG4B 2FZ3A 4HKZA 1FAIH 2R23A 4PRBA 5T1DH 2A1WH 1CLOL 3Q3GB 3FTGA 1QO3B 4F5CE 4B7LA 1SN2A 3OB0H 4G3YL 4QXWA 1G87A 1ZS8A 2ADIB 2NY1C 3MA7A 2XBTA 1OCWH 3PQYD 3L13A 2MQCA 2X1WL 3BFWA 3H2WA 3S48A 4B6ZA 3MYJA 3OKEA 3GMRA 4XR8C 4UTCA 1SYSB 2E6JA 5CP3A 3PF2A 4KZDH 3ZL4H 4N2AA 5DWPA 2HWZL 4JN2B 5J6SA 4BZ1H 5LCVL 2Y07H 2PCPA 2ETWA 5FUCE 2PCFA 2HT4C 2E4FA 3DYPA 5C0NC 1A25A 1SLWA 5GS0D 1FBIH 2DQUH 4P2CG 2I32A 1IBYA 2BOBA 2RGSA 2WZ6A 4KXZH 1RZ8A 2HFFA 1I7ZB 2VDMH 2XVBA 3D48R 4RMRA 2BERA 1P7HL 1G0XA 1ZHLA 1K6QH 2A6IA 4HBQA 2IADB 1GS8A 3L4TA 5FIEA 1NGZA 5SWSB 1VADA 3EFOB 4OUOA 3FPYA 2VLRD 4OZFA 3TBSB 1QUNA 3QUXB 4N20A 1OWWA 2EIDA 3B8YA 4KMTH 4BSWA 2BSDA 2CGRL 3QWOB 5DEJA 5E5MB 4L3ED 1EFXB 4WTZA 1KB3A 4RIRA 3APNA 5DS8A 4Z7NF 4F7TA 3S35X 1I9IL 3RY6C 3V8CA 5GSVA 3MNVA 1LE9B 5GJSH 2AJSH 4M6NL 3UAFA 4KOCA 5IROA 1I3RA 4S1QL 5DWUL 4HPHA 4K94L 5CGTA 1P7KB 3HJ0A 4FFZL 4BZ1A 2D3NA 2P8MA 5MERB 4X6CA 4OFQA 2EYTA 2YA0A 4NQXA 3SZ6A 4GRMB 4DKAA 2IXQB 4P3WA 2CPCA 1QUPA 3BAEL 2AJUL 3WLBB 4H25B 4IHOB 2BM3A 4JJHA 5KAQF 1JZEA 3HZVA 4FXGB 2PCPB 1WDAA 3EOTH 2VERA 5GZOA 4ELME 5E5LA 4KV5F 1KB5H 1UKSA 4RFOH 3SCMC 4HSQA 2Z7UA 2AGJH 3VFSB 3D12B 1PLCA 4K3EL 1CFVL 3QR2A 5HY9B 1WIOA 4HIPA 1A5FL 1EDHA 2IANB 1SFDA 3MLRH 5IV2A 5AOJA 5K1NA 3VXPA 5L2JA 2AK4E 4V11A 5ISZD 1WIPA 1JV5B 3L3HA 3DO7A 4HKXB 3WL9A 3VWKA 4R0LC 2SEBB 1NMCB 1VENA 4S0SD 5IR1B 1G43A 4D9LL 1HHGB 2FX7H 3SE4C 5DS8B 5BMFH 1X6LA 3PWUA 1IJ9A 2PR4H 5MP6L 3W11C 1O75A 3PWJB 3NIFB 4X7CC 3P73A 3MLZL 4OZFB 1MCPH 3EYUL 3F7QA 2Y1YA 4EN3A 2JKLA 5A2CA 1WFTA 3EG9B 4KRPC 4U1MB 2X3BA 3OZ9L 4UB0L 3T4AB 3TLRA 3CX5J 2VMDA 3SGEI 3F7YB 4NQCD 1BX2A 1R5WA 3UEQA 1E5BA 3M1BA 1Z5YD 1EUTA 3FFCD 1JNNH 2WD0A 4C4BA 3QYMA 3SKOB 5DRZB 4Y7OC 1A4BA 1IARB 5GGVY 1TZHB 1T1YB 3MLVH 3QZWG 4P3DA 4F8NA 1W16A 1SEBA 2VABB 4LKXB 1OSZB 3T2NL 4RAVA 3QDME 4M7KH 5HHMB 1F3JA 1I4FA 5ILTH 3MYJB 4ZXBC 4OFIA 3BAKA 4W6XB 3HUJB 5CIPA 1T22B 4J28A 4GEIA 1ZEAH 5KVMC 4GAGL 1USQA 4GPVA 1MQKH 1MFBH 3UAAA 4YDLB 5ADPL 1UWXK 3GMLA 4MMYA 5DO2D 4ZSOB 3VDCA 2LHAA 3ME0B 1QHQA 2EEDA 1GGBL 5E6ID 4UM9A 4HIEA 2ZQKA 3PFUA 4FTVA 2F58L 1NH6A 3UERA 1PYWA 5DFWH 5C0CE 4K5MA 1AVAA 3GO1L 4KH2A 5EZIL 3ZPDA 3GHEL 2EXWC 4ZRGA 2E47A 4MYWB 1MFBL 2QKIC 3H9SB 3MFFA 4OKVB 2YEZB 3FCTA 1JFQL 2YMXH 1NLBL 1F90L 2X4QB 4PGCB 1EMTH 4FXKB 3HI1A 2PO6C 4WDIB 4XO5A 3U4AA 3UXFA 3T04D 1PLGH 1FO0L 3DJZA 2A6DA 3WEOA 1U3ZA 3H9SA 3MFFB 1MRFH 4NBXB 1G5GA 1N67A 5KN5B 4HHAB 1A6VL 4OTXH 3CAFA 3HZKA 4YSTA 4KKZA 2X4TB 2BVYA 4KXDA 1HE8A 5I66A 5CSZA 4ZUVA 4EVNB 1XXFC 5BUPA 2GJPA 3D18B 2ZAGA 3HN3A 4O02A 4IOIB 4PREA 1QRNA 2HZHA 1NGQL 1TDQA 5JUEL 4D3CH 3IFLL 2FATL 4ZZFA 5EORL 2R83A 1YNLH 3KD4A 3X2QB 3RDTB 1CLZL 4JAMA 3KNBA 4LBEB 1LD9A 2X1QA 5E6IA 1I7TB 2B1HH 3AU1A 4IIQC 5DJXA 3UGXA 1DJYA 2R0WH 2X4NB 3NA9L 5I8CB 3AXHA 1SUHA 4JQVA 5DHYA 4AGOA 4LVHB 3VFNB 2XN2A 4M8UA 1CGSL 3D09A 1S5IL 4OVUA 2VLMD 4Y19A 4KHXL 3SQRA 5FO8B 4Q52A 4KVCL 2BZ7A 1UA7A 1MVUA 3WY4A 4B41A 3DO4A 4FG4A 3WJLC 2B20A 1VKXA 4U6VH 4UTAA 4N2KA 5EEZA 1OAQL 5FFGA 3ARDD 3QH3B 4GKSB 2ED6A 2DRUA 4TTGA 1BIIA 4LSSL 3K8MA 4OZIF 5FFOA 3RZCC 2QBWA 4DO6A 1MZZA 1RUKL 3LKQB 3NCYS 4L3FA 4NRZB 3EUUA 3PWJA 4B9CA 2B16A 2K0RA 5I16B 5KUMA 3B3IA 5J6GA 4NQVB 2FNBA 3NK4A 2ZXBA 4LPUA 4HC1A 2OK0H 3ZE2E 3GZPA 2YR3A 2CXGA 4YXLL 4PRIE 1JVOA 5G5DB 2GJZA 3ZKMD 1PKQB 2OTUA 4WENB 3LNGA 4L8SC 4Z9KB 3INUH 3HS0C 4YDJA 2A6IB 5AEAA 3OLIA 43C9A 5CD5D 3HC0B 4LEOA 2BVTA 3RVXC 2EDMA 3ARED 3GSRA 4RCAA 3TF4A 1MFEH 2BNRB 3BEWA 4I0CC 5I0VA 4MQXC 2WVVB 3EJSA 3W39B 1BAFL 1H3PH 3VFGL 5F93C 4EI5B 3O3AB 1XCQB 2HJKB 1KIRB 4KMQA 1QTPA 4LIQH 3HR5A 5EORH 1R24B 3STZB 2GUOA 5JUEH 4I18A 2VJ8A 3U0TB 3A4EA 3QIWC 3QS3A 2RJMA 5C07D 2XOTA 1BBDH 4WO4B 3KWTA 4N3UA 1JZ3A 4XE5B 3QAZB 5HHXL 3RKDC 5ELIA 3L9YA 5EEUA 4OTXL 1AQDB 3RKPA 3CQQA 4WNSA 1SM3L 1QAWA 2EKSA 2VERN 5LWYH 5I30L 3TO4D 2NY6C 3MLYH 4JFTA 1JL8A 3LKPB 5F3FA 1Z9SB 2APXA 1KTLB 2HH0H 3FFDB 3T0EE 1IM3B 1K4DB 3UG4A 1T83C 5T1KA 4X5LA 3TV3H 1NDMB 2HJFA 3VWKD 4XN4A 1A1NA 4ZMZA 1F97A 2YMXL 4WFHD 4DKFH 1RUAL 3UTPD 3N0PB 1IBGH 1GZPA 2RHEA 3DXAB 3VWKC 1CD1A 4MZ2A 1NBVL 1TO4A 4NQDB 3MQIA 2X89A 1FNSL 4OF6A 4UT6A 5DGQA 3NCCB 3NUKA 2H6UA 3S36H 1CIDA 2OJEA 2HMIC 1WFJA 4KAQL 2CO6A 2HN7B 2H1XA 2Z0BA 3PDOB 3V5HA 3QDMD 3NMEA 4JFFA 2P7TA 3LKNA 4YDKH 3QDMB 1U8KB 3MHZA 3RHWF 1HIML 1OTTD 1IGTA 1XEUA 4RWYL 4EUPA 2ADGB 4GIOA 5D93B 1YMME 2VXQA 1QLFB 5DHDA 5DTFB 3FH8A 1S2EA 5AKRA 3DXAD 5DD0L 3MREB 2O5XH 5KJRL 3B34A 2DM7A 4AYDC 2A83B 2OPCA 3KBFA 3TPUA 2PWDA 2BVQB 25C8L 2C9SA 3QIBD 4WI2A 4HUVB 3I6KB 3IF1A 2ZYRA 4JO4L 5KYWB 5E6RB 1TJIH 3L3IA 2XYCA 1IM3D 4AL8L 4HXBH 3O2VL 1UFGA 3VNZA 4K9EC 5JDSB 1YSOA 5HHME 4MQXD 3VXNA 4XI5C 4APQC 1Y07A 3VXMA 3WMQA 1CBVH 4BCXA 3KMDA 1V55B 1JNJA 2IBBA 3RIKA 3TFKD 2AK4B 1NLDH 5DUJA 4G7SB 4MD0B 4QCIA 4DHLA 4WO4A 5AVWB 5L9DL 3RWFA 2OSLA 5TPWH 4YNYA 4X0KB 3QUZD 3RJQB 5DS2A 5AZ2H 1NSNL 2DDQL 1MFUA 3GINA 1CE6A 1HWGB 3H9HB 2ATAA 1G7MB 3C60A 1DVXA 3UZQA 3HHMA 1VFOA 5FB8A 5ITFA 5AW1B 2XNAB 3T2PA 2XN9A 1T1ZB 1QWNA 3IK2A 4H13C 5GGSY 3D6GA 2H3XC 3DURA 5E1AB 1VACA 2E7HA 1OLZA 3OPUA 4U1GC 1AE6L 5HDRA 1ITCA 1F4HA 4GG6F 2ORBH 2K6ZA 5C6TL 4EZMA 4YVNA 3VVVA 4FFVC 3BESR 4Q6IA 4UT9H 3AREB 1SMOA 5HPMA 3DXAA 1FVDB 1CD1B 2LFGA 4Y1AE 2DYSB 2W0FB 2HTLC 3NIFF 3JWDH 5DA4A 1JVLA 4BKSC 4HUNB 4RFOL 3VNYA 4RAHA 3AU0A 3UTSB 4XCYA 2COQA 4MA3A 3RX8A 5MHSE 3KGUA 3LEVH 1ADQH 4GQ9L 4TSCH 1KCVL 3KYKL 4WRLA 2EDJA 1IEBB 3FQNB 1R3LB 2W07A 3SBWA 1T66C 1R5VB 4ODTL 4ZFFA 5BS0B 4L3CA 4IRJB 3LQZA 3WKMH 5JXAL 2KERA 4PQXA 2AQTA 3HG0A 1U8NB 4TQHA 5HJGA 2P43B 5GJTH 3DRQB 3BH9A 3WNKA 1KFGA 4WV1C 2B3IA 1KBVA 1ADQL 4TSCL 3FTYA 2DYPD 2ICEA 2IALB 4XN9A 4CVZB 4JFED 5IB4B 1HQRA 4CA4A 1E4XL 5JNYB 3EUDA 4RZCB 3PWNB 5IFHL 4PP2A 2KQMA 3O11B 1WH0A 2X9XA 1GGUA 3G6AB 1J05B 3IDNA 3BPOC 3EJYC 4WHTB 5E00A 1BFTA 1T3FA 2G30A 1NOAA 4MNQD 5DZVA 4WFGD 1OTSC 5LQBH 3RWCA 5HDOA 2V7NA 2OSYA 2PO6A 4KMTL 1BZEA 1DEEB 4OUUB 3MBEB 4ADGA 2N1KA 1RZ7H 1XF4B 2WANA 3L3KA 3LEYH 4R5VA 3ZDZE 4JREC 4MD4A 3CZNA 4QTHB 3VXSE 2YRBA 1YEFL 1S7UB 1W8NA 5K9JL 2ARJB 4GW5B 3QEGH 3FOMA 1WS7A 3VD2A 1NCAH 2XETA 1F4WL 3C75A 4KQ4H 3WTSA 3RGVD 3UTSA 5K59F 3RWEA 3B9DA 1G9MC 4HFWA 1A6PA 3MTRA 2Z93A 1HILA 3ZE2B 1JF5A 1XTLA 2D03H 2W92A 5EZPA 2NZ1A 3M1CA 1A2YB 4YSUA 3CVDA 1P69B 2GHZA 3RE0A 3EBHA 3AW5A 5I6PA 1B6DA 1D3CA 3BSZH 4MVBC 1ZLVK 1FVDA 1E4KA 4OSUH 3P0YL 3RA7H 2WK2A 5T3XH 4MMZA 2GHWB 1I8MB 5EFIB 4AXWB 4DP8X 5EF2A 1FJ1B 2HJLB 3D4GA 1CBVL 4K71B 5GGUA 4AQ1B 4KTDL 4ONOA 4HJ1A 2FAUA 4O4YL 3ARTA 1J11A 4XCNA 1FAIL 3Q2LA 3RILA 1ET5A 2W59A 4Q6YA 5F97E 3S4SG 2EYSA 5E51A 1J05A 2VQ1A 1Z3RA 3IDNB 3IGFA 5E00B 3WJLA 2GC4C 1FJ1A 2YRZA 1FYTA 4YH6A 2AQPA 4MYPA 3OGCA 3FC8A 1T5WA 3OKKB 5F7AA 5KJRH 3P40A 3VXOB 5I1JL 5F1IA 4BH8A 2XWTB 1ZDSA 4H2AA 4YNYB 5D7LA 2AQQA 3B9AA 2OLDA 1BAWA 5I26A 5SX4I 2EC8A 3ULUF 2WLLB 1KGXA 2MNJB 3EF7A 4KXBA 2CA4A 2XFXB 3AQZA 3CUPB 3CX5K 1V05A 1F2XK 1JTTA 2DJ4A 3VUAA 5I5MA 2VLJA 2H0FA 4KAQH 3WIIL 5M95B 2YQGA 3BSZA 3LKOB 5C0BA 3KGRA 4KUCD 5CU5A 1L7IL 2L7QA 1TYJA 4OCWH 1DJGA 1IFRA 2NNFA 5E8DH 4E0RA 4KI5D 5JDJA 1L5GB 4L1LA 2JKIS 4YWGH 4M1CC 1TU2A 1YY8A 3HS0A 2HFGH 3F62A 3IDYB 5LAXB 1VLXA 2VXQH 5DA0B 3OJDA 4OCXL 4CJ0A 3WJJC 3E2HB 4LGSB 2X89D 3NACL 3ZIYA 1CICA 1YPZB 4OZGF 3UJJL 3L3OC 4NDMB 1Q1JH 2DQTH 2IEPA 5L8KB 4DGIH 5FM5M 4K55A 1HDMA 4X5WA 1DFBH 2WQRA 1FFPB 4WEBL 3MNMA 3D25B 5JORA 2CO1A 32C2B 1R33A 5CFAA 2Q10A 2GABA 4N8VB 4OCRH 5CN1A 3T0XA 3MOBL 4U1KB 5KBKA 1YEDA 2ZUVA 4TQEL 2PR9A 3SPVB 2MPVA 2K9UA 2OP4L 4NO0A 3GSXB 4YL9A 4AJVA 3JTSB 4CW1A 5IWLA 1KTDB 1IGJB 2FJUB 1ZHKA 2N4IA 3G6JF 1BSIA 1MWOA 3DX3A 3IS0X 4Y5YB 1E30A 2WBJB 1FFNA 1KTJA 5F9JB 1XF5B 4WAFA 5C3IA 3RIFK 2B0SH 1JHTB 3PP3K 3QQ3B 2JB6B 4OZHA 1KTLA 1ZXQA 4TLSA 3M86A 2FWOA 4HUUA 4J2XA 1SN5A 1XZ0B 4L4VD 3CZUB 3GTTA 4L1DA 4YQXH 4N0FB 1T5WB 1A4KB 4LCYB 4E5XG 4L3EE 1YN7A 2JKXA 3LPGA 4PJ7E 5HYSG 1RUPH 5J6HA 3QZPA 2CBTA 4N2OA 4NJ9L 1OK8A 1DBKH 5F1KC 3OMZA 1HZLA 3DBXA 5B1KA 2EDDA 1IGFH 2PCYA 4ORZC 4Z7WA 2A6DB 4XHJD 2JQZA 4HGKC 3O4LE 2JLLA 4JZJB 4LSRH 1HH6B 5EG6C 5EA0L 2XV3A 3T4YA 2ZD0A 2V2TA 1RK0B 4K7FB 3PV6B 3PGDB 2VAAB 1NMBL 1B6UA 3DGDA 4ZNEE 2L0DA 4LLUB 5DURD 5EBMA 4L1SA 1IFGA 3T3ME 5CF3A 4ZQKA 5F7YC 4LKCB 4YOKA 1FFTB 5BS0E 1E4XI 1LE5B 4O2FA 3QUMB 5AAMA 1OAQH 2BH0A 3WD5H 1A6WL 4CRPA 5AW6B 4AV5A 2ORBL 5FK9B 2WCGA 4L4VB 1UHVA 4IBWA 4FQQB 4LAQL 3T0EC 5GS1B 2QDVA 1G9EA 4KK9C 3A4AA 2PWHA 3Q05A 1TO5A 2AV7A 3OLEA 4AKOA 2Y3NA 3JWDC 4AV0A 5C0JA 2R0WL 2HX9A 1FV1B 3NA9H 3MUY1 3GRWL 5DFAA 1LO5B 5DI8B 5GS3A 5H94B 4MJ6A 1I7UA 3IVKB 4GI6A 4TTDD 1NPNA 4BFRA 4FFYL 4UNTA 2IH8A 4PJGF 4PWEA 4R2GB 4GINA 4YDLC 2QGEA 5I8OH 5KVDH 2ZSVA 1HINH 1FV1A 4M02A 3D2TA 3CN3A 5CR8A 3ROOA 3FOLB 4X4ME 2NSQA 3D39B 4GRMA 4PN6A 3ISYA 4YDIH 4AEEA 3TS8A 1LWJA 1IGCH 4KHTH 3RWHA 3PPSA 1N8ZB 4GLRI 3CX2A 5IVXA 1CI3M 5JMOC 4BELD 1UWXH 3K1KC 2VITA 3P9LA 3FB6A 3TA4D 3WFBH 2MOQA 1J8HD 3FU5A 3FSZA 3Q8AA 2JF1A 4E42A 4NYLA 5TTRA 1RUQL 2CUAA 3NJXA 1I3GL 3PQYE 3OKYA 2YQBA 4FXLA 4NKQB 3RVVD 2YAHA 3VYPA 2VUYA 1YEIL 2R15A 2ZXDA 1W9XA 4MVBD 5F70A 5A2AA 43C9B 5CLYA 1C08A 2W95A 4K9EH 3AXIA 3TCLB 2VKXA 5T5FL 4Y8AA 2MCPH 2R2EA 3K91A 1LNUA 3DMMA 3VWKB 4GUCA 1KJ3H 5B8CB 5D4HA 4U1LA 3BN3B 3GO1H 3ZKSD 1URIA 4KXAA 4K5NA 2BVOA 1OPGH 3RGVC 1YJDL 3FB5B 1JPFA 2HRHA 1U93B 1HHIB 1TTRA 4P2QA 1KC5H 2WB1A 5IKCB 4NENA 4OGZA 4OT1H 4M03A 2VW4A 2CU9A 2R29H 1ASQA 1WEJL 1Q9LA 4EIBA 2JKRM 3LXAA 1NFIB 5E6SB 2K8MA 4CAGA 3CQPA 1CFBA 1SDDB 4PJFA 5ICZB 2CCWA 4G42B 3PWNA 2NXYD 1SYSA 3LB6D 3HUJA 4LQ1A 4Y5VA 3BOVA 4WJKB 1J0HA 1EHLL 2FBRA 3EYOA 4AV4A 4NPYB 2H2SC 1AANA 4EAEA 1LK3L 2Y2WA 4PYGA 3CSYA 1OF2A 2Y4SA 3N1QC 4N0UA 5T1LA 3N9GL 3EHBD 3VWJC 3WIFB 1AR1D 4BV1A 4QRQB 1EEZA 5DQ9B 1QO3A 5GGSB 1YNTF 2DWEB 1HWHB 3RNKA 2JNZA 4PSPA 3REWB 2HRPH 4J8RB 5CS7A 5C2BL 1DUYB 1X4YA 2LLGA 4X9FA 3T0VA 5DJ8A 2WWMD 2A73B 3LS4H 3RGVB 4EBQH 2EE9A 1DVQA 3B4NA 3OKLA 1DLFL 3IBOA 3KYNA 1QP1A 4X8GA 3VFGH 2F2HA 3IT8D 3Q6GH 4PD4K 4FLSA 5I6XB 3HI1B 3QZLA 5EOQH 1DVUA 2AKRA 4DPRA 5LO7A 2O72A 1X5KA 1G9NH 3ABKB 2C7UA 3QHZH 1MCFA 4P2QB 1NWOA 5AZEL 5BZWA 2KLTA 5BRZD 1WFIA 1I7ZA 3M8OH 5K9QI 5DUPL 4YO0B 4C58B 4P46B 5FOBB 3MRFA 4IQHA 4JM2D 3JVGC 1Z3GH 3KLSA 1JCVA 3ARGA 2Z7WA 4F3FB 2JKSA 3L4VA 1AGEB 2WNKA 3L3OA 2Y0SA 2XTJC 2LVCA 4K3EH 1W15A 2NY0B 2YBRA 2VDNB 1TLMA 1SOKA 1AGDB 1HZHH 4G5ZL 1T20A 5BXFB 5BVPH 3KLKA 1RUKH 5CJQL 4ANUA 2J73A 3L5JA 4OD1L 4UNUA 4IRJD 4Q4EA 2XT1B 4E5XA 5GZND 3WIHL 4F5CA 1ADQA 1T21A 1UG9A 2CR0A 1TQBB 2OBGA 3BHBB 5IB2B 3CN2A 1D6EA 1ZVYA 4IOIA 4KI1A 3F7VA 3RHWK 4LSVH 2Q86A 4D8PB 2OMXB 4XMTA 2IMMA 5IW1B 4BQ8A 4FA6A 4R90L 4M1DL 1YN6B 4G5AA 4N1EA 1R9FA 4AYBA 2B08A 1WZKA 1T4KA 1D6EB 3RBSA 4HF5H 1SDDA 4AWJC 3OXSB 3T3MB 3MV9D 4EO5A 2B1HL 1BYOA 2NUTB 5GIRA 4MXVE 4NN6B 5HYEA 2VLME 1PD1A 5D2LF 3HPJB 3NJFA 3QXDB 3KVPA 2VH5H 2N7SA 5KWYC 3MRRB 1VHPA 5KS9A 4YZFE 2OS7A 3T4AA 5B8CA 1P7KA 2VZSA 4GIAA 5E24E 1A6VH 3L8QA 1Q4NX 3SODB 3N43F 1IGMH 1JNLH 1AZCA 1MRFL 3K7UA 4G7RB 1EH9A 1NCHA 4L0ZA 1NCTA 1LO0L 5KS9B 1YMHB 3QFDA 3HW7A 3N1FC 3MX0B 4UT7H 2J88L 5K93A 5IMMA 2FBJH 5JHDE 2LTQB 3T5WA 1WBZB 4CDHA 4HIXL 3TIEA 4U7MA 5KUKA 1BQ5A 4QRFA 4QR7A 3MRJA 1QSFB 5FYKE 1FCGA 2CDEA 4WTXA 4ORGB 3D2UB 2WIIA 1GGIL 2X4OB 3MV7B 5ITBL 5JMRA 4WI7A 4Z3IA 4KRNA 4QWWC 4F2ME 1PJWA 5I71C 1G0DA 1JRHL 5DHEA 4KVPA 5C92A 1HHKA 3C2AL 1JNHA 3BYTA 3OHMB 4MDRA 3D2UA 3V4VB 3F7YA 3R4RA 5D7KD 3ULAB 2NTFA 3CFMA 4GAGH 1JMZA 4XVUD 1O6SB 2IVFC 1SMAA 4E9SA 1G9NC 3ARFA 1RJLA 4K15A 5JYMA 4LVEA 1T22A 5LNEA 1DJSA 3BAJA 2Y6SD 4JFSA 4KKBD 4GIPD 4A7TA 5LNDA 2PYED 2Q6WB 1F0LA 4RA0C 4RAVB 4NUPA 4FN0A 2AZAA 3ARVA 3UGUA 3S9DB 3IDIB 3BDBA 4IRSA 3S5LB 3DPBA 1MCBA 4NM4H 1PKQA 2OTUB 3GHBH 3SGDH 3TJHC 5BVJA 3IU4L 1TQVA 2VRAA 4LASH 5ISZE 1XIWB 4PTUA 1IRAY 2KZBA 3LQAL 3K5SA 1VACB 2GTZA 3HRPA 4OZFH 1IM3A 1K4DA 2PXYD 2XSKA 2APSA 3IDYC 4DVBB 2HLEB 2D3JA 3MGOA 3VXRB 1WCBA 1WE5A 4RX4A 3G9VA 4L8DA 5GIRB 2AITA 4HUMB 3UPRB 2VNCA 1QPPA 3QJUB 2NZIA 3UACA 3MROA 3VSTA 3SYAA 1U2CA 4Q2ZA 1NGZB 2CLRA 2JJTA 5SWSA 1QSVA 4AZUA 2B77A 2HRLA 2CA3A 2VZVA 3SQOH 5K69A 3TEWA 4DAGL 2YKLL 3F58H 4Z7WF 1DO5A 4MDJA 2HT3D 4AEFA 2J8HA 3HN8A 3LOWA 1KGUA 1FGVL 5D72L 2FCBA 1MCOL 4X7TA 1BWWA 1N0XH 5F21B 1LXMA 3HFFA 3ZDZF 4KJQC 4BH7A 4DUVA 4W9IC 1CK0L 3F7VB 1ZLSH 3VXNB 2VC2H 4MNQA 2DIBA 3A47A 4MHHG 3AXLA 1PD6A 4CSZA 5HGHB 2DQDH 4QJ4B 4YS4A 3D69B 3WDJA 1ZE3H 4FMFA 1JGEA 2KH2B 1GZQB 5J7CC 1NCBH 4NJAH 3QC5X 4ZUSB 4JPVH 4OZHF 4Q14A 3ABGA 5L7XH 4CN6A 5I1IL 1RIHH 5BZDA 4J4PA 5JPMA 3DI2B 2X6CA 3AB0C 3FUIA 2XXCB 5IMOB 5DR5H 4I5BB 5I1AA 4L4JA 1JGUH 1VGEL 5I76A 3W0WA 2OMZB 3CLFH 4JPSA 3O45B 3QWNA 4RA3A 1UQSB 2BVOB 2WQAA 1PY4A 2JCCA 4NZJA 1L9TA 2CLRB 2DTMH 2AJXL 1OGAB 2KKQA 1HFUA 4G8FB 1I9IH 4P2QE 2ZCLH 1M71B 5SWZB 3TO4C 4N4YB 1E65A 3OAYH 4ENZA 1S4IA 3DUHA 5GRWA 4IJ3B 5HYQA 3KHQA 3PJNA 4G8IA 4PJFE 2WXKA 1RFDH 3SHSA 2EO7A 4FC3E 1KBGH 4PG9A 4RH4A 3O81A 3HUJE 1ZT4B 3QCVH 4KUZL 3D0VA 4UV4H 2P52A 3KLDA 4Y19B 1OAUH 3OKDA 1HSBA 1N5AA 3F04A 4FQIL 4LE8A 4N0UB 5KBLA 4HG4J 2K78A 2GBUA 3HOGA 3UROR 3WFEH 3WEXA 3WY1A 4X7TB 3HN5A 4DTGL 3DHMA 2X6UA 3DVIA 3NFSH 5H35B 3TEXA 2DLFH 2CWRA 4OD1H 1PFOA 2AEPL 4IU2B 3OKNB 1QSZA 4KZDL 1AH1A 5JIMA 1U2HA 1NICA 4JR9L 4XXCA 3BVNA 4P3DB 4G72B 3G9AB 2E7BA 1AZBA 4D0BB 3TCXA 2GBAA 2H8PB 4ZT1A 3N41F 3QQDB 1VCBC 4PWKA 4FYTA 5DJZA 4DF9A 1E67A 1VFAB 1SLUA 5DRWA 5AOLA 2VDNH 4XC3H 2A1WL 3LSOA 1PPIA 3BD5A 5JQHC 3B6SB 1KLFB 4U6YA 3U7YL 4IIQB 1MW0A 2K6YA 3EFFA 4LLVA 2ESVA 1A7QL 5DQJA 3QUYB 5C0BE 4OF8A 1LL1A 1JN6A 5C71A 4G8IB 1KGCD 4P05A 4EE2A 1FFOA 2A6KB 3RZCD 4RMBA 1Z32X 1A1NB 1M7XA 1T7VA 4UZSA 1GYWA 5CEZD 2IWEA 1P9MC 2ICWB 2EE0A 2CRYA 3MUHL 4YHMH 2Q8BL 5IG7B 7FABL 3QEQB 3LKPA 4HPOH 2Y7OA 1JN6B 1UZ8A 3T4AC 2B9AA 4F7EB 4X4YA 2BRQA 1GOFA 4O00A 2IDTA 1CICB 1YPZA 2ZXGA 3X1EA 2R0ZH 2ZWSA 3ZY7A 2DBLL 2HRPL 4WI3A 4YLBA 1YNKH 2HKHH 3PWPD 5HJ3A 4XVUC 4ELMF 4JGMA 1ZXKA 4X99B 4XVJL 5FKAB 3WXWL 3ARRA 3O6LL 1WHOA 4MLIA 1UVQA 2NNAA 4BM7A 3WHXA 3STZA 2VDQH 2ZSVB 4ZO8A 5DJ2B 4G71B 1JZGA 3QZBA 2GITA 4MA7L 3IGAA 4X0KA 1BJ8A 1MCQA 2X4RA 2ITCA 3WEXB 5AENA 4MRCA 4NQCB 5DUMH 4R84A 1ZPLA 1Q90A 5BQ7B 4PJIE 2WQ8A 4L8BB 2Y1ZA 3OKDB 2WKLA 2COVD 2DQEH 1AYRA 3WTXA 1KJ3L 2H32H 2GJRA 4HUVA 3PREA 1F4YL 4PJ7A 3RVWD 4CVXB 2EDXA 3B5HA 1ID5I 3NP3A 1OM9A 2Z7ZA