4I88A

R107g hsp16.5
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
113
structure length
113
Chain Sequence
IQISGKGFMPISIIEGDQHIKVIAWLPGVNKEDIILNAVGDTLEIRAKRSPLMITESERIIYSEIPEEEEIYRTIKLPATVKEENASAKFENGVLSVILPKAESSIKKGINIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Changes in the quaternary structure and function of MjHSP16.5 attributable to deletion of the IXI motif and introduction of the substitution, R107G, in the alpha-crystallin domain.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Chaperone
molecule keywords Small heat shock protein HSP16.5
total genus 17
structure length 113
sequence length 113
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2012-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17886 ArsA_HSP20 HSP20-like domain found in ArsA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4i88A00
1GMEA 2Y22A 3L1GA 1X5MA 4FEIA 1WFIA 2Y1ZA 4I88A 3EUDA 3L1EA 3QORA 4M5TA 4ELDA 3QORD 4MJHA 2KMWA 3QORB 1SHSA 2N0KA 4M5SA 3VQMA 3Q9QA 2MNWA 3IGFA 2K8QA 4YDZA 2Y1YA 4JUTA 2WJ5A 1WGVA 2KLRA 3AABA 2WJ7A 3N3EA 2CG9X 2XCMC 3GT6A 4YL9A 4ZJ9A 3L1FA 2O30A 3J07A 4JUSA 2BOLA 1RL1A 5DS2A 2JKIS 4YE0A 3GLAA 5DS1A 4RZKA 2N3JA 4YLCA 3VQLA 3Q9PA 4PCKA 4PBDA 4YLBA 5LUMA 1EJFA 1WH0A 3AACA 3W1ZA 2CR0A 3GUFA 3QORC 2RH0A
chains in the Genus database with same CATH superfamily
2WTPA 4XMVA 4MDIB 1D2OA 5GGTL 1Q1PA 1DQLL 4QKXB 3FU7B 4E9VA 4U3CA 4K23H 2D73A 4B0MB 5DJAB 1OCZB 4XCNA 2EIBA 2FGZA 2J7LA 1KXQA 2YQ3A 4OLUH 2D4DA 2J8UB 3DV6A 3D4GA 4WU7A 3U9PL 4IKIA 4NCC2 3OAWA 5D7IB 3RWDA 3PJNA 1JGUH 4JDVB 3V6OC 4QCIB 5FF6A 4ZFZA 5JZ7D 2RAMA 2ZAIA 3CAFA 2X1QA 1AOHA 4G8GA 1JBJA 4QKTA 1YN6A 4MD5A 1XF2A 4XODA 1D9KD 2H0EA 3CVBA 1X3DA 3RI5F 4MNQD 4UV7H 3UBXG 4EN3B 2OTUB 4ANVA 2WBJB 1CK0H 1SMDA 4DQOL 1J9RA 2IPTH 3ZTJG 1NQBA 2ZSWB 4QF1A 2ZOOA 4PM1A 1VADA 2AJVL 4X4ME 3PXJA 4MJID 1Z2KA 3E7JA 3UXFA 3OPZH 3VAEA 3FN0H 2D0GA 1ZLDA 3A4FA 2VL5B 4OJEH 4JFYB 1A8ZA 5F9WC 2PCXA 3N1GC 4XXDB 3TIEA 1X9RA 3RWIB 1I1YB 2EH8L 1BBJB 3VGGA 2X42A 4KDVA 4NUMA 1HL5A 1OSPH 2BHUA 4XCNB 5JXAL 2MTPA 5E1AB 5IIEB 1GJWA 3L3JA 3FUFA 4F37F 4U6YA 1LE5B 4A7UA 1HOCA 2B5IB 3HUJE 4NP4H 2GG1A 4C56D 3NBNA 4QIRA 3T2NH 3FMGL 1AYRA 4PJHB 4QOKD 1AG6A 1INDH 3WUZA 4MAUH 2FYYB 2NSMA 2DBLH 1P7QA 3B2VL 5BW7C 1NBCA 3T8MA 5HHOA 4N0UE 5DQJB 5CGBA 4GG8B 3L3GB 2UZIH 1VCAA 5EIIG 5CD5D 3DRQB 3G5YA 1NEPA 2GTQA 2PWFA 3DYMA 4Y1AA 3RZCC 3TTYA 1K8IA 5D1QE 3A67H 2ADGA 1BVLA 3MZGB 3ASWA 1TZIB 1UH4A 1XF5B 3FQ4A 4IHOB 1U8HB 4NQSA 4WQOA 5HI3D 4KHTH 5EBMA 1PY9A 4P5TA 3KM1A 2ZP9A 2ZOUA 3N3EA 1OWWA 1TPXB 1IRAY 1VACA 2P8MB 4Y5XB 4DGYH 1TU2B 3CBKB 4MD0A 2NCMA 1BVKB 3L13A 2FECI 3QNZA 3L2NA 4MHHG 1N70A 2JJSA 3KNBA 4LSQH 3SKJH 4KZDH 1QSEB 3BT0A 3IT8D 5TPWH 3PIQA 3DBSA 3EUDA 4LLVA 2BJML 4G7SB 1NCHA 3C6LC 1EZLA 4TTDC 3RPKA 1L0PA 4NKQB 3X1BA 2I60H 5AOJA 4IOIA 2VO5A 5KYWA 2WP3T 3MLSH 1B0GA 3VCLA 1GPOL 3BVVA 1O75A 2VN4A 2CO6B 3ZGIA 2OTPA 3FSAA 4N0RA 5SV3A 1A7QH 2EDWA 3OF6D 4EZJA 1RPKA 3NJGA 3LN5A 3C6EA 3EGXB 3SY6A 1DVFD 3MRDA 4XNDA 4NERA 4L8SB 1S9KC 3P9MB 2C9UA 4IBSA 2Q5BA 4R90L 5MERB 3VVWA 4Y89A 4LOEA 1C5BL 4KU1A 4CVXB 1I7TA 2Z8RA 3MHZA 4QHKJ 4RISH 5SWQA 3GMPB 4BKSC 2LV4A 5E1IA 3IDGB 4IM8A 5EG6C 3GBML 3H9HA 1ZGLP 2VE6A 4QY8A 1O6SB 3EXJA 4RAUB 5EO9A 5A2BA 1N9PA 2QHRL 1F3JA 2W9LA 5LJYH 2BNRB 1JV2B 2Y6TE 5DZJA 1DVQA 4PCKA 2HZHA 1A02N 1U3JA 3SGJA 2Z8SA 1EXUA 1ID5I 1INEL 1E27A 1H3XA 3AU0A 4XCFH 5BMFH 7FABL 4PYHA 2ZG2A 3MV7A 1DYZA 1QFPA 4EDXA 5B7FA 2ESVD 4PWJA 3QCUL 1BJ8A 1MHPL 2I26N 4LSSH 2AI0L 5JOFA 2LFGA 1BBJA 3NJVA 4GSDL 4HJTA 3S97C 1IL1B 1K4DB 4P2RA 4Z7QF 1ZLUH 1BQRA 1QI5A 1TR7A 1KACB 5F7EL 3IJYA 5E8DH 3QC6X 2KZBA 3F7PC 3FB8B 1OE3A 2HX8A 2DWDA 4JHUA 4XNYL 2DLIA 5CEXB 3OAZK 5L88L 3PQYD 4RSYA 2OMTB 2V9TA 2P26A 2K78A 3AJ7A 5E8PA 2XQBL 1XGPB 5ANME 3AU1A 3EYOA 2SEBB 5JW4M 2EO7A 3GLDA 4GEJA 3VXUB 3F7QA 3V0VA 3KPSB 4R26H 4JHVA 4KTGA 3UADA 3VDAA 4EQ3A 3CBRA 1I3RA 1UZ6F 1U9KA 4P05A 3MR9B 4MA1C 5C0BA 5EBLA 5F9OL 1YQVH 4WI3A 1RZIA 3AWFA 1K2DB 2F7OA 3LIZL 4UI2A 1NAMH 1UB6A 4GP5B 2JVUA 1X4XA 2DM2A 2Y23A 3QPQD 4EDWH 1M6OA 5F7DB 3STZA 3EDDA 1YYLH 3MV7D 4G7VH 4A67A 3BWUC 1FNGA 5CUSL 4LASL 1WFIA 3RX5A 1MCKA 3PDDA 1NBYA 1CU4H 1AXTL 4OFIA 2OLDA 4OCWL 5DTFB 5E8EB 1BZ8A 2BK8A 2HJKB 2H47C 4U1SA 3SIKA 4GQ9L 1I9JH 2WVVA 4YOKA 3D08A 1TZOA 4YDKL 3V5HB 1J05B 5C0AB 2NSXA 3BZDA 3NFSL 5IOKA 3PUCA 1MIMH 1MJUH 5DMIH 1TQTA 2APXA 1ZEAL 3AM8C 2NZ1A 3GMOA 1UHVA 1YVLA 3LEVL 3QZBA 3WEMA 3VD0A 3GK8L 4Y5YC 2EXWD 2HT3D 2FYVA 2IAMC 4W9CC 3QG7H 5DU7A 5G55A 3OQ3B 1AGCB 3G6JF 4E9QA 4F27A 2SODB 3A23A 2HKHL 5LVEA 5I17B 1BLNB 2BSTB 3VFOA 4GY4A 5D5MB 2NY3C 3QZOA 5ISZA 1BPVA 2BHFA 1M57B 3TBSA 3UZEA 5CLWA 2VDML 3ULSB 4YHNB 2R69L 3KEHA 4KJWC 2WB1A 2JKWA 4KTDL 3RWGB 3MV9E 2J6EH 1UZ8B 4YAQA 2EKJA 1IBDA 2A38A 2B9AA 3EDJA 3FO1A 3ARDA 1HI6B 4V11A 4XPFH 3MNVA 2F74B 1MI5A 2MCAA 5AG8A 4QAWA 4Q9CA 1QLEH 1S4IA 2OL3A 1JHTA 4QEGA 5FV1L 2HJKA 5KBLA 5DQJA 3VX0A 1OAKH 1KPUA 1RHHA 4XO4A 3VU1A 2GCYA 2F54B 4H4NA 4RQQB 5L2KA 3Q44A 4OD2A 3NIFE 1IVTA 1MRCL 2PP9A 3BWSA 3L7EA 5GS0L 2VLMD 2X2UA 2ZUQB 5DQ9B 4ZS6C 5I1EL 2ZX8A 5EEYA 5HHVL 5F3BB 1I8IA 3DPBB 4FQ1L 3N42B 2E7CA 2DRUA 4PBDA 2C4FT 5F9JA 4L9LA 2HT4C 5E94A 35C8H 2OJZH 3TVMD 2CJUH 4ELMA 4DUXA 2FHFA 1IQDA 2EC8A 3OKOB 2J8OA 3ESMA 4BFIB 3S5YA 5B7MA 1MG2C 5J11B 1PJ9A 5SWZB 3HA0A 1A4KB 2WQ8A 5IJDC 4FYQA 4PJFE 4KQ4H 1P4LA 1W72A 3STLB 1SMOA 4OIAA 3TV3H 3G5YB 4XNUL 3TEZA 1GW0A 1M3IA 2DQGL 4Z9KB 2N0MA 2XWBA 1X5FA 2ORBL 3G08B 2QVMA 4BRJA 5JORB 4UT7L 4WEBL 4Z0BH 2EIMB 4H0GA 1ECYA 4GAGH 4AEEA 2LVCA 5AVWB 5FXCH 4BFGA 1IUZA 4PJGA 5EIQA 4ERSL 4ZG1A 1W15A 3ZZQA 2GT9B 3CCHB 2XWJA 2B1HL 3F7LA 4YEFA 1K4CA 3QQ3B 1T2QL 2DKMA 4ZFQA 3W11C 2CIIA 1UD5A 2HJLA 1XFPA 4S1RL 3SOBL 4GBXC 1A1NB 3Q8FA 1UACL 1QSFB 1HYRC 4PUBH 2LAAA 3CLWA 4BKTC 2R0LH 1TO4A 1FVDB 1ETJA 3O4LB 4RGOL 3VI3F 1MZZA 3KLHC 5CHNB 2ZCKH 2Z4TA 4ZW7A 1D5BB 1S5HB 1E7VA 2VABA 3ZRFC 4CAGA 1X44A 3QEHA 3G5VB 4YSPA 3MPCA 3VRLF 5IB3B 1JDDA 4OKVA 2B0SL 3NJXA 3U1SL 3UTTE 3KPSD 1SBBA 5IHZA 2OMZB 3QEUA 3JWOH 1DN0B 3N9GL 4WGKA 3MX0A 4HKZA 2QEJA 4G42B 3PU7A 2ZUVA 3ZT6A 2V4LA 1MFDL 5ICUA 5I74C 3EFDH 3VFOB 5D70L 4L3CB 1I3GL 2DYPD 5KSVA 4GXVL 2E3VA 5D4QA 3PS6A 1MHEA 1YEKH 3P3SA 5D2LF 4NQCB 3AW5A 1BEYH 4IOIB 5KYWB 1YMMA 4IMLA 4WO4D 1UG9A 4RMBA 2VDQB 1XR9B 3DC0A 1IFHL 4ZX5A 1D9KC 1XSJA 4KZEH 1VZIA 3QP3A 3ET9F 2GJZA 2Z91A 3ZHFA 4ZX4A 3H85A 3KDMA 1E4HA 1T03L 3BLKA 3DO3A 2PYEB 3GSNH 4M1DL 1NUNB 4FQXC 3RP1A 4PGBB 4ZI8A 1JZ4A 3BKMH 4L8BB 3RDTA 4XPAL 3CFBB 2FEEI 1N6VA 4XMKL 5F88B 1RK1B 4YHOH 1AZNA 2YZ1A 2IWFA 1G7PB 2JB6B 2CJ3A 4APQA 2MQGA 2FZ3B 1XGZA 3FK3A 5D7KE 1QX1A 4M6NL 3II3A 3FQUB 4B9GA 3G6AA 3RNKB 5T5FA 1AQDB 5MEOB 1FIEA 3K72B 4UIKH 2VXUL 3VFPA 1MDTA 3AZUA 3PJSB 5AVYB 3QEQA 3OAYH 3Q8BA 3MUY1 3VXQB 2QGEA 4UF7C 5IMMB 3DO7B 5F0MB 1AKJA 3IJEA 3TCLA 1MFMA 1V55B 1PS3A 2QPFA 4BFNA 1KJMA 2YWYA 4TUKL 1OGTB 2BS9A 3IEAA 4MA8L 3DJZA 4OUUB 4ODBD 3KLKA 3M1OA 3L3DB 1R0AL 5IGXL 3CXHK 1U4FA 1SY6A 2VJ0A 4DGWC 4G6AC 5F7KC 4IK7A 3F7VB 3IJYB 1TJXA 4MZIA 4WTXA 4KI1A 1KYAA 4KZCA 3WY4A 3KYOB 1OE2A 3ECUA 1CS6A 3PGFH 3QCTH 2HJLB 4XMXA 3C5ZD 1T0PB 1XGYL 3QO0B 4WDIB 2QKSA 1E8XA 3QQDA 5AVUB 1UASA 3EYUH 5FOBA 3GIVB 5EB9A 1CVSC 4ZUSB 3GXTA 4NXKA 2H9GB 3Q3GB 4M03A 5ICYB 2WO4A 2VXVL 1AY1H 3EH1A 4B7IA 4E41B 5DF0A 1JZ8A 3IPFA 2BWDA 4OU3A 2W94A 3VTTA 4TUKH 3WIHH 2FQFA 4Z76B 2IAMB 1Z5YD 2NXZC 3QORB 1DQJB 2CCVA 5L2KD 1BVLB 4MMYB 3H9ZA 1LP9A 4BQBA 3GBNH 4JO3H 3N40F 1IBYA 4JHAH 4M7ZB 3VFMA 2O30A 2VDKH 2X6AA 1S46A 2XZCH 3UFIA 5KSAB 5EO1B 3K1DA 4YSUA 1OZUA 2R1YA 1KIPA 5DLLA 2FO4B 1OOWA 4DAGL 5A6LA 2O5ZH 3BSZH 4NZRH 3ZQXA 1KXTA 3QRLA 3HS0A 4HIXL 2YSSA 5HJ3B 4YDNA 1I8UA 1UADC 4N2OA 4PWFA 1OTSD 1TEYA 1E4JA 5JUEL 5E00B 4HGKC 4PG2A 3IDJB 4A2HA 5ENWA 2B1AL 5C0AD 5GRJL 5E4IA 2XRAH 3I6SA 1QLFB 4J2QA 5A16B 3H56A 1UXWB 2OJEB 4M62L 3DOHA 4HHWA 4D0DA 3HBGA 3V6OA 1ROWA 2GBAA 3L3OC 4FA8A 4IU2B 5KBKA 1R0AH 2BXZA 3C75A 3GJFA 4QNPE 4I13B 1OL0A 5AKSA 3Q43A 4GINA 25C8H 1LDSA 1A22B 4HUNB 5DWUH 1LQBC 3CZLA 4NPKA 4QJ5B 1N19A 4JFTA 3N44B 1OB1A 3MNZB 1NCCH 2W59A 3IAQA 3K8KA 3KJ6L 3QORA 2GIMA 5C71A 4Y1TA 5IGXH 2BVQB 1U93B 3KVPA 4RA3A 1VJSA 4W1TA 3LDBB 4YL9A 5EPMB 5JTWA 4L9LB 1HHKB 4YHML 1X5HA 1TDQA 5GIRB 1UOKA 5D1XE 3PJLA 2VAAA 3H9SB 2FSEB 3QJVB 5A6MA 1D9KA 5DVOA 4HZAA 4QLRA 1MCDA 1KCUH 1KCLA 2DAVA 3FZUC 5HHPB 1XCQA 3KXFB 4PJDE 3E0GA 1CG9A 5CEZL 1BAFL 3VFWB 2XLLA 4AL8L 1G1YA 3PQYA 2DS4A 4RFNB 2R2BB 2BSCA 4M93C 1U41A 1UXWA 2OJEA 3WNOA 3C5XA 3MKGA 5LQBH 1DJZA 4JO3L 2OYPA 4PJIE 3RNQA 2L3BA 5TTRA 2YXFA 2H4EA 3MBWA 3BN9C 3FC8A 3BJ91 3CZFA 4JQXA 4W6XB 1K9TA 5EZJA 1CXEA 1JTOA 2WO2B 2YKLL 1RZ8A 2WZ5A 3I50H 4B0MM 3WTVA 3VW3H 1JK9B 3VI3A 3LZQA 3B2UD 1EHXA 5DDHA 3KJ6H 2EVIA 2OMBA 2ICEC 4ERSH 1OAYL 5D7SH 2LQRA 1OD9A 1OTTD 1BG1A 2YAHA 1HCFX 1KB5H 4C4UA 2P9RA 4F5CE 4JDEB 3QDGA 4H26A 2JLPA 2ZOWA 3B7SA 4TUOA 3RX8A 2WLYA 3FN3A 2IGTA 4ZOEA 3VD3A 2H41A 1QACA 1LXMA 3DHUA 4PI0A 5DHDA 4P3DA 2R7EA 5AW2B 4WHYG 3CFTA 3MRJB 4PN6A 1AMYA 3MOQA 1A3LL 3RX7A 2DLTA 4ZZFA 2R9HC 1ZE3H 3U0TA 3FO2B 3VE0B 4Y8DC 2PWHA 4P2OC 3U83A 1MSPA 2DD8H 2H7WA 4DO5A 2NXZB 3O8XA 1W0YT 5JW4Q 3T77B 3KBHE 1JPGA 3EBAA 4FQXA 1V3JA 4WFFE 3Q06A 1VKXA 5HHQA 4P2YA 1UQSA 5KSUB 1P7QD 4FJ6A 2YC1A 3GUTB 3EO0A 3OR6A 4YSQA 3CFKA 1AHWB 4PTTB 2VSMB 3FU7A 3HR5A 4NRZB 2Z7ZA 1NUGA 4E42B 3K2UH 3C8KB 4PUBL 3HFMH 4YPGA 1A6AB 3O3BB 1S7UA 5C3IA 4Y2LA 3CVHA 3Q1SH 3VFVB 2BIQA 3L9RA 2BW5A 2CDEB 4U7KA 3VD4A 2XG5A 1NDMA 3VXUA 1A1OA 4LHUD 5F96H 5K1VA 5FO7B 4PRPB 1AIZA 4L8DB 3LKOA 3RE0A 3VMOA 1WC7B 1KTBA 4WI2A 5D9SA 1OO2A 1IFRA 2FD6H 4UMGA 5CMAA 5KVEH 2JB6A 3IXTA 3UC0H 1BXAA 4WIQA 1U8JA 3MBED 1OSEA 3KYOA 4E9LA 3WTUA 1GZHC 2A6IA 4IRSC 4PP2A 2HG5B 2VDQH 4PRBB 1CDCA 3BP5B 1JGVH 1M7IB 3KPPB 3OMZA 4YC2C 2BWQA 1MFBH 3QUKA 5DRWB 1X5IA 4XI5D 4ADIA 5HDRA 1IO4C 2BY0A 1MJUL 5JHDE 4FI6A 4MMZA 5DFWH 4YDJA 1FFNB 4L37A 1SBSL 4MKMA 4P5RA 1JHKH 1DJHA 4FQ1H 2BY1A 2AKRA 3QZPA 3BKJL 3S4SB 2G75A 1Z0MA 4HCRA 1DVYA 3JV0A 2WXHA 4JM4L 1KNOB 4LPYA 3RVTC 1M7UA 3SDDD 1S2EA 1IM3A 3RJDA 1IV8A 2BVYA 2PPDA 3JXAA 2W9DH 4PCSA 2DWTA 3NCYP 5CUSH 5D1XA 2H2PD 4GMTH 5ALBH 4CNIB 2BS8A 2IQ9L 4KTDH 3U30B 4TSCH 5EZLA 1A1OB 4PJDA 3UMTA 4HKXB 5F2FA 3M1BA 3SPHA 4DKFL 5IFJA 1CURA 4FQIH 4IOFD 2A6KB 4TQEH 1JZJA 3NPZB 3MNMA 4YN3A 2J6EL 4P2QB 4HC1L 4ZFOB 3J27A 3D69A 2ADGB 4GS7B 2ZOKA 4I48B 3ZHNA 3DIFB 4OCRH 1E0OB 1WPCA 4KQ3L 2Z31C 1JG9A 2JJWA 1C12B 4N3UA 3H7BB 1M7IA 3KPPA 2G3NA 3B9KB 4UQEA 2OI9C 3TBWA 5HD8D 1AD9B 1YNKH 3FO0L 3HHRB 5FHBH 1DQMH 1OSZB 1HHIA 2GITB 2XA8H 3O11B 3QFDB 2NUPB 4IKJA 1W0WB 2IPKB 1NFDA 2Q10A 3B9KD 1BAWA 3QDGE 2FJFA 3QH3A 4HYTB 4L4TD 4GSDH 3VXOA 4HS6B 3FAXA 1BYPA 1EWHA 4M4PA 5EPMA 2Y06L 1KN4H 2EYSB 1P5VB 2FT7A 1Y1UA 2RJMA 4JQVA 1R3HB 2AW2A 4TQPA 2OMZA 1OLLA 3QEUB 4ABUA 3FONA 2OXGA 4B9KC 2EE2A 3W57A 1JMXA 3FHQA 5DJDA 1BGXH 4PWHA 5JIIA 1KDIA 3WXWL 3FFDA 3L9RB 5EOTA 1YO4A 2K45A 3AITA 1U8MA 1MWAH 1CICC 4N86A 5LLIC 1MEXH 4OF3A 3NDYE 1T83C 1XD0A 1WFJA 2D0HA 2NNAB 3FT9A 4HPOH 4GG6F 4NWUL 3AMKA 1VFAB 4ZD3H 3K2IA 3T6ZA 4R26L 3ULUF 4DGVL 4UQIM 5GGSY 2B1HH 3BXNA 1BF8A 4DP1X 1NC4D 3ARTA 3IDJA 4YFLF 5DC0A 4BH8A 3IS1X 3L3JB 4OGYL 1G7JA 1JF1B 5DHEA 3MJ6A 4R0LA 1ZVYA 4FQLL 1FNGB 4OI7A 1P2CA 1Z9OA 4F2MA 3ULVL 3FCTB 3AREB 4RH4A 1UH3A 2C3XA 1I1FB 4A7QA 1OF2B 2OXHB 1EXUB 2EVJA 3U48A 2FAUA 4IRJA 4PGDA 3RVXD 3AG4B 4BSWB 4M7JH 1JZ6A 3I6KA 4OZIB 3BVWA 1T1YA 3T0XA 5IW6B 4QRAA 2OMUA 4PLKD 5AVXB 3S3SA 3QULA 2D3JA 4ISVB 4XPGL 2GEQA 2X6VA 4X80H 3OGOE 2H2SD 1VERA 3IDUA 4M61B 4NRYB 5L0QB 4G6ML 3G3LA 4U1NA 4WUKL 2BP8A 3IJHB 4KRPC 1JK9A 4I18B 1XGPA 4UT9H 4PRIB 4WJ5A 2DQIL 4U49A 1RL1A 1SN2A 1Z3GH 1YN7B 1OKEA 3EJPA 3LS5H 3P54A 4HXBH 2I5YH 4RVBA 4D9QE 1QRKA 3BP6A 3DLQR 3TA3D 4FQXB 1Y6NR 5EU6D 3L6FA 5BV7B 2GJ6D 4HQQL 4BQ9A 5JPMA 3WKML 4UAHA 3ARFC 2X4UB 3N43F 3TOPA 1J5OL 5ANHA 4MBOA 4X7TB 4BA8A 1DVFC 1QOKA 2NDGA 1MNUH 3VSVA 4UB0H 5K9KB 2A0LC 4NJ9H 3IFOB 5B1CA 1L9PA 3UCRA 2F53E 2WNGA 2XJKA 5CZKA 5SWSD 5GGVL 1JZFA 2VMDA 5CKAA 4CVUA 2GJRA 4I18C 4PJEF 3ARWA 1CZ8L 1ZK5A 3SDDB 5HGHA 5KBDA 2OZ4A 2O6EA 3GHPA 1H19A 1UM4H 2OKMA 4OFVA 1K3ZA 4L8CB 1N59B 4YDLC 5EHFA 5G4MA 3F8UB 3RKDD 5J3HD 2V6HA 2DQJL 3GMPA 3CHXA 3PFUA 1SM3L 3UL4A 3WUWB 4D0BA 3CHSA 3I3DA 4NGHL 1ZTXL 4FHKA 4Q4IA 2GK0A 3VO0A 3UGXA 1UXSB 4X6FA 5DMIL 1M71A 4AQZA 2V7HA 1PZSA 1FORL 3JV5A 3QDMA 3CZFB 4JR9L 2WXLA 2FJHB 5CSGA 3UAFA 5CBAA 1A6AA 4JX0A 2CRZA 3DO4A 1FYTA 4Y2DD 4HAGA 4UTAA 5E2VH 5ESQB 4XVJL 5IG7A 2WBJD 1CU4L 2FSDA 4LF3B 1H6FA 1YRKA 3U9WA 4N90D 3PL6B 4HWNA 3GSRB 5I8EB 3U6RA 3TEUA 1KCVL 3V0WL 5AD0A 1UQSB 2JQAA 4NUJA 2DDQH 4JFQB 3VI4E 4U1LA 3IU4H 4I0PC 4W93A 4OFQA 2K3HA 5FYJD 3SGKA 3WNMA 4JG5A 3PGDB 3TBYA 1H9VA 1Q4NX 4KI5E 3D06A 1BPLB 3L3DA 2V3EA 5E1GA 5GSRA 2DLFH 3V2AR 1J8SA 4OM1L 1VGEL 1SJXA 2AC0A 3VH8G 2X7LB 4FXGC 3QZWB 1ETZB 2IGFL 3HB3D 4HPYH 4DWHA 3FQRB 3CXDH 3P40A 5CS7A 4ECNA 3O81A 3KR3H 3SSGA 5L9DL 2BOBA 3P77B 5C0FA 1T83A 5J06A 3QQ4B 3H54A 4HJJH 1UXSA 4X6FB 3B83A 1PCSA 5KYYB 2N7BA 1YN6B 3P0YH 4LOUC 2R1XA 3BT2L 4JFOA 3W81A 5TDNB 3BIKA 4GRLA 1AE6H 5ACLA 2F68X 4JGJA 4Z76A 1ANUA 3KLAA 2IDFA 1QPKA 4BFIA 4L5FL 5ITBH 3S8FB 4ZDHA 2NY7H 4I3SL 1U8IA 1Q9LB 1J9QA 1Q9WA 3D0LA 4KKBD 3T3PE 2BNQB 5HI5C 4N2IA 3N06B 4WWOA 3AQZA 3O3DB 4WWKB 3OZLA 2EE3A 5I8EA 2FJFB 3B5TA 4PJHF 3AC0A 3HZYA 2X6CA 1LO3L 4NFDA 4QNPF 1BWWA 4OLZL 2EDFA 5DRNB 1DCEA 1CD1B 1BQLL 4UDUA 1IGCH 4PJEE 4AL8C 2O93L 3ARGB 4L23A 2BNUA 4KTEL 4JKMA 4PLJC 2CD0A 3DMMC 4LPUA 4ELMF 4KNQA 3BPOB 4MAYC 4PH8A 1W16A 3S5ZA 3D39B 2KHAA 4GLRH 4I4WA 2CKBL 3N41F 1ZTXE 4YS4A 4RAUA 4UQCA 5DJDB 5EO9B 4NOFA 1Z32X 5FDWA 3VYNA 4E41D 4ZFFB 5AWNH 1UATA 1YEDA 1F5WA 1SXBA 2ICEA 4PGZA 1XGRA 3KBEA 1ZS8A 2H26B 3QS3A 4JHBA 4YSAA 4HMDA 1CFTA 2H8PB 3PPEA 2VLRE 5IFJB 2L7JA 4H20L 4FTDA 3TBSB 1E7UA 3MRHB 2R39A 3W39B 1K6QH 3JTBA 3ZUCA 1AD0A 2WVSA 1BMGA 3FU9A 5ID1B 4PRID 4CSZA 4QCIA 5FF6B 1HE7A 4DW2H 1FFPB 3O6KL 1FZMB 5IHZB 4XC1L 1PDKA 4N8VG 5F7WC 4FTVD 1AS7A 4WO0A 3JWNG 5LCVA 5ICZA 1NCTA 1KNOA 4OBRA 1B0IA 1R5IB 2D8KA 4OTXL 3Q6FA 3C8HA 3ZYIA 4XVUC 5KVFH 4HIEA 3EAKA 4TOYL 5JQ6H 4Z77B 1KPUB 3MC0A 3OPZL 1ZANL 1VZGA 3IMSA 4XNXL 1E3FA 1T89C 3QXAA 1ZT1B 2VQ1B 3H42L 4AYMC 3QG6B 4UDUB 2YAFA 3L7FB 1I1AA 5LAXB 2MCPL 4N25A 3WN6A 4DP6X 2AK4B 3CPUA 3O8XD 4EUPB 5MEPA 3NJHA 2EXSA 3T3PF 3D07A 4G70B 4JFHE 5EA0H 2H45A 4YE4H 5HGAA 3QPXL 4BH8B 2B4CC 3K4AA 1H3WM 4Q9BA 4RNRB 5LB1A 2I32A 2YEZB 5MP6H 4KKPA 3LMJL 4F20A 1E65A 1E6JH 3TT1H 3U4EB 3CWGA 4FAAB 1OGSA 5DHVB 1G0YR 2BHYA 2VKXA 4GRWE 4P2OD 3UAJC 4EMZA 3D2UB 3WDHA 1E4WH 5K9JL 2CM6A 1RIUH 3VQMA 5IJVB 1BJMA 2QKIB 1AGCA 3P9LA 3FFDB 4ELKB 3RB7A 4M7KH 3GB7A 4A2GA 3KPRB 1V3MA 1R5WA 1U42A 3RIAK 4ODXA 5ESVB 1JHKL 1NJ9B 4XI5C 1QW9A 4KXDA 1D2PA 4FTVA 3IPBA 1OP9A 3CFJB 3KPMB 2EDQA 2FCBA 4NP4L 4X4XA 4CGTA 3UO1L 5I1KH 4DTGL 5I1DB 3LPGA 4OR1A 1I8LC 1THCA 5F9DC 2EO9A 3BAWA 1R5VA 4UYQA 2VT0A 4JZJB 4HU8A 4WW2B 5F7FA 2WANA 3WGVB 3ARGC 3MLZL 3ZRCC 4Q4EA 2DYPB 2HA1A 1JRHL 1KN2H 2OXHA 1BJ1H 3I6LD 4HKBA 2JCWA 5A2CA 4IK6A 1KJ2L 3AUWB 4L3FA 4X5WB 4EN3C 1A25A 3L1FA 3IFNH 2CBOA 3BP6B 2XTJC 4U1JB 4Z7UF 5FDYA 2QTEA 1JI1A 5CWSB 3T0VA 3WLWC 1RPUA 1DDHB 1YUKB 1T7ZA 4N5EC 3QHZL 2JWYA 3IE9A 2RFXA 4XC1H 5F44A 5IVZB 2OPCA 5IUSA 3HAEB 5AW3B 4Z8FH 5INDA 1PU0A 4LCYA 1UGNA 5IB2A 1JDCA 4LRIA 2HFFB 3MSPA 2KZWA 3F6JA 2AHIA 3V0GA 2GSIA 1H9DA 4XVUD 3AU1B 3EYOB 4WTZA 5DVPA 5GZND 3OKKA 3L5JA 4M02A 4MA1B 2X1PA 4JFFB 3BUPA 4LEXH 5IVXF 3EBGA 4X6DA 2YXMA 3S7GA 5CXPA 4Y4FA 2Q6WB 3DXAB 3H4HA 5MENE 3COOA 5HDQH 2VLJB 2Y5EA 1EPFA 2MOGA 4NXSA 3P9MA 3T0EC 5DD6B 3WE6B 1D5XA 4FEIA 1FBIH 1OANA 5EEZA 1EZUA 1DQLH 4A7TA 3WJLC 4OFPA 4LCWB 3T4AC 1SDDB 2ZWYA 4X7SH 1NEZG 3C6LB 3QEGL 1E42A 4OLZH 3DTXA 4NN5B 2X4OB 3CLFL 3NJJA 2GTZB 2C3VA 1OSZA 3CVHL 2FL5A 2E9BA 2ZXCA 4LSTL 4NO5A 2HT4D 4N26A 3P3UA 4HUVB 4FFZA 4I3RL 1A3RL 1S7XA 3D2UD 4U0RC 4F33A 3SE4A 3MA7B 5AYUL 3V0JA 5KVFL 1SQMA 3ZKQD 5BVPL 2AEIT 5DSCB 1AE6L 3DSNA 2N01B 1ND0B 1DZ0A 1K85A 1WDAA 2AXHA 2VUOA 1T6VN 3KD4A 1FHGA 1AIFA 5DRXA 4DPCX 3O6KH 2Z93A 3NRQA 2D0FA 1EK3A 3KWXA 1CICA 4AITA 1WFMA 2ZYSA 4KKBC 4BCYA 1VA9A 3KR3L 1AC0A 1CXHA 4RMVA 2AJ3A 4HMEA 2DICA 3SQBA 5J6HA 1A6WL 1KBGL 4ZXBD 5CJOL 3MNZA 2X38A 4G6AD 4JKNA 5GPRA 4K4KA 3ZGHA 1KB3A 5B3NA 2J73A 1HIMH 4UB0L 1M3JA 4FNSA 4YL4A 2J88L 3TIDA 2JKRM 3X11A 3HG3A 1DJSA 2K8MA 3A6CL 3U4KA 1MWAB 4AENB 4FQQB 2PNDA 1F2QA 3V7AG 1F4HA 2GK2A 3DIFA 3M7OA 3GLEA 2IH1A 2HWZH 3PHQA 1GW6A 3C5ZC 1KCSH 5E4EC 5EIIB 1Z3GL 2EJ1A 4DEUA 1AGFB 1XGQB 3O3DA 4WWKA 3ILEA 1LO3H 3UTPE 5E6RB 3T5WA 2ZWLT 4FNPA 2J4WH 4JPKH 2X4SB 1IGJB 2NYYC 3LRGA 4WUKH 2I69A 4RFOL 2BY2A 3PGCB 4O9HL 4BV1A 3CQQA 4LLUB 1E4XI 1AIFB 2A1WH 3FBKA 4LHUG 2Y2TA 3QYNA 1URLA 1A4AA 4U1IB 4TVPE 4YLQT 2R1XB 2CK0H 1WAPA 5GHWL 1QEXA 3VFMB 4NUPA 1HEZB 3CVDA 1CT8B 5FLUA 3IJ9A 1H0DB 4WTWA 4DT2A 3VFVA 2W0LA 1UWXH 1NWPA 2JCCA 2QL1A 1F4XL 1FO0L 1YEEL 2R9HD 1CZ8H 5DEFB 3VYPA 1KT2A 3ZE0F 4WO4C 2EEDA 5F1IA 1BBDL 2H1XA 1WWWX 4LARH 1AGEA 4LAQL 5D6DC 2Z92A 1U3HC 4XN4A 5IB5B 4PB9H 4U4IA 5GZOD 1NEZB 2FTAA 2IH1B 5ICXA 3RZWA 3KVQA 2JKJA 4RIRB 1OW0A 4IDLA 5EOCL 5SWZD 3VSTA 4Z7NF 2X4PB 1MCIA 5DYOA 3GRWL 3LEYH 1NGYA 3VGEA 1MWAL 5KSAA 3LH2L 4O02L 1A2YB 3NESA 3IRCA 4K07A 3ZO9A 4JHAL 3WO4B 4IGBC 4K7PY 2F1BA 1RUKL 4FTVB 4BBWA 4YIQB 4JW3A 3RGVB 5EU7C 3BOVA 3MRKB 1CLYH 3S6CA 3QSKB 4NCDA 3LNDA 1FH5H 1IKFL 1XH2A 4Z7WE 5M95B 1WLHA 2Z93B 1RH8A 4HJEA 3DTUB 3P9WB 5JQIB 4IW4C 5HJGA 5BXFA 5E5LA 1I8KB 1UXLA 3DV6B 3KGSA 1DBBH 1OK0A 3QJUB 4MB5A 3T2OA 2VDOB 3H2QA 3PQYB 4MJ4A 3HEIB 3BSGA 4S1SL 4JG0H 4CADA 4TRPH 4X42A 3RA7L 3M8OH 1YAIA 2Y0SA 4W9ZA 3MNVB 4U6HA 1E6OH 4CN6A 3B5GA 2D9CA 5IEKB 3L4UA 3BVNA 4N9OB 2EXYC 4TMPA 5ENWB 3WFBL 2JKIS 3PV6B 2Z9TA 3EYQD 4AQAB 3LHPH 5D2LB 2Z8WC 3FQTB 3GHBH 3L48A 4XCEB 5GIRA 5HGGS 5C7ZA 3TA4D 2XSKA 2A6IB 4BSJA 1G9ML 1KYUA 3T4YA 4HVBA 1DQIA 1ID2A 1CFSA 1PFOA 4IHBA 5MI0B 3LB6C 4C56E 2I7OA 2QQLL 4KITB 1KFAL 2JELL 1WGOA 2R1YB 3EJRA 1PCXA 1OT2A 4G8GE 2XPGB 4JMXA 3IFPB 4X6DB 4ZUTB 1U6AH 5HPMB 4WO4B 3CLEH 3OZKA 4ICWA 4LU5H 2WXPA 2FRGP 1PZ3A 3F00A 3D87B 5HGHB 4XMKH 3QQ4A 2AKRB 5HY9A 4A39A 1EHKB 2XN0A 5KSAD 4PJ8B 3RTQD 4I0PA 2ZXAA 4XRCA 4AYEC 2H32H 3VYOA 2OV0A 3TJEL 2N59A 1NOAA 3S8GB 2ITDA 1QI4A 5FFGA 1UM6L 1EMTH 1IM9B 2FJGA 1DBJH 5T5FH 4AGPA 1JGVL 3DX7B 3GJFB 4BZ2A 3SO5A 4NKOB 1XB8A 4MQ7B 1UFUA 2IQAA 4G1EB 3FCBA 3PF2A 3FTGA 3EW3B 3EOAB 4MJ2A 2OZ4H 5IQMA 1YNKL 1WUNT 3HMXH 4YDIH 3TT3H 2G3XA 1F42A 1KEGH 2FNWA 4LOUD 2V8MA 3BE1L 5FKPA 5TGBB 4N2LA 1Q90A 1JF1A 1XGTB 3GSVB 3PWPE 4NSKA 1K4CB 3QQ3A 1N5YL 2KBGA 5BQ7A 1I3GH 4ODSL 3HBZA 1M2OA 4BZ2H 1PZ2A 4GAYB 4BEIA 3MMEB 3KHOA 3NDZE 1QNZH 4WEUD 3MLPA 3HI6H 5HHOE 1T22A 4EF3A 5HDBB 1LNUB 3BZEA 3Q05A 1SHSA 1JGLL 1CFQA 2AEWA 2YJQA 4PREA 3VH8A 4CGUB 5F3FA 1U8NB 1WEJH 3GO1H 3L3HB 4PS8A 4JDZB 1BGXL 1BXUA 3QDGB 1SMAA 6TAAA 2FX8H 3NCEB 1XGUB 3EJCA 5EOQL 4Y4KA 2YC1B 3GPEA 4J3SA 3C08H 2QELA 1FE8L 1FG2A 1MRFL 1IQDB 3IDNA 3QZMA 3UYRL 1RIHH 3N42F 3ZOAA 2YD7A 2OA9A 3T6VA 5CR1A 1CR9H 3V7MA 4UTCA 2DMKA 5GSVB 4M7LL 4MQ7A 2R59A 1VAHA 5F8RC 4CILA 2N7AA 1AGBA 4J8RA 5EUKA 2WK2A 3KYMB 1PD0A 5EC2A 1DVSA 2V2TA 3PWNB 4YXKL 3JV6B 1Q9LA 4ZOCA 3RHWF 4LCIL 3QG6A 5JORA 1N5YH 3PABB 2X4UA 2XQ0A 4JO8A 4GSXA 3DKHA 3RIAF 3VXQA 4UT6H 5ALCH 4PG2C 5M7QA 1G7LB 4LLVB 2PABA 3KAAA 4YDIL 3TT3L 4L1DA 4K5PA 1HEZA 3TV3L 3WKNA 2J1YA 1MNNA 2EVGA 1EJ8A 1O6SA 4G3YH 3FO1B 3IGUA 4KQ3H 1UJ3C 4FQXD 1UD6A 2EDNA 5I0YA 4HCIA 5D7SL 1ES0B 1S7WA 3B7UX 1F4AA 3F7YA 1DVZA 3DBXB 5C0RL 3CFEB 4FLHA 4NHCL 2CJUL 5CIPH 4FQIL 1OAXH 2Q20A 3IMBA 3N04A 3O9WD 5IB1A 2BVEA 1SQ2N 2F53A 5GGRB 4UZSA 1KSRA 1FVEA 4YX2H 5B7EA 3S37H 2G75B 3TO4C 5EO0A 3ZDYF 1UWYA 2G2NA 1NGYB 3GI9H 4IJ3B 1JF5A 3OKEB 4JVWA 3WL9B 4GXUN 1QBML 1DANT 2CPUA 5D93B 4WI8A 5IG7B 4HWBH 1BHGA 5FM5M 1KCUL 1XMEB 4QRUA 4JKWA 3NACH 3TM6A 3CZUB 3IK2A 3NTCL 4M29A 4TLUA 4QT5A 2P5PA 3F05A 3FTVA 3HI6L 4UM8A 2MIZA 4OCYH 3QDMD 2AJ3B 2HKFH 4YO0A 1QWNA 3SQBB 3WFBH 1IGTA 3Q9PA 2WQVA 4E5XG 4J8QA 4UINL 3ULUL 2XKSA 5C0JA 2KQMA 4OLWH 4NP9A 1VFOA 1J0IA 4XN9A 4PGEA 1NAMB 2DQMA 4XP5L 1B3JA 4LVHB 5CU5A 2WGNB 3Q2WA 3GBEA 4K3EH 4IEFB 3SJVD 1EEUA 3HNSL 5E4OA 3VXPB 4LO9A 1E28B 3NIGE 3UC0L 1IGFL 3RUGF 4D9LL 4YQXH 5DMGD 4EZKA 5DWUL 1XDTT 1QZNA 5JHLA 1DBJL 1ZA3A 2E7DA 5T5FL 3KWTA 1EMTL 3X1GA 5C0FB 1KEGL 4JANA 2WC7A 5HHNB 4GT0A 4WSGA 5E5MA 2ATPA 4PJEB 1FVDA 1TENA 3O4LA 4B96A 4P5MB 3CN2A 5FECB 3FRUA 1EHLH 4MNQE 3VW3L 2J2ZB 5HHMD 2Z0BA 3T8VA 4U7MA 3KHQA 3U0WL 3U1PA 1MRDH 2GIYA 5AZEH 3LPWA 4LVNB 1LEIA 4U6VH 5D6CA 3HRZA 3DGGA 4YGAB 2ZXQA 2MPAH 1OP5K 2DQUL 3EDKA 3IMRA 3IJ7A 1OF2A 2VIRB 4LGPB 3IB4A 4Z95L 2UUDK 2CO2A 4FZ8L 1BAFH 3GRWH 3LEYL 4ZMNA 1YCSA 4NC1E 4ORZC 3UBXI 3ULVC 3U36B 5FUCE 3RJQB 1QFWH 3QDAA 4HMCA 5I75C 1ZA6A 4KK5C 4WI4A 4TTDD 2XICA 1XCTA 3FFOA 2G2RB 2WIIB 4ONGH 2WWNA 1S7VA 2RBLA 1DQDL 4TKWA 1JPST 4WNSA 5D7LB 9PCYA 2LU4A 4AGLA 5EWIH 1P5VA 4TRPL 3P69A 4OT1L 1J5CA 5KSBA 4AM0Q 2V37A 1HSBB 3BGMA 4N2BA 3MJ7B 4NZJA 4LVNC 1OV8A 4UZUA 4AQEA 2DPKA 1CICD 2JSFA 5I1GL 3KWWA 1MCNA 2Q0ZX 3T0ED 2PPAA 4JKPL 3GSQA 2AK4E 5I9QC 2RQ8A 2WSKA 1DJIA 2VW7A 2GFBA 2IEPA 2XVBA 4ZODA 1HILB 1KIUA 4A1RA 4KJWD 1BZDA 4RAHA 1L0QA 43CAA 2JI1A 2YD0A 3VXNB 3ZR5A 2OYKA 1J0ZA 2AQ1A 4WNQB 5D71L 3UJTH 3VXMA 1MG3C 3WD5L 2A2QT 1L9QA 4BQ8A 1TFHA 3D34A 2JIXD 2CHZA 3GS7A 1NUFA 4MBRA 5EC1B 4WGWB 3MUGA 5F9AC 1ZT1A 1KLGA 2Q7YA 5F6HJ 1R3JA 1KFGA 8FABB 2FHBA 1KEML 4AT6B 3CN0A 3IDYB 4GIOA 4C8XA 3HTLX 4G72B 5JDSA 1TJGH 1N2RA 4ZMTA 5A2JH 2XZCL 1EXGA 1I7ZA 5I17A 4D0BB 4M8VA 2VUKA 3V79C 2OYLA 4WWID 1R1CA 2ARWA 3RPIA 2F15A 5T3ZL 3UGUA 4URKA 4GP8B 4OH2A 4XO9A 2EADA 4NAJA 4OZHE 4F33B 2C26A 4P46A 3TA3B 5EMYA 3A4EA 3I2CH 5B1KA 5I6MA 2VJXA 3HE7C 3I74A 4AQAA 4ENEC 3U7YH 2CE6A 3Q2LA 3VQLA 2HVJA 4CNIA 5HVHC 1YEDB 3MRGB 4JJOA 4Y2DC 3WIFB 1KYFA 1U8CA 1YEEH 3UTQA 3HI5L 3D30A 3KJ4C 5DJ8B 2M83A 3APNA 5I0VA 5HI4D 3KJ4B 4OQTA 2OR7A 1RHHB 3ARXA 1IGIH 4P2OA 1FNSL 4BSWA 4RA0C 3CPLB 5FWRA 1JUFB 4D9LH 2OSLA 2UX7A 1QW8A 3PV7A 3QUYB 2KT6A 3DMMA 4WY7L 3CJJA 1SFHA 2NUTA 3OGCA 4M62H 3M46A 4MA8H 3UG3A 2X41A 3NP3A 5D1QB 1PZUB 1UYWH 5DEGA 2X09A 3CCHA 3GSNA 1YYMH 2NDFA 4NIYE 3V4PA 2XVGA 1XAUA 2OP4H 2OI9B 4P4RA 3VRIB 5IUCA 5F7DA 4G1MA 3FT2A 4K7PX 3D33A 2A3TA 1VDGA 4JFYA 4P4KA 1G7MA 1Z5LA 4CU7A 5E08L 4Z23A 1G94A 2A9NL 1QSEE 2NLJA 4OF7A 1B4LA 3VI4A 4WRLA 1VFMA 2OMXB 2QR0B 4JREC 5D7LA 3EF7A 3A6CH 1HZHL 4BGDA 3LKRA 2B4CH 2VERN 3WFHA 3W9EB 4BQ6A 5IB2B 1ITCA 2ZCKL 1PD6A 3L4ZA 5FYLE 1MREH 2N3JA 3WYRA 2J44A 2NR6A 3LPOA 5CCKL 3P02A 3WEBA 1JGEA 3V4PL 2OW7A 2B2XL 1HXKA 1DBMH 4A04A 3EYFA 2FX9L 1KGXA 3HZYB 3HC3L 1MFNA 4B3EA 1YNTA 1FSKC 2WLZA 4X5RA 1ZLSL 1FL6A 4KVCH 4U3HA 1USQA 1D5XB 2NUTB 4L4VE 2X2HA 3QHZH 4UZGA 5D2NA 5DJYA 3IDIA 4GAGL 1FYTD 5AOZA 5ILTL 4RWYL 3NABL 1XGUA 4OZ4A 5H4ZA 3KPLA 1UT9A 4LQFL 1YEKL 5JA8B 2VITB 4NPYB 5L2JB 4J4PD 3WTWA 3BQVA 2HVKB 4PSRA 2D3NA 2X4RA 1UOWA 3THML 1AXSA 3ERXA 4WSKA 4QXTA 3U4AA 1DBAH 1HQRB 3V7AE 3RFRA 1OWRM 5E8NB 5CBAB 5E5MB 4Z3IA 2KMWA 1H8OA 3E3QC 3WLBA 4LIQH 5E2TH 2AEOA 3GF8A 4YHZH 2VDPB 1N18A 1LMKA 3FQXB 2OJZL 3QUMB 4HH9B 2BRQA 1NFIA 4JEGB 4UQ2B 4PV8A 4XGZB 4FTVE 4RGNB 4LPVA 5E5RB 1AHWA 4PTTA 5E7BA 2I9LA 3FQYA 3H53A 5F97E 2Q8BH 2EE0A 2WN2A 3OBAA 4FG6D 1SOQA 1F6FB 1A64A 3ASNB 1QG3A 1EDHA 1QFWM 4LVOB 3VA6A 1BCIA 1GC1C 3DURB 1ZIBA 4K23L 1P7QB 4NQEE 2EYTA 3LKQA 4KPHH 1QYGH 4B5EA 1KWKA 3OZ9H 4UM8B 3RTQB 1GGBH 4G6FD 1ZK9A 4JJ5B 4XMPH 4UQBA 1FAKT 3ESPA 1X6NA 3LQZB 3QUGA 4LXFA 4PGCA 4NO0A 3MROB 4GKNB 5ELIA 3APCA 1F6LL 3DI3B 5LDSA 4JKLA 4PJCF 1A4BA 2FQEA 3UIZA 5I0ZA 1KIRA 4N90E 1ZHBB 5GRYA 3TN0A 1L9MA 5ICZB 3Q1EA 3WFEH 4TOYH 1BM3L 5F1OB 5JQ6L 4PLOB 1YJDC 5JA9A 2O61A 1S3KH 4HX1B 2Y5QA 4CDHA 1QLRB 1NFIB 4UQ2A 1XIWC 1ZT4B 2BVOB 3MRFA 5ABAA 3W9DB 3EFDL 1UZ6E 4DKAA 3D25A 3HHSB 2H8PA 1MCWM 4NNPL 4K3JL 2A9ML 1H3GA 3V0EA 1XF5A 1N7MH 4NZFA 2VLKB 2O6FA 4UWQB 4JLRB 3UO1H 5HYQA 4ZTPL 5FCUH 1FVCB 1CD1A 4G6KL 5IY5B 1MJ8L 3C09B 3QEHB 3B2PA 4WFHE 4XHQA 5DRZB 3BH9B 4K9EC 3GJEB 5HHVH 2OTWA 3CXFA 4OQ1A 1O9VA 1WUZA 1HJBC 3E38A 3OHMB 4LZKA 2X53A 5FUZH 3FT4B 2CIKB 4Z7UA 4X98B 1E9QA 2DIEA 1N67A 5FO8B 1SHMA 4ODVH 2QZ5A 4I8DA 3LQAC 1LGVA 4C57C 1G6RL 1PZBA 1CLOH 4KTEH 3ZHKA 4F3FA 1V7NH 4MJ6A 5D9SB 3FTUA 4FJZA 4KV5F 5HJ3A 1Z9SA 1D5ZB 5KZCB 3GHEH 5FYJE 3HJEA 2YAEA 1B0RA 4MD4A 5JLZB 1OT4A 2J2ZA 4HFWB 1JVOA 5I1DA 1VFBA 5E9NA 3KDPB 4S11A 2NQ3A 2AJZB 3NEXA 3NSDA 1DQJA 4N2MA 3CD4A 5D7EA 2OZNA 5DD0H 1R3KB 1KTDA 1HQRA 4P9HC 1BYNA 4ETQA 4G5ZL 5KVGH 4XC3H 2X7LA 2H0FA 1DBBL 3MUUA 4ODUA 4Y19D 3CHRA 3ZTCC 2P1YA 3NQIA 3I9AA 5DS1A 4F8PA 1O0VA 5BV7L 5I1LB 3LQAH 4Z7VE 4HJ0C 2XG4A 3MRPA 3HRZC 3CFBA 3OKMA 1KLUB 1ZDSA 1IC0A 2VXTH 1XF2B 4JK0D 2QSCH 4DNLA 1AR2A 3SYOA 5E00A 5HGAB 1L9OA 1NIAA 1J12A 4R96B 5JXED 3OHXB 1L3NA 3RWEA 2AP2A 4LVEA 4EZLA 2QQQA 1LEGB 4XH2B 1MF2H 4ZFGH 1NMBH 5C08A 4KK6D 1E43A 1GS8A 4X5XA 3ARBB 4D3CL 2IWGA 4QXGL 1RUKH 5C0GA 1AXTH 1NCJA 3L9EA 5D55A 4CADB 4NKIH 1FC1A 5IQOA 4M5ZL 1U30A 2YA0A 1SFDA 3RLSA 2A73A 4QLWA 2DDQL 1VEOA 2WXIA 5ESQA 2Z7YA 4H8VA 1OTUD 3W0WA 4KH2A 5IJKC 1HQ4A 1N5AB 3NFNB 3UERA 4XN5A 3A6BL 3VJ6A 1IX2A 4WSJA 3UTZB 3H7LA 2NQDA 2WAHA 1TTCA 4W9EC 5JQHC 2ZWKA 4FG4A 2RCSH 1SXAA 4U31A 1HH6A 3JWNE 4LAQH 4LARL 4AW7A 4XN8A 4IMKC 2VXQH 5J0BA 4JG0L 3OR7B 1JZDC 3QWQB 1HZKA 4I3SH 2WW8A 4U0QB 4AYSA 4ZW8A 3MKKA 1DFBL 1GPOH 4XE5B 3MU3A 3QFJE 2YS4A 1R24A 3C2AL 3DRQA 3QJZA 1BX2A 2XV6B 4N2FA 5DUBB 1DQVA 1LE9B 1J0JA 1PL3A 1PAMA 2OMNA 4OZ4B 3JWDC 4H13C 2BJMH 1GAFH 5EEXA 4N2EA 4W4OA 2VISA 4BJLA 2GUOA 3FT3B 4H88L 2ZUQC 3GSUB 5EIVA 2YD2A 2WJ7A 1IZKA 1YZZA 1MAJA 1LE5A 1U3YA 2ED9A 2XWEA 5E8EA 4U2ZA 3DX8A 4E9SA 1JZ2A 1H5BB 1TU2A 1WH0A 2VDRB 4NZUH 2ALAA 1NMCB 1H15B 2IANE 2FT8A 4HH9A 2DQTL 3L3IA 4GFTB 5DR5H 5I6NA 4JFED 4DH2A 5ISZB 5AAMC 5FOJA 1JZHA 4JHZA 3MV9A 1F3RB 4JZOA 3PHOB 4UM9B 4JL1A 5I1CL 2D7PA 3KLDA 3V0DA 5DSCA 3QI9B 3WFHB 2NTFB 1HEHC 4JE0A 1IM3B 4PSPA 1EO5A 3VFNA 2IH3A 4HJSA 3BEWA 1E5ZA 1FV1A 2A83A 4OUOA 2W0KA 4RDBA 5AZ2H 3VFRA 5L7XH 1KTDB 3DUSA 2ZAGA 1WAAA 4XPTH 3I6GB 1FFOB 3B2VH 4EIBA 4Q9RH 3FB6A 1KCRH 4F58L 5DD5L 5L6YL 2EVHA 3T2NL 2ZAHA 1FLRH 2WXJA 2VZ3A 4AK1A 3HHMA 1RJLA 1ASPA 1WV7T 2WQSA 1FO0H 4EOWH 1KXVC 4ZTEA 5D4HA 2K4AA 2WXNA 1NDTA 1CQKA 2Y1YA 3F84A 4PRPD 3SGDI 3WHXB 3K6DA 4LDEB 4A2MA 4XX5A 2FLBT 4U6XA 2AV7B 2F6AA 4XNYH 5CEYB 2WZ0A 3C2AH 4ZBJA 3SO3C 2WSPA 1MQKH 3EOBB 1IC5H 2XFGB 5HYFA 5EUOA 4WW2A 1EJFA 4L4TA 4ZUWB 2VN5A 4G83A 4N2DA 2Q3ZA 2AJVH 5C07A 1JNNH 1ULVA 2Q8AH 1KT2B 4CKQA 4JM2C 4PWIA 3NRFA 2WPGA 1QR1B 2WXQA 3RAJH 3QEGH 1WS8A 3G9VA 3U9UA 5CGMA 2EYSA 5GGRY 3BUDA 3SCMD 1JXJA 4BE6A 5E6ZA 4M3JA 2YMTA 2NY0B 2VYRE 3VXTA 5FOBB 4Z3JA 5IFAH 2X4PA 4HSQA 4KJPD 1EFQA 2I07B 3ZU8A 1S5IL 4EI6A 2AAVA 3RY6A 5FO8A 2D9QB 1FGVL 2JIXB 4XB8A 5KG9A 2NNRA 3VI3B 1HIML 1CE6B 4D3CH 2DBLL 4UT9L 3MJGX 4X6BA 1X5XA 3FUIA 3DX9A 3ENEA 1MW3A 3CH8A 1SOSA 3O6LH 2Y7MA 3DROA 1UM5H 3PAVA 1AP2A 1AZBA 5K93A 3E1ZA 3PP4L 3H9SE 3JWDH 3LRSB 2I24N 2IBBA 3NIGB 3PLYA 3WNPA 2EINB 2GUOB 5DZAA 1UZ8A 1YEGH 4NNPH 3PWJB 4UV4L 2BZCA 3UDWA 4P3DB 1X5GA 4AE0A 5KVMC 5BVPH 5TPWL 4M6ML 3HMXA 1L5GA 5AVSB 5ABDE 3IFLH 3VM5A 1R33A 2YRPA 1GGYA 2E47A 4MJHA 1MXGA 3HUJB 4PS4H 4NYLB 3QR2A 4ZFOL 4FQLH 4OGQC 1BZOA 1J9TA 3ATDA 4OCRL 4HKXA 1Q0YH 1S9XB 1KBPA 1T7XA 2Y7LA 4AJVA 3VWJD 5EBLB 4M61A 3INOA 2EEFA 4NENB 4OM0L 4AMKL 3EOTH 1YPZE 1A7NH 1ND0A 4IU3A 2I9TA 1J0HA 4G9DB 2ATKA 2AMGA 1FBIL 4ZMOA 4JDTL 4F15B 1QSED 1NMCC 2ZCHL 2DLHA 2I25N 3FB7A 4LSRL 1NCGA 3L1OL 1MJJB 2DM4A 2FQDA 3EYVA 4Q6YA 2GJPA 2UZIL 1KV3A 1OP3H 5I2IB 2A6JA 5IBUB 4KK8C 1MI5D 2ZOTA 3R4DA 4Y5YA 1D5IL 3S36H 1M1XB 4JFDE 4MAUL 4ORGB 3UBXA 2HPOA 1DR9A 3O6FC 5T1KB 4H44C 1SBSH 1W8EA 1OD7A 3GS4A 1JWSA 4AIZA 4EO5A 4WU5B 4POZC 2OMVA 4YDVA 1MN4A 3UABA 4ODHH 2EEXA 2EDRA 4KFMA 3ZZ1A 1KELH 5CP3H 4W4NA 3JTTA 1FCGA 3NP4A 3MNWB 4U0RB 1I53A 4XXWC 1SEQH 1DBAL 1O7DC 3M17B 1JPFB 2P42B 3FL7A 3WTXA 3ZE1F 1SJHA 2E8ZA 4WVRA 3NZ8A 1XCTB 1U8NA 1BQ5A 3PWPA 2VGLM 2A73B 1T1YB 4LCCB 4JFDB 1DQQB 4LPTA 4QOKB 2UXFA 3N40P 5CJQH 2JB5H 4OZIE 4YDJB 2BNUB 5TF1L 4DQOH 1BSIA 1G9HA 2CDGB 4Z7VB 5CP7B 5I71C 5J56B 5DDHB 4HFWA 5GGUB 1K4DA 1Q94B 2QVIA 1MHCB 2XWDA 2F58H 2AABL 2GHZA 2FIRT 2L7QA 4O00A 4XVTL 5FYKH 2HLAA 4HALA 1Z66A 4F7TA 1WRFA 4P3CL 4WDIA 2ZYHA 3AQDA 1BQUA 5D7JC 1DE4A 3BVUA 1KIUB 3GRBA 4CMHC 2NY0C 1NSNL 2PF6A 3MOAH 1ADWA 3GKWL 5DD6A 5IHLB 5CILH 3D0VB 1IILE 2GCYB 3U6RB 1B3IA 2VMFA 2YZ8A 3GMNA 1Z9PA 1EAPB 5ACMA 2CKBH 1SXCA 3HNVL 2AEQL 4ES8A 1MJ8H 4LEBA 3BEWB 4N5UA 3TT1L 3U6XS 5L8KB 1YEHL 1TNMA 3KEDA 4I48A 4RFNC 3IF1A 4HK0A 1IAIM 3I6GA 3UJJL 4WW1B 1UD3A 1G5GA 1EZVY 1HH6B 2XWXA 3ZE1B 3WFZA 1RLBA 1RUPL 3CFCH 2GW5A 1GRWA 4ONHA 1WO2A 4M56A 4QGTA 2X28A 3AG1B 3QXUA 4TSAH 3TASA 4ZO9A 3TPUB 1SJEA 3O2DA 3PXLA 2WUCH 4TUJA 4MNQA 4LRNL 1FIGH 3MV9B 3KWUA 3LS4H 2JCCE 3EADA 2WBWB 2UZXB 4LGSB 1HYSD 5BZDA 4XBMA 5IVXA 1T3FA 4NCC1 2JQMA 1VLXA 1PZDA 1UB5B 3TO4D 1VIWA 5AB9A 3QHFH 4PBXA 5KS9E 4Z7QB 1OAYH 4M5YH 4QTHB 1N0XL 3BH9A 2FYYA 1ACCA 2XXGA 1SUHA 4U4BA 5B3JF 1ZLEA 4HWUA 3BCFA 3VWKB 1U2CA 1UM5L 4IGBD 1DBML 1FYTB 2QFPA 4R6UA 2IH8A 4XOAA 2NZ9D 4LSPL 5EZIL 3V4VB 3VGDA 2HCZX 4LCVA 3B7YA 4C56B 2ESVB 5J8OA 2XXMB 7TAAA 3V0HA 1QTYT 2DLFL 5LQBL 3SYPA 5D7KD 1Z3RA 2PYFA 4HFUH 1JYVA 1H3VA 1HC1A 2B4CL 2DJMA 4PLJD 2W07A 3C2SA 5FB8B 1PLCA 1S7TB 3WAKA 3TYFA 4MXVE 3S34L 5F3HB 4KJPC 1WGVA 2EVFA 3TN0B 4AZUA 3FCGA 3UDWC 4Z7WB 3BAEH 4ETQB 2Z4QA 3FOLB 1BMZA 1OAZL 2Y07L 5D7IE 4GW5B 1FZKA 4IBYA 5AFAA 1YYML 1LK3H 3II1A 4NQTA 1QR1A 4Q2ZB 4YSCA 3QPKA 2HH0L 2QV2A 2BFVH 2WCPA 1ZV9A 4PVMA 4TPRL 5E6UB 2OMUB 1EQWA 1U0QA 3DUHA 4G7QB 3RVUC 2CCWA 4PJ9A 4DVBA 2ENPA 2OMTA 5LNDA 2FWLB 4NN7B 2CXGA 2E46A 2ZUUA 2C1OB 1NCBH 5LCVH 3MCG1 5JR1H 5E24E 3VXME 5DZOA 5FYKE 2VLRD 2XI9A 4H8WH 4R4FL 4XH2A 4Y9GA 3TNMB 3QQNA 4KO5A 4FFZH 2CLZA 4YEEA 1BZEA 3N1QC 4PJ8D 3FB5B 2XQYK 3U2IA 4L8DA 4P2QE 4WHYH 5DJCB 3VSQA 1RZFH 3HG1D 3I2CL 3TCLB 2IWKA 3L5XH 3QDJE 4TTGA 2DF3A 1F4YH 3SQRA 1TSHA 4JREB 1BA9A 2NY5C 1FL5A 4G7YH 3DHMA 2NY4D 1MAMH 3QAZC 3HZKA 3OG6B 3MZTA 3ROLB 1J88A 3IU4L 3OAUH 1G6RB 4HQQH 5IQNA 2X70A 1UWXK 3BP7A 1TQCC 4FZ8H 1DBKH 2VSKB 3APFA 2VSDA 5BO1L 3ZRSA 1COBA 4QYOA 3GD1C 2AV1B 3BWUF 3D18B 1E4KA 1WHPA 1P1ZB 4DHLA 5LDUA 5DR5L 3Q8AA 1I1FA 3D4YA 4JPSA 2J43A 4FADA 5I1IL 5F7UA 1B88A 4WF7A 5LGJB 5EBGA 4EEEA 2DQIH 5ICYA 1PKQE 3RI5K 4OV5A 1T7WA 4LK4A 4QYAA 4G8EB 5I18L 3LN4A 3EG9B 2FH8A 4R8WH 2VMJA 3TO4B 1BVOA 4AY0A 1IAII 2G0LA 3RDJA 1IBBA 4XPGH 3SBWC 4GEIA 4I3GA 4J39A 3FBQA 1U36A 5C97A 1XT5A 2ZNWA 4MCNA 2L7UA 25C8L 4KK5D 2J1KA 1IGFH 2G3MA 4QWWC 4FX5A 3HI5H 1L7TL 5H2BA 4P49A 1U8OA 3HZVB 4XN2A 2OS7A 2QGCA 3D85D 3SDXE 1XH0A 3CFNA 4K3EL 1QABA 2QPSA 3MOBH 5BZWA 2Z35A 2YWZA 2BSBA 4KKLC 3WKPA 3K6IA 1PG7L 4IQHA 5D7HA 3ROOA 3NCJH 4JRXA 1CXIA 1O6VA 2LLLA 4UTAH 5IESL 3F12A 4ZUTA 4KO9A 1FNEA 1UA6L 5LGHL 1HH9B 3SN6N 5CLYA 1W0WA 3MBXL 3UTOA 3RYMA 1E9PB 1JD7A 3U2SB 5AZUA 4OZHF 4ADJA 2PCPB 3ZKMC 5I2IA 4RZCA 3FUNA 3QXAB 4QRPD 1MW2A 4KOCA 3ILDA 1CXKA 3I75A 4CSPA 1QUNB 1WT5A 2OL3H 2ZX5A 3ES6A 4NJAH 5D4JA 1T1WB 4FL4B 4Y19A 4EI5B 4YUEL 4OGAD 2EXYD 2PTUA 3RVVC 5GGQH 2YUWA 1NIFA 4GOSA 3BP5A 5E1AA 4ZUVA 3ZYJA 1NBVL 4GKSB 1CXFA 7PAZA 1RURH 3JYBA 1ZPUA 2VDPL 3ABZA 5D7JB 5IHHA 5F1SA 2DEXX 3EYSL 3PFQA 2AVFA 2H1PH 4YSSA 3VFUA 1GZQA 3RFZB 4JPQA 1WBZA 4R2GC 1R34A 2ZCLL 4JAMB 3CIAA 3ZXAC 1S8DB 1U58A 3C6LD 4W9GC 2OK0H 3US0A 3HCVB 1GYAA 5D70H 4YLCA 4DN3L 5FIEA 1PJWA 4W81A 1QHPA 1XB3A 3BKYH 4PHZA 5CFAA 5HGDA 4Q89A 3DTXB 5JOPE 4ONOA 2CNYA 3QJFB 4UIMA 3I6KB 4I88A 1RUMH 4YPJA 2DJUA 3X13B 4M7LT 4GH7B 3QQDB 4HPOL 2R29L 4WW2C 1F90H 3LEXB 5ACZB 3VU2A 5J11C 4LSVL 1KLUA 1MPAL 1IGYA 4Z95H 2ZSVA 3T77A 5HI3C 4J28A 1BMWA 2BNRE 3IXTB 1T6BX 1U4EA 2WNXA 1SYSB 2WUBH 1JPEA 1LLAA 1VSCA 2O5NA 3O6FB 4N2AA 1E3ZA 5DZPA 3CDZA 1WZKA 4RMWA 3RU8L 2EEAA 1F90L 3T65B 2X9YA 3QC5X 3L3KA 2AQRA 4F8NA 2XN9B 1F02I 2OXGB 4LCWE 3LZOA 2YFNA 5FM5O 3KS0J 4AIXA 3G7TA 4ZK8A 2J5LB 1U8MB 4AVHA 3MRCA 3QO1A 3OWRA 3LKSA 2WAQA 4ZNCD 2R29A 4FXGA 4K55A 4JRFA 2E8YA 2WXKA 2R51A 1NKGA 4XP4H 2QR0A 2WTRA 2LAGB 2VZOA 3SDAA 1EZVX 1QP1A 4X50A 3GMNB 2IAAC 5KYUB 1TJHH 5FB8A 3DSNB 1J8KA 4PWGA 2OZ4L 1MCRA 1OB0A 4V1DB 5AW4B 2COQA 4JBSA 3L5WB 2CMRH 2VLKD 4Q58C 3UACA 1TYJA 3BEVB 3L4XA 4X7FC 5DJAA 3TBVA 3HKFA 3ZLQC 3MRNA 4IJ3C 1QWUA 5F1IB 1CDBA 4FOMA 5TQ0L 1G7QB 3ES6B 3VD7A 3T1WA 2R56L 2EDBA 2IOOA 3WL9A 4O2CA 4TSCL 4I89A 2HFGH 4P5TD 5SWSB 5C92A 1ROCA 2ZJSL 3DOSB 3K72A 5IVXB 2IO5A 1YEFH 4NKMB 1BQSA 2Y6SC 3MRBB 4L48A 2BCMA 2CSPA 3L95A 1JTPA 3WG7B 3IVKB 5FS5A 3ME0A 4WUUA 4FL4C 3TN0C 1CC3A 3SPVA 2AAAA 1UD8A 1SF5A 4NX0A 4ZSOB 1J8HA 4HAKA 4KNTA 1KPRA 4MDJB 1IMHC 3DX0A 2UYLA 1NMAL 4GLRI 3W56A 3V6ZA 4L4VB 4JO1L 4C56A 2JK5B 3NCFB 4R4BA 2R0KH 2PXYD 1HTYA 4K71B 2CR6A 2Y2WA 1ILUA 3UYPB 4PJCB 5E1HB 4J23A 3SD5A 4XVSH 4M6AA 2AK4A 1Y0LA 3VSUA 3ZY7A 3UZVA 3ARFA 5KZCD 1SVZA 3KLLA 2W92A 2LR4A 3DVNA 3KPOB 4KRPD 4NB7A 4CMHB 4NI6A 1CFVH 3B9AA 4KV5E 5DMKB 1QEWB 5C8JB 1GGIH 3GC3A 3DX4A 3VRLE 4LCIH 1LO0H 1EO7A 2ATKB 3BPNC 3QRFM 1UM6H 3TCXA 3QUZD 4I9WD 5ACZA 3WN5C 2VZUA 3RG1C 5TF0A 3UPCA 3UBGA 1SNRA 1BZ9A 4I0KA 4B27A 1EBAA 4JFFA 5ECGA 2GABA 3C60C 3IWVA 3T2QA 4LVOC 1CLYL 3U0PA 4XMTA 1KOAA 2IOMA 2ZONA 1A6ZA 2YPLB 2WUBL 1S7SA 2DZEA 1TZIA 2P5WB 3DDGA 3ML8A 3OWEA 4IHOA 1KB9J 4M6OL 5GQBA 4PJ6A 1Y1DA 3RILA 1F8TH 2VZVA 5AAPA 1QVOA 3ZBMA 4QHNB 2AGJL 1IEBB 4P9HL 5E8PB 2A9NH 3E6FB 2WLIB 2DD8L 1G7MB 2PUQT 3GMMB 3ARGA 5T33L 1EJOL 3N50A 3TF7C 2WP3O 3ALPA 4X5WA 4XBEH 2X05A 4NIKB 4GI6A 3ALXA 1ZXKA 2OP4L 1B0RB 1TZAA 3BN3B 1O5DT 1XXDC 3NJNA 4J12A 3WV0A 5C6PB 4OJFL 1LP9E 5LXGL 2UZPA 3EO0B 1OP3K 4FG6C 4S1SH 4PD4K 3CH1A 3QBTB 2ZCLH 4MJIB 3ZDZB 3C6SA 2VDKB 3P11L 4IIQB 5GS3A 3FF7A 1OGAE 4G1EA 3EJZC 3E6HA 1PKOA 1TG8A 3V10A 3DVGB 3KZ8A 1KB5L 1J48A 3I02B 3LKNA 4EN3D 3EO9L 4RZCB 5LCVL 2Q86B 2QDWA 3WTTA 3T4AA 3PNWB 1YLBB 3G5ZA 2OCCB 1F6AA 2CKBB 2C7UB 4JGUA 5K5YA 1FVEB 1R47A 2VXSL 1NFKA 1MIML 1ZSHA 2YO3A 3MCYA 3QIUA 4PBWD 1IAIH 4FKKA 5GGQL 3B37A 4PJFF 4XVOA 1EEYA 1FL3B 1ADQA 2AJSL 1OXYA 3RL1A 4ZX3A 5LGKA 1LDPH 4BQCA 3TBBA 1AYOA 1T0OA 5F3HA 5SX5H 3RUGA 3BAEL 2F61A 5EBMB 1UXMA 1TETH 5CWSA 5D1QA 4Z18A 2NSQA 2GUYA 3N41B 5MEPB 2FH6A 5H35B 4EUPA 5CJXC 2IV8A 3ABMB 1AQKH 3RNQB 3UJIL 1WYJA 1MIEL 4Y2OA 3P30L 1MFEH 2WYHA 4ZAKC 1QUNA 2IADA 3ZSSA 5IM7A 3RWHA 5J13C 3MFFA 3UO8B 4E41E 3GBNL 1K5WA 1K5NB 2ERJB 4GSUA 2BMKB 3REWA 1HAWA 5K9KA 4N6RA 1RZFL 3QUYC 4HS3A 1WBXA 4YAQB 5EUKB 3GBDA 4HIJB 3MGTA 1XF3A 4NM8H 5GS1A 2BWIA 2H32B 4Y4FD 3BLPX 4MKTA 3B2XA 1N0XH 2VB5A 4PRDA 3GXNA 3MCKB 2J6WA 3CMOH 1IIIA 4K94C 1MJ7L 1GZQB 4M8UA 1A3QA 5ERWA 3TFKC 1BREA 1CO1A 5AW1B 1HQ4B 1N5AA 3NFNA 1RURL 4LT7A 1EUUA 4KROD 1IKFH 4OKDA 3DGDA 4GXFA 4RFOH 3QQXA 4ZRGA 1NOLA 1YECH 4NQVA 2WLMA 1R3JB 5AVRB 1IJ9A 4R4NC 4PJDF 5F9WB 5I16A 1ZRUA 1UA7A 1INQB 4NJAL 1XBRA 1AGDB 1JHLL 4WZ9A 2X88A 1NEUA 4K3DH 2BIPA 1A47A 3BSZL 4NZRL 1GZPB 2WBXA 3N5AA 4NQCD 5T3ZE 4FHBD 4IDJH 5TD4A 2YBRB 3WJJC 3K2KA 4KY2A 5DTFA 4P06A 3WS3B 5MENA 1IAOB 1AACA 1JNLL 1WHOA 4OLVL 2ATAA 1FN4A 1YUHA 4LLQA 3WY3A 4BK5A 3GM8A 3PCYA 2AV7A 2X6MA 3D50A 1I1CA 1FG2B 3IDNB 3LDBC 3O2DH 2F5AH 4AI7A 1RY7B 1YNTB 3QB7C 1ET8A 5HYSB 3MJWA 3OKKB 4P46D 1NFDF 2HRPH 4XNMA 1E8WA 1KXTB 3ARFD 5T1MA 3NSXA 4XVTH 5FYKL 3N55A 3N1MC 2QGBA 3LKSB 4MSWA 2EE9A 1B6UA 3N1FC 2KKQA 4H5SA 4A63A 3AS0A 5JIDA 5DA0B 1F4XH 5ESVA 3MLSL 5TF1H 4S1QH 1A1MA 3MJ8B 4PJ5E 5HVHB 5DT1L 4POYA 2YR3A 5I73C 2Z31D 2DLEA 3D39A 3MDJA 5FUCC 3ZKSD 1JK8A 4IBUA 3JVGA 4NDMA 1J8HE 4U1HA 5DMGC 4ZMPA 5KVEE 2VERA 4QR7A 2E86A 4GRLD 3WNIA 4G6FB 3WNJA 3VG0H 2XZQL 4KY1L 2DWEB 1BZ9B 4NN6C 5B8CB 4OCYL 1SUJA 4CC4C 2XNAB 4MAYA 3OVUB 3KPQA 1P6AB 1J9CT 4HA1A 2HWZL 1IC4L 2X2JA 3HOGA 4HWBL 1P7BA 2R1WA 1M9SA 1JL8A 1RZKH 2WWOA 3ABKB 3U1SH 1IFGA 4AIOA 1GS6X 3EJUA 5TFSL 4L8SC 2F5BL 2IBZY 3BIKB 3LV3A 5IBTH 4G8IB 4PVLA 4M7KL 3Q6FB 5B4MC 2DQ6A 5FYJL 2A83B 1QVOB 1NCIA 1F1GA 4PB0H 2C4XA 5EU6A 3G6AB 3RNKA 4PPTA 3TEWA 2Y3AA 3LX9A 4DZBA 3ZR6A 4W9KC 1INDL 2ZCHH 1JNJA 3FQNA 1MOEA 5IROC 4H25B 4XPAH 5I0DA 4DK3A 3MRRA 1I7TB 5JOPD 4MRCA 3DECA 4F37K 4LAJH 1QO3B 3D7PA 4BSVA 2W88A 4IRSD 5GJTH 3SDXB 5C0RH 3NA9H 1JPTH 4E0RB 2EYRA 5EA0L 4RMUA 4KZEL 3V5DA 5I6XC 3GSVA 1IFHH 4W9DC 2JB5L 5EV7A 2WWKO 1RK1A 4D8OA 1CBVL 4FQHA 5B39G 1KJVB 4ZAKA 3IN2A 1E90A 2DOCA 2R0WL 3KLSA 3IFNL 1CD0A 5D6DA 3VXUD 2V2XA 4ZTOH 1W91A 2AQTA 2R23B 1C1EH 2NNFA 1DEEA 2K8QA 3CK0L 3HN8A 1RUPH 2IPTL 3M86A 2OMYA 3CFQA 1R4XA 3PHAA 2NXZD 2DLGA 1GKOA 2LFEA 2GY5A 1U8LB 5IOPA 3BSHA 2WXMA 1JFQL 3A4AA 4IRJD 1RLWA 4J2XA 5HTSA 5IFAL 3QEQD 1QRND 1SLUA 3N9GH 2BSSA 5AL0A 4NENA 3LZFL 3CMGA 5I6LA 1A4JA 3T3MB 2FATL 3MNDA 3O0RL 4XZ4A 1A7RH 3CFCL 5L2KE 3ARPA 2JTYA 4OFYA 4XAKD 4OZGA 3DTDA 5EZLB 5K1JA 4HEMA 5IT2H 1KJ3H 2JI3A 2XOTA 5I1JL 2UY6A 2FX8L 5BOJA 5HYIA 1XV8A 2A9DA 3FOMA 1E4WL 4QHNA 1D6VH 1LO4H 5FDWB 1A9EB 2EICA 3PWPB 5TQ2H 1OTSC 1P7KA 3W0WD 3B1UA 1ZWIA 3I6LE 3Q0HA 4FXGB 1A9BA 2RALA 2W91A 3FQTA 3AQYA 2F7RA 1AOZA 3QPXH 3LRSA 3MBEB 2R69H 3NZHL 2CRMA 1A6UH 2D03L 4S2SB 4AE1A 4KHXH 3NEEA 5EIIA 1NBYB 1NC2D 4GW4B 5FW8A 4KGJA 4K9EH 1QKZH 3ARRA 4OZFB 1N10A 2J8UA 3BPLB 1MQKL 4LP8A 3WMPA 2CJTA 3CSYA 2VL5A 3ULUD 5K33A 3X13A 1S9YA 5CJQL 3MODH 1RJLB 4P48A 3STBA 4PJ9B 3TVMC 3CX5K 4JS7A 1I3UA 4RGMC 2HP4A 3FDWA 4HWEL 4UANA 1L9TA 3UMNA 3D3VD 4BKLB 3FONB 2P43B 3RZCD 5SWZA 3ZTNL 2QLVB 2EIZB 1RU9L 1I1AD 1RVFH 2M1KA 2VH5H 4HXAH 4A68A 3WHE1 4XMZA 1VHPA 2TSBA 2X4SA 2AZAA 3L3KB 2B59A 5HDBF 4LE8A 5D5MA 1H6TA 3HS9A 3MV11 3DVGA 1NDGA 1T04A 1RD6A 1OAKL 5ERWB 4YSOA 4OFYD 3RWDB 4ALAL 4L2YA 4PJCE 5KANG 1M1XA 4ORGA 3L3IB 1D5IH 4P0DA 3S36L 4Z7UE 3E8VA 2Q87A 1WIUA 1G6VK 4NHUA 4WFGE 4AIZB 3MI6A 3EJSA 1PZCA 4FG2A 4OSUL 2F8VA 4CA4A 2ZQKA 2YEQA 3OD3A 3WIHA 1R5VB 2J8HA 4KO7A 2DQEL 3HS8A 2DM7A 2X4OA 4S1DC 3SKMB 3BWAA 4Y4FC 1XD1A 5C2UB 4IKLA 1ZHLB 5LO7A 4P2QA 5DC9B 4XNXH 1R75A 4JANB 1BM7A 4H88H 4PCTA 5HY9B 4Y5VC 1XCQB 3MRMB 1MFAL 5IW1B 5HBBA 3WO3B 4X9HA 4WWKD 3G5WA 4M1CC 5DEZA 3AAZA 3LRLA 2BZDA 1SVBA 4DW2L 4I0PD 1CF8L 2DKUA 3TZVC 4BFKA 1SVCP 4S1DD 2BCKB 5JDJA 1BYOA 4LSSL 2VO8A 3V8CA 4C54A 4P46B 3HG1B 2K6WA 4ZS7H 5SX5K 3V4PB 3HJ0A 4K2UL 3BDBA 3QH3B 2JKNA 3CVHB 4YIQA 5EN3A 5GRVL 5KJRL 3ME0B 2R69A 3FUHA 3V4VA 3O9WB 1CFBA 3LD8C 1PBYA 4MMZB 4JRYA 1PLGL 4LASH 4RX4A 3ILQD 3L7FA 2QSVA 1CGVA 5AZ2L 1DSFL 4XPHL 2OULB 2JLLA 3CPLA 3ZDXE 1AR1B 1MFCH 3N91A 3TU6A 4AEFA 1TVBA 1CE1H 3FB8A 1T21A 4UU9B 4V2CB 2F19L 1IGCL 3DPDA 1QLFA 1ZAGA 4F2MB 2YGPA 2DTMH 3CH1B 4XCYB 1C8QA 3V95A 3ZZSA 3W0WE 1FO0A 1IBZA 3F5WA 3FSWA 2Y3NA 4X8JA 5J6SA 2QVTA 3ECBB 4HV8A 1FGNL 2MOVA 1UUNA 2XZAH 3EYFB 2P8MA 4Y5XA 3V4VL 1ZMYA 3QK0A 1CXLA 2VNCA 3SDXA 1QA9A 2GFBB 3KW7A 5FHAH 1U3HD 1ZKAA 5LN8A 2VXTL 3UAJA 2R4SH 3KLAB 5DK2B 4IGBA 3FFCB 3ZTDC 3P4OA 2AJUL 2V2WA 1X5LA 1A0QL 3D51A 3SJVB 4RRPG 5F8QC 2DI7A 4A6YA 5BS0B 1JNNL 4PY7A 1Y07A 1S7QA 1YMHB 3KL5A 4QY8B 4EKJA 4HOZA 3WMSA 1SLWA 3BQUB 3OMNB 1T2JA 2F18A 2NW2A 4O4YL 4YGVA 4B95C 4DP8X 3O2WL 4F2ME 5E03A 2P3YA 2KDYA 2WBJA 2X2YA 3O2WH 2IGLA 4ESKA 2PTVA 3AS3A 4FA7B 1MHHA 3IGAB 3J8F7 1CGSH 3UTTD 4U3SB 4AMXA 2CR0A 3TFBA 1NAMA 4FLQA 3CUPB 3SODB 2DQEH 1D5MA 3EHBC 2XKNA 1T89A 2IGFH 5DRWA 4XCFL 4NJ9L 4HS6A 1X6LA 4G71B 3LZNA 4A7GA 1MCOH 1DVTA 1KIQB 3TBYB 2G9HB 4YDZA 4X9YA 4KHTL 3HS0B 4N22A 4NM4H 4ZD3L 4DIXA 1NC4A 4FLRA 3RWIA 5KBPA 4J3XA 4JKKA 3BJLA 5CP7A 3T1FB 1J1XH 4JUSA 1RK0A 4XOBA 4F7PB 4XPHH 4EZMA 2WLLB 4NKOA 3ZE0B 1SYVB 5IQLA 1W0VA 1E3XA 2X89D 1MCOL 3BFWA 3ORJA 4TVSa 4YMPA 4X5LA 4XVJH 1HSBA 3AROA 3BGMB 1CI5A 2D4FA 1TEFA 1SJMA 2LT9A 5E56A 1XHHA 3QZLA 1BZQK 1J1XL 1FNHA 4XMLL 4BXSV 1V27A 1FFPA 5I1CH 5D7LD 3BZ4B 4UCFA 2ADFL 4G6MH 1MVUB 3MREA 1T5XB 3JV4A 4FQ2L 3NSFA 1VFBB 3HC0B 1R5WB 5JYMA 4X2UA 1FCCA 2ZG1A 4YDLB 1HK6A 2DQTH 3QDME 4O4YH 4AZ8A 5EEWA 4UILH 1HS6A 2ODHA 3AUVA 2PP8A 4NQSB 1J5DA 3HUJA 3GLAA 3MXVL 2YA1A 1DEDA 3WFCL 3DHPA 5FHBL 5AYUH 4IBWA 4JFPA 1EERB 4Z7IA 3DSFH 3JZYA 4L29B 4LKXA 2J3SA 4P04A 2VXQL 5DD0L 4UNIA 2DV6A 2VLJE 3GSRA 4YZFF 3K8LA 3NAAL 4A2LA 2R83A 5I8KH 2K70A 5DD5H 4CSTA 1E5CA 3MFGB 2O72A 3T0DA 2PETA 3EJTA 1PIFA 3L4WA 1TQCB 4Q52A 4MCMA 4UV7L 1BF5A 3KPRD 3BP4A 2D3VA 3IAPA 1ODUA 5G4OA 2FJHA 3OXRB 3RWEB 5C6TH 2FUTA 4U6TA 1XH1A 1CLOL 1QYGL 2P49B 1I1YA 4RFEB 5CD5C 1TLKA 3GYRA 1KC5L 3BUBA 1KJVA 4KWUA 1A14L 3ISRA 5BS0D 2JH2A 3B9EA 3MGAA 3FOMB 1NDGB 1SRDA 3PWVA 3QORD 1OALA 4P3WA 1FI8C 1AD0B 3FRPG 3B2MA 3DV4A 1HHKA 3VXSD 2MPVA 3W0WB 2GSIB 5GS0D 1JS4A 2ITFA 1G7IA 3E1F1 5CCGE 2CUHA 1MY7A 2KC0A 4PRNA 3DOSA 1UH2A 4TL4A 4QF1B 5IMKB 3H6AA 5C0BE 1QFHA 5ANMB 4Q14A 3S96B 4BWTA 4X6EA 1K8IB 5ISZD 2PYEA 4YVNA 2YPVL 3SKMA 3FQWA 1HWGB 1DCLA 3HS0C 1PTZA 2G9KA 5CZVH 2VDQL 3MACH 4UOW0 5AW7B 3RGVD 1P5UC 5IJKA 2K6YA 5ADOH 4IRJB 4AYID 2FO1A 3GXIA 4LDCA 1L7IH 3AY2A 4Y5XC 1LVEA 1UVQB 3T0WA 3BIAX 5BNXD 4ODWA 5J3HC 3RKDC 3BRGC 4AGNA 2G9HA 4C4KO 1Q1JH 1EAQA 3NCWA 1KTKE 2BS71 2YBRA 4M1GH 4LL9A 3BXNB 1KGJA 1TXKA 1OOAA 1XF4B 1XO8A 2D31A 3GHEL 3HN5A 3PWUA 4HGWB 4MNGA 4DTGH 5I23A 5JZ7C 3WAJA 4TQHA 2AMUA 3VFSB 2E6QA 4Y9CA 4A37A 2YXWA 4LP4A 4YHPB 5IMOB 3M1CA 4Y9EA 4CVWA 2E9WA 2VDNB 3AG2B 4I87A 4U1MB 1W72B 2QVKA 4MD5B 3U9PH 1W72L 3MLVL 2WMPB 5LHDA 5A2FA 1L6PA 5HPMA 1F11B 2UXTA 3VXPA 1ZLVK 2G3ZA 1G6RH 2VH5L 4JCLA 4EN3A 1A6ZB 4LLDB 2BSDA 4R7VA 1P5UA 3LMJH 1PZAA 2EE6A 5BVJA 1SDYA 5D1ZD 5EU3B 4IBVA 4AX3A 3OHXA 1X5Z