4I8GA

Bovine trypsin at 0.8 resolution
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title On the reproducibility of protein crystal structures: five atomic resolution structures of trypsin.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Cationic trypsin
total genus 62
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2012-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4i8gA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4i8gA02
3ZVFA 5TCAA 3QLPH 3NWUA 2OUAA 1BBRK 1DITH 3SJIA 1LCYA 1AUTC 2Q1JA 4ABDA 1TPOA 3KQBA 3GY4A 3MU1A 1CHOF 1OWIA 3F1SB 1EJNA 1GBAA 3KQCA 2Y6TA 5DP7A 3Q3YA 1O2RA 3RXJA 1P0SH 1O2KA 2DUCA 3QGNB 1DSTA 3DUXH 4CHAB 4E05H 1TPPA 1ELBA 5J4QA 1PFXC 3AW1A 4ZKNU 1ZRBA 2BHGA 5DP5A 3SQHE 2IN2A 3SI4H 1ZHRA 3HGPA 2G4UA 1WTHD 4U32A 2ZU1A 3RM0H 6LPRA 3S9BA 3EDXB 1DICA 1AUJA 1CE5A 2A4QA 1QQ4A 4ASHA 2A4OA 2FYQA 1SSXA 2BOHB 3TJUA 1SLXB 1C5MD 2Z9LA 2VWNA 4ABJA 1GGDB 3URDA 2FI4E 4K1EA 3BEFB 1GPZA 1P2KA 3FP7E 2ZTXA 1M9UA 2GZ8A 2B7DH 5IDKA 2ZGCA 5SGAE 3RLYH 1F0UA 1LO6A 2Y80A 3GCNA 1FAKH 3PTNA 4FUBA 1UK4A 4IBLH 2WPIS 1Y3XA 3E91A 3V7TA 5GWZA 1KY9A 1MD8A 1W11U 4VGCB 4Q7YA 4TWYA 1GMHG 3UREA 1GHAG 1GI5A 5AF9H 1QA7A 1PPZA 2Y5HA 1W12U 1JIMA 4ISHH 1LDTT 3B23B 4IMZA 1TMTH 3UR6A 4TPYA 2J95A 3AAVA 2SGEE 4CR9A 5GCHG 1Y5UT 4AX9H 1C4Y2 1P11E 1ZTJA 1EP5A 2HNTC 1RTLA 3SUDA 2VWOA 1G3CA 4B2BA 1S85A 1NRSH 1O3JA 2FXRA 3BTQE 2P16A 4ABBA 2KAIB 2J34A 1CT0E 3MO3A 1HAVB 4ZKSU 1SGEE 1IQJA 5G4BA 1O36A 1C4U2 1NRRH 3FP6E 1WUNH 1GCTB 3BG8A 4NIWA 5C3NA 2OC1A 5DJ7A 1AMHA 1KXEA 1O3GA 1O39A 4OGXA 1GHBG 2Z3EA 3UQOA 1VCWA 1MZDA 1TPAE 1O3PB 1QR3E 5DG6A 3LGUA 3P8OA 1ARCA 3PWCA 5GCHF 1OKXA 3SORA 4AYVB 2H9HA 1NRNH 2FOCA 3GDVA 4Y10E 3GCOA 3DFJA 2G51A 3F6UH 3MU8A 4UFEH 1W8BH 1CU1A 4K1TA 1C5LH 5EPYA 2XWAA 3EGKH 2HPQH 2GX4A 4JZFH 4K8BA 1MUEB 1EB2A 2QCYA 1IQNA 2PSXA 3GICB 4MVNA 1S82A 3PO1C 4D76A 5FX5A 4GHQA 2RG3A 4A1TA 1QL7A 1T8LA 2ZPRA 2BY9X 4QT8C 4HI3A 1QRZA 1SMFE 3MTYA 3A7XA 2STAE 3MNCA 3ODFA 4AN7A 5F8ZA 1ORFA 1TONA 4NA8A 1O2QA 3FVFB 1ZMNA 3O8DA 2FP7B 1C2DA 1BZXE 2PKSC 3MYWA 3PROA 3ATWA 1GHVH 5JBAS 2D26C 3ZZ3A 4TY7A 4HFPB 2FOBA 1HBTH 2PHBA 1QA0A 1TQ7B 2G55A 3A80A 1YYY1 2BLQA 4UFFH 2AYWA 1DWCH 3U8OH 1QHRB 1BRBE 3M5NA 5FPTA 2SNVA 3DFLA 3ATLA 3HPTB 1V6DA 4ISOA 2A4GA 2XBYA 1NPMA 4UD9H 1KXAA 3LT3A 1KXBA 1ZSLA 1BTYA 2ZDNA 4GHTA 1OP2A 1V2NT 3VB3A 3JZ1B 1P3EA 1SQAA 1TBRH 2C3SA 3PLBA 2CGAA 1QL8A 4RKJB 2SNWA 2BQWB 4NWLA 2FS8A 3UPEA 2HLCA 1MTWA 6GCHF 3M36A 1IHSH 2QYIA 2H1UA 1TABE 2F83A 2AH4X 2J2UA 1J9CH 3SJ8A 3SGQE 4NCYA 1A46H 2NWNA 1K22H 1LHEH 2W7UA 1TGTA 2EI8A 4NWKA 2ZNKH 4WXVA 1Y3VA 1Z71A 3RXUA 4RN6A 1BTUA 1O3OA 2GD4B 3QDZB 2I6QA 5A8ZA 3SUFA 2HRVA 1D6RA 1ETTH 1QRWA 2F91A 2ZPQA 3MHWU 4ZKRU 1P05A 2WUCA 5FBEA 5T6DA 3SNAA 1EP6A 3T2NA 1O3NA 1T32A 2QN5T 1DWDH 1GJ6A 1RIWC 2XW9A 3M5LA 4ISLA 2Z9GA 1RFNA 4ZXXH 2ZHQH 3SGBE 3P95A 4K2YA 4MDSA 3ATKA 5GIBA 3D65E 1TRMA 3A84A 3RMLH 2IOTA 3TLOA 4FUHA 1O5GH 3SU2A 1C2KA 3ZVBA 2H2ZA 2BXUH 1P12E 4RKOB 4D9RA 1BRCE 5E2OA 3TJNA 3KIDU 1HAVA 3LGIA 1GMHF 1H8IH 3TVJB 1ZGVA 3RMMH 3LOXA 1ZPBA 2FLBH 3FAOA 2GCHG 1YCPK 2DE9A 2ZGXH 4B2CA 2QXHA 4LOYH 4BTIB 1VJAU 5L2YH 3VGCB 4THNH 7GCHF 3BN9A 4JZDH 1GL0E 1TNHA 2PKAB 1SOTA 1P03A 1TNJA 1F5LA 4Y0YE 2W5EA 3SJKA 2CMYA 4B76A 2ZWLH 2GMTC 2J9NA 2ZC9H 2FTLE 1F0RA 1ELGA 1MCVA 2JH5D 1XXDA 2BDIA 2FOEA 3GY8A 1MQ5A 1BUIA 3U9AH 1C1UH 3RLWH 3RDZA 3VB6A 2H5DA 1GG6B 1GI4A 1Z1JA 3PMHB 2ZDMA 2Y7XA 1GMCG 1BTZA 2G4TA 4NA9H 5L2ZH 1BMNH 4X2YA 1EKBB 4KKDA 1THPB 2ZDLA 2EA3A 1FDPA 3B9FH 5C5OA 1HPGA 2OLGA 1D3DB 2PV9B 1C2JA 1OS8A 1WCZA 3MU4A 1C2IA 3OYPA 1FN6A 2JETB 3ESTA 3MH5A 1TGSZ 5TJXA 1MKWH 2GP9B 1S0RA 4JK6A 3RXSA 5DP6A 3U69H 1C5XB 2V0BA 3A89A 3BEUA 1EZUC 4ZHLU 2GKVE 3UOPA 4JCNA 4AG2A 1KIGH 2B0FA 3PMJA 4JYVH 2F9VA 5BRRE 3UOUA 2C93B 3K6ZA 4ZXYH 1EXFA 1OWDA 1HV7A 2O8WA 5FAHA 1C5VA 1H4WA 1TNGA 5J4SA 4BAKB 1AKSA 1AFQC 3H7TA 2ZU5A 4K1SA 1OWEA 1T4UH 1H9LB 4WMEA 2YNAA 2V6NA 3K6YA 3MNSA 3QN7A 3SI3H 2P95A 1AE8H 3ODDA 1EPTC 3BTHE 3T29A 1SVPA 3LJOA 1C5RA 1JOUB 2R3UA 1FIWA 1NM6A 4X1PU 4ABHA 2NU3E 2F9OA 2WPJS 1PQ5A 2J92A 2C90B 1L2EA 1GI9B 4JMYA 6CHAB 1OXGA 3A8BA 2SGQE 2A0QB 2EI6A 1S0QA 4XDEA 3A86A 1TGBA 1O2VA 2XBWA 1UTQA 3UWJH 1LPGB 1H9HE 3NUMA 3EA9A 2ZCLP 4IS5A 4KTSA 4INLA 1Q2WA 1UCYH 2P3UB 1SLVB 4B2AA 3BTGE 5EXMA 1FI8A 3U8TH 2FM2A 4YOJA 1TMBH 1KDQA 1PJPA 1WU1A 1CBWB 3RXHA 6ESTA 5GPIB 1NFUA 3SGAE 3PLPA 1UMAH 2ZFPH 3TIUA 1XVMA 1C1QA 1E38B 2JKHA 3M61U 4Z6AH 3A7ZA 2HNTE 2V3OH 4ZAEA 3SBKA 1WBGB 2QGRA 5B6OA 4Y11E 3SHAH 4BTUB 3LC3A 1HXFH 1VITF 1ZR0A 3FZZA 2F9PA 1AWFH 1Z6EA 2Z9JA 3RXLA 1ZJKA 3BIVH 1UVUH 2BZ6H 3BV9B 3ZV9A 4TPIZ 1EATA 4I8JA 1Y59T 3PMBB 1SGNE 4U01A 5FPYA 1FQ3A 3T5FH 3MU0A 1DS2E 4MPUA 2BDGA 1XXFA 1XMNB 2V3HH 1GBJA 5L6NH 3RXPA 4YT7H 1HAIH 1OSSA 2C8YB 2F3CE 1C1NA 4DT7B 1MTUA 4O97A 3UNQA 2A2XH 4JYUH 2D8WA 4BAQB 4FUDA 2HALA 2OCVB 1A5HA 3ZZ6A 1BTPA 4NA7A 2ZKSA 1P2MA 2BD9A 1GBLA 5A0AE 3SV2H 1UO6A 5JBCS 1O38A 5CHAC 1TB6H 4NG9H 2WV5A 3UNSA 1K9OE 2BD4A 1V3XA 1YP9A 4AOQA 2BB4A 1GCTC 1O3BA 1C1SA 2CHAC 3T26A 1LHFH 1P3CA 1QCPA 3SNEA 4CRBA 1GCDA 3M3TA 4NZLA 2FO9A 1DLEA 4LZ1H 1EOLA 1N1LA 2P3FH 1SHYA 3SOSA 1UCYE 5EQRA 4ZMAH 1SGIB 3VB5A 4BOHA 1VR1H 1CHOG 1TGCA 4DG4A 4NGAH 1GI0A 3SNBA 5HM2A 2BM2A 1AGJA 2PR3A 4X1RU 3GY3A 2UUJB 2Q6GA 1O2UA 5HXFA 2XCFA 1MKXK 2VJ1A 3RXEA 2FZZA 1GJBB 2SFAA 1YPEH 1V2RT 3RU4E 1BMMH 2FOMB 3RXMA 1AVXA 4KGAA 4B71A 1AN1E 1ZSJA 4Y7AA 1A2CH 3E0NB 1P10A 2A31A 1XX9A 3LGVA 4B74A 3VXFH 4AFQA 1G36A 4Q7ZA 1O32A 1MMJN 5DGJA 1DDJA 1HGTH 3BF6H 2H6MA 3NXPA 2ESTE 4FUFA 1FY3A 3M7TA 4ABIA 1BJVA 1S6HA 1TFXA 3PYHA 4AORA 1O30A 1ZHPA 2THFB 3ZYEA 2BY8X 1GDQA 1RGQA 3C27B 1NFYA 2P8OB 2TGPZ 4MPVA 4AG1A 5EW2H 2V35A 5E8EH 2FOHA 2ZHFH 2HGTH 4AGKA 1FONA 1INCA 1AIXH 1IQMA 4K5ZA 1ZGIA 8ESTE 3SO3A 4B1TA 2JETC 1BHXB 1X7AC 1ZHMA 2SGAA 1G32B 1Z7KA 1LPKB 4WVPE 4ABFA 1GI6A 1GHZA 2FLRH 2O8UA 1V2ST 5DP3A 3SV8A 1TX7A 3BTME 4A1VA 1IOEA 4DIIH 3K2UA 3TH3H 1V2VT 2Z6BD 1UTMA 1A4WH 4AZ2B 1HJ8A 2ANKH 1EZXC 3RMOH 3RXCA 3EA7A 1AHTH 1O5AB 3SJ9A 2BZAA 2ULLA 3ZZAA 1HAXB 2OP9A 5A8YA 4BAOB 3S7KB 1LVBA 4CHAC 1O3IA 2PFEA 3LH3A 1O2YA 4IN2A 1CT2E 1YC0A 1PYTC 3TPIZ 2ZGJA 1DUAA 3ZZ7A 2H9TH 5K0HA 2WINI 1GMDG 2BOKA 2XCNA 3LU9B 3PLKA 1MBMA 1E0FD 3H7OA 4XBCA 1KTSB 1PQ8A 5K7RA 1IHTH 4U30A 2XC0A 1SQOA 1VGCC 3GY7A 4D7GA 3RMNH 1DPOA 3A7TA 1ACBE 1XUHA 1G2LA 2BQ7B 1YPJH 2PSYA 3KN2A 4VGCC 4Y0ZE 2FX6A 1PQAA 1FPCH 4KELA 5CHAB 1FN8A 3RXQA 3EE0B 1K1NA 4I32A 2BTCE 4XFQA 3STJA 3TITA 1AFQB 1MAYA 2BVXH 4OS5A 1KLJH 5C1YA 5LPEA 3PWBA 5EG4A 4J2YB 5EU8A 1EJAA 2UWLA 4J1YA 4YLUA 2ZA5A 1HDTH 1JIRA 2A4RA 1FY4A 3KQEA 3M37A 3RC5A 2IPHA 1NT1A 3TK9A 1A7SA 4NZQA 3V0XA 4JZ1A 4YLQH 1ARBA 1TMUH 1NFWA 2BVSH 3S0NA 2OQ5A 3FFGA 3BTTE 1N6XA 2SGFE 3CS0A 1O2WA 1YLCA 1QURH 1GG6C 1V2QT 1MU8B 1HAYB 2VIOA 1L1JA 1GVKB 1SI5H 2J38A 1DANH 3L3TA 5ESTE 1DOJA 2BLVA 1XKBC 1OWJA 2AMQA 2QXIA 3SUGA 3S7HB 2P94A 1ETSH 1GBDA 3RXOA 1FJSA 3T28A 4BXWA 3VB7A 3BIUH 3NZIA 3ZVAA 1LKAA 1UTLM 1GJCB 1GI7B 1C5SA 1GJ9B 2OXSA 3E16B 4X8UH 4BTTB 4IN1A 5A0CA 1IQIA 1P9SA 1V2TT 3P92A 4FUJA 4WH8A 3LGWA 2RA0A 1DT2A 1MZAA 1NU7B 2BY6X 1MQ6A 1YCPH 2ZFTA 1UCYK 2CHAB 2ZDKA 2TBSA 1P2JA 1UTOA 1CGJE 1O0DH 3SU5A 3SQEE 2Z9IA 1VITG 1C2EA 3NCLA 1G3BA 3CS7A 3TK6A 1TAWA 3GCTG 4MNYA 2A7CA 9LPRA 1FNIA 1RS0A 3BTKE 1SB1H 2ODPA 1CT4E 1XVOA 2GCHF 4H6SB 1EPTB 3P8FA 5H4IB 4DIHH 1TOMH 2FOAA 3EQ0H 1G37A 5F6MA 1TRNA 4H42U 3SNDA 3SUEA 4CRGA 2G00A 3S9AA 3URCA 4FUEA 2BVRH 2UUKB 3ELAH 1LKBA 5IYTA 1PPEE 1GWAA 1ZPCA 5LPRA 1O34A 3QGJA 4SGBE 2XYAA 1K1JA 4PROA 1EQ9A 4I8LA 1BBRH 1T4VH 4ISNA 5E0JA 5FBIA 1OYTH 4DURA 5A2MH 1QJ7B 2FMJA 1NY22 4AGJA 4X1NU 3SU3A 3G01A 3U1JB 5FCKA 2BY5X 4A1XA 1XUKA 4Y8YA 3S9CA 2OINA 1AB9C 4MNWA 2A5IA 4DOQA 5EXNA 4ZKOU 1KXFA 3UWIA 3NK8A 3SHCH 4D9QA 3MU5A 4Y76A 1GHAF 4K60A 4O3TA 1OP8A 1EB1H 5JBTA 1CA0C 1SPJA 1KSNA 1OWKA 1P2OA 1ID5H 2TRMA 1C2FA 3RUOA 5EOKA 4LZ4B 4X8TH 1VCQA 3A87A 4FUGA 1B7XB 1TRYA 3U98H 5JB8S 1FZZA 3A82A 2BDAA 1ZZZA 1VJ9U 2G81E 4I8HA 2PWXA 1L1GA 1NZQH 4Q7XA 1P2QA 4IC6A 1LQEA 3MFJA 1N6YA 2FOGA 1O31A 3BG4C 3PB1E 3GCHC 2CJIA 1ZMJA 3O8RA 4E7RG 2G5NA 1NROH 2GV7A 4MG3A 8LPRA 4F49A 1S81A 3L33A 5AHGH 5GDSH 1ZJDA 1ANDA 1HIAA 4ESTE 3K9XB 1T8MA 3ENSB 2FYRA 2R2MB 1SGYE 4XBDA 1D9IA 3A85A 3ATMA 4OS4A 1T7CA 2WPLS 3KNXA 3TJVA 3ZVGA 2EEKA 1DY9A 4GUXA 2AMPA 1EJMA 5AFZH 4H6TA 3RM2H 4FVDA 3PMAB 1TOCB 1HAGE 2VWMA 1OP0A 1KDQB 1IQLA 2HVXA 1SLWB 5I46H 2ZFQH 4Y79A 1C1RA 2GCTB 2ZP0H 1LPZB 1NO9H 2EC9H 1TE0A 1TWXB 1ELEE 1L4DA 4INKA 1BTXA 1ELFA 1IQHA 1GBHA 1O2LA 4K8YA 2YOLA 2Y82A 4AFZA 1GBMA 4X0WU 1HJ9A 2R3YA 1UVPA 2ZZUH 1EZQA 3RXBA 1NC6A 2H9EH 1QNJA 3GDUA 4FVBA 1Z8GA 1GGDC 1AKSB 1E34B 1BB0B 4XBBA 1IQKA 3E90B 5E0HA 1MD7A 1AO5A 1RJXB 4R0IA 5F8TA 5CMXH 5C2ZA 4ABAA 2OQUA 2CXVA 1TLDA 3SJOA 1Z8RA 1ZRKA 3RXRA 1GI3A 2BMGB 2ZF0H 2TGTA 4UE7H 1C1VH 8GCHF 1DWEH 3A8AA 1K1MA 2AMDA 1UHBB 1MTSA 3MNXA 1RTKA 1QJ1B 2W7SA 4BAHB 5I25A 2VIPA 4IW4E 1DSUA 4FXGH 1SGTA 4X8VH 1O2PA 1FY1A 3GCTF 4X6PA 2SGDE 4D7FA 1WYKA 3F9EA 2OTVA 1GHXH 3A7VA 2ZGBH 3MNBA 3HK6B 4I33A 3M7QA 3E1XB 1AI8H 4MLFB 2FX4A 1Y3UA 2BX4A 2P3TB 1O2NA 1DE7H 1BQYA 1W14U 3O8CA 1BTHH 4FUIA 4TYDA 4E7NA 5A09A 3QWCH 2ZGHA 1HAOH 2ZDAH 1QBVH 4FU7A 1GI2A 2FWWA 2BDHA 3A8DA 4TY6A 3M3VA 4NIYA 3VB4A 1YKTA 1CA8B 4CH8B 1C2MA 1XUJA 1ELVA 1N8OC 3SV6A 1RXPA 1DX5M 1GMCF 4KTUA 2FEQH 3ZZ5A 3MWIU 1J14A 1UTPA 1ESTA 4YZUA 3RXDA 5TCCA 1XKAC 1ZTKA 2D1JA 1ANCA 2STBE 4GCHG 3W95A 3KF2A 2ANWA 3TGKE 1O2SA 3PV4A 1EPTA 3VPKA 1A0LA 4AFUA 1J16A 1L4ZA 1O3CA 3E6PH 7ESTE 4NSVA 1W0ZU 8KME2 4LK4A 3D62A 1SBWA 5T6FA 2FODA 1C9TA 2C8ZB 3M5MA 2UUFB 2VVCA 4Z0KA 2KAIA 4WWYA 1Z1IA 4AYYB 3I77A 3N7OA 1W10U 1MBQA 2VVUA 1JMOH 2OBQA 3UIRA 1J8AA 3AAUA 4GSOA 2XBXA 3EAJA 1XM1A 3CP7A 3RU4D 1PPCE 2GTBA 3ITIA 3UR9A 3LIWA 3LKWA 1P09A 1SC8U 2AERH 4ZUHA 3M35A 3BEIB 4A7IB 2VIQA 4F4OC 4TWWA 2K1QA 1C1PA 1O2TA 1O3EA 2VH0A 4K3JA 4OS1A 2GZ9A 2VIDA 1GDUA 1TBQH 1WTGH 2R0LA 5EW1H 2QF0A 3Q3KA 2OC0A 3ZZ8A 1V2PT 2O9QA 1CSOE 5F03A 3ZVDA 2BD2A 3RXAA 1EAWA 3EYDA 1C5OH 1VITH 3ZZCA 1J15A 1F0TA 1F7ZA 1KXCA 1PPGE 1LHCH 1FXYA 4X6OA 1YGCH 3UNRA 1AVGH 2A1DB 4ZROA 4GAWA 2EI7A 1GJDB 2VIWA 1O33A 2Z3CA 5HGGA 4UFGH 1K1IA 4XSKU 2BDYA 1W13U 5DK1A 2UUYA 4WY3A 1HAPH 4MNVA 1TX8A 1H1BA 3PM3A 3OU0A 1PYTD 1RD3B 4I8GA 1C1WH 4MQAA 1ELAA 2VWLA 2Y7ZA 4A6LA 1EAXA 3H5CB 3KQDA 1NRQH 4CRDA 2ZFRH 1YM0A 2WYJA 4O9VA 3WY8A 5C1XA 3R3GB 5FHTA 1W3CA 4CRAA 3QO6A 5T3HA 3RXIA 1QBNA 3IWMA 2NU1E 2H5CA 3OY6U 3TGIE 3OTJE 5L30H 1A1RA 1K28D 2CF9H 1W7GH 1O37A 1S84A 1ANBA 1T8OA 3UTUH 2XWBI 4DCDA 1BRAA 1QB9A 3MI4A 1QFKH 3TH2H 5C67A 2PW8H 1G9IE 3SU0A 1NFXA 1HNEE 1E35B 3T27A 4JZEH 1SQTA 2AGGX 1JRTA 2P8OC 1MKXH 1FY5A 5T6GA 1TNKA 4NFFA 1OWHA 4ISIH 4WXIA 1P2IA 1YPGH 5HM9A 4X2XA 1ANEA 3F9FA 1W0YH 1ETRH 4Y8XA 3M5OA 3DT0H 3L6PA 3BTWE 1GBTA 2BYAX 3D49H 3RC4A 3MO9A 1HFDA 1GJ7B 3QUMP 2ZU4A 4CREA 6GCHG 1A0JA 1THRH 5LPFA 1C1TA 2RA3A 2TGAA 3V12A 2UWOA 1FMGA 3GCHB 2ANMH 3KCGH 1C5QA 4GVUA 2A5AA 3QK1A 2ZQ1A 3HK3B 1BITA 1TYNA 1B0EA 1MCTA 1UK2A 1GDNA 1SR5C 3RXTA 4FUCA 3JZ2B 3TJOA 2A5KA 1L1NA 1D3QB 2W26A 1QIXB 2GDDA 1SOZA 1KTTB 2PGQB 5LH8A 2LPRA 3GY2A 1FPHH 4LXBH 1YF4A 2OD3B 1BIOA 3HATH 3P17H 1PPFE 2ZEBA 1SGDE 1DY8A 2A2QH 1GVZA 3OY5U 3DA9B 2YNBA 4DY7B 4YTAA 1P06A 2ODQA 5GXPA 3GYMA 1Y5BT 2LNCA 3D23A 1QGFA 2JH6D 1UJ1A 1XUIA 1GHWH 2Z3DA 2XTTB 4WJG2 1QB6A 1O2HA 2VU8E 1HUTH 3A83A 2ZHWH 3F9HA 1NS3A 5EXLA 1FY8E 2FIRH 2I6SA 1BT7A 4WH6A 2P59A 1LMWB 1GBKA 1QRXA 1QL9A 2O8LA 1CO7E 1UVSH 4GPGA 1LHGH 2BDBA 1JWTA 5EODA 1AVWA 3R0FA 1LHDH 2ZDVH 1S6FA 4KTCA 1TNLA 2ZHDA 3MMGA 1YPMH 1O2JA 2A7HA 1WQSA 1AD8H 1G2MA 2PTCE 5DO4H 4YESB 1P9UA 3DD2H 2SGPE 5C1UA 1K21H 5GJ4B 3KGPA 3UUZA 5AVDA 1V2OT 1O3MA 4U2WA 3VEQB 3Q77A 3V13A 1SGFG 2GVFA 1A0HB 1WOFA 2PUXB 4I31A 2VGCC 2WPMS 5EPNA 9ESTA 2FPZA 1WSSH 2ZCHP 3GY5A 2B5TB 1TNIA 2GT8A 4O03A 1DM4B 8GCHG 4MPXA 2HNTF 1ZYOA 2PGBB 1C1OA 2BQ6B 1HJAB 1V2KT 1T8NA 2BLWA 1UTNA 2BXTH 3KHVA 2GV6A 2FI5E 1Q3XA 1ELCA 3ATIA 4A5TS 1DUEA 1V2JT 2FS9A 2Z94A 3P8GA 1XUGA 4KP0A 3TNSA 4MNXA 4OS7A 2R0KA 1SL3A 1KYNA 1O5EH 2Z9KA 4DJZB 2QY0B 1IQGA 1BHXF 3UFAA 4SGAE 4YT6H 3ZV8A 3ZZDA 3STIA 1O3AA 4BXSA 1V2MT 4Y6DA 4Q2KA 3SZNA 3W94A 4NSYA 4Y8ZA 3O8BA 3ZZ4A 1RRKA 1Q31A 1CVWH 1IQFA 3IG6B 2QF3A 1ABIH 4NIXA 1CA0B 4FU9A 4X6MA 4M7GA 1C5WB 4I7YH 2Q6DA 1ABJH 1O5BB 2OC7A 1Y5AT 5JDUB 3LDXH 1O5DH 2Y5GA 2RCEA 1MKWK 1IQEA 1EOJA 3A8CA 1O2XA 4HZHA 2XC5A 2G8TA 1ZOMA 4DGJA 3SV7A 1Z8JB 3RP2A 1MU6B 1CHGA 3BTEE 1BCUH 2ZO3H 1FUJA 2BX3A 1SG8B 4WF8A 2QC2A 1SGQE 3MO6A 1BBRE 3LC5A 4GLYA 1A5GH 2F9NA 2HOBA 2UWPA 2G52A 1C5UA 7LPRA 3Q00A 3LJJA 1GJ8B 2PLXA 1Z8IB 2CV3A 1NRPH 1O3LA 2AEIH 3RXKA 2BDCA 1ESAA 2FI3E 4YOIA 7GCHG 4CBNA 2ILNA 4CRCA 2Z7FE 1FAXA 1A3EH 1J17T 3SN8A 5E0GA 1SLUB 3ZZBA 3HKIB 2TGDA 3VXEH 1K2I1 1O5CB 1P8VC 5C20A 1P57B 1YCPM 4UDWH 3M7UA 1CBWC 4X2VA 1DFPA 5DP9A 1GBBA 1MTVA 1YBWA 4ABGA 1C4V2 3UY9A 1HIAB 2O8TA 3SW2B 4O3UA 4CRFA 1ZPZA 2TIOA 4YOGA 3ZYDA 3LGYA 1JBUH 1TX6A 5PTPA 4UEHH 2W3IA 3TH4H 1GJ4H 5CE1A 3QTOH 3MH4A 3I29A 1SGCA 2HWLB 2WV4A 1E36B 2F9BH 2ZFFH 3BG4B 2RDLA 2VINA 3LGTA 3MH6A 6CHAC 2NU0E 5C5NA 4CBOA 1DXWA 1EAIA 2GDEH 3QX5H 1HXEH 4R8TB 4AB8A 1BJUA 3MH7A 1NESE 1LTOA 1QTFA 2F9UA 1K1LA 2ZTYA 2J94A 2R2WU 4NIVA 1L0ZA 3Q3XA 3RXVA 2XC4A 3E0PB 1W2KH 1BRUP 1P04A 2W3KA 2Y81A 5JPMH 1D3TB 3GDSA 2FDAA 3AASA 5FXLA 2CF8H 1U6QA 1ZSKA 2VGCB 2WPHS 1B0FA 1GI8B 1VCPA 2XXLA 1ZTLA 1HB0B 2C4FH 2A7JA 2HPPH 1G30B 1ZLRA 4IGDA 1AZZA 2ZHEH 4JK5A 4JZIA 1A61H 3F9GA 1THSH 4XOJA 1LVYA 3QZRA 2M5TA 2AIPA 1PPHE 1DVAH 1FLEE 2R9PA 5AFYH 1D4PB 2ALVA 1A5IA 1Y8TA 1O2ZA 2ZTZA 3GYLB 2B8OH 1KXDA 1BA8B 1F5KU 1GVLA 3GISB 2AIQA 3KEEA 5JBBS 1AFEH 1GBCA 1SFIA 4X8SH 4H4FA 1O2MA 4A92A 2JH0D 1YPKH 3RU4T 2VVVA 1IAUA 1EUFA 4ZHAA 1FV9A 5BPEA 4ABEA 2QV1A 3I78A 2WYGA 2DE8A 5DKMA 2ZG0H 4INHA 1O5FH 3T62A 3SV9A 2NU2E 4DVAU 5FCRA 4D8NA 2WUBA 1TQ0B 2GMTB 3HGNA 3ZVCA 1ELTA 1H9IE 1SGPE 1TALA 1LVOA 3TNTA 1E37B 1SFQB 2IJOB 2Y5FA 1BMAA 5EQSA 3KL6A 1TA2A 1EAUA 1C5TA 4AFSA 1HAZB 4Y7BA 1CQQA 1CGHA 1EASA 3OX7U 1HAHH 4UONA 1P2NA 1ELDE 1P01A 1UTJA 4MTBA 1JXPA 2AGEX 4MPWA 4B75A 1O3HA 1NU9A 1AQ7A 1K1OA 5FPSA 1OX1A 1F0SA 4K69A 2VH6A 4DW2U 1HCGA 1PQ7A 2PKSB 2P93A 3VGCC 1QY6A 2OBOA 2PUQH 3RXFA 3A7WA 2AFQB 3C1KA 1O2OA 2C8WB 3Q76A 1Z6JH 3BSQA 1S5SA 1TGNA 1Y3YA 4HTCH 1C5PA 4CR5A 3B8JA 2ZFSA 3GY6A 2ZCKP 2VB0A 2XRCA 1V2LT 1SHHB 4I8KA 2ZI2H 1LQDB 2ZECA 3VFEA 1F5RA 4BNRA 2ASUB 1WAYB 3PO1B 1EX3A 1BOQA 1MTNB 1NN6A 3V3MA 3BTFE 2VIVA 4BAMB 1QBOA 4OS2A 1D3PB 1KLTA 1AB9B 4UFDH 5EQQA 5A0BA 2FTMA 3QTVH 1B5GH 2TPIZ 3FP8E 1C5YB 1GL1A 4WMDA 2QA9E 1EZSC 3LONA 5FX6A 1ZMLA 2Q6FA 2BD5A 2AS9A 5HYOA 1O2IA 2WPKS 1UVTH 2QAAA 4OGYA 1GJAB 1RTFB 1C2LA 1V2UT 3LPRA 1V2WT 1YPHE 5ABWA 3HKJB 1GHYH 2FOFA 1H8DH 2G5VA 1GBFA 2ZU2A 1VGCB 3A7YA 4GCHF 4IMQA 1A3BH 2GGVB 3CENA 2XNIA 2A45B 4RSPA 1C2HA 1S83A 3DHKH 4X6NA 3IITA 3PTBA 1LVMA 2ALPA 4X1QU 5DP4A 1P02A 5EGMA 2PKAA 1HRTH 3EA8A 1N8OB 1MH0A 2ZIQH 3P8NA 2FESH 5DP8A 1K1PA 1HYLA 2C8XB 5JB9S 1OOKB 1ESBA 4OS6A 5A8XA 2A32A 3ZVEA 2ZQ2A 4BANB 3TK5A 3NPSA 3FZDA 4X2WA 1QJ6B 1VZQH 1AU8A 1MAXA 4E06H 5ETXA 1AWHB 1C9PA 1OPHB 5F8XA 1UVOA 1QQUA 1TIOA 1UK3A 1C5NH 1GI1A 3S69A 1GBEA 1NTPA 5LGOA 2BD8A 3K65B 3E8LA 2OC8A 3FANA 1O35A 1O3DA 2QXGA 3MOCA 1HLTH 3E3TA 4IC5A 3QZQA 1WQVH 1YLDA 3P70B 4WMFA 2BD3A 2AGIX 1G3EA 3U8RH 3UQVA 2XBVA 5JYIA 1BTWA 1PPBH 2D2DA 4AB9A 2O8MA 1HJAC 1GHBF 2J4IA 3LH1A 4ZHMU 1C1MA 1C5ZB 1JRSA 2CN0H 3A88A 1O3KA 4Y71A 3SU6A 3RXGA 3SNCA 3F68H 4ZH8A 2GT7A 1RIWB 2GZ7A 1OYQA 3SU1A 1KLIH 4CH2B 1AY6H 1FIZA 1F92A 1TBZH 1Y3WA 3BTDE 2QIQA 3AVZA 7KMEH 1GMDF 4FU8A 4X1SU 1UTKA 3NKKA 2ANYA 3ZZ9A 2GCTC 2BLOA 5ESBA 1CGIE 1AE5A 1O2GH 2ODYB 1MTNC 3GOVB 1BDAA 2PTNA 1DLKB 1O3FA 1SGFA 1WV7H 2BY7X 2NU4E 1DWBH 5E2PA 2ZPSA 3U1IB 2BD7A 2VNTA 2B9LA 5DPAA 1TPSA 1XUFA 3M3SA 4JYTA 3TGJE 5HMAA 3TU7H 1F2SE 4YO9A 1D6WA 1W7XH 1BMLA 1YPLH 1G3DA 1GBIA 1GJ5H 4Q80A 1YPHC 1T31A 4YM9A 1QB1A 4NFEA 4HGCA 3AW0A 1UHBA 3OSYA 1TA6A 3A81A 3T25A 3P6ZB 2QXJA 3SU4A 1AZ8A 2ZU3A 1C2GA 4XE4A 1DXPA 1SGRE 4B73A 3RC6A
chains in the Genus database with same CATH superfamily
3ZVFA 5TCAA 4P02A 3QLPH 3NWUA 2OUAA 3ZIAD 1BBRK 1DITH 3SJIA 1LCYA 1AUTC 2Q1JA 4ABDA 5EJ1A 1TPOA 3KQBA 3GY4A 3MU1A 1CHOF 1OWIA 3F1SB 1EJNA 1GBAA 3KQCA 2Y6TA 5DP7A 3Q3YA 1O2RA 3RXJA 1P0SH 1O2KA 2DUCA 3QGNB 1DSTA 3DUXH 4CHAB 2KFWA 1TPPA 4E05H 1ELBA 5J4QA 1PFXC 3AW1A 4ZKNU 1ZRBA 2BHGA 5DP5A 5EIYA 3SQHE 2IN2A 3SI4H 1ZHRA 3HGPA 2G4UA 1WTHD 4U32A 2ZU1A 3RM0H 6LPRA 3S9BA 3EDXB 1DICA 1W0JD 1AUJA 1CE5A 2A4QA 2RDEA 1QQ4A 4ASHA 2A4OA 2FYQA 2QE7D 1SSXA 2BOHB 3TJUA 1SLXB 1C5MD 2Z9LA 2VWNA 4ABJA 1GGDB 4RI0A 3URDA 2FI4E 4K1EA 3BEFB 1GPZA 1P2KA 3FP7E 2ZTXA 1M9UA 2GZ8A 2B7DH 5IDKA 2ZGCA 5SGAE 3RLYH 1F0UA 1LO6A 2Y80A 3GCNA 1FAKH 3PTNA 4FUBA 1UK4A 4IBLH 2WPIS 1Y3XA 3E91A 3V7TA 5GWZA 1KY9A 1MD8A 1W11U 4VGCB 4Q7YA 4TWYA 1GMHG 3UREA 1GHAG 1GI5A 5AF9H 1QA7A 1PPZA 2Y5HA 1UW7A 1W12U 1JIMA 4ISHH 1LDTT 3B23B 4IMZA 1TMTH 3UR6A 4TPYA 2J95A 3AAVA 2SGEE 4CR9A 5GCHG 1Y5UT 4AX9H 1C4Y2 1P11E 3NRLA 1ZTJA 1EP5A 2HNTC 1RTLA 3SUDA 2VWOA 1G3CA 4B2BA 1S85A 1NRSH 1O3JA 2FXRA 3BTQE 2P16A 5DN6D 4ABBA 2KAIB 2J34A 1CT0E 3MO3A 1H8HD 1HAVB 4ZKSU 1SGEE 1IQJA 5G4BA 2YMSD 1O36A 1C4U2 1NRRH 3FP6E 1WUNH 1GCTB 3BG8A 3AK5A 4NIWA 5C3NA 2OC1A 5DJ7A 1AMHA 1KXEA 1O3GA 1O39A 4OGXA 1H8ED 1GHBG 2Z3EA 3UQOA 1VCWA 1MZDA 1TPAE 1O3PB 3KQ5A 1QR3E 5DG6A 3LGUA 3P8OA 1ARCA 3PWCA 5GCHF 1OKXA 3SORA 4AYVB 2H9HA 1NRNH 2FOCA 3GDVA 4Y10E 3GCOA 3DFJA 2G51A 3F6UH 3MU8A 1KMHB 1W8BH 4UFEH 1CU1A 2JIZD 4K1TA 1C5LH 5EPYA 2YMSC 2XWAA 3EGKH 2HPQH 2GX4A 4JZFH 4K8BA 1MUEB 1EB2A 2KZ4A 2QCYA 1IQNA 2PSXA 3GICB 4MVNA 1S82A 3PO1C 4D76A 5FX5A 4GHQA 2RG3A 4A1TA 1QL7A 1T8LA 2ZPRA 4TSFD 2BY9X 4QT8C 4HI3A 1QRZA 1SMFE 3MTYA 3A7XA 2EQNA 2STAE 3MNCA 3ODFA 4AN7A 5F8ZA 1ORFA 1TONA 4NA8A 1O2QA 3FVFB 1ZMNA 3UB0A 3O8DA 2FP7B 1C2DA 1BZXE 2PKSC 3MYWA 3PROA 3ATWA 1GHVH 5JBAS 2D26C 3ZZ3A 4TY7A 3DSOA 2FOBA 1HBTH 4HFPB 2PHBA 2HLDD 1QA0A 1TQ7B 2G55A 3A80A 1YYY1 2BLQA 4UFFH 2AYWA 1DWCH 3U8OH 3N7DA 1QHRB 1BRBE 3M5NA 5KECA 5FPTA 2SNVA 3DFLA 3ATLA 3HPTB 1V6DA 5HKKD 4ISOA 2A4GA 2XBYA 1NPMA 4UD9H 1KXAA 3LT3A 1KXBA 1ZSLA 1BTYA 2ZDNA 4GHTA 1OP2A 1V2NT 3F0OA 1QZ8A 3VB3A 3JZ1B 1P3EA 1SQAA 1TBRH 2C3SA 3PLBA 2CGAA 1QL8A 4RKJB 2SNWA 2BQWB 4NWLA 2FS8A 3UPEA 3OEED 2HLCA 4F48B 1MTWA 6GCHF 3M36A 1IHSH 2QYIA 2H1UA 1TABE 2F83A 2AH4X 2J2UA 1J9CH 3SJ8A 3SGQE 4NCYA 1A46H 2NWNA 1K22H 1LHEH 2W7UA 1TGTA 2EI8A 4NWKA 5KGOA 2ZNKH 4WXVA 3DSGA 1Y3VA 1Z71A 3RXUA 4RN6A 1BTUA 5FL7D 1O3OA 2GD4B 3QDZB 2I6QA 5A8ZA 3SUFA 2HRVA 1D6RA 1ETTH 1QRWA 2F91A 2ZPQA 3MHWU 4ZKRU 1P05A 2WUCA 5FBEA 5T6DA 3SNAA 1EP6A 3T2NA 1O3NA 1T32A 2QN5T 1BMFD 1DWDH 1GJ6A 1RIWC 2XW9A 3M5LA 2AHME 4ISLA 2Z9GA 1RFNA 4ZXXH 2ZHQH 3SGBE 3P95A 4K2YA 4MDSA 3ATKA 5GIBA 3D65E 1TRMA 3A84A 3RMLH 2IOTA 3TLOA 4FUHA 1O5GH 3SU2A 1C2KA 3ZVBA 2H2ZA 2BXUH 1P12E 4RKOB 4D9RA 1BRCE 1YWUA 5E2OA 3TJNA 3KIDU 1HAVA 3LGIA 1GMHF 1H8IH 3TVJB 1ZGVA 3RMMH 3LOXA 1ZPBA 2FLBH 3FAOA 2GCHG 1YCPK 2DE9A 1YLNA 2ZGXH 4B2CA 2QXHA 4LOYH 4BTIB 1VJAU 5L2YH 3VGCB 4THNH 7GCHF 3BN9A 4JZDH 1GL0E 1TNHA 2PKAB 1SOTA 1P03A 1TNJA 1F5LA 4Y0YE 2W5EA 3SJKA 2CMYA 3OEHD 4B76A 2ZWLH 2GMTC 2J9NA 2ZC9H 2FTLE 1F0RA 1ELGA 1MCVA 2JH5D 1XXDA 2BDIA 2FOEA 3GY8A 1MQ5A 1BUIA 3U9AH 1C1UH 3RLWH 3RDZA 3VB6A 2H5DA 1GG6B 1GI4A 1Z1JA 3PMHB 2KCYA 2ZDMA 2Y7XA 1GMCG 1BTZA 2G4TA 4NA9H 5L2ZH 1BMNH 4X2YA 1EKBB 4KKDA 1THPB 2ZDLA 2EA3A 1FDPA 3B9FH 5C5OA 1HPGA 2OLGA 1D3DB 2PV9B 1C2JA 1OS8A 1WCZA 5EJLA 3MU4A 1C2IA 3OYPA 1FN6A 2JETB 3ESTA 3MH5A 1TGSZ 5TJXA 1MKWH 2GP9B 5DSFA 1S0RA 4JK6A 3RXSA 5DP6A 3U69H 1C5XB 4B6FA 2V0BA 3A89A 3PV2A 3BEUA 1EZUC 4ZHLU 2GKVE 3UOPA 4JCNA 4AG2A 1KIGH 2B0FA 3PMJA 4JYVH 2F9VA 5BRRE 3UOUA 2C93B 3K6ZA 4ZXYH 1EXFA 1OWDA 1HV7A 2O8WA 5FAHA 1C5VA 1H4WA 1TNGA 5J4SA 4BAKB 1AKSA 1AFQC 3H7TA 2ZU5A 4K1SA 1OWEA 1T4UH 1H9LB 4WMEA 2YNAA 2V6NA 3K6YA 3MNSA 3QN7A 3SI3H 2P95A 1AE8H 3ODDA 1EPTC 3BTHE 3T29A 1SVPA 3LJOA 1C5RA 1JOUB 2R3UA 1FIWA 1NM6A 4X1PU 4ABHA 2NU3E 2F9OA 3KYGA 2WPJS 1PQ5A 2J92A 2C90B 1L2EA 1GI9B 1MABB 4JMYA 6CHAB 1OXGA 3A8BA 2SGQE 2A0QB 2EI6A 1S0QA 4XDEA 3A86A 1TGBA 1O2VA 2XBWA 1UTQA 3UWJH 1LPGB 1H9HE 3NUMA 3EA9A 2ZCLP 4IS5A 4KTSA 4INLA 1Q2WA 1UCYH 2P3UB 1SLVB 4B2AA 3BTGE 5EXMA 1FI8A 3U8TH 2FM2A 4YOJA 1TMBH 1KDQA 1PJPA 1WU1A 1CBWB 3RXHA 6ESTA 5GPIB 1NFUA 3SGAE 3PLPA 1UMAH 2ZFPH 3TIUA 1XVMA 1C1QA 1E38B 2JKHA 3M61U 4Z6AH 3A7ZA 2HNTE 2V3OH 4ZAEA 3SBKA 1WBGB 2QGRA 5B6OA 4Y11E 3SHAH 4BTUB 3LC3A 1HXFH 1VITF 1ZR0A 3FZZA 2F9PA 1AWFH 1Z6EA 2Z9JA 3RXLA 1ZJKA 3BIVH 3OAAD 5CHBA 1UVUH 2BZ6H 3BV9B 3ZV9A 4TPIZ 3W1EA 1EATA 4I8JA 1Y59T 3PMBB 1SGNE 4U01A 5FPYA 1FQ3A 3T5FH 3MU0A 1DS2E 4MPUA 2BDGA 1XXFA 1XMNB 2V3HH 3DSPA 1GBJA 5L6NH 3RXPA 4YT7H 1HAIH 1OSSA 2C8YB 2F3CE 1C1NA 4DT7B 1MTUA 4O97A 3UNQA 2A2XH 4JYUH 2D8WA 4BAQB 4FUDA 2HALA 2OCVB 3OFND 1A5HA 3ZZ6A 1BTPA 4NA7A 2ZKSA 1NBME 1P2MA 2BD9A 1GBLA 5A0AE 3SV2H 1UO6A 5C17A 5JBCS 1O38A 4ACAA 5CHAC 1TB6H 4NG9H 2WV5A 3UNSA 1K9OE 2BD4A 1V3XA 1YP9A 4AOQA 2BB4A 1GCTC 1O3BA 1C1SA 2CHAC 3T26A 1LHFH 1P3CA 1QCPA 3SNEA 4CRBA 1GCDA 3M3TA 4NZLA 2FO9A 1DLEA 4LZ1H 1EOLA 1N1LA 2P3FH 1SHYA 3SOSA 1UCYE 3KYFA 5EQRA 1SGIB 3VB5A 4BOHA 4ZMAH 1VR1H 1CHOG 1TGCA 4DG4A 4NGAH 1GI0A 3SNBA 5HM2A 2BM2A 1AGJA 2PR3A 4X1RU 3GY3A 2UUJB 2Q6GA 1O2UA 5HXFA 2XCFA 1MKXK 2VJ1A 3RXEA 2FZZA 1GJBB 2SFAA 1YPEH 1V2RT 1SQRA 3RU4E 1BMMH 2FOMB 3RXMA 1AVXA 2WV9A 4KGAA 4B71A 1AN1E 1ZSJA 2L6OA 1EFRD 1A2CH 3E0NB 4Y7AA 1P10A 2A31A 1XX9A 3LGVA 4B74A 3VXFH 4AFQA 1G36A 4Q7ZA 1O32A 1MMJN 5DGJA 1DDJA 1HGTH 3BF6H 2H6MA 3NXPA 2ESTE 4FUFA 1FY3A 3M7TA 3WWBA 4ABIA 1BJVA 1S6HA 1TFXA 3PYHA 2OK5A 3WW7A 4AORA 1O30A 1ZHPA 2THFB 3ZYEA 2BY8X 1GDQA 1RGQA 3C27B 1NFYA 2P8OB 2TGPZ 4MPVA 4AG1A 5EW2H 2V35A 5E8EH 2FOHA 2WZQA 2ZHFH 2HGTH 4AGKA 1FONA 1INCA 1AIXH 1IQMA 4K5ZA 1ZGIA 8ESTE 3SO3A 3H09A 4B1TA 2JETC 1BHXB 1X7AC 1ZHMA 3MQKC 2SGAA 1G32B 1Z7KA 1LPKB 4WVPE 4ABFA 1GI6A 1GHZA 2FLRH 2O8UA 1V2ST 5DP3A 3SV8A 1FX0B 1TX7A 3BTME 4A1VA 1IOEA 4DIIH 3K2UA 3TH3H 1V2VT 2Z6BD 1UTMA 1A4WH 4AZ2B 1HJ8A 2JJ1D 2W6JD 2ANKH 1EZXC 3RMOH 3RXCA 3EA7A 1AHTH 1O5AB 3SJ9A 2ULLA 2BZAA 3ZZAA 1HAXB 2OP9A 5A8YA 4BAOB 3S7KB 1LVBA 4CHAC 1O3IA 2PFEA 3LH3A 1O2YA 4IN2A 1CT2E 1YC0A 1PYTC 3TPIZ 3DCLA 2ZGJA 1DUAA 3ZZ7A 2H9TH 5K0HA 2WINI 1GMDG 2BOKA 2LP6A 2XCNA 3LU9B 3PLKA 5CDFE 1MBMA 1E0FD 3H7OA 4XBCA 1KTSB 1PQ8A 5K7RA 1IHTH 4U30A 2XC0A 1SQOA 1VGCC 3GY7A 4D7GA 3RMNH 1DPOA 3A7TA 1ACBE 1XUHA 1G2LA 2BQ7B 1YPJH 2PSYA 3KN2A 4VGCC 4Y0ZE 2FX6A 1PQAA 1FPCH 4KELA 5CHAB 1FN8A 3RXQA 3EE0B 1K1NA 4I32A 2BTCE 4XFQA 3STJA 3TITA 1AFQB 1MAYA 2BVXH 4OS5A 1KLJH 1WXRA 5C1YA 5LPEA 3PWBA 5EG4A 4J2YB 5EU8A 1EJAA 2UWLA 4J1YA 4YLUA 2ZA5A 1HDTH 1JIRA 2A4RA 1FY4A 3KQEA 3M37A 3RC5A 2IPHA 1NT1A 3TK9A 1A7SA 4NZQA 3V0XA 4B6EA 4JZ1A 4YLQH 1ARBA 1TMUH 1NFWA 2BVSH 3S0NA 2OQ5A 3FFGA 3BTTE 1N6XA 2SGFE 3CS0A 1O2WA 1SKYE 1YLCA 1QURH 1GG6C 1V2QT 1MU8B 1HAYB 2VIOA 1L1JA 1GVKB 1SI5H 2J38A 1DANH 3L3TA 1NBMD 5ESTE 1DOJA 2BLVA 1XKBC 1OWJA 2AMQA 2QXIA 3SUGA 3S7HB 2P94A 1ETSH 1GBDA 3RXOA 2J97A 1FJSA 3T28A 4BXWA 3VB7A 3BIUH 3NZIA 3ZVAA 1LKAA 2K0QA 1UTLM 1GJCB 1GI7B 1C5SA 1GJ9B 2OXSA 3E16B 4X8UH 4F55A 4BTTB 3EE7A 4IN1A 5A0CA 1IQIA 1P9SA 1V2TT 3P92A 4FUJA 4WH8A 3LGWA 2RA0A 1DT2A 1MZAA 1NU7B 2BY6X 1MQ6A 1YCPH 2ZFTA 1UCYK 2CHAB 2ZDKA 2TBSA 1P2JA 1UTOA 1CGJE 1O0DH 3SU5A 3SQEE 2Z9IA 1VITG 1C2EA 3NCLA 1G3BA 3CS7A 3TK6A 4TT3D 4YXWD 1TAWA 3GCTG 4MNYA 2A7CA 9LPRA 1FNIA 1RS0A 3BTKE 1SB1H 2ODPA 1CT4E 1XVOA 2GCHF 4H6SB 1EPTB 4I86A 3P8FA 5H4IB 4DIHH 1TOMH 2FOAA 3EQ0H 1G37A 5F6MA 1TRNA 4H42U 3SNDA 3SUEA 4CRGA 2G00A 3S9AA 3URCA 4FUEA 2BVRH 2UUKB 3ELAH 1LKBA 5IYTA 1PPEE 1GWAA 1ZPCA 5LPRA 1O34A 3QGJA 4SGBE 2XYAA 1K1JA 4PROA 2M2AA 1EQ9A 4I8LA 1BBRH 1T4VH 4ISNA 5E0JA 5FBIA 1OYTH 4DURA 5A2MH 1QJ7B 2FMJA 1NY22 4AGJA 4X1NU 3SU3A 3G01A 3U1JB 5FCKA 2BY5X 4A1XA 1XUKA 4Y8YA 3S9CA 2OINA 1AB9C 4MNWA 2A5IA 4DOQA 5EXNA 4ZKOU 1KXFA 3UWIA 3NK8A 3SHCH 4D9QA 3F3BA 3MU5A 4Y76A 1GHAF 4K60A 4O3TA 1OP8A 1EB1H 5JBTA 1CA0C 1SPJA 1KSNA 1OWKA 1P2OA 1ID5H 2TRMA 1C2FA 3RUOA 5B6LA 5EOKA 4LZ4B 4X8TH 1VCQA 3A87A 4FUGA 1B7XB 1TRYA 3U98H 5JB8S 1FZZA 5IK2D 3A82A 2BDAA 1ZZZA 1VJ9U 2G81E 4I8HA 2PWXA 2V7QD 1L1GA 1NZQH 4Q7XA 1P2QA 4IC6A 1LQEA 5HIZA 3MFJA 4ASUD 1N6YA 2FOGA 1O31A 3BG4C 3PB1E 3GCHC 2CJIA 1ZMJA 3O8RA 5C0TA 4E7RG 2G5NA 1NROH 2GV7A 4MG3A 8LPRA 4F49A 1S81A 3L33A 5AHGH 5GDSH 1ZJDA 1ANDA 1HIAA 4ESTE 3K9XB 1T8MA 3ENSB 2FYRA 2R2MB 1SGYE 4XBDA 1D9IA 3A85A 3ATMA 2IJD1 3OTPA 4OS4A 1T7CA 2WPLS 3KNXA 3TJVA 3ZVGA 2EEKA 1DY9A 4GUXA 2AMPA 1EJMA 5AFZH 4H6TA 3RM2H 4FVDA 3PMAB 2KM0A 1TOCB 1HAGE 2VWMA 1OP0A 2L74A 1KDQB 1IQLA 2HVXA 1SLWB 5I46H 2ZFQH 4Y79A 1C1RA 2GCTB 2ZP0H 1LPZB 1NO9H 2EC9H 1TE0A 1TWXB 1ELEE 2F43B 1L4DA 4INKA 1BTXA 1ELFA 1IQHA 1GBHA 1O2LA 2QF4A 3F0PA 4K8YA 2YOLA 2Y82A 4AFZA 1GBMA 4X0WU 1HJ9A 2R3YA 1UVPA 2ZZUH 1EZQA 3RXBA 1NC6A 2H9EH 1QNJA 3GDUA 4FVBA 1Z8GA 1GGDC 1AKSB 1E34B 1BB0B 4XBBA 1IQKA 3E90B 5E0HA 1MD7A 1AO5A 1RJXB 4R0IA 5F8TA 5CMXH 5C2ZA 4ABAA 2OQUA 2CXVA 4Z1MD 1TLDA 3SJOA 1Z8RA 1ZRKA 3RXRA 1GI3A 2BMGB 2ZF0H 2TGTA 4UE7H 1C1VH 8GCHF 1DWEH 3A8AA 1K1MA 3SYJA 2AMDA 1UHBB 1MTSA 3MNXA 1RTKA 1QJ1B 2W7SA 4BAHB 5I25A 2VIPA 4IW4E 1DSUA 4FXGH 1SGTA 4XD7D 4X8VH 1O2PA 1FY1A 3GCTF 4X6PA 2SGDE 4D7FA 1WYKA 3F9EA 2OTVA 1GHXH 3A7VA 2ZGBH 3MNBA 3HK6B 4I33A 3M7QA 3E1XB 1AI8H 4MLFB 5EJZA 2FX4A 5GNDA 1Y3UA 2BX4A 2P3TB 1O2NA 1DE7H 2V3MA 3FN8A 1BQYA 1W14U 3O8CA 1BTHH 4FUIA 4TYDA 4E7NA 5A09A 3QWCH 2ZGHA 1HAOH 2ZDAH 1QBVH 4FU7A 1GI2A 2FWWA 2BDHA 3A8DA 4TY6A 3M3VA 4NIYA 3VB4A 1YKTA 1CA8B 4CH8B 1C2MA 1XUJA 1ELVA 1N8OC 3SV6A 1RXPA 1DX5M 1GMCF 4KTUA 2FEQH 3ZZ5A 3MWIU 1J14A 1UTPA 1ESTA 4YZUA 4ACBA 3RXDA 5TCCA 1XKAC 1ZTKA 2D1JA 1ANCA 2STBE 4GCHG 3W95A 3KF2A 2ANWA 3TGKE 1O2SA 3PV4A 1EPTA 3VPKA 1A0LA 4AFUA 1J16A 1L4ZA 1O3CA 3E6PH 7ESTE 4NSVA 1W0ZU 8KME2 4LK4A 3D62A 1SBWA 5T6FA 2FODA 1C9TA 2C8ZB 1E79D 3M5MA 2UUFB 2VVCA 4Z0KA 2KAIA 4WWYA 1Z1IA 2GJGA 4AYYB 3I77A 3N7OA 1W10U 1MBQA 2VVUA 1JMOH 2OBQA 3UIRA 1J8AA 3AAUA 4GSOA 2XBXA 3EAJA 1XM1A 3CP7A 3RU4D 1PPCE 2GTBA 3ITIA 3UR9A 3LIWA 3LKWA 1P09A 1SC8U 2AERH 4ZUHA 2EY4C 3M35A 3BEIB 4A7IB 2VIQA 4F4OC 4TWWA 2J5UA 2K1QA 1C1PA 1O2TA 1O3EA 2VH0A 4K3JA 4OS1A 2GZ9A 2VIDA 1GDUA 1TBQH 4Q4LA 1WTGH 2R0LA 5EW1H 2QF0A 3Q3KA 2OC0A 3ZZ8A 1V2PT 2O9QA 1CSOE 5F03A 3ZVDA 2BD2A 3RXAA 1EAWA 3EYDA 1C5OH 1VITH 3ZZCA 1J15A 1F0TA 1F7ZA 1KXCA 1PPGE 1LHCH 1FXYA 4X6OA 1YGCH 3UNRA 1AVGH 2A1DB 4ZROA 4GAWA 2EI7A 1GJDB 2VIWA 1O33A 2Z3CA 5HGGA 4UFGH 1K1IA 4XSKU 2BDYA 1W13U 3F2HA 5DK1A 2UUYA 4WY3A 1HAPH 4MNVA 1TX8A 1H1BA 2KCOA 3PM3A 3OU0A 1PYTD 1RD3B 3VG8A 4I8GA 1C1WH 4MQAA 1ELAA 2VWLA 2Y7ZA 4ZCNA 4A6LA 1EAXA 3H5CB 3KQDA 1NRQH 4CRDA 2ZFRH 1YM0A 2WYJA 4O9VA 3WY8A 5C1XA 3R3GB 5FHTA 1W3CA 4CRAA 3QO6A 5T3HA 3RXIA 1QBNA 3IWMA 2NU1E 2H5CA 3OY6U 1OHHD 3TGIE 3OTJE 5L30H 1A1RA 1K28D 2CF9H 1W7GH 1O37A 1S84A 1ANBA 1T8OA 3GS9A 3UTUH 2XWBI 4DCDA 1BRAA 1QB9A 3MI4A 1QFKH 3TH2H 5C67A 2PW8H 1G9IE 3SU0A 1NFXA 1HNEE 1E35B 3T27A 4JZEH 1SQTA 2AGGX 1JRTA 2P8OC 1MKXH 1FY5A 3PRBA 5T6GA 1TNKA 4NFFA 1OWHA 4ISIH 4WXIA 1P2IA 1YPGH 5HM9A 3N7EA 4X2XA 1ANEA 3F9FA 1W0YH 4RT1A 1ETRH 4Y8XA 3M5OA 3DT0H 3L6PA 3BTWE 1GBTA 2BYAX 3D49H 3RC4A 3MO9A 1HFDA 4HG6A 1GJ7B 3QUMP 2ZU4A 4CREA 6GCHG 1A0JA 1THRH 5LPFA 1C1TA 2RA3A 2TGAA 3V12A 2UWOA 1FMGA 3GCHB 2ANMH 3KCGH 1C5QA 4GVUA 2PP6A 2A5AA 3QK1A 2ZQ1A 1COWD 3HK3B 1BITA 1TYNA 1B0EA 1MCTA 1UK2A 1GDNA 1SR5C 3RXTA 4FUCA 3JZ2B 3TJOA 2A5KA 1L1NA 1D3QB 2JDID 2W26A 1QIXB 2GDDA 1SOZA 1KTTB 2KR7A 2PGQB 5LH8A 2LPRA 3GY2A 1FPHH 4LXBH 1YF4A 2OD3B 1BIOA 3HATH 3P17H 3SZEA 1PPFE 3UAIC 2ZEBA 1SGDE 1DY8A 2A2QH 1GVZA 3OY5U 3DA9B 2YNBA 4DY7B 4YTAA 1P06A 2ODQA 5GXPA 3GYMA 1Y5BT 2LNCA 3D23A 2CK3D 1QGFA 2LELA 2JH6D 1UJ1A 1XUIA 1GHWH 2Z3DA 3WWFA 2XTTB 4WJG2 1QB6A 1O2HA 2VU8E 1HUTH 3A83A 2ZHWH 3F9HA 1NS3A 4OM9A 1FY8E 2FIRH 2I6SA 2JJ2D 5EXLA 4WH6A 1BT7A 2P59A 1LMWB 1GBKA 1QRXA 1QL9A 2O8LA 1CO7E 1UVSH 1E1RD 4GPGA 1LHGH 2BDBA 1JWTA 5EODA 1AVWA 3R0FA 1LHDH 2ZDVH 1S6FA 4KTCA 2IPQX 2K8IA 1TNLA 2ZHDA 3MMGA 1YPMH 3PRDA 1O2JA 2A7HA 1WQSA 1AD8H 1G2MA 2PTCE 5DO4H 4YESB 1P9UA 3DD2H 2SGPE 5C1UA 1K21H 5GJ4B 2HVYB 3KGPA 3UUZA 5AVDA 1V2OT 1O3MA 4U2WA 3VEQB 3Q77A 1E1QD 3PV5A 3V13A 1SGFG 2GVFA 1A0HB 1WOFA 2PUXB 4I31A 2VGCC 2WPMS 5EPNA 9ESTA 2FPZA 1WSSH 2ZCHP 3GY5A 2B5TB 1TNIA 2GT8A 4O03A 1DM4B 8GCHG 4MPXA 2HNTF 1ZYOA 2PGBB 1C1OA 2BQ6B 1HJAB 1V2KT 1T8NA 2BLWA 1UTNA 2BXTH 3KHVA 2GV6A 2FI5E 1Q3XA 1ELCA 3ATIA 4A5TS 1DUEA 1V2JT 2FS9A 2Z94A 3P8GA 1XUGA 4KP0A 3TNSA 4MNXA 4OS7A 2R0KA 1SL3A 1KYNA 1O5EH 2WHXA 2Z9KA 2QY0B 1IQGA 4DJZB 1BHXF 3UFAA 4SGAE 4YT6H 3ZV8A 2WPDD 3STIA 1O3AA 3ZZDA 4BXSA 1V2MT 4P00A 4Y6DA 4Q2KA 3SZNA 3W94A 4NSYA 4Y8ZA 3O8BA 2WSSD 3ZZ4A 1RRKA 1Q31A 1CVWH 1VKYA 1IQFA 3IG6B 2XOKD 2QF3A 1ABIH 4NIXA 1CA0B 4FU9A 4X6MA 4M7GA 1C5WB 4I7YH 2Q6DA 1ABJH 1O5BB 2OC7A 1Y5AT 5C94A 5JDUB 3LDXH 1O5DH 2Y5GA 2RCEA 1K0HA 1MKWK 1IQEA 1EOJA 3A8CA 1O2XA 4HZHA 2XC5A 3FO8D 2G8TA 1ZOMA 4DGJA 3SV7A 1Z8JB 3RP2A 1MU6B 1CHGA 3BTEE 1BCUH 2ZO3H 3FOAA 1FUJA 2BX3A 1SG8B 4WF8A 2QC2A 1SGQE 3MO6A 1BBRE 3LC5A 4GLYA 1A5GH 2F9NA 2HOBA 2UWPA 2G52A 1C5UA 7LPRA 3Q00A 3LJJA 1GJ8B 2PLXA 1Z8IB 2CV3A 1NRPH 1O3LA 2AEIH 3FKSD 3RXKA 2BDCA 1ESAA 2FI3E 4YOIA 7GCHG 4CBNA 2ILNA 4CRCA 2Z7FE 1FAXA 1A3EH 1J17T 3SN8A 5E0GA 1SLUB 3ZZBA 3HKIB 2TGDA 3VXEH 1K2I1 1O5CB 1P8VC 5C20A 1P57B 1YCPM 4UDWH 3M7UA 1CBWC 4X2VA 1DFPA 5DP9A 1GBBA 1MTVA 1YBWA 4ABGA 1C4V2 1WDIA 3UY9A 1HIAB 2O8TA 3SW2B 4O3UA 4CRFA 1ZPZA 2TIOA 4YOGA 3ZYDA 3LGYA 1JBUH 1TX6A 5PTPA 4UEHH 2W3IA 3TH4H 1GJ4H 5CE1A 3QTOH 3MH4A 4DT4A 3CNRA 3I29A 1SGCA 2HWLB 2WV4A 1E36B 2F9BH 2ZFFH 3BG4B 2RDLA 2VINA 3LGTA 3MH6A 6CHAC 2NU0E 5C5NA 4CBOA 1DXWA 1EAIA 2GDEH 4FETA 3QX5H 1HXEH 4R8TB 4AB8A 1BJUA 3MH7A 1NESE 1LTOA 1QTFA 2F9UA 1K1LA 4AC9A 2ZTYA 2J94A 2R2WU 4NIVA 1L0ZA 3Q3XA 3RXVA 2XC4A 3E0PB 1W2KH 1BRUP 1P04A 2W3KA 2Y81A 5JPMH 1D3TB 3GDSA 2FDAA 3AASA 5FXLA 2CF8H 1U6QA 1ZSKA 2VGCB 1B0FA 1GI8B 1VCPA 2WPHS 2XXLA 1ZTLA 1HB0B 2C4FH 2A7JA 2HPPH 1G30B 1ZLRA 4IGDA 1AZZA 2ZHEH 4JK5A 4JZIA 1A61H 3F9GA 1THSH 4XOJA 1LVYA 2J98B 3QZRA 2M5TA 2AIPA 1PPHE 1DVAH 1FLEE 2R9PA 5AFYH 1D4PB 2VBCA 2ALVA 1A5IA 1Y8TA 1O2ZA 2ZTZA 3GYLB 2B8OH 1KXDA 1BA8B 1F5KU 1GVLA 3GISB 2AIQA 3KEEA 5JBBS 1GBCA 1AFEH 1SFIA 2J98A 4X8SH 4H4FA 1O2MA 4A92A 2JH0D 1YPKH 3RU4T 2VVVA 1IAUA 1EUFA 4ZHAA 1FV9A 5BPEA 4ABEA 2QV1A 3I78A 2WYGA 2DE8A 5DKMA 2ZG0H 4INHA 1O5FH 1S6LA 3T62A 3SV9A 2NU2E 4DVAU 5FCRA 4D8NA 2WUBA 1TQ0B 2GMTB 3HGNA 3ZVCA 1ELTA 5C0UA 5HIYA 1H9IE 1SGPE 1TALA 1LVOA 3TNTA 1E37B 1YY3A 1SFQB 2IJOB 2Y5FA 1BMAA 5EQSA 3KL6A 1TA2A 1EAUA 1C5TA 2KCPA 4AFSA 1HAZB 4Y7BA 1CQQA 1CGHA 1EASA 3OX7U 1HAHH 4UONA 1P2NA 1ELDE 1P01A 1UTJA 4MTBA 3U28C 1JXPA 2AGEX 4MPWA 4B75A 1O3HA 1NU9A 1AQ7A 1K1OA 5FPSA 4RT0A 1OX1A 1F0SA 4K69A 2QF5A 2VH6A 4DW2U 5F53A 1HCGA 1PQ7A 2PKSB 2P93A 3VGCC 1QY6A 2W6ID 2OBOA 2PUQH 3RXFA 3A7WA 2AFQB 3C1KA 3F2GA 2XNDD 1O2OA 2C8WB 3Q76A 1Z6JH 3BSQA 5KEDA 1S5SA 1TGNA 1Y3YA 4HTCH 1C5PA 4CR5A 3B8JA 2ZFSA 3GY6A 2ZCKP 2VB0A 2XRCA 1V2LT 1SHHB 4I8KA 2ZI2H 1LQDB 2ZECA 3VFEA 1F5RA 4BNRA 2ASUB 1WAYB 3PO1B 1EX3A 1BOQA 1MTNB 1NN6A 3V3MA 3BTFE 2VIVA 4BAMB 1QBOA 4OS2A 1D3PB 1KLTA 1AB9B 4UFDH 5EQQA 5A0BA 2FTMA 3QTVH 2YMSB 1B5GH 2TPIZ 3FP8E 1C5YB 1GL1A 4WMDA 2QA9E 1EZSC 3LONA 5FX6A 1ZMLA 2Q6FA 2BD5A 2AS9A 5HYOA 1O2IA 2KCAA 2WPKS 1UVTH 2QAAA 4OGYA 1GJAB 1RTFB 1C2LA 1V2UT 3LPRA 1V2WT 4XRNA 1YPHE 5ABWA 3HKJB 1GHYH 2FOFA 1H8DH 2G5VA 1GBFA 2ZU2A 1VGCB 3A7YA 4GCHF 4IMQA 1A3BH 2GGVB 3CENA 2XNIA 2A45B 4RSPA 1C2HA 1S83A 3DHKH 4X6NA 3IITA 3PTBA 1LVMA 2ALPA 4X1QU 5DP4A 1P02A 5EGMA 2PKAA 1HRTH 3EA8A 1N8OB 1MH0A 2ZIQH 3P8NA 2FESH 5DP8A 2RFKC 1K1PA 1HYLA 2C8XB 5JB9S 1OOKB 1ESBA 4OS6A 5A8XA 2A32A 3ZVEA 2ZQ2A 4BANB 3TK5A 3NPSA 3FZDA 4X2WA 1QJ6B 1VZQH 1AU8A 1MAXA 4E06H 5ETXA 1AWHB 1C9PA 1OPHB 5F8XA 1UVOA 1QQUA 1TIOA 1UK3A 1C5NH 1GI1A 3S69A 1GBEA 1NTPA 5LGOA 3OE7D 2BD8A 3K65B 3E8LA 2OC8A 3FANA 1O35A 1O3DA 2QXGA 3MOCA 1HLTH 3E3TA 4IC5A 3QZQA 1WQVH 1YLDA 3P70B 4WMFA 2BD3A 2AGIX 1G3EA 3U8RH 3UQVA 2XBVA 4M9FA 5JYIA 1BTWA 1PPBH 2D2DA 4AB9A 2O8MA 1HJAC 1GHBF 2J4IA 3LH1A 3F2FA 4ZHMU 1C1MA 1C5ZB 1JRSA 2CN0H 3A88A 1O3KA 4Y71A 3SU6A 2F4LA 3RXGA 3SNCA 3F68H 4ZH8A 4FOUC 2GT7A 1RIWB 2GZ7A 1OYQA 3SU1A 1KLIH 4CH2B 1AY6H 1FIZA 1F92A 1TBZH 1Y3WA 3BTDE 2QIQA 3AVZA 7KMEH 1GMDF 4FU8A 4X1SU 1UTKA 3NKKA 2ANYA 3ZZ9A 2GCTC 2BLOA 5ESBA 1CGIE 1AE5A 1O2GH 2ODYB 1MTNC 3GOVB 1BDAA 2PTNA 1DLKB 1O3FA 1SGFA 1WV7H 2BY7X 2NU4E 1DWBH 5E2PA 2ZPSA 3U1IB 2BD7A 2VNTA 2B9LA 5DPAA 1TPSA 4Q63A 1XUFA 3M3SA 4JYTA 3TGJE 5HMAA 3TU7H 1F2SE 4YO9A 1D6WA 2KX4A 1W7XH 1BMLA 5T1VA 1YPLH 1G3DA 1GBIA 1GJ5H 4Q80A 1YPHC 1T31A 4YM9A 1QB1A 4NFEA 4HGCA 3AW0A 1UHBA 3OSYA 3N99A 1TA6A 3A81A 3T25A 3P6ZB 2QXJA 3SU4A 1W0KD 1AZ8A 2ZU3A 1C2GA 4XE4A 1DXPA 1SGRE 4B73A 3RC6A
chains in the Genus database with same CATH topology
3ZVFA 5TCAA 3QLPH 3NWUA 2OUAA 1BBRK 1DITH 3SJIA 1LCYA 1AUTC 2Q1JA 4ABDA 1TPOA 3KQBA 3GY4A 3MU1A 1CHOF 1OWIA 3F1SB 1EJNA 1GBAA 3KQCA 2Y6TA 5DP7A 3Q3YA 1O2RA 3RXJA 1P0SH 1O2KA 2DUCA 3QGNB 1DSTA 3DUXH 4CHAB 4E05H 1TPPA 1ELBA 5J4QA 1PFXC 3AW1A 4ZKNU 1ZRBA 2BHGA 5DP5A 3SQHE 2IN2A 3SI4H 1ZHRA 3HGPA 2G4UA 1WTHD 4U32A 2ZU1A 3RM0H 6LPRA 3S9BA 3EDXB 1DICA 1AUJA 1CE5A 2A4QA 1QQ4A 4ASHA 2A4OA 2FYQA 1SSXA 2BOHB 3TJUA 1SLXB 1C5MD 2Z9LA 2VWNA 4ABJA 1GGDB 3URDA 2FI4E 4K1EA 3BEFB 1GPZA 1P2KA 3FP7E 2ZTXA 1M9UA 2GZ8A 2B7DH 5IDKA 2ZGCA 5SGAE 3RLYH 1F0UA 1LO6A 2Y80A 3GCNA 1FAKH 3PTNA 4FUBA 1UK4A 4IBLH 2WPIS 1Y3XA 3E91A 3V7TA 5GWZA 1KY9A 1MD8A 1W11U 4VGCB 4Q7YA 4TWYA 1GMHG 3UREA 1GHAG 1GI5A 5AF9H 1QA7A 1PPZA 2Y5HA 1W12U 1JIMA 4ISHH 1LDTT 3B23B 4IMZA 1TMTH 3UR6A 4TPYA 2J95A 3AAVA 2SGEE 4CR9A 5GCHG 1Y5UT 4AX9H 1C4Y2 1P11E 1ZTJA 1EP5A 2HNTC 1RTLA 3SUDA 2VWOA 1G3CA 4B2BA 1S85A 1NRSH 1O3JA 2FXRA 3BTQE 2P16A 4ABBA 2KAIB 2J34A 1CT0E 3MO3A 1HAVB 4ZKSU 1SGEE 1IQJA 5G4BA 1O36A 1C4U2 1NRRH 3FP6E 1WUNH 1GCTB 3BG8A 4NIWA 5C3NA 2OC1A 5DJ7A 1AMHA 1KXEA 1O3GA 1O39A 4OGXA 1GHBG 2Z3EA 3UQOA 1VCWA 1MZDA 1TPAE 1O3PB 1QR3E 5DG6A 3LGUA 3P8OA 1ARCA 3PWCA 5GCHF 1OKXA 3SORA 4AYVB 2H9HA 1NRNH 2FOCA 3GDVA 4Y10E 3GCOA 3DFJA 2G51A 3F6UH 3MU8A 4UFEH 1W8BH 1CU1A 4K1TA 1C5LH 5EPYA 2XWAA 3EGKH 2HPQH 2GX4A 4JZFH 4K8BA 1MUEB 1EB2A 2QCYA 1IQNA 2PSXA 3GICB 4MVNA 1S82A 3PO1C 4D76A 5FX5A 4GHQA 2RG3A 4A1TA 1QL7A 1T8LA 2ZPRA 2BY9X 4QT8C 4HI3A 1QRZA 1SMFE 3MTYA 3A7XA 2STAE 3MNCA 3ODFA 4AN7A 5F8ZA 1ORFA 1TONA 4NA8A 1O2QA 3FVFB 1ZMNA 3O8DA 2FP7B 1C2DA 1BZXE 2PKSC 3MYWA 3PROA 3ATWA 1GHVH 5JBAS 2D26C 3ZZ3A 4TY7A 4HFPB 2FOBA 1HBTH 2PHBA 1QA0A 1TQ7B 2G55A 3A80A 1YYY1 2BLQA 4UFFH 2AYWA 1DWCH 3U8OH 1QHRB 1BRBE 3M5NA 5FPTA 2SNVA 3DFLA 3ATLA 3HPTB 1V6DA 4ISOA 2A4GA 2XBYA 1NPMA 4UD9H 1KXAA 3LT3A 1KXBA 1ZSLA 1BTYA 2ZDNA 4GHTA 1OP2A 1V2NT 3VB3A 3JZ1B 1P3EA 1SQAA 1TBRH 2C3SA 3PLBA 2CGAA 1QL8A 4RKJB 2SNWA 2BQWB 4NWLA 2FS8A 3UPEA 2HLCA 1MTWA 6GCHF 3M36A 1IHSH 2QYIA 2H1UA 1TABE 2F83A 2AH4X 2J2UA 1J9CH 3SJ8A 3SGQE 4NCYA 1A46H 2NWNA 1K22H 1LHEH 2W7UA 1TGTA 2EI8A 4NWKA 2ZNKH 4WXVA 1Y3VA 1Z71A 3RXUA 4RN6A 1BTUA 1O3OA 2GD4B 3QDZB 2I6QA 5A8ZA 3SUFA 2HRVA 1D6RA 1ETTH 1QRWA 2F91A 2ZPQA 3MHWU 4ZKRU 1P05A 2WUCA 5FBEA 5T6DA 3SNAA 1EP6A 3T2NA 1O3NA 1T32A 2QN5T 1DWDH 1GJ6A 1RIWC 2XW9A 3M5LA 4ISLA 2Z9GA 1RFNA 4ZXXH 2ZHQH 3SGBE 3P95A 4K2YA 4MDSA 3ATKA 5GIBA 3D65E 1TRMA 3A84A 3RMLH 2IOTA 3TLOA 4FUHA 1O5GH 3SU2A 1C2KA 3ZVBA 2H2ZA 2BXUH 1P12E 4RKOB 4D9RA 1BRCE 5E2OA 3TJNA 3KIDU 1HAVA 3LGIA 1GMHF 1H8IH 3TVJB 1ZGVA 3RMMH 3LOXA 1ZPBA 2FLBH 3FAOA 2GCHG 1YCPK 2DE9A 2ZGXH 4B2CA 2QXHA 4LOYH 4BTIB 1VJAU 5L2YH 3VGCB 4THNH 7GCHF 3BN9A 4JZDH 1GL0E 1TNHA 2PKAB 1SOTA 1P03A 1TNJA 1F5LA 4Y0YE 2W5EA 3SJKA 2CMYA 4B76A 2ZWLH 2GMTC 2J9NA 2ZC9H 2FTLE 1F0RA 1ELGA 1MCVA 2JH5D 1XXDA 2BDIA 2FOEA 3GY8A 1MQ5A 1BUIA 3U9AH 1C1UH 3RLWH 3RDZA 3VB6A 2H5DA 1GG6B 1GI4A 1Z1JA 3PMHB 2ZDMA 2Y7XA 1GMCG 1BTZA 2G4TA 4NA9H 5L2ZH 1BMNH 4X2YA 1EKBB 4KKDA 1THPB 2ZDLA 2EA3A 1FDPA 3B9FH 5C5OA 1HPGA 2OLGA 1D3DB 2PV9B 1C2JA 1OS8A 1WCZA 3MU4A 1C2IA 3OYPA 1FN6A 2JETB 3ESTA 3MH5A 1TGSZ 5TJXA 1MKWH 2GP9B 1S0RA 4JK6A 3RXSA 5DP6A 3U69H 1C5XB 2V0BA 3A89A 3BEUA 1EZUC 4ZHLU 2GKVE 3UOPA 4JCNA 4AG2A 1KIGH 2B0FA 3PMJA 4JYVH 2F9VA 5BRRE 3UOUA 2C93B 3K6ZA 4ZXYH 1EXFA 1OWDA 1HV7A 2O8WA 5FAHA 1C5VA 1H4WA 1TNGA 5J4SA 4BAKB 1AKSA 1AFQC 3H7TA 2ZU5A 4K1SA 1OWEA 1T4UH 1H9LB 4WMEA 2YNAA 2V6NA 3K6YA 3MNSA 3QN7A 3SI3H 2P95A 1AE8H 3ODDA 1EPTC 3BTHE 3T29A 1SVPA 3LJOA 1C5RA 1JOUB 2R3UA 1FIWA 1NM6A 4X1PU 4ABHA 2NU3E 2F9OA 2WPJS 1PQ5A 2J92A 2C90B 1L2EA 1GI9B 4JMYA 6CHAB 1OXGA 3A8BA 2SGQE 2A0QB 2EI6A 1S0QA 4XDEA 3A86A 1TGBA 1O2VA 2XBWA 1UTQA 3UWJH 1LPGB 1H9HE 3NUMA 3EA9A 2ZCLP 4IS5A 4KTSA 4INLA 1Q2WA 1UCYH 2P3UB 1SLVB 4B2AA 3BTGE 5EXMA 1FI8A 3U8TH 2FM2A 4YOJA 1TMBH 1KDQA 1PJPA 1WU1A 1CBWB 3RXHA 6ESTA 5GPIB 1NFUA 3SGAE 3PLPA 1UMAH 2ZFPH 3TIUA 1XVMA 1C1QA 1E38B 2JKHA 3M61U 4Z6AH 3A7ZA 2HNTE 2V3OH 4ZAEA 3SBKA 1WBGB 2QGRA 5B6OA 4Y11E 3SHAH 4BTUB 3LC3A 1HXFH 1VITF 1ZR0A 3FZZA 2F9PA 1AWFH 1Z6EA 2Z9JA 3RXLA 1ZJKA 3BIVH 1UVUH 2BZ6H 3BV9B 3ZV9A 4TPIZ 1EATA 4I8JA 1Y59T 3PMBB 1SGNE 4U01A 5FPYA 1FQ3A 3T5FH 3MU0A 1DS2E 4MPUA 2BDGA 1XXFA 1XMNB 2V3HH 1GBJA 5L6NH 3RXPA 4YT7H 1HAIH 1OSSA 2C8YB 2F3CE 1C1NA 4DT7B 1MTUA 4O97A 3UNQA 2A2XH 4JYUH 2D8WA 4BAQB 4FUDA 2HALA 2OCVB 1A5HA 3ZZ6A 1BTPA 4NA7A 2ZKSA 1P2MA 2BD9A 1GBLA 5A0AE 3SV2H 1UO6A 5JBCS 1O38A 5CHAC 1TB6H 4NG9H 2WV5A 3UNSA 1K9OE 2BD4A 1V3XA 1YP9A 4AOQA 2BB4A 1GCTC 1O3BA 1C1SA 2CHAC 3T26A 1LHFH 1P3CA 1QCPA 3SNEA 4CRBA 1GCDA 3M3TA 4NZLA 2FO9A 1DLEA 4LZ1H 1EOLA 1N1LA 2P3FH 1SHYA 3SOSA 1UCYE 5EQRA 4ZMAH 1SGIB 3VB5A 4BOHA 1VR1H 1CHOG 1TGCA 4DG4A 4NGAH 1GI0A 3SNBA 5HM2A 2BM2A 1AGJA 2PR3A 4X1RU 3GY3A 2UUJB 2Q6GA 1O2UA 5HXFA 2XCFA 1MKXK 2VJ1A 3RXEA 2FZZA 1GJBB 2SFAA 1YPEH 1V2RT 3RU4E 1BMMH 2FOMB 3RXMA 1AVXA 4KGAA 4B71A 1AN1E 1ZSJA 4Y7AA 1A2CH 3E0NB 1P10A 2A31A 1XX9A 3LGVA 4B74A 3VXFH 4AFQA 1G36A 4Q7ZA 1O32A 1MMJN 5DGJA 1DDJA 1HGTH 3BF6H 2H6MA 3NXPA 2ESTE 4FUFA 1FY3A 3M7TA 4ABIA 1BJVA 1S6HA 1TFXA 3PYHA 4AORA 1O30A 1ZHPA 2THFB 3ZYEA 2BY8X 1GDQA 1RGQA 3C27B 1NFYA 2P8OB 2TGPZ 4MPVA 4AG1A 5EW2H 2V35A 5E8EH 2FOHA 2ZHFH 2HGTH 4AGKA 1FONA 1INCA 1AIXH 1IQMA 4K5ZA 1ZGIA 8ESTE 3SO3A 4B1TA 2JETC 1BHXB 1X7AC 1ZHMA 2SGAA 1G32B 1Z7KA 1LPKB 4WVPE 4ABFA 1GI6A 1GHZA 2FLRH 2O8UA 1V2ST 5DP3A 3SV8A 1TX7A 3BTME 4A1VA 1IOEA 4DIIH 3K2UA 3TH3H 1V2VT 2Z6BD 1UTMA 1A4WH 4AZ2B 1HJ8A 2ANKH 1EZXC 3RMOH 3RXCA 3EA7A 1AHTH 1O5AB 3SJ9A 2BZAA 2ULLA 3ZZAA 1HAXB 2OP9A 5A8YA 4BAOB 3S7KB 1LVBA 4CHAC 1O3IA 2PFEA 3LH3A 1O2YA 4IN2A 1CT2E 1YC0A 1PYTC 3TPIZ 2ZGJA 1DUAA 3ZZ7A 2H9TH 5K0HA 2WINI 1GMDG 2BOKA 2XCNA 3LU9B 3PLKA 1MBMA 1E0FD 3H7OA 4XBCA 1KTSB 1PQ8A 5K7RA 1IHTH 4U30A 2XC0A 1SQOA 1VGCC 3GY7A 4D7GA 3RMNH 1DPOA 3A7TA 1ACBE 1XUHA 1G2LA 2BQ7B 1YPJH 2PSYA 3KN2A 4VGCC 4Y0ZE 2FX6A 1PQAA 1FPCH 4KELA 5CHAB 1FN8A 3RXQA 3EE0B 1K1NA 4I32A 2BTCE 4XFQA 3STJA 3TITA 1AFQB 1MAYA 2BVXH 4OS5A 1KLJH 5C1YA 5LPEA 3PWBA 5EG4A 4J2YB 5EU8A 1EJAA 2UWLA 4J1YA 4YLUA 2ZA5A 1HDTH 1JIRA 2A4RA 1FY4A 3KQEA 3M37A 3RC5A 2IPHA 1NT1A 3TK9A 1A7SA 4NZQA 3V0XA 4JZ1A 4YLQH 1ARBA 1TMUH 1NFWA 2BVSH 3S0NA 2OQ5A 3FFGA 3BTTE 1N6XA 2SGFE 3CS0A 1O2WA 1YLCA 1QURH 1GG6C 1V2QT 1MU8B 1HAYB 2VIOA 1L1JA 1GVKB 1SI5H 2J38A 1DANH 3L3TA 5ESTE 1DOJA 2BLVA 1XKBC 1OWJA 2AMQA 2QXIA 3SUGA 3S7HB 2P94A 1ETSH 1GBDA 3RXOA 1FJSA 3T28A 4BXWA 3VB7A 3BIUH 3NZIA 3ZVAA 1LKAA 1UTLM 1GJCB 1GI7B 1C5SA 1GJ9B 2OXSA 3E16B 4X8UH 4BTTB 4IN1A 5A0CA 1IQIA 1P9SA 1V2TT 3P92A 4FUJA 4WH8A 3LGWA 2RA0A 1DT2A 1MZAA 1NU7B 2BY6X 1MQ6A 1YCPH 2ZFTA 1UCYK 2CHAB 2ZDKA 2TBSA 1P2JA 1UTOA 1CGJE 1O0DH 3SU5A 3SQEE 2Z9IA 1VITG 1C2EA 3NCLA 1G3BA 3CS7A 3TK6A 1TAWA 3GCTG 4MNYA 2A7CA 9LPRA 1FNIA 1RS0A 3BTKE 1SB1H 2ODPA 1CT4E 1XVOA 2GCHF 4H6SB 1EPTB 3P8FA 5H4IB 4DIHH 1TOMH 2FOAA 3EQ0H 1G37A 5F6MA 1TRNA 4H42U 3SNDA 3SUEA 4CRGA 2G00A 3S9AA 3URCA 4FUEA 2BVRH 2UUKB 3ELAH 1LKBA 5IYTA 1PPEE 1GWAA 1ZPCA 5LPRA 1O34A 3QGJA 4SGBE 2XYAA 1K1JA 4PROA 1EQ9A 4I8LA 1BBRH 1T4VH 4ISNA 5E0JA 5FBIA 1OYTH 4DURA 5A2MH 1QJ7B 2FMJA 1NY22 4AGJA 4X1NU 3SU3A 3G01A 3U1JB 5FCKA 2BY5X 4A1XA 1XUKA 4Y8YA 3S9CA 2OINA 1AB9C 4MNWA 2A5IA 4DOQA 5EXNA 4ZKOU 1KXFA 3UWIA 3NK8A 3SHCH 4D9QA 3MU5A 4Y76A 1GHAF 4K60A 4O3TA 1OP8A 1EB1H 5JBTA 1CA0C 1SPJA 1KSNA 1OWKA 1P2OA 1ID5H 2TRMA 1C2FA 3RUOA 5EOKA 4LZ4B 4X8TH 1VCQA 3A87A 4FUGA 1B7XB 1TRYA 3U98H 5JB8S 1FZZA 3A82A 2BDAA 1ZZZA 1VJ9U 2G81E 4I8HA 2PWXA 1L1GA 1NZQH 4Q7XA 1P2QA 4IC6A 1LQEA 3MFJA 1N6YA 2FOGA 1O31A 3BG4C 3PB1E 3GCHC 2CJIA 1ZMJA 3O8RA 4E7RG 2G5NA 1NROH 2GV7A 4MG3A 8LPRA 4F49A 1S81A 3L33A 5AHGH 5GDSH 1ZJDA 1ANDA 1HIAA 4ESTE 3K9XB 1T8MA 3ENSB 2FYRA 2R2MB 1SGYE 4XBDA 1D9IA 3A85A 3ATMA 4OS4A 1T7CA 2WPLS 3KNXA 3TJVA 3ZVGA 2EEKA 1DY9A 4GUXA 2AMPA 1EJMA 5AFZH 4H6TA 3RM2H 4FVDA 3PMAB 1TOCB 1HAGE 2VWMA 1OP0A 1KDQB 1IQLA 2HVXA 1SLWB 5I46H 2ZFQH 4Y79