4I8KA

Bovine trypsin at 0.85 resolution
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title On the reproducibility of protein crystal structures: five atomic resolution structures of trypsin.
pubmed doi rcsb
molecule tags Hydrolase
total genus 63
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2012-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4i8kA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4i8kA02
2PSXA 5E0HA 3PM3A 5E0JA 4ABFA 1EAWA 4NA8A 1W13U 4ZUHA 2Z3EA 1O34A 3PB1E 4X8TH 4A1XA 1O5AB 1H8DH 1QJ6B 5DP3A 1BCUH 1TYNA 4HTCH 2ZC9H 2UUYA 1L0ZA 1BIOA 1Y5UT 1ARCA 2QXIA 1UVUH 3T29A 2OC7A 1AE8H 2ZNKH 2NU0E 1C2IA 2ZGXH 1AD8H 1Z1JA 2QCYA 1M9UA 1YKTA 2P3TB 1SMFE 3GY6A 1SOZA 2G5VA 2A45B 1NU7B 4OGYA 1O3AA 3FP6E 2A32A 1IQEA 3BTME 3U9AH 3RMNH 1YPHE 1EPTB 2HPQH 2ZA5A 3KQCA 2WYGA 3GY8A 4B2AA 2O8MA 1XKBC 2AYWA 3GY7A 2P94A 4ZKOU 1HJAB 2ZU1A 1FIZA 3TNTA 5LH8A 1H9IE 4K69A 3SJ9A 1FPHH 3RLYH 1JIRA 3SUDA 3SGAE 2BZ6H 1H1BA 1VGCC 1P2JA 2O8LA 2CF8H 2ZU5A 1O2WA 5JPMH 1GVKB 1DY8A 1GI2A 7LPRA 1CGJE 5DP7A 6ESTA 1K9OE 1Y3UA 1P2MA 1KYNA 4GVUA 2FLBH 4WXIA 2Q6GA 3I77A 3M5MA 5CHAC 2BY7X 1C9TA 1MKWK 1SHHB 3G01A 2QIQA 3AAUA 4IMZA 3TU7H 3RXEA 1LVMA 1K1JA 2Z94A 5C1XA 4Q7XA 2ZGJA 1UTNA 2BDGA 1UK4A 3SN8A 1BRUP 1QA0A 4LOYH 4I8HA 4ABIA 1V2RT 2ZKSA 4ZROA 2ANMH 3ATLA 1C5UA 1C5MD 1D3PB 4XBBA 1ANBA 1TQ0B 4FU9A 1O2UA 3SQHE 1W3CA 1IHTH 4YESB 1BTZA 2ZHFH 1UVOA 3F68H 2OLGA 3EA9A 1ANDA 3MOCA 4BOHA 1J14A 1A5GH 5LPRA 1V2TT 2NU1E 1QL9A 4Y0ZE 1AMHA 3E0PB 2J34A 4X2YA 2C8WB 4O9VA 4BAQB 1BUIA 1SQOA 1FIWA 1Z6EA 1LVBA 1E37B 2EA3A 1LVYA 1O3FA 1ZJKA 4Y8XA 1YPLH 2Z7FE 1TGTA 1JOUB 1KTSB 4K1EA 2DE8A 5EQRA 5DGJA 3PLBA 3SORA 1JMOH 1IHSH 8GCHG 1C1VH 1OWEA 1P11E 1GBHA 1SL3A 2Z3DA 1MQ5A 3RM2H 1CE5A 1J15A 5GIBA 1TGNA 4IW4E 1IQIA 3BTGE 1W11U 4F49A 1J8AA 1TIOA 1GJAB 1EP6A 2A4QA 2SNWA 3RXUA 4U01A 2OCVB 3TVJB 1BHXF 3A87A 3D62A 3OY6U 1EAXA 1O3GA 1DS2E 1GL0E 2F91A 2ZU2A 3FZZA 3SW2B 1CGHA 1WQSA 3GDSA 1INCA 1HPGA 2NU4E 5DPAA 5LPEA 1UTQA 1ZRKA 1SGTA 3QUMP 3SJKA 2ZTZA 5JBBS 1SGNE 2F9OA 1AZ8A 2A4GA 2TRMA 3ZZ4A 4GCHG 1O3OA 1OKXA 4XE4A 3A8DA 1LPGB 3O8CA 1RIWC 1SC8U 1XVMA 1ZZZA 4PROA 3W94A 1BTPA 3KIDU 1Q3XA 3SI3H 1OP0A 1OWHA 1ABIH 2M5TA 2QA9E 1BA8B 1TPOA 3SHCH 1GPZA 4JK6A 4Y71A 4HGCA 3TITA 2OC1A 4MNVA 1THRH 4MPXA 2ODYB 3L3TA 3DT0H 4I33A 4CRAA 6GCHF 2ZU4A 1TPSA 1K22H 1WSSH 5EXNA 2PKSC 4U2WA 4YTAA 1TBZH 4ZKNU 2G52A 1Z8IB 2B5TB 2FI4E 2GX4A 1ANEA 2BHGA 3VGCC 4IN2A 3MH7A 3VB6A 3H7TA 4OS5A 2ULLA 2W26A 3P95A 4BTTB 4K3JA 1QHRB 3ZZDA 1TX7A 1CA0B 3U69H 4X6OA 1C5NH 3WY8A 1TGSZ 1DWCH 5A0AE 2PKAB 3SZNA 1FV9A 2HLCA 2EC9H 1MBMA 4Z6AH 1C1MA 1F5LA 3QZQA 1F0RA 3LPRA 4UFGH 1DOJA 2HOBA 5I46H 2FTLE 2V3HH 4LZ1H 1ZGVA 1AVWA 2OXSA 4X1QU 3SNDA 3PTBA 3V12A 1TRYA 3PYHA 1F2SE 2HALA 3GY5A 3SJ8A 1D3TB 3SNEA 2C90B 3UR9A 2CN0H 1BDAA 5EXMA 4I8KA 1S0QA 1RS0A 4YLQH 5TCAA 5DP6A 5GCHF 2FESH 5E8EH 4NA7A 3VFEA 1HAVB 1Y3VA 5G4BA 1TABE 1LHDH 3RMMH 3M7UA 2A7HA 1AGJA 3TNSA 4THNH 3OSYA 2O8TA 2A7JA 1GL1A 2VIDA 3S7KB 2WUBA 5T3HA 1AFEH 1GJ9B 2ZFFH 3M5NA 4INKA 3RUOA 4YM9A 1HAZB 5A8YA 2LNCA 3FVFB 4AFQA 4ZHLU 4NZQA 2A7CA 1A7SA 2VWLA 5DO4H 2QAAA 3LGUA 1GCDA 3RXLA 1L2EA 4A6LA 2A5KA 1T8OA 3SV7A 1O2ZA 5EW2H 1P02A 3PWCA 4Y10E 2ZCHP 4Y8ZA 4OS4A 2XBXA 5TCCA 1FY8E 1AKSB 3TH3H 1AB9B 1JRSA 1J9CH 4H6SB 4SGBE 2Z3CA 1TOCB 3EQ0H 5DG6A 2OBOA 3ZZ5A 1YLDA 3R3GB 2F9BH 1TNHA 5HM9A 1L1NA 1AE5A 2P3UB 4CRGA 1GVZA 1NS3A 3RC4A 2BB4A 2RG3A 1TALA 1NPMA 4X8VH 2FOFA 2ODPA 1NN6A 1K1LA 3B23B 3JZ2B 1QL8A 3RXVA 4CBNA 3GY2A 5EG4A 3QN7A 1CHGA 1SGFG 1OSSA 1BT7A 3A88A 1AFQB 3C1KA 4INLA 1C1QA 5FPYA 3TGIE 2A5AA 2PR3A 1HV7A 1FONA 5GXPA 2NU3E 3RXSA 1ORFA 4E06H 1A0HB 1ESTA 4Y8YA 4CH2B 3F6UH 3DA9B 1GI8B 3F9FA 3Q3XA 3MHWU 1C4Y2 5LPFA 1Z6JH 2RDLA 1A5HA 2IOTA 1BBRE 1HAIH 1NRSH 2R3YA 1GHYH 1HAXB 3DHKH 2XYAA 4B2CA 1V2MT 3AAVA 2UUKB 3URDA 2YOLA 5DP8A 3ZZ6A 1W7XH 1G9IE 3SBKA 2CHAB 2RCEA 3LJJA 1DPOA 4CRCA 5FPSA 1SI5H 1CBWB 2J9NA 1FN8A 5ESTE 4E7NA 2A4OA 5FBIA 1HAPH 3VEQB 1MAXA 3RXTA 1ELGA 3MNCA 3SO3A 1UTLM 3RP2A 3A8AA 3A86A 3EYDA 1Y3YA 4NGAH 1G30B 3M7TA 1HAHH 2OUAA 1ETSH 1TMUH 2RA3A 3SV6A 4ABBA 5A2MH 1YBWA 3MU4A 2ZFSA 8LPRA 1BMAA 2CGAA 1LQEA 3CS0A 1TGCA 2BMGB 1K21H 2V35A 5JBCS 1TFXA 2W7UA 2KAIA 2PW8H 1UCYE 2R2WU 1IQMA 3GYMA 1OP2A 1GJ8B 1NESE 3SU3A 2ZQ1A 4DY7B 3T25A 3K9XB 1XMNB 2BYAX 4Q2KA 4DW2U 3EE0B 3L6PA 2GMTB 1V2QT 1GGDB 4CH8B 1PQAA 1DWBH 4MNYA 2OQ5A 1ZTJA 4UDWH 5AVDA 1LPKB 4O3UA 1UVSH 1YYY1 1GBBA 1ZJDA 3M7QA 1KXFA 1EAIA 1O3LA 3SU6A 2NWNA 3OTJE 1KXEA 3QX5H 3S7HB 1JIMA 1O2RA 4X6MA 5JDUB 1GHWH 1WAYB 4R8TB 2DUCA 3RU4E 3FP7E 1ZGIA 3R0FA 1O2XA 4MNWA 1SGCA 4M7GA 2A0QB 2OINA 1K1IA 4YZUA 1N8OC 2OBQA 3ATIA 1QRZA 4DJZB 1GBDA 1P57B 4BAKB 2GP9B 1VZQH 1C1UH 3Q77A 3NKKA 5EU8A 3T27A 3VXEH 1F5KU 1ELTA 4FUEA 1MTNB 1W8BH 1GBFA 2BD2A 2ZP0H 1O3PB 1GCTB 1NRNH 2FOAA 3MU0A 1K1OA 2P93A 1SLXB 4XOJA 2IPHA 4MDSA 3ZVDA 3PLPA 2WPHS 1JWTA 3NXPA 1PQ8A 3A7ZA 1SLWB 1EJMA 2UWOA 4TPIZ 1NTPA 5CE1A 2CJIA 2PWXA 1AHTH 4ESTE 1G2LA 2JETB 4NA9H 3UTUH 3O8RA 1DX5M 3GDUA 5T6GA 1JRTA 3RC5A 1TNJA 5EQQA 1AWFH 1MD7A 3QZRA 2I6QA 3RXJA 1TA6A 1TAWA 1YM0A 3BG8A 2BY5X 2W3KA 3TK6A 3SGBE 3MYWA 1H9HE 5GCHG 3H7OA 4MPUA 3RU4D 1WU1A 4AG2A 1DSTA 1CHOF 2JH0D 2W3IA 3RM0H 1SVPA 3KCGH 3AW1A 1GBIA 3NZIA 5L30H 2D1JA 2BX4A 3CS7A 2IN2A 3TIUA 1SGYE 1Z8JB 1OWJA 4R0IA 1IAUA 3HKJB 1Q2WA 1T32A 2ZFPH 4UONA 1C1TA 2G8TA 1UTPA 4YLUA 3PMBB 1K1NA 2BD3A 2IJOB 3VB5A 1HNEE 1FMGA 3MU5A 4YOGA 3BTTE 1TX8A 1C5ZB 3E16B 1MKXH 3ATMA 2FZZA 1AQ7A 2P16A 3LGTA 1SFIA 5K7RA 2FX6A 1KIGH 1ZYOA 2FDAA 3LIWA 5ABWA 3BIUH 2J94A 1VGCB 3SI4H 1GI6A 1MBQA 2ILNA 2R2MB 5FCKA 2F9PA 1EZQA 2V6NA 1GHVH 2FODA 4NFEA 1MQ6A 1PPEE 5JYIA 1GDNA 3GDVA 5CHAB 1ZMNA 1WBGB 2VH6A 2AGGX 1AI8H 2QXJA 3SHAH 1PPGE 1FAXA 1SLUB 1PPHE 3P92A 4O97A 2GD4B 1P3EA 4CHAC 2O8UA 3I29A 3V3MA 2H6MA 2FX4A 2GKVE 2STAE 1MTSA 3I78A 4IN1A 1EPTA 8ESTE 1FY1A 2Y80A 2VWMA 2AS9A 1Y8TA 1N6YA 1A46H 4INHA 3RXHA 3M3TA 1A61H 5A8XA 1DWDH 2GCTC 1XX9A 1O33A 4X1SU 2VIVA 1O2QA 3OY5U 4FVDA 5FPTA 1ELEE 1UHBB 3S9CA 1BITA 3EA7A 3IWMA 4DT7B 1EB2A 1C5RA 2WPMS 1HJ9A 1FAKH 1C2FA 1SPJA 2WV4A 4AN7A 3ATWA 1QR3E 4FU8A 1BZXE 5HXFA 2GV7A 1O5FH 1Z8GA 1YF4A 2BD4A 3GCHC 2ZU3A 1PQ7A 1BMMH 2ZHWH 4XBCA 2ZG0H 3QO6A 3T26A 2ZDLA 4ISIH 1DLEA 1SGRE 2ZFRH 4Y76A 1O2VA 1F0SA 4NIVA 1AN1E 2Y82A 4WY3A 3KL6A 4ASHA 3MTYA 3UPEA 2F9UA 5GPIB 4ABGA 1BBRH 1V2OT 1XM1A 1YCPH 2TGDA 4OS7A 1HYLA 2HVXA 2V3OH 3HPTB 2FOMB 3UOPA 4LZ4B 1C2EA 1G3EA 5C1YA 1LHCH 4TY7A 1ELDE 2AIPA 1ZRBA 3KEEA 1GJ5H 1T4VH 1O2OA 3SV2H 3RXBA 3BEUA 1XUGA 5HYOA 2OD3B 1LQDB 4GAWA 3A85A 3ELAH 2WPKS 1C5SA 1PPZA 4A92A 4NWLA 4I8GA 2XC5A 1XXFA 4ZKSU 5A8ZA 2BD9A 2BDAA 2ZPRA 2ZDKA 5L2YH 2ZHDA 1RIWB 2V0BA 2B0FA 2FYQA 1HJAC 1FZZA 1EJAA 1TNGA 4MQAA 2A4RA 1HBTH 1GDQA 4WF8A 3RDZA 3VB4A 1UCYH 1SSXA 2FO9A 4TY6A 3U8RH 1KXDA 4DG4A 3ZZAA 2XBVA 1C2KA 3ZZ3A 2FIRH 4JZFH 1QRXA 3UFAA 2ZTXA 1EOLA 2C8YB 1E38B 1YGCH 1EUFA 5I25A 2AGIX 1ZPZA 2PKSB 2R0LA 1W10U 1PQ5A 1KXBA 4I8JA 1A3EH 4K60A 3SJIA 2OP9A 1GI7B 1RRKA 1P3CA 1IQJA 1BTXA 1XUIA 1NRQH 2VIPA 3P8NA 2AMQA 2BVXH 1ETTH 1EX3A 1P01A 1EAUA 3BG4C 3PO1C 3BEFB 1UK3A 5E2OA 1W12U 3GY3A 4CR9A 5FCRA 1HUTH 1WTHD 4A5TS 3PLKA 3MNXA 4FXGH 1GBTA 4KGAA 4D7GA 5E0GA 3PMHB 3T62A 1Y3WA 3MO6A 2AEIH 2PSYA 2VH0A 1KSNA 1V2NT 5C5OA 7GCHF 1ELCA 3RXGA 1BJVA 8KME2 1GG6C 2BLOA 1DITH 1WCZA 1P2IA 1EP5A 1T8NA 3P8FA 1VCQA 1ZPBA 1EB1H 2SGQE 1HDTH 2ALPA 1C5YB 2BVSH 2BD7A 3BF6H 1X7AC 4DGJA 4JZ1A 4ABAA 1CHOG 2WPLS 1Z1IA 2VGCC 3RXCA 3BV9B 2D2DA 3P8OA 1MMJN 3M61U 1AY6H 2BX3A 1CT4E 2UUFB 1L4ZA 3E0NB 3RXQA 3TJNA 1CSOE 2PKAA 4WMDA 3ODFA 1O35A 4GLYA 4JZIA 1C5TA 1O2YA 2BLWA 5C1UA 2ZI2H 4JZEH 1NU9A 3AW0A 1NFXA 3MI4A 3TJOA 2AMPA 1SGPE 3NUMA 2JH5D 1O2IA 4X8SH 3DD2H 2ZGHA 1J17T 1MKWH 1UVTH 1RGQA 3C27B 1S84A 4YT7H 2Z9KA 3OYPA 2ZQ2A 3PV4A 1BJUA 2EI7A 1AVXA 4FUGA 3Q3KA 1ZMLA 3ZV9A 1O3KA 1DDJA 4K2YA 3AVZA 3MWIU 3U98H 1HLTH 1W0ZU 1HXEH 1NROH 1QURH 3S9AA 1A4WH 3KF2A 1FLEE 2PHBA 3H5CB 2ZDNA 5EXLA 1JXPA 1HAVA 4Y7AA 1QNJA 1ARBA 4UE7H 3SNAA 5A0CA 5J4QA 2XRCA 1QBNA 4DVAU 3V13A 4DOQA 1S82A 2ZHEH 3HGPA 3GCNA 1MTVA 3MO3A 3RMLH 2BY8X 3OX7U 1G32B 4ZAEA 1C5VA 1O39A 2VIQA 2GVFA 4X1RU 1K1PA 1O3HA 4JZDH 2UWLA 4B74A 1TBRH 3TGJE 1QTFA 1C9PA 5FXLA 1QY6A 1BTWA 3SNBA 3U8TH 3ZZ7A 2VWNA 3RXRA 3MNBA 3A7WA 2OTVA 5IDKA 3LGYA 2HNTC 4ZHAA 2C4FH 1CA0C 1AKSA 2ZF0H 5EOKA 2H5CA 1O30A 2XC0A 4JYVH 3LGIA 2JH6D 3D49H 2QV1A 1OWKA 2QY0B 4TWYA 2XXLA 3M36A 3B8JA 2UUJB 3ZZBA 3F9GA 1YPEH 1HCGA 3QGNB 1G3CA 1GHXH 2TGPZ 3LC5A 4H42U 3SOSA 2P8OC 3BTHE 3NK8A 4RN6A 1BMLA 2TIOA 1GHBF 3TK5A 1YP9A 3FP8E 1A5IA 1O32A 2PLXA 1EATA 2GZ7A 2CF9H 1O2TA 2PV9B 3ESTA 1P03A 1GJ4H 1IQGA 1C5PA 1OYTH 1V6DA 2VWOA 3UQVA 1THSH 1TNIA 2GT8A 4D9QA 2HWLB 2ALVA 4IGDA 1T31A 1NFUA 4ABHA 1HFDA 4BANB 1HIAB 1G3BA 1XUKA 4RSPA 2FMJA 1NC6A 4NG9H 1FN6A 4BAOB 1FY3A 2P59A 4VGCC 4Y7BA 1O3BA 2TPIZ 3O8BA 4FU7A 4K8YA 1D6RA 3TJUA 1C1NA 2J4IA 2PGQB 1RTFB 1GBEA 3QWCH 1SQTA 1G37A 5H4IB 1P2KA 1ELAA 2A31A 1BRCE 4E05H 5EODA 2PFEA 1QB1A 6CHAC 1AB9C 2H9HA 2ZCLP 4YOIA 2H9TH 3M37A 4Y6DA 1ZTLA 1C5QA 1UK2A 2GTBA 1O3IA 3IG6B 2OQUA 4UFEH 1GBJA 1N8OB 3ZYEA 3ZZ9A 4ISHH 2VJ1A 4AFUA 1WQVH 2Y5FA 2OC8A 1O3JA 1SGQE 1O2GH 3SU0A 3PTNA 1NRPH 2ZGBH 1KLJH 3GCTF 1E34B 1OS8A 3Q00A 4AFSA 1C1RA 1HXFH 3K2UA 3KQEA 3MU8A 1TBQH 5FAHA 1SFQB 2R0KA 5FBEA 1SG8B 1C5OH 1BRAA 4NCYA 3LH3A 2GCHF 2WPJS 1O5BB 1KDQB 3MH4A 4B76A 1KLTA 4UEHH 1O3DA 4JYUH 1PPBH 1LCYA 3FANA 1WV7H 1XUJA 1ID5H 1ZHRA 1PYTC 1O2LA 1ELFA 2I6SA 1BHXB 3RXMA 3P70B 7GCHG 1MZAA 4AZ2B 2A5IA 1OYQA 1IOEA 5DJ7A 2EEKA 2BQWB 1SHYA 2XBYA 3QK1A 4BXWA 3A80A 3UOUA 2AH4X 2ZIQH 5GDSH 3UR6A 6GCHG 4X1PU 2Q6FA 3PMAB 2SFAA 2QXHA 3E8LA 4J1YA 5PTPA 1T8MA 2VU8E 2H9EH 1YPKH 4ZMAH 1IQNA 1NFWA 3ZVAA 1LHEH 5JB9S 1LTOA 1CBWC 3BTFE 2BDBA 2ZPQA 4A7IB 1UTOA 1WYKA 1A1RA 4DCDA 1ZHPA 2QXGA 4XBDA 1WUNH 4BTUB 1QIXB 2Q1JA 3A8BA 3A84A 2YNBA 1AO5A 3A81A 4HZHA 1TOMH 4UD9H 4K5ZA 1O2PA 3K6YA 3ITIA 2WV5A 2Y81A 2GDDA 1C1SA 6LPRA 5IYTA 1VITF 2ZWLH 1AIXH 1LKBA 4K1TA 1S6FA 4NIWA 4Q80A 2G5NA 1TB6H 3RXPA 5C5NA 1MU6B 3HGNA 2ZDMA 4AFZA 1LHFH 2Y5HA 3LH1A 1K1MA 3RXAA 1QQ4A 1PJPA 2NU2E 4FUJA 2ZCKP 4GUXA 3RC6A 2Y6TA 2A2XH 2ZPSA 4JK5A 4ISLA 1TQ7B 1O2JA 1CU1A 3ZZ8A 2BLQA 4FUHA 3LU9B 7ESTE 1PYTD 3LGVA 1DXPA 1L1JA 1G36A 3UNRA 2P95A 1ELBA 3STIA 2STBE 2HNTF 2PUXB 3BSQA 3BTEE 4H4FA 5HGGA 1B0FA 3SU1A 3MO9A 1FI8A 3OU0A 4SGAE 2THFB 2BDIA 4H6TA 1EASA 1QRWA 2A2QH 5FX5A 2GT7A 3GOVB 2H2ZA 3RMOH 1UTKA 4CHAB 2Y7ZA 2JKHA 1FPCH 2FWWA 1TRNA 3RXDA 4B71A 3FFGA 1YPJH 2O9QA 4OS6A 5EGMA 2BQ6B 3D65E 2XCFA 3T2NA 3SU4A 1NM6A 2VVCA 4IC5A 1GBCA 4X2VA 2PTCE 5A09A 2DE9A 1MAYA 1O2NA 3P17H 4KP0A 4U30A 2ZEBA 3ZZCA 2GDEH 5JBTA 3HKIB 4GHTA 2HGTH 2QC2A 1D6WA 1O5EH 3KQBA 3QTOH 5EQSA 3V0XA 1ESBA 3LONA 1PPCE 4BNRA 4DURA 4FVBA 1C2HA 2VNTA 4TWWA 1SR5C 1ZTKA 5A0BA 1V2JT 4ZXXH 4Y11E 1L4DA 4ZKRU 2XCNA 3N7OA 3EGKH 3GCHB 5DP5A 1DSUA 2C8XB 1L1GA 2ANKH 1GHBG 1FUJA 1O37A 3QLPH 5K0HA 2AMDA 2ZTYA 3KNXA 4AG1A 3L33A 2AFQB 1GJCB 1BTYA 3HK3B 1LHGH 3A7VA 1AUTC 5B6OA 4ZHMU 5L6NH 4BAHB 1EKBB 4WJG2 4KELA 4D8NA 1LVOA 2FM2A 1V2UT 5ESBA 1QQUA 3TK9A 1C2LA 3CP7A 5DP9A 1HAGE 3SNCA 2XW9A 4J2YB 3SV8A 4BXSA 1S81A 1T7CA 1F7ZA 1GBKA 1ZSKA 1GHAF 4Z0KA 3HATH 2XNIA 2D26C 4KTCA 4MG3A 1T8LA 4I32A 1H8IH 1UHBA 1YCPM 3S69A 2SGPE 1TPAE 2Z9IA 3QDZB 4JCNA 1O36A 2GZ9A 1YPHC 1CO7E 1MH0A 1AU8A 1HB0B 2SGDE 4NFFA 1HAOH 4CREA 1N1LA 2G4UA 1S83A 5EPNA 2B7DH 1V2VT 2J2UA 3QTVH 1E36B 5F8ZA 1XKAC 2TGTA 1BMNH 2FI5E 3A83A 1LPZB 4XFQA 3U1JB 1H4WA 1GI5A 1S5SA 1B5GH 1Y3XA 2TBSA 1SGDE 4U32A 4K1SA 1C2MA 3TLOA 4NZLA 2FOHA 3NPSA 5T6DA 3NWUA 3UUZA 2VVUA 4WWYA 5ETXA 1P09A 3GCTG 5JB8S 1C5WB 4Y0YE 4UFFH 1C2JA 1VCWA 1P2OA 4NIYA 5F6MA 1KY9A 3MU1A 1AVGH 1W2KH 4MPVA 3BG4B 1EQ9A 1SGIB 5CMXH 3PO1B 3E3TA 1C4V2 4AX9H 2GCHG 3UNSA 1C5LH 2BLVA 4WMEA 3EAJA 1EPTC 1GBMA 4AORA 1GJ6A 2D8WA 1CGIE 1UMAH 1ABJH 1MU8B 1MCTA 2R3UA 4NSYA 3RXIA 1HGTH 1QGFA 1QA7A 1Y5BT 3M5LA 9ESTA 1P06A 1P04A 1LKAA 1GG6B 2ZDAH 1YPGH 1FY5A 2ZDVH 3BN9A 2J38A 2ASUB 3MMGA 3ZYDA 1FDPA 5AHGH 5F8XA 5J4SA 3E1XB 1T4UH 1TRMA 4MLFB 3LC3A 1MTUA 1MD8A 1A3BH 4MNXA 2F9VA 3B9FH 1SLVB 1ZLRA 3VGCB 2VIWA 1TNLA 2VGCB 2ZGCA 2FPZA 3TGKE 2BDCA 2F83A 2BD5A 2W5EA 4IC6A 2FI3E 1GMHF 3ZVCA 1QB9A 4LK4A 2XBWA 1ZSJA 4CBOA 2FTMA 4ISOA 3VXFH 1A0JA 1G3DA 2O8WA 2QF0A 2UWPA 1UO6A 1W14U 3RLWH 1KLIH 1VITG 1RTLA 4ZH8A 1XUHA 1V2LT 2K1QA 3GY4A 4AYYB 1O31A 2G51A 5BRRE 3CENA 1CT2E 1BTUA 1F5RA 3RU4T 2ESTE 2RA0A 1C1OA 2XC4A 4TPYA 4AOQA 4I31A 1THPB 4B1TA 1BB0B 2A1DB 1KXCA 1J16A 2ZECA 3M5OA 1UTJA 5F03A 3P6ZB 1HAYB 4HI3A 4AB9A 1FNIA 3A7TA 1GJDB 3QGJA 4Q7ZA 3GYLB 5T6FA 3STJA 1O5CB 3A89A 3GISB 4X0WU 4YOJA 5EW1H 1D4PB 1DANH 4GSOA 3S9BA 1KTTB 2TGAA 4O3TA 5E2PA 1O5DH 3UWJH 2FOCA 1GJBB 2BTCE 4JMYA 1GWAA 4WMFA 3F9HA 4I7YH 1JBUH 2BY6X 3M35A 2ANYA 2BOHB 3PMJA 2Z6BD 1V2PT 1DLKB 1OWIA 1P8VC 2Y7XA 3LT3A 2XWAA 2BQ7B 2WINI 4ISNA 2EI8A 3SUGA 3AASA 2QYIA 4WH6A 1NRRH 2BZAA 4X2WA 1DE7H 2C3SA 2J95A 1Q31A 3D23A 4TYDA 2J92A 2XWBI 4FUFA 1BQYA 1Z7KA 1G2MA 3A82A 4CR5A 4B2BA 1C1PA 4LXBH 1YPMH 2ANWA 3ZVBA 1YC0A 1O2KA 1C2GA 1GI3A 3SGQE 1OX1A 2HRVA 3UREA 3GCOA 5LGOA 1XUFA 4FUIA 1QJ1B 1MZDA 2LPRA 5FHTA 2SGFE 2SNVA 4ABDA 1SOTA 1QBOA 3NCLA 2B9LA 1E35B 2YNAA 1D3QB 1GMCF 1PPFE 3U1IB 1WTGH 3KGPA 3P8GA 4X6NA 3DFLA 2P8OB 1C1WH 3UWIA 4Q7YA 3LDXH 2G55A 2Q6DA 2XTTB 1PFXC 1D3DB 4D9RA 1NY22 5C2ZA 1OP8A 1B7XB 1O3NA 3A7XA 3BTDE 1GMDF 1MUEB 4ZXYH 3K6ZA 3ATKA 3W95A 4Y79A 4IMQA 1P05A 3LJOA 2HPPH 5HM2A 2ZZUH 1QFKH 1SGEE 3SQEE 1P10A 2PUQH 1OXGA 2VVVA 4KKDA 5C3NA 1LDTT 4OGXA 1GHAG 4OS1A 1GVLA 3MH6A 3TH4H 2CV3A 4BTIB 2WPIS 1H9LB 2SGEE 2HNTE 4QT8C 3UIRA 4VGCB 3KHVA 4MVNA 4MPWA 1TNKA 3PWBA 1F0TA 5SGAE 5FX6A 3SV9A 5JBAS 2Z9JA 1OPHB 1P12E 1ACBE 1O3CA 3LGWA 1XVOA 1TONA 5HMAA 1QCPA 7KMEH 3LKWA 1CA8B 5DP4A 1EJNA 1IQLA 4DIIH 1TA2A 3KN2A 4CRDA 6CHAB 2FS9A 3TJVA 1TWXB 5C20A 2AIQA 1DFPA 1OWDA 2G00A 3E6PH 1GI4A 2BD8A 5DK1A 2FS8A 2VB0A 3A7YA 4BAMB 1VCPA 1TMTH 4RKJB 1ZHMA 3GICB 4NSVA 1HJ8A 3JZ1B 1ZR0A 3ZV8A 3EDXB 1Z8RA 3V7TA 1GBAA 1DXWA 1HIAA 1DWEH 1O38A 3VB7A 4AGKA 3RXKA 1SQAA 4F4OC 1QB6A 3T5FH 5AFZH 5L2ZH 1ESAA 1V2ST 3SJOA 1C2DA 2FP7B 2F3CE 3ZVGA 1EZXC 4CRFA 1SGFA 4D76A 1D9IA 3MFJA 1C4U2 3Q3YA 1FJSA 2WUCA 3TPIZ 2BXTH 5C67A 1NT1A 1QL7A 3BTWE 4OS2A 1A2CH 1O3MA 1A0LA 4UFDH 3O8DA 3SUEA 2QGRA 3BIVH 4AB8A 1WOFA 1Y59T 5TJXA 2OC0A 2EI6A 1EXFA 1BOQA 3ZVFA 3RXOA 3EA8A 4NIXA 2QN5T 3BTKE 1GBLA 3M3SA 1VJ9U 3HK6B 4D7FA 3F1SB 2B8OH 4ABEA 1AZZA 1EZSC 1TX6A 5GJ4B 1RTKA 1C5XB 3URCA 1BTHH 4KTUA 4WXVA 2QF3A 4X8UH 1IQKA 1MKXK 1ELVA 5AF9H 4E7RG 1TMBH 2G81E 3ENSB 2CXVA 1GMHG 1OOKB 1AFQC 2CMYA 2FOGA 2P3FH 1VR1H 2ZFQH 1GI1A 4AGJA 4FUDA 3ODDA 1KDQA 1F92A 1GJ7B 1LMWB 1DY9A 4I8LA 3KQDA 1XXDA 1RXPA 2KAIB 4JYTA 4HFPB 3E91A 3T28A 1FY4A 1Z71A 1HRTH 1P2QA 3UNQA 2VINA 1ZOMA 4YT6H 1TPPA 3SU5A 3U8OH 1NFYA 1O2MA 3E90B 3FAOA 1LO6A 4A1VA 1RJXB 3RXFA 1FXYA 2ZO3H 4GPGA 4AYVB 1CQQA 2FYRA 2ODQA 1NZQH 1MCVA 1CVWH 1O5GH 2CHAC 2Z9LA 2BDYA 2GV6A 2FOEA 4FUCA 1CT0E 2R9PA 2BY9X 3BEIB 3SUFA 1O2HA 1GI0A 8GCHF 4B75A 2BVRH 4KTSA 1QJ7B 2AERH 1O3EA 5EPYA 1P2NA 3Q76A 2AGEX 1GDUA 2BDHA 2FLRH 3UY9A 4X2XA 1RD3B 1U6QA 3DFJA 1SB1H 1ZMJA 1DVAH 1FQ3A 4FUBA 5F8TA 4NWKA 3SU2A 3A8CA 4ABJA 1GI9B 1MTWA 4B73A 3DUXH 1S6HA 1V2WT 1V2KT 1K28D 1DUEA 4YO9A 2BXUH 1AWHB 3VPKA 4X1NU 1BBRK 1IQHA 1P9UA 1DUAA 3FZDA 1QBVH 1F0UA 1S85A 2GMTC 1GGDC 2VIOA 1O0DH 4WH8A 1UVPA 1W0YH 1YCPK 3F9EA 1UTMA 2SGAA 3BTQE 1GMCG 2ZFTA 4MTBA 4GCHF 2Y5GA 3LOXA 5AFYH 1DICA 3ZVEA 1UJ1A 1V3XA 2PGBB 1NO9H 1EOJA 1GHZA 1DT2A 2BOKA 1KXAA 1W7GH 4RKOB 1GMDG 4O03A 1AUJA 1ETRH 1TE0A 2ZHQH 3S0NA 1S0RA 1TLDA 3MNSA 5DKMA 4IBLH 2C93B 2W7SA 1E0FD 1VJAU 2H1UA 1SBWA 3TH2H 4X6PA 2C8ZB 1RFNA 1EZUC 1N6XA 2GZ8A 5GWZA 2FEQH 4XSKU 1O2SA 1MTNC 1DM4B 1YLCA 4DIHH 3K65B 1UCYK 1P9SA 1GCTC 4WVPE 2GCTB 2WYJA 3M3VA 2PTNA 2GGVB 3IITA 3PROA 4CRBA 2G4TA 1VITH 3VB3A 1ANCA 4K8BA 2Z9GA 3MH5A 4XDEA 3UQOA 2BM2A 1K2I1 2F9NA 1P0SH 1ZPCA 2FOBA 4IS5A 5BPEA 1Y5AT 1BRBE 4GHQA 1IQFA 2FXRA 2H5DA 1ZSLA 1B0EA 9LPRA 1TGBA 4A1TA 2JETC
chains in the Genus database with same CATH superfamily
2PSXA 5E0HA 3SZEA 3PM3A 5E0JA 4ABFA 1EAWA 4NA8A 1W13U 4ZUHA 2Z3EA 1O34A 3PB1E 4X8TH 4A1XA 1O5AB 1H8DH 1QJ6B 5DP3A 1BCUH 1TYNA 4HTCH 2ZC9H 2UUYA 1L0ZA 1BIOA 1Y5UT 1ARCA 2QXIA 5CHBA 2VBCA 1UVUH 3T29A 2OC7A 1AE8H 2ZNKH 2NU0E 1C2IA 2ZGXH 1AD8H 1Z1JA 2QCYA 1M9UA 2JIZD 1YKTA 2P3TB 1SMFE 3GY6A 1SOZA 2G5VA 2A45B 1NU7B 4OGYA 1O3AA 3FP6E 2A32A 1IQEA 3BTME 3U9AH 3RMNH 1YPHE 1EPTB 2HPQH 2ZA5A 3PV5A 3KQCA 2WYGA 3GY8A 4B2AA 2O8MA 1XKBC 2AYWA 2M2AA 2P94A 3GY7A 4ZKOU 1HJAB 2ZU1A 1FIZA 3TNTA 5LH8A 1H9IE 4K69A 3SJ9A 1FPHH 3RLYH 1JIRA 3SUDA 3SGAE 2BZ6H 1H1BA 1VGCC 1P2JA 2O8LA 2CF8H 2ZU5A 1O2WA 5JPMH 1GVKB 1DY8A 1GI2A 7LPRA 1CGJE 5DP7A 6ESTA 1K9OE 1Y3UA 1P2MA 1KYNA 4GVUA 2FLBH 4WXIA 2Q6GA 3FKSD 3I77A 3M5MA 5CHAC 2BY7X 1C9TA 1MKWK 1SHHB 3G01A 2QIQA 3AAUA 4IMZA 3TU7H 3RXEA 1LVMA 1K1JA 4ACBA 2Z94A 5C1XA 4Q7XA 3PRDA 2ZGJA 1UTNA 2BDGA 1UK4A 3SN8A 1BRUP 1QA0A 4LOYH 4I8HA 4ABIA 1V2RT 5KGOA 2ZKSA 4ZROA 2ANMH 3ATLA 1C5UA 1C5MD 1D3PB 4XBBA 1ANBA 1TQ0B 4FU9A 1O2UA 3SQHE 1W3CA 1IHTH 4YESB 1BTZA 2ZHFH 1UVOA 3F68H 2OLGA 3EA9A 5C0TA 1ANDA 3MOCA 4BOHA 1J14A 1A5GH 5LPRA 1V2TT 2NU1E 1QL9A 4Y0ZE 1AMHA 3E0PB 2J34A 4X2YA 2C8WB 4O9VA 1WXRA 4BAQB 1BUIA 1SQOA 1FIWA 1Z6EA 1LVBA 1E37B 2EA3A 1LVYA 1O3FA 1ZJKA 4Y8XA 1YPLH 2Z7FE 1TGTA 1JOUB 1KTSB 4K1EA 2DE8A 5EQRA 5DGJA 3PLBA 3SORA 1JMOH 1IHSH 8GCHG 1C1VH 1OWEA 1P11E 1GBHA 1SL3A 2Z3DA 1MQ5A 3RM2H 1CE5A 1J15A 5GIBA 1TGNA 4IW4E 1IQIA 3BTGE 1W11U 4F49A 1J8AA 1TIOA 1GJAB 1EP6A 2A4QA 2SNWA 3RXUA 4U01A 2OCVB 3TVJB 1BHXF 3A87A 3D62A 3OY6U 2XNDD 1EAXA 1O3GA 1DS2E 1GL0E 2F91A 2ZU2A 3FZZA 3SW2B 1CGHA 1WQSA 3GDSA 1INCA 1HPGA 2NU4E 5DPAA 5LPEA 1UTQA 1ZRKA 1SGTA 3QUMP 3SJKA 2ZTZA 5JBBS 1SGNE 2F9OA 1AZ8A 2A4GA 2TRMA 3ZZ4A 4GCHG 1O3OA 1UW7A 1OKXA 4XE4A 3A8DA 1LPGB 3O8CA 1RIWC 1SC8U 1XVMA 1ZZZA 4PROA 3W94A 1BTPA 3KIDU 1Q3XA 3SI3H 1OP0A 1OWHA 1ABIH 2M5TA 2QA9E 1BA8B 1TPOA 3SHCH 1GPZA 4JK6A 4Y71A 4HGCA 3TITA 2OC1A 4MNVA 1THRH 4MPXA 2ODYB 3L3TA 2WPDD 3DT0H 4I33A 4CRAA 6GCHF 1FX0B 4F55A 2ZU4A 1TPSA 1K22H 1WSSH 5EXNA 2PKSC 4U2WA 4YTAA 1TBZH 3DSOA 1W0KD 4ZKNU 2G52A 1Z8IB 2B5TB 2FI4E 2GX4A 1ANEA 2BHGA 3VGCC 4IN2A 3MH7A 3VB6A 3H7TA 4OS5A 2ULLA 2W26A 3P95A 4BTTB 4K3JA 1QHRB 3ZZDA 1TX7A 1CA0B 3U69H 4X6OA 1C5NH 3WY8A 1TGSZ 1DWCH 5A0AE 2PKAB 3SZNA 1FV9A 2F43B 2HLCA 2EC9H 1MBMA 4Z6AH 1C1MA 1F5LA 3QZQA 1F0RA 2YMSC 3LPRA 4UFGH 1DOJA 2HOBA 5I46H 2FTLE 2V3HH 3WW7A 4LZ1H 1ZGVA 1AVWA 2OXSA 4X1QU 3SNDA 3PTBA 3V12A 1TRYA 3PYHA 1F2SE 2HALA 3GY5A 3SJ8A 1D3TB 2KM0A 1K0HA 2J97A 2C90B 3SNEA 2CN0H 3UR9A 1BDAA 5EXMA 4I8KA 1S0QA 1RS0A 4YLQH 5TCAA 5DP6A 5GCHF 2FESH 5E8EH 4NA7A 3VFEA 1HAVB 1Y3VA 5G4BA 1TABE 1LHDH 2OK5A 3RMMH 3M7UA 2A7HA 1AGJA 3TNSA 4THNH 3OSYA 2O8TA 2A7JA 1GL1A 2VIDA 3S7KB 2WUBA 5EJ1A 5T3HA 1AFEH 1GJ9B 2ZFFH 3M5NA 4INKA 3RUOA 4YM9A 1HAZB 5A8YA 2LNCA 2KCYA 3FVFB 4AFQA 4ZHLU 4NZQA 2A7CA 1A7SA 2VWLA 5DO4H 2QAAA 3LGUA 1GCDA 3RXLA 1L2EA 4A6LA 2A5KA 1T8OA 3SV7A 1O2ZA 5EW2H 1P02A 3PWCA 4Y10E 2ZCHP 4Y8ZA 4OS4A 2XBXA 5TCCA 1FY8E 1AKSB 3TH3H 1AB9B 1JRSA 2YMSD 1J9CH 4H6SB 4SGBE 2Z3CA 1TOCB 3EQ0H 5DG6A 2OBOA 3ZZ5A 1YLDA 3R3GB 2F9BH 1TNHA 2J5UA 5HM9A 1L1NA 1AE5A 2P3UB 4CRGA 1GVZA 1NS3A 1YLNA 3RC4A 2BB4A 2RG3A 1TALA 1NPMA 4X8VH 2FOFA 2ODPA 1NN6A 1K1LA 3B23B 3JZ2B 1QL8A 3RXVA 4CBNA 3GY2A 5EG4A 3QN7A 1CHGA 3FOAA 1SGFG 1OSSA 1BT7A 3A88A 1AFQB 3C1KA 4INLA 1C1QA 4M9FA 5FPYA 3TGIE 2A5AA 2PR3A 1HV7A 1FONA 5GXPA 2NU3E 3RXSA 1ORFA 1E1RD 2F4LA 1A0HB 4E06H 1ESTA 4Y8YA 4CH2B 4F48B 3F6UH 3DA9B 1GI8B 3F9FA 3Q3XA 3MHWU 1C4Y2 5LPFA 3PRBA 1Z6JH 2RDLA 5EJLA 1A5HA 2IOTA 1BBRE 1HAIH 1NRSH 2R3YA 1GHYH 1H8HD 1HAXB 3DHKH 2XYAA 4B2CA 4I86A 4ACAA 1V2MT 3AAVA 2UUKB 3URDA 2YOLA 3CNRA 5DP8A 3ZZ6A 1W7XH 1G9IE 3SBKA 3DCLA 2CHAB 2RCEA 3LJJA 1DPOA 4CRCA 5FPSA 1SI5H 1CBWB 2J9NA 1FN8A 5ESTE 4E7NA 2A4OA 5FBIA 1HAPH 3VEQB 1MAXA 3RXTA 1ELGA 3MNCA 3SO3A 1UTLM 3RP2A 3A8AA 3A86A 3EYDA 1Y3YA 4NGAH 1G30B 3M7TA 1HAHH 2OUAA 1ETSH 1TMUH 2RA3A 3SV6A 4ABBA 5A2MH 1YBWA 3MU4A 2ZFSA 8LPRA 1BMAA 2CGAA 2K0QA 1LQEA 3CS0A 1TGCA 2BMGB 1K21H 4HG6A 2V35A 5JBCS 1TFXA 2W7UA 2KAIA 2PW8H 1UCYE 2R2WU 1IQMA 3GYMA 1OP2A 1GJ8B 3KYGA 1NESE 3SU3A 2ZQ1A 4DY7B 3T25A 3K9XB 1XMNB 2BYAX 4Q2KA 4DW2U 3EE0B 3L6PA 2GMTB 1V2QT 1GGDB 4CH8B 1PQAA 1DWBH 4MNYA 2OQ5A 1ZTJA 4UDWH 5AVDA 1LPKB 4O3UA 1UVSH 1YYY1 1GBBA 1ZJDA 3M7QA 1KXFA 1EAIA 1O3LA 3SU6A 2NWNA 3OTJE 1KXEA 3QX5H 3S7HB 4YXWD 1JIMA 1O2RA 4X6MA 5JDUB 1GHWH 1WAYB 4R8TB 2DUCA 5CDFE 3RU4E 3FP7E 1ZGIA 3R0FA 1O2XA 4MNWA 1SGCA 4M7GA 2A0QB 2OINA 1K1IA 4YZUA 1N8OC 2OBQA 3ATIA 1QRZA 4DJZB 1GBDA 1P57B 4BAKB 2GP9B 1VZQH 1C1UH 3Q77A 3NKKA 5EU8A 3T27A 3VXEH 1F5KU 1ELTA 4FUEA 1MTNB 1W8BH 1GBFA 2BD2A 2ZP0H 1O3PB 1GCTB 1NRNH 2FOAA 3MU0A 1K1OA 2P93A 1SLXB 4XOJA 3OE7D 2IPHA 4MDSA 3ZVDA 3PLPA 2WPHS 1JWTA 3NXPA 1PQ8A 3A7ZA 1SLWB 1EJMA 4B6FA 2UWOA 4TPIZ 1NTPA 5CE1A 2CJIA 2PWXA 1AHTH 4ESTE 4RT1A 1G2LA 2JETB 4NA9H 3UTUH 3O8RA 1DX5M 3GDUA 5T6GA 1JRTA 3RC5A 1TNJA 5EQQA 1AWFH 1MD7A 3QZRA 2I6QA 3RXJA 1TA6A 1TAWA 1YM0A 3BG8A 2BY5X 2W3KA 3TK6A 3SGBE 3MYWA 1H9HE 5GCHG 3H7OA 4MPUA 3RU4D 1WU1A 4AG2A 1DSTA 4Q4LA 1CHOF 2JH0D 2W3IA 3RM0H 1SVPA 3KCGH 3AW1A 4TSFD 1GBIA 3NZIA 3F2GA 2D1JA 2BX4A 5L30H 3CS7A 2IN2A 3TIUA 1SGYE 1Z8JB 1OWJA 4R0IA 1IAUA 3HKJB 1Q2WA 1T32A 2ZFPH 4UONA 1C1TA 2G8TA 2LP6A 1UTPA 4YLUA 3PMBB 1K1NA 2BD3A 2HLDD 2IJOB 3VB5A 1HNEE 1FMGA 3MU5A 4YOGA 3BTTE 1TX8A 1C5ZB 3E16B 1MKXH 3ATMA 2FZZA 1AQ7A 2P16A 3LGTA 1SFIA 5K7RA 3OEHD 2FX6A 1KIGH 4B6EA 1ZYOA 2FDAA 3LIWA 5ABWA 3BIUH 2J94A 1VGCB 3SI4H 1GI6A 1MBQA 2ILNA 2R2MB 5FCKA 2F9PA 1EZQA 2V6NA 1GHVH 2FODA 4NFEA 1MQ6A 1PPEE 5JYIA 1GDNA 3GDVA 5CHAB 2JDID 1ZMNA 1WBGB 2KZ4A 2VH6A 2AGGX 1AI8H 2QXJA 3SHAH 1PPGE 1FAXA 3KQ5A 2KCAA 2IJD1 1SLUB 1PPHE 3P92A 4O97A 2GD4B 1P3EA 4CHAC 2O8UA 3I29A 3V3MA 2H6MA 2FX4A 2GKVE 2STAE 2KCOA 1MTSA 3I78A 4IN1A 1EPTA 8ESTE 1FY1A 2Y80A 2VWMA 2AS9A 1Y8TA 1N6YA 1A46H 4INHA 3RXHA 3M3TA 1A61H 5A8XA 3SYJA 1DWDH 2GCTC 1XX9A 1O33A 4X1SU 2VIVA 1O2QA 3OY5U 4FVDA 5FPTA 1ELEE 1UHBB 3S9CA 1BITA 3EA7A 3IWMA 4DT7B 1EB2A 1C5RA 2WPMS 1HJ9A 1FAKH 1C2FA 1SPJA 2WV4A 4AN7A 3ATWA 1QR3E 4FU8A 1BZXE 4P00A 5HXFA 2GV7A 1O5FH 1Z8GA 1YF4A 2BD4A 3GCHC 2ZU3A 1PQ7A 1BMMH 2ZHWH 4XBCA 2ZG0H 3QO6A 3T26A 2ZDLA 4ISIH 1DLEA 1SGRE 2ZFRH 4Y76A 1O2VA 1F0SA 4NIVA 1AN1E 2Y82A 4WY3A 3KL6A 4ASHA 3MTYA 3UPEA 2F9UA 5GPIB 4ABGA 1BBRH 1V2OT 1XM1A 4ZCNA 1YCPH 2TGDA 4OS7A 1HYLA 2HVXA 2V3OH 3HPTB 2FOMB 1WDIA 3UOPA 4LZ4B 1C2EA 1G3EA 5C1YA 1LHCH 4TY7A 1ELDE 2AIPA 1ZRBA 3KEEA 1GJ5H 1T4VH 1O2OA 3F3BA 3SV2H 3RXBA 3BEUA 2EY4C 1XUGA 5HYOA 2OD3B 1LQDB 2V7QD 4GAWA 3A85A 3ELAH 2WPKS 1C5SA 1PPZA 4A92A 4NWLA 4I8GA 2XC5A 1XXFA 4ZKSU 5A8ZA 2BD9A 2RFKC 2BDAA 2ZPRA 2ZDKA 5L2YH 2ZHDA 1RIWB 2V0BA 2B0FA 2FYQA 1HJAC 1FZZA 1EJAA 1TNGA 4MQAA 2A4RA 1HBTH 1GDQA 4WF8A 3RDZA 3VB4A 1UCYH 1SSXA 2FO9A 2L74A 4TY6A 2WHXA 3U8RH 1KXDA 4DG4A 3ZZAA 2XBVA 1C2KA 3ZZ3A 2FIRH 4JZFH 1QRXA 3UFAA 2ZTXA 1EOLA 2C8YB 1E38B 1YGCH 1EUFA 5I25A 2AGIX 1ZPZA 2PKSB 2R0LA 1W10U 1PQ5A 1KXBA 4I8JA 1A3EH 4K60A 3SJIA 2OP9A 1GI7B 1RRKA 1P3CA 1IQJA 1BTXA 1XUIA 1QZ8A 1NRQH 2VIPA 3MQKC 3P8NA 2AMQA 2BVXH 1ETTH 1EX3A 1P01A 1EAUA 3BG4C 5KEDA 3PO1C 3BEFB 1UK3A 5E2OA 2L6OA 1W12U 3GY3A 4CR9A 5FCRA 1HUTH 1WTHD 3FN8A 2YMSB 4A5TS 3PLKA 3MNXA 4FXGH 1GBTA 4KGAA 4D7GA 5E0GA 3PMHB 3T62A 1Y3WA 3MO6A 2AEIH 2PSYA 1NBME 2VH0A 1KSNA 1V2NT 5C5OA 7GCHF 1ELCA 3RXGA 1BJVA 8KME2 1GG6C 2BLOA 5HIYA 1DITH 3KYFA 1WCZA 1P2IA 3N7DA 5B6LA 4XD7D 1EP5A 1T8NA 3P8FA 1VCQA 1ZPBA 1EB1H 2SGQE 1HDTH 2ALPA 1C5YB 2BVSH 2W6JD 2BD7A 3BF6H 1X7AC 4DGJA 4JZ1A 4ABAA 1CHOG 2WPLS 1Z1IA 2VGCC 3RXCA 3BV9B 2D2DA 3P8OA 1MMJN 3M61U 1AY6H 2BX3A 1CT4E 2UUFB 1L4ZA 3E0NB 3RXQA 3TJNA 1CSOE 2PKAA 4WMDA 3ODFA 1O35A 4GLYA 4JZIA 1C5TA 1O2YA 2BLWA 5C1UA 2ZI2H 4JZEH 1NU9A 3AW0A 1NFXA 3MI4A 3TJOA 2AMPA 1SGPE 3NUMA 2JH5D 3U28C 1O2IA 4X8SH 3DD2H 2ZGHA 1J17T 1MKWH 1UVTH 5EJZA 1RGQA 3C27B 1S84A 4YT7H 2Z9KA 3OYPA 2ZQ2A 3PV4A 1BJUA 2EI7A 1AVXA 4FUGA 3Q3KA 1ZMLA 3ZV9A 1O3KA 1DDJA 4K2YA 3AVZA 3MWIU 3U98H 1HLTH 1W0ZU 1HXEH 1NROH 1QURH 3S9AA 1A4WH 3KF2A 1FLEE 2PHBA 3H5CB 2ZDNA 5EXLA 4OM9A 1JXPA 1HAVA 2KR7A 4Y7AA 1QNJA 1ARBA 4UE7H 3SNAA 5A0CA 5J4QA 1SKYE 2XRCA 1QBNA 4DVAU 3V13A 4DOQA 1S82A 2ZHEH 3HGPA 3GCNA 1MTVA 3MO3A 3RMLH 2BY8X 3OX7U 1G32B 4ZAEA 1C5VA 5C17A 1O39A 3UB0A 2VIQA 2GVFA 3F2HA 4X1RU 1K1PA 1O3HA 4JZDH 2UWLA 4B74A 1TBRH 3TGJE 1QTFA 1C9PA 5FXLA 1QY6A 1BTWA 3SNBA 3U8TH 3ZZ7A 2VWNA 3RXRA 3MNBA 3A7WA 2OTVA 5IDKA 3LGYA 2KCPA 2HNTC 3WWFA 4ZHAA 2C4FH 1CA0C 1AKSA 2ZF0H 5EOKA 2H5CA 1O30A 2XC0A 4JYVH 3LGIA 2JH6D 3D49H 2QV1A 1OWKA 2QY0B 4TWYA 2XXLA 3M36A 3B8JA 2W6ID 2UUJB 3ZZBA 3F9GA 1YPEH 1HCGA 3QGNB 1G3CA 1GHXH 2TGPZ 3LC5A 4H42U 3SOSA 2P8OC 3BTHE 3NK8A 4RN6A 1BMLA 2TIOA 4FOUC 1GHBF 3TK5A 1YP9A 3FP8E 1A5IA 1O32A 2PLXA 1EATA 2GZ7A 2CF9H 1O2TA 2PV9B 3ESTA 1P03A 1GJ4H 1IQGA 1C5PA 1OYTH 1V6DA 2VWOA 3UQVA 1THSH 1TNIA 2GT8A 4D9QA 2HWLB 2ALVA 4IGDA 2XOKD 1T31A 1NFUA 4ABHA 1HFDA 4BANB 1HIAB 1G3BA 1XUKA 4RSPA 2FMJA 1NC6A 4NG9H 2QF5A 2RDEA 1FN6A 4BAOB 1FY3A 2P59A 4VGCC 1OHHD 4Y7BA 1O3BA 2TPIZ 3O8BA 4FU7A 4K8YA 1D6RA 3TJUA 1C1NA 2J4IA 2PGQB 1RTFB 1GBEA 3QWCH 1SQTA 1G37A 5H4IB 1P2KA 1ELAA 2A31A 1BRCE 4E05H 3OFND 5EODA 2PFEA 1QB1A 6CHAC 1AB9C 2H9HA 2ZCLP 4YOIA 2H9TH 3M37A 4Y6DA 1ZTLA 1C5QA 1UK2A 2GTBA 1O3IA 3IG6B 5DN6D 2OQUA 4UFEH 1GBJA 1N8OB 3ZYEA 3ZZ9A 4ISHH 2VJ1A 1YY3A 1WQVH 4AFUA 2Y5FA 2OC8A 1O3JA 1SGQE 1O2GH 3SU0A 3PTNA 1NRPH 2ZGBH 1KLJH 3GCTF 1E34B 1OS8A 3Q00A 4AFSA 1C1RA 1HXFH 3K2UA 3KQEA 3MU8A 1TBQH 5FAHA 1SFQB 2R0KA 5FBEA 5IK2D 1SG8B 1C5OH 1BRAA 4NCYA 1H8ED 5C94A 3LH3A 2GCHF 2WPJS 1O5BB 1KDQB 3MH4A 4B76A 1KLTA 4UEHH 1O3DA 4JYUH 1PPBH 1LCYA 3FANA 1W0JD 1WV7H 1XUJA 1ID5H 1ZHRA 1PYTC 1O2LA 1ELFA 2I6SA 1BHXB 3RXMA 3P70B 7GCHG 1MZAA 4AZ2B 2A5IA 1OYQA 1IOEA 2PP6A 5DJ7A 2EEKA 2BQWB 1SHYA 2XBYA 3QK1A 4BXWA 2EQNA 3A80A 3UOUA 2AH4X 2ZIQH 5GDSH 3UR6A 6GCHG 4X1PU 5EIYA 2Q6FA 3PMAB 2SFAA 2QXHA 3E8LA 4J1YA 5PTPA 1T8MA 2VU8E 2H9EH 1YPKH 4ZMAH 1IQNA 1NFWA 3ZVAA 2J98B 1LHEH 5JB9S 1LTOA 1CBWC 3BTFE 4RI0A 2BDBA 2ZPQA 4A7IB 1UTOA 1WYKA 1A1RA 4DCDA 1ZHPA 1BMFD 2QXGA 4XBDA 1WUNH 4BTUB 1QIXB 2Q1JA 3A8BA 3A84A 2YNBA 1AO5A 3A81A 4HZHA 1TOMH 4UD9H 4K5ZA 1O2PA 3K6YA 3ITIA 2WV5A 2Y81A 2GDDA 1C1SA 6LPRA 3DSPA 5IYTA 1VITF 2ZWLH 1AIXH 1LKBA 4K1TA 1S6FA 4NIWA 4Q80A 2G5NA 1TB6H 3RXPA 5C5NA 1MU6B 3HGNA 5HKKD 2ZDMA 4AFZA 1LHFH 2Y5HA 3LH1A 1K1MA 3RXAA 1QQ4A 1PJPA 2NU2E 4FUJA 2ZCKP 4GUXA 3RC6A 2Y6TA 2A2XH 2ZPSA 4JK5A 4ISLA 1TQ7B 1O2JA 1CU1A 3ZZ8A 2BLQA 4FUHA 3LU9B 7ESTE 1PYTD 3LGVA 1DXPA 1L1JA 1G36A 3UNRA 2P95A 1ELBA 3STIA 2STBE 2HNTF 2PUXB 3BSQA 3BTEE 4H4FA 5HGGA 1B0FA 3SU1A 3MO9A 1FI8A 3N99A 3OU0A 4SGAE 2THFB 2BDIA 4H6TA 1EASA 1QRWA 2A2QH 5FX5A 2GT7A 3GOVB 2H2ZA 3RMOH 1UTKA 4CHAB 2Y7ZA 2JKHA 1FPCH 2FWWA 1TRNA 3RXDA 4B71A 3FFGA 1YPJH 2O9QA 4OS6A 5EGMA 4Z1MD 2BQ6B 3D65E 2XCFA 3T2NA 3SU4A 1NM6A 2VVCA 4IC5A 1GBCA 4X2VA 2PTCE 5A09A 2DE9A 2QF4A 1MAYA 1O2NA 3P17H 4KP0A 4U30A 2ZEBA 3ZZCA 2GDEH 5JBTA 3HKIB 4GHTA 2HGTH 2QC2A 1D6WA 1O5EH 3KQBA 3QTOH 5EQSA 3V0XA 1ESBA 3LONA 2LELA 1PPCE 4BNRA 4DURA 4FVBA 1C2HA 2VNTA 4TWWA 1SR5C 1ZTKA 5A0BA 1V2JT 4ZXXH 4Y11E 1L4DA 4ZKRU 2XCNA 3N7OA 4AC9A 3F0OA 3EGKH 3GCHB 5DP5A 1DSUA 2C8XB 1L1GA 2ANKH 1GHBG 1FUJA 1O37A 3QLPH 5K0HA 2AMDA 2ZTYA 3KNXA 4AG1A 3L33A 5HIZA 2AFQB 1GJCB 1BTYA 3HK3B 1LHGH 3A7VA 1AUTC 5B6OA 4ZHMU 5L6NH 4BAHB 1EKBB 4WJG2 4KELA 4D8NA 1LVOA 2FM2A 1V2UT 5ESBA 1QQUA 3TK9A 1C2LA 3CP7A 5DP9A 1HAGE 3SNCA 2XW9A 4J2YB 3SV8A 4BXSA 1S81A 1T7CA 1F7ZA 1GBKA 3F0PA 1ZSKA 1GHAF 4Z0KA 3HATH 2XNIA 2D26C 4KTCA 4MG3A 1T8LA 4I32A 1H8IH 1UHBA 1YCPM 3S69A 2SGPE 1TPAE 2Z9IA 3QDZB 4JCNA 1O36A 2GZ9A 1YPHC 1CO7E 1MH0A 1AU8A 1HB0B 2SGDE 4NFFA 3EE7A 1HAOH 4CREA 1N1LA 2G4UA 1S83A 5EPNA 2B7DH 1V2VT 2J2UA 3QTVH 1E36B 2JJ2D 5F8ZA 1XKAC 2TGTA 1BMNH 2FI5E 3A83A 1LPZB 4XFQA 3U1JB 1H4WA 1GI5A 1S5SA 1B5GH 1Y3XA 2TBSA 1SGDE 4U32A 4K1SA 1C2MA 3TLOA 4NZLA 2FOHA 3NPSA 5T6DA 3NWUA 3UUZA 2VVUA 4WWYA 5ETXA 2K8IA 2CK3D 1P09A 3GCTG 5JB8S 1C5WB 4Y0YE 2V3MA 4UFFH 1C2JA 1VCWA 1P2OA 4NIYA 5F6MA 1KY9A 3MU1A 1AVGH 1W2KH 4MPVA 3BG4B 1EQ9A 1SGIB 5CMXH 3PO1B 3E3TA 1C4V2 4AX9H 2GCHG 1E79D 3UNSA 1C5LH 2BLVA 4WMEA 3EAJA 1EPTC 1GBMA 4AORA 1GJ6A 2D8WA 1CGIE 1UMAH 1ABJH 1MU8B 1MCTA 2R3UA 4NSYA 3RXIA 1HGTH 1QGFA 1SQRA 1QA7A 3ZIAD 1Y5BT 3M5LA 9ESTA 1P06A 1VKYA 1P04A 1LKAA 1GG6B 2ZDAH 1YPGH 3UAIC 1FY5A 2ZDVH 3BN9A 2J38A 3WWBA 2ASUB 3MMGA 3ZYDA 1FDPA 5AHGH 5F8XA 5J4SA 3E1XB 1T4UH 1TRMA 4MLFB 2KX4A 1MTUA 3LC3A 1MD8A 1A3BH 4MNXA 2F9VA 3B9FH 1SLVB 1ZLRA 3VGCB 2VIWA 1TNLA 4P02A 2VGCB 2ZGCA 2FPZA 3TGKE 2BDCA 2F83A 2BD5A 2W5EA 4IC6A 2FI3E 1GMHF 3ZVCA 1QB9A 4LK4A 2XBWA 1ZSJA 4CBOA 2FTMA 4ISOA 3VXFH 1A0JA 1G3DA 2O8WA 2QF0A 2UWPA 1UO6A 1W14U 3RLWH 1KLIH 1VITG 1RTLA 4ZH8A 1XUHA 1V2LT 2K1QA 3GY4A 4AYYB 1O31A 2G51A 5BRRE 3CENA 1CT2E 1BTUA 1F5RA 3RU4T 2ESTE 2RA0A 1C1OA 2XC4A 4TPYA 4AOQA 4I31A 1THPB 4B1TA 1BB0B 2A1DB 1KXCA 1J16A 2ZECA 3M5OA 1UTJA 5F03A 3P6ZB 1HAYB 3N7EA 4HI3A 4AB9A 1FNIA 3A7TA 4XRNA 1GJDB 3OTPA 3QGJA 4Q7ZA 3GYLB 5T6FA 3STJA 1O5CB 3A89A 3GISB 4X0WU 4YOJA 5EW1H 1D4PB 1DANH 4GSOA 3S9BA 1KTTB 2TGAA 4O3TA 5E2PA 1O5DH 3UWJH 2FOCA 1GJBB 2BTCE 4JMYA 1GWAA 4WMFA 3F9HA 4I7YH 1JBUH 2BY6X 3M35A 2ANYA 2BOHB 3PMJA 2Z6BD 1S6LA 1DLKB 1OWIA 1P8VC 1V2PT 2Y7XA 3LT3A 2XWAA 2BQ7B 2WINI 4ISNA 4TT3D 2EI8A 3SUGA 3AASA 2QYIA 4WH6A 1NRRH 2BZAA 5F53A 2AHME 4X2WA 1DE7H 2C3SA 2J95A 1Q31A 3D23A 4TYDA 2J92A 2XWBI 4FUFA 1BQYA 1Z7KA 1G2MA 3A82A 4CR5A 4B2BA 1C1PA 4LXBH 1YPMH 2ANWA 3ZVBA 3OEED 1YC0A 1O2KA 1C2GA 1GI3A 3SGQE 1OX1A 2HRVA 3UREA 3GCOA 3DSGA 5LGOA 1XUFA 4FUIA 1QJ1B 1MZDA 2LPRA 5FHTA 2SGFE 2SNVA 4ABDA 1SOTA 1QBOA 3NCLA 2B9LA 5T1VA 1NBMD 1E35B 2YNAA 1D3QB 1GMCF 1PPFE 3U1IB 1WTGH 3KGPA 3P8GA 4X6NA 3DFLA 2P8OB 1C1WH 3UWIA 4Q7YA 3LDXH 2G55A 4FETA 2Q6DA 2XTTB 1PFXC 1D3DB 4D9RA 1NY22 5FL7D 5C2ZA 1OP8A 1B7XB 1O3NA 3A7XA 2JJ1D 1GMDF 3BTDE 1MUEB 4ZXYH 3K6ZA 3ATKA 3W95A 4Y79A 4IMQA 1P05A 3LJOA 2HPPH 5HM2A 2ZZUH 1QFKH 1SGEE 3SQEE 1P10A 2PUQH 1OXGA 2VVVA 4KKDA 5C3NA 1LDTT 4OGXA 1GHAG 2HVYB 4OS1A 1GVLA 3MH6A 3TH4H 2CV3A 4BTIB 3AK5A 2WPIS 1H9LB 2SGEE 2HNTE 4QT8C 3UIRA 4VGCB 3KHVA 4MVNA 4MPWA 1TNKA 5GNDA 3PWBA 1F0TA 5SGAE 5FX6A 3SV9A 5JBAS 2Z9JA 1OPHB 1P12E 1ACBE 1O3CA 3LGWA 1XVOA 1TONA 5HMAA 1QCPA 7KMEH 3LKWA 1CA8B 4RT0A 5DP4A 1EJNA 1IQLA 4DIIH 1TA2A 3KN2A 4CRDA 6CHAB 2FS9A 3TJVA 1TWXB 5C20A 2AIQA 1DFPA 1OWDA 2G00A 3E6PH 1GI4A 2BD8A 5DK1A 2FS8A 2VB0A 3A7YA 4BAMB 1VCPA 1TMTH 4RKJB 1ZHMA 3GICB 4NSVA 1HJ8A 3JZ1B 1ZR0A 3ZV8A 3EDXB 1Z8RA 3V7TA 1GBAA 1DXWA 1HIAA 1DWEH 1O38A 3VB7A 4AGKA 3RXKA 1SQAA 4F4OC 1QB6A 3T5FH 5AFZH 3H09A 5L2ZH 1ESAA 1V2ST 3SJOA 5KECA 1C2DA 2FP7B 3W1EA 2F3CE 3ZVGA 1EZXC 4CRFA 1SGFA 4D76A 1D9IA 3MFJA 1C4U2 3Q3YA 1FJSA 2WUCA 3TPIZ 2BXTH 5C67A 1NT1A 1QL7A 3BTWE 4OS2A 1A2CH 1O3MA 1A0LA 4UFDH 3O8DA 3SUEA 2QGRA 3BIVH 4AB8A 1WOFA 1Y59T 5TJXA 2WV9A 2OC0A 2EI6A 1EXFA 1BOQA 3ZVFA 3RXOA 3EA8A 4NIXA 2QN5T 3BTKE 1GBLA 3M3SA 1VJ9U 3HK6B 4D7FA 1MABB 3F1SB 4DT4A 2B8OH 4ABEA 1AZZA 1EZSC 1TX6A 5GJ4B 1RTKA 1C5XB 3URCA 1BTHH 4KTUA 4WXVA 2QF3A 4X8UH 3VG8A 1IQKA 1MKXK 1ELVA 5AF9H 4E7RG 1TMBH 2G81E 3ENSB 2CXVA 1GMHG 1OOKB 1AFQC 2CMYA 2FOGA 2P3FH 1VR1H 2ZFQH 1GI1A 4AGJA 4FUDA 3ODDA 1KDQA 1F92A 1GJ7B 1LMWB 1DY9A 4I8LA 3KQDA 1XXDA 1RXPA 2KAIB 4JYTA 4HFPB 3E91A 3T28A 1FY4A 1Z71A 1HRTH 1P2QA 3UNQA 4ASUD 2VINA 1ZOMA 4YT6H 3FO8D 1TPPA 3SU5A 3GS9A 3U8OH 1NFYA 1O2MA 3E90B 3FAOA 1LO6A 4A1VA 1RJXB 3RXFA 1FXYA 1COWD 2ZO3H 4GPGA 4AYVB 1CQQA 2FYRA 2ODQA 1NZQH 1MCVA 1CVWH 1O5GH 2CHAC 2Z9LA 2BDYA 2J98A 2GV6A 2FOEA 4FUCA 1CT0E 2R9PA 2BY9X 3BEIB 3SUFA 1O2HA 1GI0A 8GCHF 4B75A 2BVRH 4KTSA 2KFWA 1QJ7B 2AERH 1O3EA 5EPYA 1P2NA 3Q76A 2AGEX 1GDUA 2BDHA 3OAAD 2FLRH 3UY9A 4X2XA 1RD3B 1U6QA 3DFJA 1SB1H 5C0UA 1ZMJA 1DVAH 2GJGA 1FQ3A 4Q63A 4FUBA 5F8TA 4NWKA 2IPQX 3SU2A 3A8CA 4ABJA 1GI9B 1MTWA 4B73A 3DUXH 1S6HA 1V2WT 1V2KT 1K28D 1DUEA 4YO9A 2BXUH 1AWHB 2QE7D 3VPKA 4X1NU 1BBRK 1IQHA 1P9UA 1DUAA 3FZDA 1QBVH 1F0UA 1S85A 2GMTC 1GGDC 2VIOA 1O0DH 4WH8A 1UVPA 1W0YH 1YCPK 3F9EA 1UTMA 2SGAA 3BTQE 1GMCG 2WZQA 2ZFTA 4MTBA 4GCHF 2Y5GA 3LOXA 5AFYH 1DICA 3ZVEA 1UJ1A 1V3XA 2PGBB 1NO9H 1EOJA 1GHZA 1DT2A 5DSFA 2BOKA 1KXAA 1W7GH 4RKOB 1GMDG 4O03A 1AUJA 1ETRH 1TE0A 2ZHQH 3S0NA 1S0RA 1KMHB 1TLDA 3MNSA 5DKMA 4IBLH 2C93B 2W7SA 1E0FD 1VJAU 2H1UA 1E1QD 1SBWA 3TH2H 4X6PA 2C8ZB 1RFNA 1EZUC 1N6XA 2GZ8A 5GWZA 2FEQH 4XSKU 1O2SA 1MTNC 1DM4B 1YLCA 1YWUA 4DIHH 2WSSD 3K65B 1UCYK 1P9SA 1GCTC 4WVPE 2GCTB 2WYJA 3M3VA 3F2FA 2PTNA 2GGVB 3IITA 3PROA 4CRBA 2G4TA 1VITH 3VB3A 1ANCA 4K8BA 3NRLA 2Z9GA 3MH5A 4XDEA 3UQOA 2BM2A 1K2I1 2F9NA 1P0SH 3PV2A 1ZPCA 2FOBA 4IS5A 5BPEA 1EFRD 1BRBE 1Y5AT 4GHQA 1IQFA 2FXRA 2H5DA 1ZSLA 1B0EA 9LPRA 1TGBA 4A1TA 2JETC
chains in the Genus database with same CATH topology
2PSXA 5E0HA 3PM3A 5E0JA 4ABFA 1EAWA 4NA8A 1W13U 4ZUHA 2Z3EA 1O34A 3PB1E 4X8TH 4A1XA 1O5AB 1H8DH 1QJ6B 5DP3A 1BCUH 1TYNA 4HTCH 2ZC9H 2UUYA 1L0ZA 1BIOA 1Y5UT 1ARCA 2QXIA 1UVUH 3T29A 2OC7A 1AE8H 2ZNKH 2NU0E 1C2IA 2ZGXH 1AD8H 1Z1JA 2QCYA 1M9UA 1YKTA 2P3TB 1SMFE 3GY6A 1SOZA 2G5VA 2A45B 1NU7B 4OGYA 1O3AA 3FP6E 2A32A 1IQEA 3BTME 3U9AH 3RMNH 1YPHE 1EPTB 2HPQH 2ZA5A 3KQCA 2WYGA 3GY8A 4B2AA 2O8MA 1XKBC 2AYWA 3GY7A 2P94A 4ZKOU 1HJAB 2ZU1A 1FIZA 3TNTA 5LH8A 1H9IE 4K69A 3SJ9A 1FPHH 3RLYH 1JIRA 3SUDA 3SGAE 2BZ6H 1H1BA 1VGCC 1P2JA 2O8LA 2CF8H 2ZU5A 1O2WA 5JPMH 1GVKB 1DY8A 1GI2A 7LPRA 1CGJE 5DP7A 6ESTA 1K9OE 1Y3UA 1P2MA 1KYNA 4GVUA 2FLBH 4WXIA 2Q6GA 3I77A 3M5MA 5CHAC 2BY7X 1C9TA 1MKWK 1SHHB 3G01A 2QIQA 3AAUA 4IMZA 3TU7H 3RXEA 1LVMA 1K1JA 2Z94A 5C1XA 4Q7XA 2ZGJA 1UTNA 2BDGA 1UK4A 3SN8A 1BRUP 1QA0A 4LOYH 4I8HA 4ABIA 1V2RT 2ZKSA 4ZROA 2ANMH 3ATLA 1C5UA 1C5MD 1D3PB 4XBBA 1ANBA 1TQ0B 4FU9A 1O2UA 3SQHE 1W3CA 1IHTH 4YESB 1BTZA 2ZHFH 1UVOA 3F68H 2OLGA 3EA9A 1ANDA 3MOCA 4BOHA 1J14A 1A5GH 5LPRA 1V2TT 2NU1E 1QL9A 4Y0ZE 1AMHA 3E0PB 2J34A 4X2YA 2C8WB 4O9VA 4BAQB 1BUIA 1SQOA 1FIWA 1Z6EA 1LVBA 1E37B 2EA3A 1LVYA 1O3FA 1ZJKA 4Y8XA 1YPLH 2Z7FE 1TGTA 1JOUB 1KTSB 4K1EA 2DE8A 5EQRA 5DGJA 3PLBA 3SORA 1JMOH 1IHSH 8GCHG 1C1VH 1OWEA 1P11E 1GBHA 1SL3A 2Z3DA 1MQ5A 3RM2H 1CE5A 1J15A 5GIBA 1TGNA 4IW4E 1IQIA 3BTGE 1W11U 4F49A 1J8AA 1TIOA 1GJAB 1EP6A 2A4QA 2SNWA 3RXUA 4U01A 2OCVB 3TVJB 1BHXF 3A87A 3D62A 3OY6U 1EAXA 1O3GA 1DS2E 1GL0E 2F91A 2ZU2A 3FZZA 3SW2B 1CGHA 1WQSA 3GDSA 1INCA 1HPGA 2NU4E 5DPAA 5LPEA 1UTQA 1ZRKA 1SGTA 3QUMP 3SJKA 2ZTZA 5JBBS 1SGNE 2F9OA 1AZ8A 2A4GA 2TRMA 3ZZ4A 4GCHG 1O3OA 1OKXA 4XE4A 3A8DA 1LPGB 3O8CA 1RIWC 1SC8U 1XVMA 1ZZZA 4PROA 3W94A 1BTPA 3KIDU 1Q3XA 3SI3H 1OP0A 1OWHA 1ABIH 2M5TA 2QA9E 1BA8B 1TPOA 3SHCH 1GPZA 4JK6A 4Y71A 4HGCA 3TITA 2OC1A 4MNVA 1THRH 4MPXA 2ODYB 3L3TA 3DT0H 4I33A 4CRAA 6GCHF 2ZU4A 1TPSA 1K22H 1WSSH 5EXNA 2PKSC 4U2WA 4YTAA 1TBZH 4ZKNU 2G52A 1Z8IB 2B5TB 2FI4E 2GX4A 1ANEA 2BHGA 3VGCC 4IN2A 3MH7A 3VB6A 3H7TA 4OS5A 2ULLA 2W26A 3P95A 4BTTB 4K3JA 1QHRB 3ZZDA 1TX7A 1CA0B 3U69H 4X6OA 1C5NH 3WY8A 1TGSZ 1DWCH 5A0AE 2PKAB 3SZNA 1FV9A 2HLCA 2EC9H 1MBMA 4Z6AH 1C1MA 1F5LA 3QZQA 1F0RA 3LPRA 4UFGH 1DOJA 2HOBA 5I46H 2FTLE 2V3HH 4LZ1H 1ZGVA 1AVWA 2OXSA 4X1QU 3SNDA 3PTBA 3V12A 1TRYA 3PYHA 1F2SE 2HALA 3GY5A 3SJ8A 1D3TB 3SNEA 2C90B 3UR9A 2CN0H 1BDAA 5EXMA 4I8KA 1S0QA 1RS0A 4YLQH 5TCAA 5DP6A 5GCHF 2FESH 5E8EH 4NA7A 3VFEA 1HAVB 1Y3VA 5G4BA 1TABE 1LHDH 3RMMH 3M7UA 2A7HA 1AGJA 3TNSA 4THNH 3OSYA 2O8TA 2A7JA 1GL1A 2VIDA 3S7KB 2WUBA 5T3HA 1AFEH 1GJ9B 2ZFFH 3M5NA 4INKA 3RUOA 4YM9A 1HAZB 5A8YA 2LNCA 3FVFB 4AFQA 4ZHLU 4NZQA 2A7CA 1A7SA 2VWLA 5DO4H 2QAAA 3LGUA 1GCDA 3RXLA 1L2EA 4A6LA 2A5KA 1T8OA 3SV7A 1O2ZA 5EW2H 1P02A 3PWCA 4Y10E 2ZCHP 4Y8ZA 4OS4A 2XBXA 5TCCA 1FY8E 1AKSB 3TH3H 1AB9B 1JRSA 1J9CH 4H6SB 4SGBE 2Z3CA 1TOCB 3EQ0H 5DG6A 2OBOA 3ZZ5A 1YLDA 3R3GB 2F9BH 1TNHA 5HM9A 1L1NA 1AE5A 2P3UB 4CRGA 1GVZA 1NS3A 3RC4A 2BB4A 2RG3A 1TALA 1NPMA 4X8VH 2FOFA 2ODPA 1NN6A 1K1LA 3B23B 3JZ2B 1QL8A 3RXVA 4CBNA 3GY2A 5EG4A 3QN7A 1CHGA 1SGFG 1OSSA 1BT7A 3A88A 1AFQB 3C1KA 4INLA 1C1QA 5FPYA 3TGIE 2A5AA 2PR3A 1HV7A 1FONA 5GXPA 2NU3E 3RXSA 1ORFA 4E06H 1A0HB 1ESTA 4Y8YA 4CH2B 3F6UH 3DA9B 1GI8B 3F9FA 3Q3XA 3MHWU 1C4Y2 5LPFA 1Z6JH 2RDLA 1A5HA 2IOTA 1BBRE 1HAIH 1NRSH 2R3YA 1GHYH 1HAXB 3DHKH 2XYAA 4B2CA 1V2MT 3AAVA 2UUKB 3URDA 2YOLA 5DP8A 3ZZ6A 1W7XH 1G9IE 3SBKA 2CHAB 2RCEA 3LJJA 1DPOA 4CRCA 5FPSA 1SI5H 1CBWB 2J9NA 1FN8A 5ESTE 4E7NA 2A4OA 5FBIA 1HAPH 3VEQB 1MAXA 3RXTA 1ELGA 3MNCA 3SO3A 1UTLM 3RP2A 3A8AA 3A86A 3EYDA 1Y3YA 4NGAH 1G30B 3M7TA 1HAHH 2OUAA 1ETSH 1TMUH 2RA3A 3SV6A 4ABBA 5A2MH 1YBWA 3MU4A 2ZFSA 8LPRA 1BMAA 2CGAA 1LQEA 3CS0A 1TGCA 2BMGB 1K21H 2V35A 5JBCS 1TFXA 2W7UA 2KAIA 2PW8H 1UCYE 2R2WU 1IQMA 3GYMA 1OP2A 1GJ8B 1NESE 3SU3A 2ZQ1A 4DY7B 3T25A 3K9XB 1XMNB 2BYAX 4Q2KA 4DW2U 3EE0B 3L6PA 2GMTB 1V2QT 1GGDB 4CH8B 1PQAA 1DWBH 4MNYA 2OQ5A 1ZTJA 4UDWH 5AVDA 1LPKB 4O3UA 1UVSH 1YYY1 1GBBA 1ZJDA 3M7QA 1KXFA 1EAIA 1O3LA 3SU6A 2NWNA 3OTJE 1KXEA 3QX5H 3S7HB 1JIMA 1O2RA 4X6MA 5JDUB 1GHWH 1WAYB 4R8TB 2DUCA 3RU4E 3FP7E 1ZGIA 3R0FA 1O2XA 4MNWA 1SGCA 4M7GA 2A0QB 2OINA 1K1IA 4YZUA 1N8OC 2OBQA 3ATIA 1QRZA 4DJZB 1GBDA 1P57B 4BAKB 2GP9B 1VZQH 1C1UH 3Q77A 3NKKA 5EU8A 3T27A 3VXEH 1F5KU 1ELTA 4FUEA 1MTNB 1W8BH 1GBFA 2BD2A 2ZP0H 1O3PB 1GCTB 1NRNH 2FOAA 3MU0A 1K1OA 2P93A 1SLXB 4XOJA 2IPHA 4MDSA 3ZVDA 3PLPA 2WPHS 1JWTA 3NXPA 1PQ8A 3A7ZA 1SLWB 1EJMA 2UWOA 4TPIZ 1NTPA 5CE1A 2CJIA 2PWXA 1AHTH 4ESTE 1G2LA 2JETB 4NA9H 3UTUH 3O8RA 1DX5M 3GDUA 5T6GA 1JRTA 3RC5A 1TNJA 5EQQA 1AWFH 1MD7A 3QZRA 2I6QA 3RXJA 1TA6A 1TAWA 1YM0A 3BG8A 2BY5X 2W3KA 3TK6A 3SGBE 3MYWA 1H9HE 5GCHG 3H7OA 4MPUA 3RU4D 1WU1A 4AG2A 1DSTA 1CHOF 2JH0D 2W3IA 3RM0H 1SVPA 3KCGH 3AW1A 1GBIA 3NZIA 5L30H 2D1JA 2BX4A 3CS7A 2IN2A 3TIUA 1SGYE 1Z8JB 1OWJA 4R0IA 1IAUA 3HKJB 1Q2WA 1T32A 2ZFPH 4UONA 1C1TA 2G8TA 1UTPA 4YLUA 3PMBB 1K1NA 2BD3A 2IJOB 3VB5A 1HNEE 1FMGA 3MU5A 4YOGA 3BTTE 1TX8A 1C5ZB 3E16B 1MKXH 3ATMA 2FZZA 1AQ7A 2P16A 3LGTA 1SFIA 5K7RA 2FX6A 1KIGH 1ZYOA 2FDAA 3LIWA 5ABWA 3BIUH 2J94A 1VGCB 3SI4H 1GI6A 1MBQA 2ILNA 2R2MB 5FCKA 2F9PA 1EZQA 2V6NA 1GHVH 2FODA 4NFEA 1MQ6A 1PPEE 5JYIA 1GDNA 3GDVA 5CHAB 1ZMNA 1WBGB 2VH6A 2AGGX 1AI8H 2QXJA 3SHAH 1PPGE 1FAXA 1SLUB 1PPHE 3P92A 4O97A 2GD4B 1P3EA 4CHAC 2O8UA 3I29A 3V3MA 2H6MA 2FX4A 2GKVE 2STAE 1MTSA 3I78A 4IN1A 1EPTA 8ESTE 1FY1A 2Y80A 2VWMA 2AS9A 1Y8TA 1N6YA 1A46H 4INHA 3RXHA 3M3TA 1A61H 5A8XA 1DWDH 2GCTC 1XX9A 1O33A 4X1SU 2VIVA 1O2QA 3OY5U 4FVDA 5FPTA 1ELEE 1UHBB 3S9CA 1BITA 3EA7A 3IWMA 4DT7B 1EB2A 1C5RA 2WPMS 1HJ9A 1FAKH 1C2FA 1SPJA 2WV4A 4AN7A 3ATWA 1QR3E 4FU8A 1BZXE 5HXFA 2GV7A 1O5FH 1Z8GA 1YF4A 2BD4A 3GCHC 2ZU3A 1PQ7A 1BMMH 2ZHWH 4XBCA 2ZG0H 3QO6A 3T26A 2ZDLA 4ISIH 1DLEA 1SGRE 2ZFRH 4Y76A 1O2VA 1F0SA 4NIVA 1AN1E 2Y82A 4WY3A 3KL6A 4ASHA 3MTYA 3UPEA 2F9UA 5GPIB 4ABGA 1BBRH 1V2OT 1XM1A 1YCPH 2TGDA 4OS7A 1HYLA 2HVXA 2V3OH 3HPTB 2FOMB 3UOPA 4LZ4B 1C2EA 1G3EA 5C1YA 1LHCH 4TY7A 1ELDE 2AIPA 1ZRBA 3KEEA 1GJ5H 1T4VH 1O2OA 3SV2H 3RXBA 3BEUA 1XUGA 5HYOA 2OD3B 1LQDB 4GAWA 3A85A 3ELAH 2WPKS 1C5SA 1PPZA 4A92A 4NWLA 4I8GA 2XC5A 1XXFA 4ZKSU 5A8ZA 2BD9A 2BDAA 2ZPRA 2ZDKA 5L2YH 2ZHDA 1RIWB 2V0BA 2B0FA 2FYQA 1HJAC 1FZZA 1EJAA 1TNGA 4MQAA 2A4RA 1HBTH 1GDQA 4WF8A 3RDZA 3VB4A 1UCYH 1SSXA 2FO9A 4TY6A 3U8RH 1KXDA 4DG4A 3ZZAA 2XBVA 1C2KA 3ZZ3A 2FIRH 4JZFH 1QRXA 3UFAA 2ZTXA 1EOLA 2C8YB 1E38B 1YGCH 1EUFA 5I25A 2AGIX 1ZPZA 2PKSB 2R0LA 1W10U 1PQ5A 1KXBA 4I8JA 1A3EH 4K60A 3SJIA 2OP9A 1GI7B 1RRKA 1P3CA 1IQJA 1BTXA 1XUIA 1NRQH 2VIPA 3P8NA 2AMQA 2BVXH 1ETTH 1EX3A 1P01A 1EAUA 3BG4C 3PO1C 3BEFB 1UK3A 5E2OA 1W12U 3GY3A 4CR9A 5FCRA 1HUTH 1WTHD 4A5TS 3PLKA 3MNXA 4FXGH 1GBTA 4KGAA 4D7GA 5E0GA 3PMHB 3T62A 1Y3WA 3MO6A 2AEIH 2PSYA 2VH0A 1KSNA 1V2NT 5C5OA 7GCHF 1ELCA 3RXGA 1BJVA 8KME2 1GG6C 2BLOA 1DITH 1WCZA 1P2IA 1EP5A 1T8NA 3P8FA 1VCQA 1ZPBA 1EB1H 2SGQE 1HDTH 2ALPA 1C5YB 2BVSH 2BD7A 3BF6H 1X7AC 4DGJA 4JZ1A 4ABAA 1CHOG 2WPLS 1Z1IA 2VGCC 3RXCA 3BV9B 2D2DA 3P8OA 1MMJN 3M61U 1AY6H 2BX3A 1CT4E 2UUFB 1L4ZA 3E0NB 3RXQA 3TJNA 1CSOE 2PKAA 4WMDA 3ODFA 1O35A 4GLYA 4JZIA 1C5TA 1O2YA 2BLWA 5C1UA 2ZI2H 4JZEH 1NU9A 3AW0A 1NFXA 3MI4A 3TJOA 2AMPA 1SGPE 3NUMA 2JH5D 1O2IA 4X8SH 3DD2H 2ZGHA 1J17T 1MKWH 1UVTH 1RGQA 3C27B 1S84A 4YT7H 2Z9KA 3OYPA 2ZQ2A 3PV4A 1BJUA 2EI7A 1AVXA 4FUGA 3Q3KA 1ZMLA 3ZV9A 1O3KA 1DDJA 4K2YA 3AVZA 3MWIU 3U98H 1HLTH 1W0ZU 1HXEH 1NROH 1QURH 3S9AA 1A4WH 3KF2A 1FLEE 2PHBA 3H5CB 2ZDNA 5EXLA 1JXPA 1HAVA 4Y7AA 1QNJA 1ARBA 4UE7H 3SNAA 5A0CA 5J4QA 2XRCA 1QBNA 4DVAU 3V13A 4DOQA 1S82A 2ZHEH 3HGPA 3GCNA 1MTVA 3MO3A 3RMLH 2BY8X 3OX7U 1G32B 4ZAEA 1C5VA 1O39A 2VIQA 2GVFA 4X1RU 1K1PA 1O3HA 4JZDH 2UWLA 4B74A 1TBRH 3TGJE 1QTFA 1C9PA 5FXLA 1QY6A 1BTWA 3SNBA 3U8TH 3ZZ7A 2VWNA 3RXRA 3MNBA 3A7WA 2OTVA 5IDKA 3LGYA 2HNTC 4ZHAA 2C4FH 1CA0C 1AKSA 2ZF0H 5EOKA 2H5CA 1O30A 2XC0A 4JYVH 3LGIA 2JH6D 3D49H 2QV1A 1OWKA 2QY0B