4I8KA

Bovine trypsin at 0.85 resolution
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title On the reproducibility of protein crystal structures: five atomic resolution structures of trypsin.
pubmed doi rcsb
molecule tags Hydrolase
total genus 63
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2012-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4i8kA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4i8kA02
1XVMA 2FESH 4B75A 3U1IB 2F9UA 4Y8YA 1EAIA 4MPXA 1DS2E 4ZROA 4CHAB 4OGYA 4X1RU 1GCDA 4RKOB 1DLKB 1KTTB 1NFXA 3RUOA 1HJ8A 1CQQA 2ZFFH 3PLPA 1XKBC 4Y10E 1FY1A 1O2TA 1A61H 1AFEH 1QHRB 5DP9A 1O37A 3KF2A 3LJJA 7ESTE 1YF4A 1O3FA 2ZQ1A 3GYMA 3H5CB 1VJAU 3TITA 2CHAB 1Z6JH 4Y76A 4ZKOU 1BMMH 1V2MT 4ABJA 4BOHA 9ESTA 1AE5A 1E38B 1KXAA 1O2SA 1O2KA 1C5MD 2EA3A 5JYIA 1J8AA 1LVBA 3UNSA 1GHBG 1QB1A 1O3CA 3Q3XA 2BXUH 1IQLA 1BBRK 5C1YA 1F0TA 3DA9B 3SI3H 4DW2U 2W26A 1P9SA 3VGCB 3RXRA 3UQOA 1GI9B 3FP8E 3RM0H 4X6PA 2Z3CA 1BDAA 3UNRA 3HGNA 1BTZA 3VEQB 2A7CA 3HATH 4X2VA 3ZZ3A 4YO9A 3KQEA 4I8KA 4O3TA 5JPMH 5HMAA 5C1UA 4MDSA 1O31A 1C2FA 3ODFA 1SGFG 4TWWA 5GPIB 2SGEE 4ABFA 3SZNA 4AZ2B 1L1JA 2XBWA 1P8VC 3ZZDA 2AIQA 2BX3A 1G3CA 2XBVA 4J1YA 2RDLA 1O3BA 4JK5A 3V13A 2FO9A 4OS7A 4NFEA 1FPHH 1IQNA 3UREA 5T6DA 1BZXE 2H5CA 4U2WA 1C4U2 4GAWA 2ZO3H 1W14U 1BJVA 4Q2KA 4THNH 1GBEA 1ZJDA 1C5VA 1VGCC 3FAOA 1T7CA 4UEHH 5EG4A 2CN0H 2BHGA 1TGTA 1P01A 3RXBA 4GUXA 3RXHA 2Q6FA 2ZU2A 5K7RA 2ZDMA 1TONA 1FY4A 2Z94A 1W3CA 1GWAA 4UDWH 1MU8B 5DJ7A 1PPGE 2JH5D 4NFFA 2AIPA 2XBYA 3PMAB 5EPNA 5HM9A 2CMYA 3G01A 1SBWA 3HK3B 1KXCA 2OQUA 1EB2A 1H1BA 3MO9A 4XSKU 2VGCC 3VB5A 1SR5C 1MAXA 2BDBA 1EOJA 4KTCA 3SGQE 1FY8E 1O35A 3M5OA 1PYTD 3V7TA 2BQ7B 1HAPH 2NWNA 4JCNA 1W12U 2Y5GA 7LPRA 1KY9A 1S82A 4YOIA 1K1JA 3SN8A 4BANB 1NY22 1C9TA 2C8XB 2GCHG 1KXDA 1SOZA 1Z8RA 3KCGH 4IC6A 4PROA 4U30A 1WU1A 5FXLA 2BDIA 4ZHLU 1PQ7A 2Z9LA 1C1RA 2GGVB 3T27A 3SV9A 1ZTLA 1ELEE 3A86A 1QNJA 1J9CH 1BHXF 1K1NA 2VIPA 3A8AA 1P10A 1VCPA 1UVSH 4XBCA 4NWKA 2BOHB 3QGJA 3LGIA 3S9AA 1MZDA 5HGGA 1QB9A 3GCTG 3EA7A 1OX1A 1TNJA 2ZDVH 3SUDA 1GDNA 1ZPBA 4MPWA 1GHAF 1RXPA 1A1RA 1C2MA 1J17T 1O5DH 5TJXA 2Z3EA 3KQCA 1AUTC 2ANMH 4WF8A 5E8EH 2C8YB 1P11E 2BY7X 5K0HA 1QA0A 1TX6A 3ZZ8A 4FVDA 1GL1A 1S5SA 1JWTA 3ZZ4A 1HGTH 1UTPA 3P8NA 1ZHPA 1JRTA 5GCHF 4BAMB 1DY8A 1UK3A 1ZMLA 1W13U 3EGKH 4AG2A 1NFUA 4WXVA 1ANBA 1A0JA 1BTYA 1O2YA 2WV4A 3RDZA 4X2WA 1TPSA 1FXYA 2GDEH 1YLDA 1WBGB 1YGCH 2ZU3A 3ATLA 4DGJA 5E2PA 3GY3A 2PUXB 2OBOA 5FCRA 4BNRA 1WUNH 2FM2A 4HI3A 1MD8A 4FVBA 3SNEA 4DIIH 1V2WT 1TMTH 2XWAA 1Y3YA 4B1TA 4X2YA 4OGXA 5A09A 2P3TB 2ZGJA 1Y3VA 5FCKA 2G00A 2ZTXA 1CO7E 3EA9A 3DHKH 1EZQA 1SC8U 2VWLA 1D3TB 1RIWB 1IQHA 3U1JB 3ZVFA 1P02A 2NU2E 3D62A 5ETXA 1G3EA 4AFSA 3QX5H 3TJNA 3O8BA 1QTFA 3GDVA 4ZUHA 2AGIX 4TY7A 1AHTH 5J4SA 2SGDE 4D9RA 2BQWB 1XXFA 2FOGA 1AKSA 2FOHA 1AMHA 3ATIA 3SJ9A 4AFUA 1MD7A 4XE4A 2H2ZA 4JK6A 1G9IE 2ESTE 1C2EA 2KAIA 5T3HA 3JZ1B 4BTIB 3UR9A 2ANKH 1P03A 1FN6A 1UCYH 3P6ZB 5F03A 1XXDA 3RC5A 1BT7A 1F0RA 3MH4A 2A45B 2VIQA 1PQ5A 1JOUB 3LH3A 2P8OC 3LT3A 4MQAA 1Z7KA 5B6OA 5I25A 4FUGA 3RMMH 3RXJA 1GMCF 2JKHA 4I31A 1QQ4A 1SHYA 3RXTA 2AMPA 3T2NA 1B0EA 1QFKH 4I8LA 1C5UA 1KXFA 6GCHG 1V2OT 2QV1A 1DWBH 3Q76A 1DE7H 5C3NA 4X1PU 3Q00A 1N8OC 4I8GA 5BPEA 3ZVGA 2XCFA 1W7XH 1SL3A 4CRDA 2Y7ZA 2BY5X 2ASUB 2ZA5A 1O2VA 1A3EH 4GPGA 4DY7B 1S83A 1ABJH 1UTOA 3Q3YA 1CE5A 1S0QA 4IMQA 1K28D 1BHXB 1O3IA 4ISLA 1YPHC 5LGOA 2G5NA 2BLOA 1NC6A 2Q1JA 2BB4A 1DXWA 1ZYOA 4ZAEA 5EU8A 1TA6A 2FMJA 3BTGE 1EP6A 1FJSA 6CHAB 2THFB 4MVNA 1RD3B 3B8JA 1XUKA 2VB0A 2RG3A 1DSTA 3FP6E 1QL8A 2ZFQH 2Z9IA 1TOMH 1QQUA 1X7AC 5F8TA 4Y8XA 3PROA 2SGQE 1W10U 1MZAA 3MO6A 4A1XA 1ELBA 2WV5A 1QJ1B 2ZPSA 4UE7H 4FUHA 4NCYA 1OWDA 1LKAA 5E0GA 3T5FH 4ISIH 1EPTA 5BRRE 1AKSB 1QA7A 2AH4X 5JBCS 3CP7A 5L2YH 4JZFH 1OPHB 2QXGA 3I78A 1GI8B 2BVRH 1ZSJA 1IQMA 1AFQB 2XRCA 1SSXA 2Z7FE 1K2I1 2OCVB 2KAIB 1CHOG 2H5DA 2ZGBH 2BY9X 6ESTA 2VNTA 1SFQB 3ZYEA 4NGAH 2WPJS 1C4V2 1QY6A 1GHXH 4YLUA 1C5ZB 3RXMA 1CVWH 2WYJA 1O2MA 2FDAA 1DWDH 2ZFTA 2P16A 1T8NA 4NSYA 4CRCA 1P3EA 1XMNB 3VB3A 4VGCB 3A8DA 4ABIA 3ZVCA 5CHAB 3Q3KA 5E0HA 4A92A 1HXEH 3F68H 4WMEA 3V0XA 4CH2B 2LPRA 4K60A 1YPGH 2VH6A 1GMHF 1L1NA 1VR1H 4GCHG 2QF0A 3QTVH 1AVGH 1WV7H 3VB6A 1TNKA 1SQTA 2Q6DA 1YCPK 1S85A 3OTJE 2BVSH 4A5TS 2AERH 1ARBA 1SGYE 2RCEA 5DKMA 1C2JA 3U8RH 1LHCH 1C5RA 3MO3A 4AYYB 2UWPA 1A46H 2FP7B 1KXBA 2QXHA 5EGMA 4BTUB 2YNAA 4KTUA 2JETB 1VZQH 1NROH 2XC5A 3GY4A 2A0QB 4CBNA 8LPRA 1OP0A 4JMYA 1GJCB 1C2IA 4NWLA 1ESTA 1G3BA 1P06A 3QZRA 2OQ5A 2BYAX 2TRMA 2I6SA 2GD4B 2OC1A 3LH1A 1VITG 4CBOA 2PTCE 1KYNA 2A5IA 1FLEE 2QF3A 1KTSB 1D3PB 5J4QA 1NESE 1FZZA 1EZSC 1XUIA 2FOAA 2XNIA 2WPMS 3D49H 3UWIA 3R0FA 1TYNA 4JZIA 1EPTB 1DT2A 1E34B 1YKTA 3TJOA 3AVZA 2GVFA 3QK1A 1BTHH 2A2QH 3EA8A 3UOPA 1T8LA 4XDEA 1TMUH 5JBAS 1V2KT 2GMTB 1HAYB 3SV6A 3D65E 1EATA 2AEIH 1DPOA 2ZQ2A 2TGDA 1ZPCA 5DK1A 3N7OA 1G3DA 5DPAA 3BG8A 2AGGX 3LGUA 1O3OA 1SGQE 1WAYB 2ZCKP 3LC3A 3RMNH 1FV9A 1O2GH 2AMQA 4ZKRU 1TE0A 3A80A 2BQ6B 3MWIU 3TU7H 1O3KA 2GCHF 1GJ4H 1O5GH 3F6UH 4M7GA 1C2KA 3T62A 3OX7U 7GCHG 1GI5A 2EI7A 1YPJH 2HPQH 4X8VH 2ZF0H 1F92A 4DCDA 3OU0A 4IMZA 1EKBB 1TLDA 5PTPA 1O2OA 1AWFH 1BMNH 3VB7A 2FODA 1SPJA 4E05H 3ZVDA 2EI6A 3T28A 1NRRH 3SU3A 1NU7B 5C5OA 1MQ6A 3GY7A 3Q77A 3RXGA 3E0PB 4Y0ZE 4F49A 5DP4A 1GG6B 2VJ1A 3GCHB 4LOYH 1C5YB 2SGAA 1OYQA 5EQQA 1ANEA 3GICB 2TGTA 4BAQB 1C1TA 3M3VA 2J92A 3DT0H 1P0SH 1LPZB 1Q3XA 1TOCB 4HGCA 1NRQH 3A7WA 2H1UA 1L1GA 3MU8A 1QJ7B 1CBWB 2ZFSA 4CR5A 1C1VH 1GBDA 2PHBA 3RXDA 2VINA 2BX4A 1Y3XA 2B7DH 1INCA 3F1SB 4Y7BA 1MTUA 1O3MA 5JBBS 2O8MA 3AW1A 1H8DH 1IHSH 1ZTJA 3M3TA 3ZVAA 3RXOA 1O5BB 1HAVA 1IQIA 2NU3E 3BG4C 4NSVA 4RKJB 1TBQH 1S0RA 1ETRH 5FPYA 1KIGH 4BXWA 3UPEA 1A3BH 1GHVH 1TNIA 3SO3A 1J15A 2QGRA 4MTBA 3OY6U 1HJ9A 2P3UB 4CRFA 2UUKB 2GZ7A 1UO6A 3TH2H 4SGAE 1ANDA 1YPHE 2QXJA 5FX5A 1OWKA 1ELVA 3TVJB 4NG9H 5EXMA 1ELCA 1UCYE 2ODYB 1GBBA 4Y11E 2ZFRH 4AGJA 2VU8E 3SBKA 5DP5A 3UUZA 3QO6A 1B7XB 2CF8H 1FY3A 2AS9A 1O2XA 1EX3A 2W3KA 5C1XA 2FEQH 1TGSZ 2A2XH 2ZHDA 4TWYA 3MNXA 1C5OH 1FQ3A 2UUFB 4ZHMU 3SUGA 1ZHMA 3MTYA 1P57B 3GY2A 1SGRE 2ZIQH 4ABHA 4BAOB 1MMJN 1PYTC 1DITH 3SV8A 2C8ZB 1LCYA 2Z3DA 4FUDA 1NT1A 1OYTH 2IN2A 1JRSA 2SNVA 4X1QU 5F8XA 3O8CA 3S69A 1O2WA 2A5AA 4UFEH 2HPPH 1ORFA 5AVDA 3UWJH 1JIRA 4H42U 1OOKB 1QURH 2ZI2H 5GDSH 1H8IH 6GCHF 1K22H 1T8MA 2PKSC 1N1LA 4YTAA 1BA8B 1DFPA 1ZSKA 1T31A 4MNVA 4UONA 1GBJA 1HAHH 5EXNA 1LO6A 1LVMA 1HRTH 2VIVA 2XW9A 1O3DA 1T4VH 3ZZ9A 3M5NA 1GI3A 1HAVB 4AB9A 1GI6A 3LPRA 1W8BH 1UTNA 1B5GH 1D6WA 1HJAC 1OP8A 3SQHE 4GVUA 3BTDE 3U8TH 2ODQA 2AYWA 1TABE 3EQ0H 1L2EA 1KLTA 2NU1E 1HB0B 1K1OA 1QRWA 3ZZAA 4Y71A 3E6PH 1TALA 2BD2A 3IG6B 2PKSB 5JBTA 3RXLA 2WUBA 1CGIE 3CS0A 4Y8ZA 2DUCA 2ZCLP 1LKBA 3M5LA 4BTTB 1EB1H 1SLVB 2J4IA 4B2BA 2PSXA 2OTVA 2HOBA 4Y7AA 4B2CA 4D76A 1VGCB 3E16B 4I7YH 4K1EA 2R2MB 3BV9B 3TK6A 3PTBA 3ATMA 1QB6A 2BMGB 1O5FH 1C5SA 1SI5H 4FUEA 3TH3H 1LDTT 4IGDA 2WYGA 4I33A 1GBLA 1GJDB 1CHOF 1F2SE 4AORA 4FUFA 3TGKE 4FUCA 1BQYA 1C1NA 1AD8H 1O39A 2J2UA 4U01A 1ZTKA 1CT0E 1ELDE 1SLUB 2VIWA 2R3YA 1LHDH 2VGCB 2XWBI 1GL0E 3U98H 1O3HA 1DUAA 1G36A 2TPIZ 4O9VA 8KME2 1HYLA 1HIAA 2V6NA 4ABAA 3L3TA 1O38A 1MQ5A 1RGQA 4GCHF 1TRMA 1PPBH 1Y5BT 2FOEA 3TIUA 2ZECA 3VXFH 1AUJA 1BTUA 3A7YA 1EAWA 2GZ9A 3WY8A 3CS7A 1GJ6A 1HUTH 4GHQA 5C20A 2J95A 1AO5A 1E36B 1P05A 3TNSA 2UWOA 1LPKB 1IHTH 2ANWA 3E90B 1QR3E 4MPUA 4INKA 1AB9C 1E0FD 3MNCA 1OWJA 1VCWA 2OC7A 4ISNA 4A6LA 4AN7A 1G32B 1KDQA 2R0KA 1AIXH 4JYUH 3F9HA 1THRH 4K3JA 2BOKA 2ZU1A 1GJ7B 4WH6A 1S6HA 2BDAA 1YLCA 1VITF 2A4RA 3LC5A 4I8JA 1AI8H 2SGFE 1YYY1 1W0YH 2ZGXH 4CRAA 1JIMA 1TNLA 2HALA 2O8UA 1NRPH 3SJIA 3MNSA 1SFIA 4MNYA 4X1SU 3SJKA 2FOMB 1ELGA 1XUGA 4E06H 3IITA 1YP9A 2BD3A 4X2XA 1TRYA 3V3MA 2DE9A 2C4FH 4RN6A 3AW0A 1UHBA 4CRBA 3RXUA 2BVXH 5A0CA 2OLGA 1QRXA 4BXSA 1O3PB 1SQAA 3ATWA 1E35B 1V2LT 1IQFA 3LDXH 3P92A 4LZ1H 3PO1C 4TPIZ 2QYIA 2FX6A 3MH6A 3ZZ5A 1T4UH 4JZ1A 4YZUA 3AAVA 2WPLS 3KQDA 3OY5U 3MOCA 3NPSA 3RP2A 4X6OA 1GI1A 3O8RA 3HKJB 1IQJA 3RXEA 2BD4A 1JMOH 1EAXA 1MKXK 4E7RG 5A8ZA 1ZLRA 3U9AH 4K1SA 4Q80A 4YOJA 5FPSA 1VITH 1NO9H 1CA0C 1HIAB 3A85A 3BTME 1MTSA 5FPTA 1SGEE 3GOVB 3M7UA 1XUJA 2FZZA 2IPHA 3I77A 3MU5A 3EE0B 3K65B 3QZQA 5FBIA 2Y82A 2D2DA 1MKWH 1YPLH 2J94A 4Q7YA 1GJBB 4BAKB 1C4Y2 1P09A 5SGAE 3DD2H 3CENA 5A8XA 1C5NH 1GGDC 1H4WA 4NZQA 2VH0A 2HLCA 3SGAE 3SU5A 5F6MA 3K2UA 2R3UA 2IOTA 3M37A 1WYKA 1CA8B 2B9LA 1IQGA 4AFQA 1K1IA 1KDQB 4OS4A 2YOLA 3SJ8A 2Z9KA 5JDUB 9LPRA 1GMDG 1QCPA 3SU4A 2RA3A 4TPYA 3H7TA 2D1JA 2P8OB 1NTPA 1CT4E 4JYTA 1T32A 1HXFH 1LTOA 1TGNA 1ZJKA 2GCTC 2BD9A 1TB6H 1WQSA 1ZGIA 2W5EA 1UHBB 1OSSA 1ACBE 4B71A 1V2TT 3JZ2B 2BLQA 3LGYA 3RC6A 1N8OB 4Q7ZA 5TCCA 1SLXB 1BRUP 1A4WH 5HM2A 4DURA 1HAOH 4IN1A 3F9FA 1SQOA 3A7ZA 1ELAA 3PWCA 3TJVA 1MBMA 1QRZA 3HKIB 1GHYH 4U32A 2BDCA 3P95A 1HAZB 3B23B 3PLKA 1PPCE 3QWCH 3R3GB 2TGPZ 1KSNA 1XKAC 1V2ST 2UWLA 3UFAA 2O8WA 1LVYA 4I32A 1LHGH 3LGTA 1THPB 1J14A 3BEFB 2IJOB 4F4OC 1Y3WA 1N6XA 3UNQA 3EYDA 4UFDH 5DP7A 5DP3A 1EQ9A 3HPTB 3T26A 1GHBF 1NS3A 1W0ZU 1WTGH 4MNWA 1C5LH 3OYPA 5L2ZH 1V2RT 3F9GA 2AGEX 3SUFA 1OS8A 7KMEH 2GTBA 1ESBA 2VWOA 1FAKH 4MPVA 1XUHA 1P2KA 3A7TA 4AB8A 3SU2A 2C90B 1K9OE 1TPPA 1DWCH 1F7ZA 1XX9A 1O3LA 1DSUA 3P70B 2Z9GA 1HAGE 1UJ1A 2GT8A 1O30A 1TAWA 2W7SA 1O3JA 4UFFH 4O97A 1PPEE 3RM2H 3MH7A 4DVAU 3RXPA 2LNCA 3MU4A 3PYHA 3STJA 1TBRH 3S9CA 2H9HA 2G4UA 5ABWA 2VVVA 1OWHA 1V2PT 3K6YA 3ZVBA 1ETSH 2ZEBA 3P8GA 1AN1E 1TFXA 4JZDH 4DT7B 2SFAA 1NRSH 2XTTB 1SGDE 1GHAG 3P8FA 3U69H 3SV2H 1GJAB 1XVOA 4A7IB 1C5WB 1V3XA 2PWXA 3M36A 2R2WU 1UVOA 1BBRH 1C5TA 1BUIA 1UTKA 3SU0A 1OKXA 2UUYA 2GT7A 3BTHE 1T8OA 1GJ8B 1PJPA 4FU7A 2WPKS 1BMLA 4ISOA 1WTHD 3STIA 3FFGA 4TY6A 5GCHG 1CT2E 1A0HB 1HFDA 4B76A 5DO4H 3NK8A 2VWMA 1C1UH 1TGBA 3A81A 3A82A 5T6FA 1ZGVA 1KLJH 1Z6EA 1S6FA 2D26C 1W2KH 3SORA 1GCTC 1SGFA 5EQRA 1SGIB 4KELA 3BEUA 1Z8JB 3UR6A 5ESBA 3RU4D 3MYWA 4AG1A 1UCYK 1W7GH 2YNBA 1BTWA 1MTNC 1LQEA 1O5CB 1NFYA 1F0UA 3KHVA 4QT8C 3GCNA 1IQKA 3BEIB 1TBZH 3QN7A 1A5GH 5H4IB 1HAIH 3U8OH 2F9NA 5E2OA 4HTCH 2VWNA 2F83A 4YLQH 3SOSA 4Q7XA 3GY5A 4LXBH 1PQAA 1O2HA 2QA9E 4IC5A 3A8BA 2M5TA 2PW8H 3B9FH 4AGKA 3MFJA 2PFEA 5DP6A 1FMGA 2ZDAH 5HYOA 1EASA 2ZDNA 1GCTB 2DE8A 1TX7A 1Y5UT 2FI3E 2WUCA 2ZFPH 4SGBE 1K1PA 2G5VA 5AFYH 1ARCA 1O33A 1QIXB 1A7SA 4MLFB 1HBTH 3TK9A 4ZXYH 3BSQA 1J16A 1DOJA 4FXGH 2Y7XA 1ID5H 3GCTF 2VVUA 3S9BA 2FOFA 4YT7H 4Y79A 3GY8A 1UVPA 1C5QA 1D3DB 2ZTZA 2A5KA 3GDUA 2VIDA 2QIQA 1AZZA 5LPFA 3M35A 2ZPRA 1AWHB 4H4FA 1UTQA 5LH8A 3QLPH 1C1QA 1D9IA 2FI4E 1GDQA 1MTVA 4HFPB 1LPGB 4CHAC 1EAUA 2V0BA 3H7OA 1A0LA 3LU9B 1ELFA 3L33A 3KEEA 3TPIZ 1O2ZA 4X0WU 1BCUH 3TH4H 2G81E 3NUMA 1HDTH 4YM9A 1P9UA 2TIOA 1FIZA 1S84A 1YPMH 3ZYDA 4D9QA 1QBNA 2CHAC 1Y8TA 1V2VT 4ZKSU 4O03A 2B8OH 2HVXA 1DWEH 4ESTE 1O2UA 1D3QB 1SVPA 2O9QA 1HLTH 3RU4T 2VVCA 3L6PA 3SJOA 2R9PA 1C1PA 4D7FA 1V2UT 2FYQA 4R8TB 2XYAA 2ILNA 2EC9H 3UOUA 2EI8A 2SNWA 4LZ4B 4NIXA 4NA8A 3VGCC 1MH0A 1RFNA 2Y5FA 3PM3A 2Z9JA 4IW4E 3RC4A 3FANA 2HNTF 3SW2B 1GBHA 4D8NA 2ZZUH 4FU9A 3BG4B 1TWXB 1RRKA 2JH0D 2I6QA 3LGVA 3K9XB 5JB8S 3UQVA 3MMGA 3RXCA 1DVAH 1L0ZA 4K69A 4R0IA 4CH8B 3SGBE 3M3SA 3TLOA 1G2LA 1NRNH 2ZDKA 1F5RA 1GI7B 1C1SA 2V3OH 5A2MH 3E8LA 3SNBA 3VPKA 2OXSA 1AU8A 2ZG0H 3GDSA 1ELTA 4ZH8A 3SNDA 1BMAA 1CU1A 1UTMA 1HPGA 1OXGA 3KGPA 3DUXH 3TNTA 4AYVB 3A7XA 1GI0A 2FLRH 2ZDLA 2H9EH 1PFXC 4OS2A 1EZXC 2W3IA 4UFGH 3RXQA 3SHCH 1SG8B 2QC2A 3SNAA 3D23A 5FX6A 3TJUA 1A5IA 1C2GA 1RTLA 1GBCA 1GI2A 1EP5A 5EW1H 5EOKA 1GMHG 1D4PB 2OUAA 3VFEA 4B73A 1C2HA 2GV7A 3RU4E 2FTLE 4WXIA 3E0NB 2XCNA 3BIVH 4OS1A 1IAUA 1O34A 2ZGHA 1O5AB 4H6SB 1H9LB 1HAXB 4I8HA 1GMDF 3BTEE 3FP7E 1MKXH 1QGFA 4K2YA 4FUBA 4TYDA 2BZAA 4X6MA 5CE1A 4GHTA 4NA9H 2ALVA 1PPZA 3ODDA 3A89A 2ANYA 2TGAA 1O2LA 2J38A 2WPIS 1GHZA 5ESTE 3RMLH 2F9PA 1DUEA 3RXSA 8GCHG 1BIOA 1FIWA 1OP2A 2SGPE 2GDDA 1YCPM 4X6NA 1P04A 4CRGA 4X8SH 2A31A 2F91A 3SU6A 1K21H 4K1TA 2P93A 3LOXA 2BLVA 1ETTH 3BTKE 2OD3B 4K8YA 4WY3A 3DFLA 1C2LA 1A2CH 1AGJA 1ZMJA 4KKDA 3VB4A 3M7TA 3E3TA 4KGAA 3SI4H 3BTTE 4MG3A 1NZQH 1Z1JA 2J9NA 1HJAB 2P3FH 2HNTC 1TA2A 1XM1A 1GHWH 2HGTH 3E91A 4ABBA 1TRNA 3SV7A 4CR9A 3A84A 2J34A 1FN8A 4YT6H 1PPHE 4NZLA 1V2JT 1JBUH 2ODPA 2G4TA 2PR3A 2BY8X 1EOLA 2PKAA 5DG6A 1BRBE 3ELAH 1Y3UA 2BD5A 1UK4A 2XC4A 4K5ZA 4FUJA 1C1MA 3RXIA 2QN5T 2JH6D 4OS5A 3UTUH 4K8BA 1NPMA 3PMHB 2QCYA 5EPYA 2ZGCA 4UD9H 2ALPA 4NIYA 1MTWA 2AFQB 5C2ZA 4X8TH 1BBRE 5GXPA 3EDXB 5T6GA 1DICA 2BDHA 4DIHH 1GBFA 1VCQA 2BDYA 2FXRA 1N6YA 2Z6BD 3UIRA 2BD8A 1DXPA 4CREA 1EUFA 1MBQA 1QBOA 2TBSA 1WQVH 1C5XB 1QJ6B 3OSYA 3RLYH 1ANCA 2A7JA 2FLBH 1H9HE 1Q2WA 3DFJA 2BTCE 1CGHA 5EODA 5LPEA 1AQ7A 1FAXA 4ISHH 1BRCE 1FDPA 1BRAA 2FI5E 3RMOH 4B2AA 2A32A 1P2OA 1ESAA 1LHEH 1P12E 1RIWC 3S7HB 2ZHEH 4WMDA 4Z6AH 1GJ5H 1O2QA 1V6DA 3T29A 2CGAA 1P2IA 1A5HA 3AASA 2BD7A 3MNBA 4YESB 1SMFE 1UTLM 2PUQH 1V2QT 3KN2A 2ZHWH 3ATKA 5JB9S 2FS9A 2ZPQA 5EQSA 3GISB 2R0LA 1O3NA 2ZHFH 3QUMP 1YCPH 2WINI 2G8TA 3TK5A 1U6QA 1FONA 3NCLA 1AB9B 3IWMA 4O3UA 5FHTA 5TCAA 4BAHB 1HNEE 4ABDA 1O0DH 1AVXA 4ABEA 1ZR0A 2ULLA 1EJNA 1NU9A 2A1DB 4MNXA 1C2DA 1AE8H 3A8CA 3E1XB 2PKAB 3PTNA 2FIRH 3RXFA 1YBWA 1DM4B 4NIVA 2F3CE 1EJMA 1DLEA 1PPFE 6LPRA 2PGBB 1FI8A 1ZSLA 2OC0A 3KL6A 7GCHF 4INLA 1CSOE 2QY0B 1Z8IB 5E0JA 1QL7A 2G52A 5EXLA 2QXIA 3P8OA 1O2RA 2BLWA 4X8UH 4WWYA 2D8WA 1K1MA 2BY6X 3C1KA 1SLWB 3VXEH 1C1WH 3PO1B 1P2MA 1SB1H 1GBTA 3BIUH 1ABIH 2PV9B 1NN6A 2BM2A 4J2YB 4LK4A 1O36A 3M61U 1TMBH 2QAAA 3RXVA 5FAHA 2H9TH 2XXLA 3A87A 1IQEA 3SQEE 4A1TA 1DANH 3KQBA 3SU1A 4ZHAA 2FS8A 1O3GA 3AAUA 1B0FA 2XBXA 4IBLH 4FU8A 1E37B 1S81A 1YPEH 2ZNKH 6CHAC 2C3SA 3A83A 1NM6A 4X1NU 1CA0B 1P2NA 4KTSA 3T25A 3ZV9A 4XBBA 1OWEA 1YC0A 2BXTH 2P59A 4Y6DA 3QGNB 1GVZA 1ZMNA 2C8WB 4XOJA 2CV3A 1BOQA 1RS0A 4D7GA 2C93B 3HGPA 3HK6B 1FY5A 1MUEB 1DX5M 4YOGA 3LONA 3M7QA 1RJXB 1O2PA 3BTWE 3ZZCA 2RA0A 1FNIA 3SNCA 1C9PA 4ZXXH 1O5EH 5HXFA 1GGDB 4WVPE 1GPZA 3ESTA 2WPHS 1TIOA 3SHAH 2F9OA 3ZV8A 3S0NA 2CXVA 1SGPE 1AFQC 4Z0KA 1BITA 5G4BA 4GLYA 5CMXH 4DOQA 2NU0E 2FOBA 3URDA 5AFZH 1THSH 5GWZA 1OWIA 1TQ0B 3GCOA 2FTMA 3QTOH 1EJAA 3TGJE 1ZRBA 2ZU4A 3BF6H 4JZEH 1VJ9U 2GCTB 2OP9A 5GIBA 5LPRA 3TGIE 4KP0A 3V12A 4VGCC 1ZHRA 2PGQB 5CHAC 2GZ8A 2NU4E 3LKWA 1P2QA 2K1QA 1KLIH 1RTFB 1TNGA 1UMAH 3LIWA 1UVTH 3LGWA 3NWUA 4HZHA 1AZ8A 2G55A 2P95A 3M5MA 4GSOA 1TNHA 4DG4A 3SUEA 1F5KU 4H6TA 4DJZB 1GVKB 1TX8A 2CF9H 2Y6TA 1QL9A 3RXKA 5I46H 3A88A 4ASHA 2STBE 1MAYA 3QDZB 1TGCA 1EXFA 2HNTE 2JETC 1UVUH 5GJ4B 5FBEA 1Z8GA 2OBQA 1C1OA 1SHHB 1EZUC 1Z71A 1F5LA 2B5TB 2ZHQH 2A4OA 2PSYA 2ZTYA 1IOEA 1GVLA 3MI4A 2V3HH 2A7HA 1LMWB 1W11U 1YPKH 5L30H 5AHGH 3UY9A 4XBDA 3ZZBA 1SGCA 2GKVE 1C5PA 1BTPA 1FPCH 1M9UA 1TQ7B 2GX4A 3MU0A 3FZDA 4ZKNU 3RXAA 3S7KB 2ZP0H 1ZPZA 1SGNE 4RSPA 3K6ZA 3MU1A 5C5NA 1UK2A 2ZU5A 1KXEA 1L4ZA 3NXPA 1O2JA 2FOCA 1EPTC 3MH5A 1LVOA 2B0FA 5AF9H 1DY9A 2V35A 2UUJB 3I29A 2EEKA 1SGTA 3FZZA 2A4GA 2GMTC 2ZKSA 3BTQE 1BJUA 1MCTA 3W95A 4Y0YE 2Y80A 3RLWH 8ESTE 3ENSB 8GCHF 1G37A 1XUFA 3PWBA 3GY6A 5DP8A 5IYTA 1V2NT 2GV6A 4XFQA 4B74A 1Y59T 1ZOMA 2FPZA 1DDJA 5A8YA 5IDKA 2H6MA 1P3CA 3P17H 4A1VA 1WCZA 3KIDU 5L6NH 5DGJA 1P2JA 5C67A 2Y81A 3FVFB 1BTXA 1UTJA 2XC0A 1CHGA 2FX4A 1MKWK 1AVWA 1MU6B 1CGJE 3MHWU 2A4QA 2ZC9H 1QBVH 1TPAE 2F9BH 2G51A 3PLBA 1HV7A 1HCGA 1G30B 3ITIA 1PQ8A 1YM0A 3NKKA 4FUIA 2PTNA 3A7VA 2ZWLH 3PMJA 1O3AA 1MTNB 2W7UA 4WJG2 1LHFH 1WOFA 1SOTA 4WH8A 1GG6C 1GDUA 2FWWA 3GCHC 2FYRA 3KNXA 3GYLB 4IS5A 2F9VA 5A0BA 1O2NA 3F9EA 3PB1E 2PLXA 4AOQA 3W94A 1GBIA 1NFWA 3BTFE 1O2IA 2Q6GA 2HWLB 4ABGA 3URCA 1MCVA 2OINA 1CBWC 1BB0B 1GBMA 2VIOA 1K1LA 3PV4A 1GI4A 4NA7A 4E7NA 2ZCHP 1Y5AT 2HRVA 1GMCG 4OS6A 1H9IE 3NZIA 1FUJA 3C27B 1GBAA 1D6RA 3O8DA 4INHA 3ZZ7A 4AFZA 1G2MA 2AMDA 1F0SA 1WSSH 1TPOA 1Q31A 3ZZ6A 2Y5HA 4ZMAH 2STAE 4IN2A 3EAJA 3ZVEA 4AX9H 4JYVH 1O3EA 1JXPA 2O8TA 1L4DA 2BDGA 4NIWA 1ZRKA 1AY6H 3LJOA 5F8ZA 5A0AE 2BZ6H 1O32A 1ZZZA 1GJ9B 1Z1IA 5EW2H 1LQDB 1GBKA 4WMFA 1RTKA 2OC8A 3BN9A 2GP9B 2P94A 2O8LA 2CJIA 3PMBB
chains in the Genus database with same CATH superfamily
1FX0B 1XVMA 2FESH 4B75A 3U1IB 2F9UA 4Y8YA 1EAIA 4MPXA 1DS2E 4ZROA 4CHAB 4OGYA 4X1RU 1GCDA 4RKOB 1DLKB 1KTTB 1NFXA 3RUOA 1HJ8A 1CQQA 2ZFFH 3PLPA 1XKBC 4Y10E 1FY1A 1O2TA 1A61H 1AFEH 1QHRB 3WW7A 5DP9A 1O37A 3KF2A 3LJJA 7ESTE 1YF4A 1O3FA 2ZQ1A 3GYMA 2W6ID 3H5CB 1VJAU 3TITA 2CHAB 1Z6JH 4Y76A 4ZKOU 1BMMH 1V2MT 4ABJA 4BOHA 4HG6A 9ESTA 1AE5A 1E38B 1KXAA 1O2SA 1O2KA 3F2HA 1C5MD 2EA3A 5JYIA 1J8AA 1LVBA 3UNSA 1GHBG 1QB1A 1O3CA 3Q3XA 2BXUH 1IQLA 1BBRK 5C1YA 1F0TA 4Z1MD 3DA9B 3SI3H 4DW2U 2W26A 1P9SA 3VGCB 3RXRA 3UQOA 1GI9B 3FP8E 3RM0H 4XD7D 4X6PA 5KEDA 2Z3CA 1BDAA 3UNRA 3HGNA 1BTZA 3VEQB 4M9FA 2A7CA 3HATH 4X2VA 3ZZ3A 4YO9A 3KQEA 4I8KA 4O3TA 5JPMH 5HMAA 5C1UA 4MDSA 1O31A 2V3MA 1C2FA 3ODFA 1SGFG 4TWWA 5GPIB 2SGEE 4ABFA 3SZNA 4AZ2B 1L1JA 2XBWA 1P8VC 3ZZDA 2AIQA 2BX3A 1G3CA 2XBVA 4J1YA 2RDLA 1O3BA 4JK5A 3V13A 2FO9A 4OS7A 4NFEA 1FPHH 1IQNA 3UREA 5T6DA 1NBMD 1BZXE 2H5CA 4U2WA 1H8HD 1C4U2 4GAWA 2ZO3H 1W14U 1BJVA 4Q2KA 4THNH 1GBEA 1ZJDA 1C5VA 1VGCC 3FAOA 1T7CA 4UEHH 5EG4A 2CN0H 2BHGA 1TGTA 1P01A 3RXBA 4GUXA 3RXHA 2Q6FA 2ZU2A 5K7RA 2KX4A 2ZDMA 3N7DA 1TONA 1FY4A 2Z94A 5HIZA 1W3CA 1GWAA 2QE7D 4UDWH 1MU8B 5DJ7A 1PPGE 2JH5D 4NFFA 2AIPA 2XBYA 3PMAB 5EPNA 5HM9A 2CMYA 3G01A 1SBWA 3HK3B 1KXCA 2OQUA 1EB2A 1H1BA 3MO9A 4XSKU 2VGCC 3VB5A 1SR5C 1MAXA 2BDBA 1EOJA 4KTCA 3SGQE 1FY8E 1O35A 3M5OA 1PYTD 3FKSD 3V7TA 2KCPA 2BQ7B 1HAPH 2NWNA 4JCNA 1W12U 2Y5GA 7LPRA 1KY9A 2VBCA 1S82A 4YOIA 3KQ5A 1K1JA 3SN8A 4BANB 1NY22 1C9TA 2C8XB 2GCHG 1KXDA 1SOZA 1Z8RA 3KCGH 4IC6A 4PROA 4U30A 1WU1A 5FXLA 2BDIA 4ZHLU 1PQ7A 2Z9LA 1C1RA 5T1VA 2GGVB 3T27A 3DSGA 3SV9A 1ZTLA 1ELEE 3A86A 1QNJA 1J9CH 1BHXF 1K1NA 2VIPA 3A8AA 1P10A 1VCPA 1UVSH 4XBCA 4NWKA 2BOHB 3QGJA 3LGIA 3S9AA 1MZDA 5HGGA 1QB9A 3GCTG 3EA7A 1OX1A 1TNJA 2ZDVH 3SUDA 1GDNA 1ZPBA 4MPWA 1GHAF 1RXPA 1A1RA 1C2MA 1J17T 5C0TA 1O5DH 5TJXA 2Z3EA 3KQCA 1AUTC 2ANMH 4WF8A 5E8EH 2C8YB 1P11E 2BY7X 5K0HA 1QA0A 1TX6A 3ZZ8A 4FVDA 1GL1A 1S5SA 1JWTA 3ZZ4A 1HGTH 1UTPA 3P8NA 1ZHPA 1JRTA 5GCHF 4BAMB 1DY8A 1UK3A 1ZMLA 1W13U 3EGKH 4AG2A 1NFUA 4WXVA 1ANBA 1A0JA 1BTYA 1O2YA 2WV4A 2WPDD 3RDZA 4X2WA 1TPSA 1FXYA 2GDEH 2K8IA 1YLDA 1WBGB 1YGCH 2ZU3A 3ATLA 4DGJA 5E2PA 2LELA 3GY3A 2PUXB 2OBOA 5FCRA 4BNRA 1WUNH 2FM2A 5EJZA 4HI3A 1MD8A 4FVBA 3SNEA 4DIIH 1V2WT 1TMTH 2XWAA 1Y3YA 4B1TA 1SKYE 4X2YA 4TT3D 4OGXA 5A09A 2P3TB 4F48B 3U28C 2ZGJA 1Y3VA 5FCKA 2G00A 2ZTXA 1CO7E 3EA9A 3DHKH 4FOUC 1EZQA 1SC8U 2VWLA 1D3TB 1RIWB 1IQHA 3U1JB 3ZVFA 1P02A 2NU2E 3D62A 1K0HA 5ETXA 1G3EA 3N99A 4AFSA 3QX5H 3TJNA 3O8BA 1QTFA 3GDVA 4ZUHA 2AGIX 4B6EA 4TY7A 1AHTH 5J4SA 2SGDE 4D9RA 2BQWB 3KYGA 1XXFA 2FOGA 1AKSA 3UB0A 2FOHA 1AMHA 3ATIA 3SJ9A 4AFUA 1MD7A 4XE4A 2H2ZA 4JK6A 1G9IE 2ESTE 1C2EA 2KAIA 5T3HA 3JZ1B 4BTIB 3UR9A 2ANKH 1P03A 1FN6A 1UCYH 2RDEA 3P6ZB 5F03A 1NBME 1XXDA 3RC5A 1BT7A 1F0RA 3MH4A 2A45B 2VIQA 1PQ5A 1JOUB 3LH3A 2P8OC 3LT3A 4MQAA 1Z7KA 5B6OA 5I25A 4FUGA 3RMMH 3RXJA 1GMCF 2JKHA 4I31A 1QQ4A 1SHYA 3RXTA 2AMPA 3T2NA 1B0EA 1QFKH 4I8LA 1C5UA 1W0JD 1KXFA 6GCHG 1V2OT 2QV1A 1DWBH 3Q76A 1DE7H 5C3NA 4X1PU 3Q00A 1N8OC 4I8GA 5BPEA 3ZVGA 2XCFA 1W7XH 1SL3A 4CRDA 2Y7ZA 2BY5X 2ASUB 2ZA5A 1O2VA 1A3EH 4GPGA 4DY7B 1S83A 1ABJH 1UTOA 3Q3YA 1CE5A 1S0QA 4IMQA 1K28D 1BHXB 1O3IA 4ISLA 1YPHC 5LGOA 2G5NA 2BLOA 1NC6A 2Q1JA 2BB4A 1DXWA 1ZYOA 4ZAEA 5EU8A 1TA6A 2FMJA 3BTGE 4RT1A 1EP6A 1FJSA 6CHAB 3F2FA 2THFB 4MVNA 1RD3B 3B8JA 1XUKA 2VB0A 2RG3A 1DSTA 3FP6E 1QL8A 2ZFQH 2Z9IA 1TOMH 1QQUA 1X7AC 5F8TA 4Y8XA 3PROA 2SGQE 1W10U 1MZAA 3MO6A 4A1XA 1ELBA 2WV5A 1QJ1B 2ZPSA 4UE7H 5C94A 4FUHA 4NCYA 1OWDA 1LKAA 5E0GA 3T5FH 4ISIH 1EPTA 5BRRE 1AKSB 4ZCNA 1QA7A 2AH4X 5JBCS 3CP7A 5L2YH 4JZFH 1OPHB 2QXGA 3I78A 1GI8B 2BVRH 1ZSJA 1IQMA 1AFQB 2XRCA 1SSXA 2Z7FE 4TSFD 1K2I1 2OCVB 2KAIB 1CHOG 2H5DA 2ZGBH 2BY9X 6ESTA 2VNTA 1SFQB 3ZYEA 4NGAH 2WPJS 1C4V2 1QY6A 1GHXH 4YLUA 1C5ZB 3RXMA 1CVWH 2WYJA 1O2MA 2FDAA 1DWDH 2ZFTA 2P16A 1T8NA 4NSYA 4CRCA 1P3EA 1XMNB 3VB3A 4VGCB 3A8DA 4ABIA 3ZVCA 5CHAB 3Q3KA 5E0HA 4ACAA 1HXEH 3F68H 4A92A 4WMEA 3V0XA 4CH2B 2LPRA 4K60A 1YPGH 2VH6A 1GMHF 1L1NA 1VR1H 4GCHG 2QF0A 3QTVH 1AVGH 3DSOA 1WV7H 1YWUA 3VB6A 1TNKA 1SQTA 2Q6DA 1YCPK 1S85A 3OTJE 2BVSH 4A5TS 2AERH 1ARBA 1SGYE 2RCEA 5DKMA 1C2JA 3U8RH 1LHCH 1C5RA 3MO3A 4AYYB 2UWPA 1A46H 2FP7B 1KXBA 2QXHA 5EGMA 4BTUB 2YNAA 4KTUA 2JETB 1VZQH 1NROH 2XC5A 3GY4A 2A0QB 4CBNA 8LPRA 1OP0A 4JMYA 1GJCB 1C2IA 4NWLA 1ESTA 1G3BA 1P06A 3QZRA 2OQ5A 2BYAX 2TRMA 2I6SA 2GD4B 2OC1A 3LH1A 1VITG 4CBOA 2PTCE 1KYNA 2A5IA 2JDID 1FLEE 2QF3A 1KTSB 1D3PB 5J4QA 1NESE 1FZZA 1EZSC 1XUIA 2FOAA 2XNIA 2WPMS 4Q63A 3D49H 3UWIA 3R0FA 1TYNA 4JZIA 1EPTB 1DT2A 1E34B 1YKTA 3TJOA 3AVZA 2GVFA 3QK1A 1BTHH 2A2QH 3EA8A 3UOPA 1T8LA 4XDEA 1TMUH 5JBAS 1V2KT 2GMTB 1HAYB 3SV6A 3D65E 1EATA 2AEIH 1DPOA 2ZQ2A 2TGDA 1ZPCA 5DK1A 3N7OA 1G3DA 5DPAA 3BG8A 2L6OA 2AGGX 3LGUA 1O3OA 1SGQE 1WAYB 2ZCKP 3LC3A 3RMNH 1FV9A 1O2GH 2AMQA 4ZKRU 1TE0A 3A80A 2BQ6B 3MWIU 4OM9A 3TU7H 1O3KA 2GCHF 1GJ4H 2RFKC 1O5GH 3F6UH 4M7GA 1C2KA 3T62A 3OX7U 7GCHG 2F43B 1GI5A 2EI7A 1YPJH 2HPQH 5C17A 4X8VH 2ZF0H 1F92A 4DCDA 3OU0A 4IMZA 1EKBB 1TLDA 5PTPA 1O2OA 1AWFH 1BMNH 3VB7A 2FODA 1SPJA 4E05H 3ZVDA 2EI6A 3T28A 1NRRH 3SU3A 1NU7B 5C5OA 1MQ6A 3GY7A 3Q77A 3RXGA 3E0PB 4Y0ZE 2GJGA 4F49A 5DP4A 1GG6B 2VJ1A 3GCHB 4LOYH 5CDFE 1C5YB 2SGAA 1OYQA 5EQQA 1ANEA 3GICB 2TGTA 2W6JD 4BAQB 1C1TA 3M3VA 2J92A 3DT0H 1P0SH 1LPZB 1Q3XA 1TOCB 4HGCA 1NRQH 3A7WA 2H1UA 1L1GA 3MU8A 1QJ7B 1CBWB 2ZFSA 4CR5A 1C1VH 1GBDA 2PHBA 3RXDA 2VINA 2BX4A 1Y3XA 2B7DH 2YMSB 1INCA 3DSPA 3F1SB 4Y7BA 1MTUA 1O3MA 1VKYA 5JBBS 2O8MA 3AW1A 1H8DH 1IHSH 1ZTJA 3M3TA 3ZVAA 3RXOA 1O5BB 1HAVA 1IQIA 2NU3E 3BG4C 5DN6D 2WSSD 4NSVA 4RKJB 1TBQH 1S0RA 1ETRH 5FPYA 5DSFA 1KIGH 4BXWA 3UPEA 1A3BH 1GHVH 1TNIA 3SO3A 1J15A 2QGRA 4MTBA 3OY6U 1HJ9A 2P3UB 4CRFA 2UUKB 2GZ7A 1UO6A 3TH2H 4SGAE 1ANDA 1YPHE 2QXJA 5FX5A 1OWKA 1ELVA 3TVJB 4NG9H 5EXMA 1ELCA 1UCYE 2ODYB 1GBBA 4Y11E 2ZFRH 4AGJA 2VU8E 3SBKA 5DP5A 3UUZA 3QO6A 1B7XB 2CF8H 3VG8A 1FY3A 2AS9A 1O2XA 1EX3A 2W3KA 5C1XA 2FEQH 1TGSZ 2A2XH 2ZHDA 4TWYA 3MNXA 1C5OH 1FQ3A 2UUFB 4ZHMU 3SUGA 1ZHMA 3MTYA 1P57B 3GY2A 1SGRE 2ZIQH 4ABHA 4BAOB 1MMJN 1PYTC 1DITH 3SV8A 2C8ZB 5EJLA 1LCYA 2Z3DA 4FUDA 1NT1A 1OYTH 2IN2A 1JRSA 2SNVA 4X1QU 5F8XA 3O8CA 3S69A 1O2WA 2A5AA 4UFEH 2HPPH 1ORFA 5AVDA 1E79D 3UWJH 1JIRA 4H42U 1OOKB 1QURH 2ZI2H 1W0KD 5GDSH 1H8IH 6GCHF 1K22H 1T8MA 2PKSC 4FETA 1N1LA 4YTAA 5HIYA 1BA8B 1DFPA 1ZSKA 2XOKD 1T31A 4MNVA 4UONA 1GBJA 1HAHH 4ACBA 5EXNA 1LO6A 1LVMA 1HRTH 2VIVA 2XW9A 1O3DA 1T4VH 3ZZ9A 3M5NA 1GI3A 1HAVB 4AB9A 1GI6A 3LPRA 1W8BH 1WXRA 1UTNA 1B5GH 1D6WA 1HJAC 1OP8A 3SQHE 4GVUA 3BTDE 3U8TH 2ODQA 2AYWA 1TABE 1OHHD 3EQ0H 1L2EA 1KLTA 2NU1E 1HB0B 1K1OA 1QRWA 3ZZAA 4Y71A 3E6PH 1TALA 2BD2A 3IG6B 2PKSB 5JBTA 3RXLA 2WUBA 1CGIE 3CS0A 4Y8ZA 2DUCA 2ZCLP 1LKBA 3M5LA 4BTTB 1EB1H 1SLVB 2J4IA 4B2BA 2PSXA 2OTVA 2HOBA 4Y7AA 4B2CA 4D76A 3N7EA 1VGCB 3E16B 4I7YH 4K1EA 2R2MB 3BV9B 2AHME 3TK6A 3PTBA 3ATMA 1QB6A 2BMGB 1O5FH 1C5SA 1SI5H 4FUEA 5F53A 3TH3H 1LDTT 4IGDA 2WYGA 4I33A 1GBLA 1GJDB 1CHOF 1F2SE 3OEHD 4AORA 3SZEA 4FUFA 3TGKE 4FUCA 1BQYA 1C1NA 1AD8H 1O39A 2J2UA 4U01A 1ZTKA 1CT0E 1ELDE 1SLUB 1YY3A 2VIWA 2R3YA 1LHDH 2VGCB 2XWBI 1GL0E 3U98H 1O3HA 2LP6A 1DUAA 1G36A 2TPIZ 4O9VA 8KME2 1HYLA 1HIAA 2V6NA 4ABAA 3L3TA 1O38A 1MQ5A 1RGQA 4GCHF 1TRMA 1PPBH 1Y5BT 2FOEA 3TIUA 2KCAA 2ZECA 1E1RD 3VXFH 1AUJA 1BTUA 3A7YA 1EAWA 2GZ9A 3WY8A 3CS7A 1GJ6A 1HUTH 4GHQA 5C20A 2J95A 1AO5A 1E36B 1P05A 3F0OA 3TNSA 2UWOA 1LPKB 1IHTH 2ANWA 3E90B 1QR3E 4MPUA 4INKA 1AB9C 1E0FD 3MNCA 1OWJA 1VCWA 2OC7A 4ISNA 4A6LA 4AN7A 1G32B 1KDQA 2R0KA 1AIXH 4JYUH 3F9HA 1THRH 5GNDA 4K3JA 2BOKA 2ZU1A 3OAAD 1GJ7B 4WH6A 1S6HA 2BDAA 1YLCA 1VITF 2A4RA 3LC5A 4I8JA 4DT4A 1AI8H 2SGFE 1YYY1 1W0YH 2ZGXH 4CRAA 1JIMA 1TNLA 1UW7A 2HALA 2O8UA 1NRPH 3SJIA 3MNSA 1SFIA 4MNYA 4X1SU 3SJKA 2FOMB 1ELGA 1XUGA 4E06H 3IITA 1YP9A 2BD3A 3OTPA 4X2XA 1TRYA 3V3MA 2DE9A 2C4FH 4RN6A 3AW0A 1UHBA 4CRBA 3RXUA 2BVXH 5A0CA 2OLGA 1QRXA 4BXSA 1O3PB 1SQAA 3ATWA 1E35B 1V2LT 1IQFA 3LDXH 3P92A 4LZ1H 3PO1C 4TPIZ 2QYIA 2FX6A 3MH6A 3ZZ5A 1T4UH 4JZ1A 4YZUA 3AAVA 2WPLS 3KQDA 3OY5U 3MOCA 4P02A 3NPSA 3RP2A 4X6OA 1GI1A 3WWFA 3O8RA 3HKJB 1IQJA 3RXEA 2BD4A 1JMOH 1EAXA 1MKXK 4E7RG 5A8ZA 1ZLRA 3U9AH 4K1SA 4Q80A 4YOJA 5FPSA 5KGOA 1VITH 1NO9H 1CA0C 1HIAB 3A85A 3BTME 1MTSA 5FPTA 1SGEE 2QF5A 3GOVB 3M7UA 1XUJA 2EQNA 2FZZA 2IPHA 3I77A 3MU5A 3EE0B 3K65B 3QZQA 5FBIA 2Y82A 2D2DA 1MKWH 1YPLH 2J94A 4Q7YA 1GJBB 4BAKB 1C4Y2 1P09A 5SGAE 3DD2H 1YLNA 3CENA 5A8XA 1C5NH 1GGDC 1H4WA 4NZQA 2VH0A 2HLCA 3SGAE 3SU5A 5F6MA 3K2UA 2R3UA 2IOTA 3M37A 1WYKA 1CA8B 3NRLA 2B9LA 1IQGA 4AFQA 1K1IA 1KDQB 4OS4A 2YOLA 3SJ8A 2Z9KA 5JDUB 9LPRA 1GMDG 1QCPA 3SU4A 2RA3A 4TPYA 3H7TA 2D1JA 2P8OB 1NTPA 1CT4E 1EFRD 4JYTA 1T32A 1HXFH 1LTOA 1TGNA 1ZJKA 2GCTC 2BD9A 1TB6H 3FO8D 1WQSA 1ZGIA 2W5EA 1UHBB 1OSSA 1ACBE 4XRNA 4B71A 1V2TT 3JZ2B 2BLQA 3LGYA 3RC6A 1N8OB 4Q7ZA 5TCCA 1SLXB 1BRUP 1A4WH 5HM2A 4DURA 1HAOH 4IN1A 3MQKC 3WWBA 3F9FA 1SQOA 2JJ2D 3A7ZA 1ELAA 3PWCA 3TJVA 1MBMA 1QRZA 3HKIB 1GHYH 4U32A 2BDCA 3P95A 1HAZB 3B23B 3PLKA 1PPCE 2KCOA 3QWCH 2TGPZ 3R3GB 1KSNA 1XKAC 1V2ST 2UWLA 3UFAA 2O8WA 1LVYA 4I32A 1LHGH 3LGTA 1THPB 1J14A 3BEFB 2IJOB 4F4OC 1Y3WA 1N6XA 3UNQA 3EYDA 4UFDH 5DP7A 5DP3A 1EQ9A 3HPTB 3T26A 1GHBF 1NS3A 1W0ZU 1WTGH 4MNWA 1C5LH 3OYPA 5L2ZH 1V2RT 3F9GA 2AGEX 3SUFA 3OFND 1OS8A 7KMEH 2GTBA 1ESBA 2VWOA 1FAKH 4MPVA 1XUHA 1P2KA 3A7TA 3F3BA 4AB8A 3SU2A 2C90B 1K9OE 1TPPA 1DWCH 1F7ZA 1XX9A 1O3LA 1DSUA 3P70B 2Z9GA 1HAGE 1UJ1A 2GT8A 1O30A 1TAWA 2HLDD 2W7SA 1O3JA 4UFFH 4O97A 1PPEE 3RM2H 3MH7A 4DVAU 3RXPA 2LNCA 1COWD 3MU4A 3PYHA 3STJA 2J97A 1TBRH 3S9CA 2H9HA 2G4UA 5ABWA 2VVVA 1OWHA 1V2PT 3K6YA 3ZVBA 1ETSH 2ZEBA 3P8GA 1AN1E 1TFXA 4JZDH 4DT7B 2SFAA 1NRSH 2XTTB 1SGDE 1GHAG 3P8FA 3U69H 3SV2H 2QF4A 1GJAB 1XVOA 4A7IB 1C5WB 1V3XA 5KECA 2PWXA 3M36A 2R2WU 1UVOA 1BBRH 1C5TA 1BUIA 1UTKA 3SU0A 1OKXA 2UUYA 2GT7A 3BTHE 1T8OA 1GJ8B 1PJPA 4FU7A 2WPKS 1BMLA 4ISOA 1WTHD 2CK3D 2KR7A 3STIA 3FFGA 4TY6A 5GCHG 1CT2E 1A0HB 1HFDA 4B76A 5DO4H 3NK8A 2VWMA 1C1UH 1TGBA 3A81A 3A82A 5T6FA 1ZGVA 1KLJH 1Z6EA 1S6FA 2D26C 1W2KH 3SORA 1GCTC 1SGFA 2M2AA 2OK5A 5EQRA 1SGIB 4KELA 3BEUA 1Z8JB 3UR6A 5ESBA 3RU4D 3MYWA 4AG1A 1WDIA 1UCYK 1W7GH 2YNBA 1BTWA 1MTNC 1LQEA 1O5CB 1NFYA 1F0UA 3KHVA 1QZ8A 2PP6A 4QT8C 3GCNA 1IQKA 3BEIB 1TBZH 3QN7A 1A5GH 5H4IB 1HAIH 3U8OH 2F9NA 5EIYA 5E2OA 4HTCH 2VWNA 2F83A 4YLQH 3SOSA 4Q7XA 3GY5A 4LXBH 1PQAA 1O2HA 2QA9E 4IC5A 3A8BA 2M5TA 2PW8H 3B9FH 4AGKA 3MFJA 2PFEA 5DP6A 1FMGA 2ZDAH 5HYOA 1EASA 2ZDNA 3UAIC 1GCTB 3CNRA 2DE8A 1TX7A 1Y5UT 2FI3E 2WUCA 2ZFPH 4SGBE 1K1PA 2G5VA 5AFYH 1ARCA 1O33A 1QIXB 1A7SA 4MLFB 1HBTH 2WV9A 3TK9A 4ZXYH 3BSQA 1J16A 1DOJA 4FXGH 2Y7XA 1ID5H 3GCTF 2VVUA 3S9BA 2FOFA 4YT7H 4Y79A 3GY8A 1UVPA 1C5QA 1D3DB 2ZTZA 2A5KA 3GDUA 2VIDA 2QIQA 1AZZA 5LPFA 3M35A 2ZPRA 1AWHB 4H4FA 1UTQA 5LH8A 3QLPH 1C1QA 1D9IA 2FI4E 1GDQA 1MTVA 3FOAA 4HFPB 1LPGB 4CHAC 1EAUA 2V0BA 3H7OA 1A0LA 3LU9B 1ELFA 3L33A 3KEEA 3TPIZ 1O2ZA 4X0WU 1BCUH 3TH4H 2G81E 3NUMA 1HDTH 4YM9A 5CHBA 1P9UA 2TIOA 1FIZA 1S84A 1YPMH 3ZYDA 4D9QA 1QBNA 2CHAC 1Y8TA 1V2VT 4ZKSU 4O03A 2B8OH 2HVXA 1DWEH 3H09A 4ESTE 1O2UA 1D3QB 1SVPA 2O9QA 1HLTH 3RU4T 2VVCA 3L6PA 3SJOA 2R9PA 1C1PA 4D7FA 1V2UT 2FYQA 4R8TB 2XYAA 2ILNA 2EC9H 3UOUA 2EI8A 2SNWA 4LZ4B 4NIXA 4NA8A 3VGCC 1MH0A 1RFNA 2Y5FA 3PM3A 2Z9JA 4IW4E 3RC4A 3AK5A 3FANA 2WZQA 2HNTF 3SW2B 1GBHA 4D8NA 2ZZUH 4FU9A 3BG4B 1TWXB 1RRKA 2JH0D 2I6QA 3LGVA 3K9XB 5JB8S 3UQVA 3MMGA 3RXCA 2YMSD 1DVAH 1L0ZA 2KZ4A 4K69A 4R0IA 4CH8B 3SGBE 3M3SA 3TLOA 1G2LA 1NRNH 2ZDKA 1F5RA 1GI7B 1C1SA 2V3OH 5A2MH 3E8LA 3SNBA 5C0UA 3VPKA 2OXSA 1AU8A 2ZG0H 3GDSA 1ELTA 4ZH8A 3SNDA 1BMAA 1CU1A 1UTMA 1HPGA 1OXGA 3KGPA 3DUXH 3TNTA 4AYVB 3A7XA 1GI0A 2FLRH 2ZDLA 2H9EH 1PFXC 4OS2A 1EZXC 2W3IA 4UFGH 3RXQA 3SHCH 1SG8B 2QC2A 3SNAA 3D23A 2JJ1D 5FX6A 3TJUA 1A5IA 1C2GA 1RTLA 1GBCA 1GI2A 1EP5A 5EW1H 2KM0A 5EOKA 4ASUD 1GMHG 1D4PB 2OUAA 3VFEA 4B73A 1C2HA 2GV7A 2K0QA 3RU4E 2FTLE 4WXIA 3E0NB 2XCNA 3BIVH 4OS1A 1IAUA 1O34A 2ZGHA 1O5AB 4H6SB 1H9LB 1HAXB 4I8HA 1GMDF 3EE7A 3BTEE 3FP7E 1MKXH 1QGFA 4K2YA 4FUBA 4TYDA 2BZAA 4X6MA 5CE1A 4GHTA 4NA9H 2ALVA 1PPZA 3ODDA 3A89A 2ANYA 2TGAA 1O2LA 2J38A 2WPIS 1GHZA 5ESTE 3RMLH 2F9PA 1DUEA 4B6FA 3RXSA 8GCHG 1BIOA 1FIWA 1OP2A 2SGPE 2GDDA 1YCPM 4X6NA 1P04A 4CRGA 4X8SH 2A31A 2F91A 3SU6A 4I86A 4F55A 1K21H 4K1TA 2P93A 3LOXA 2BLVA 1ETTH 3BTKE 2OD3B 4K8YA 4WY3A 3DFLA 1C2LA 1A2CH 1AGJA 1ZMJA 4KKDA 3VB4A 3M7TA 3E3TA 4KGAA 3SI4H 3BTTE 4MG3A 1NZQH 1Z1JA 2J9NA 1HJAB 2HNTC 1TA2A 1XM1A 2P3FH 4RT0A 1GHWH 2HGTH 3E91A 4ABBA 1TRNA 3SV7A 4CR9A 3A84A 1E1QD 2J34A 1FN8A 4YT6H 1PPHE 4NZLA 1V2JT 1JBUH 2ODPA 2G4TA 2PR3A 2BY8X 1EOLA 2PKAA 5DG6A 1BRBE 3F2GA 5FL7D 3ELAH 1Y3UA 2BD5A 1UK4A 2XC4A 4K5ZA 4FUJA 1C1MA 3RXIA 2QN5T 2JH6D 4OS5A 3UTUH 4K8BA 1NPMA 3KYFA 3PMHB 2QCYA 1KMHB 2ZGCA 5EPYA 4UD9H 2ALPA 4NIYA 1MTWA 2AFQB 5C2ZA 4X8TH 4RI0A 1BBRE 5GXPA 3EDXB 5T6GA 1DICA 2BDHA 4DIHH 5HKKD 1GBFA 1VCQA 2BDYA 2FXRA 1N6YA 2Z6BD 3UIRA 3PRBA 2BD8A 1DXPA 4CREA 1EUFA 1MBQA 1QBOA 2V7QD 2TBSA 1WQVH 1C5XB 1QJ6B 3OSYA 3RLYH 1ANCA 2A7JA 2FLBH 1H9HE 1Q2WA 3DFJA 2BTCE 4YXWD 1CGHA 5EODA 5LPEA 1AQ7A 1FAXA 3W1EA 4ISHH 2J5UA 1BRCE 1FDPA 1BRAA 2FI5E 3RMOH 4B2AA 2A32A 1P2OA 1ESAA 1LHEH 1P12E 1RIWC 2KCYA 3S7HB 2ZHEH 4WMDA 4Z6AH 1GJ5H 1O2QA 1S6LA 1V6DA 3T29A 2CGAA 1P2IA 1A5HA 3AASA 2BD7A 3MNBA 4YESB 1SMFE 3GS9A 1UTLM 2PUQH 1V2QT 3KN2A 2ZHWH 3ATKA 5JB9S 2FS9A 2ZPQA 5EQSA 3GISB 2R0LA 1O3NA 2ZHFH 3QUMP 1YCPH 2WINI 2G8TA 3TK5A 1U6QA 1FONA 3NCLA 1AB9B 3IWMA 4O3UA 5FHTA 5TCAA 4BAHB 1HNEE 4ABDA 1O0DH 1AVXA 4ABEA 1ZR0A 2ULLA 1EJNA 1NU9A 2A1DB 4MNXA 1C2DA 1AE8H 3A8CA 3E1XB 2PKAB 3PTNA 2FIRH 3RXFA 1YBWA 1DM4B 4NIVA 2F3CE 1EJMA 1DLEA 1PPFE 6LPRA 2PGBB 1FI8A 1ZSLA 2OC0A 3KL6A 7GCHF 4INLA 1CSOE 2QY0B 1Z8IB 5E0JA 1QL7A 2G52A 5EXLA 2QXIA 3P8OA 1O2RA 2BLWA 4X8UH 4WWYA 3PV5A 2D8WA 1K1MA 2BY6X 3C1KA 1SLWB 3VXEH 1C1WH 3PO1B 1P2MA 1SB1H 1GBTA 3BIUH 1ABIH 2PV9B 1NN6A 2BM2A 4J2YB 4LK4A 1O36A 3OEED 3M61U 1TMBH 2QAAA 5B6LA 3RXVA 5FAHA 2H9TH 2XXLA 3A87A 1IQEA 3SQEE 4A1TA 1DANH 3KQBA 3SU1A 4ZHAA 2FS8A 1O3GA 3AAUA 1B0FA 2XBXA 4Q4LA 4IBLH 4FU8A 1E37B 1S81A 1YPEH 2ZNKH 6CHAC 3PV2A 2C3SA 3A83A 1NM6A 4X1NU 1CA0B 1P2NA 4KTSA 3T25A 3ZV9A 4XBBA 1OWEA 1YC0A 2BXTH 2P59A 4Y6DA 3QGNB 1GVZA 1ZMNA 2C8WB 4XOJA 2CV3A 1BOQA 1RS0A 4D7GA 2C93B 3HGPA 3HK6B 1FY5A 1MUEB 1DX5M 4YOGA 3LONA 3M7QA 1RJXB 1O2PA 3BTWE 3ZZCA 2RA0A 1FNIA 3SNCA 1C9PA 4ZXXH 1O5EH 5HXFA 1GGDB 4WVPE 5EJ1A 1GPZA 3ESTA 2WPHS 4P00A 1TIOA 2WHXA 3SHAH 2F9OA 3ZV8A 3S0NA 2L74A 2CXVA 1SGPE 1AFQC 4Z0KA 1BITA 5G4BA 4GLYA 5CMXH 4DOQA 2NU0E 2FOBA 3URDA 5AFZH 1THSH 5GWZA 1OWIA 1TQ0B 3GCOA 2FTMA 3QTOH 1EJAA 3TGJE 1ZRBA 2ZU4A 3BF6H 2IPQX 2JIZD 4JZEH 1VJ9U 2GCTB 2OP9A 5GIBA 5LPRA 3TGIE 4KP0A 3V12A 4VGCC 1ZHRA 2PGQB 5CHAC 2GZ8A 2NU4E 3LKWA 1P2QA 2K1QA 1KLIH 1RTFB 1TNGA 1UMAH 3LIWA 1UVTH 3FN8A 3DCLA 2J98A 3LGWA 3NWUA 4HZHA 1AZ8A 2G55A 2P95A 3M5MA 4GSOA 1TNHA 4DG4A 3SUEA 1F5KU 4H6TA 4DJZB 1GVKB 1TX8A 2CF9H 2Y6TA 1BMFD 1QL9A 3RXKA 5I46H 3A88A 4ASHA 2STBE 1MAYA 3QDZB 1TGCA 1EXFA 2HNTE 2JETC 1UVUH 5GJ4B 5FBEA 1Z8GA 2OBQA 1C1OA 1SHHB 1EZUC 1Z71A 3SYJA 1F5LA 2B5TB 2ZHQH 2A4OA 2PSYA 2ZTYA 1IOEA 1GVLA 3MI4A 2V3HH 2A7HA 2HVYB 1LMWB 1W11U 1YPKH 5L30H 5AHGH 3UY9A 4XBDA 3ZZBA 1SGCA 2GKVE 1C5PA 1BTPA 1FPCH 1M9UA 1TQ7B 2GX4A 3MU0A 3FZDA 4ZKNU 3RXAA 3S7KB 2ZP0H 1ZPZA 1SGNE 4RSPA 3K6ZA 3MU1A 5C5NA 1UK2A 2ZU5A 1KXEA 1L4ZA 3NXPA 1O2JA 2FOCA 1SQRA 1EPTC 3MH5A 1LVOA 2B0FA 5AF9H 1DY9A 2V35A 2UUJB 3I29A 2EEKA 1SGTA 3FZZA 2A4GA 2GMTC 2ZKSA 3BTQE 1BJUA 1MCTA 3W95A 4Y0YE 2Y80A 3RLWH 8ESTE 3ENSB 8GCHF 1G37A 1XUFA 3PWBA 3GY6A 3F0PA 5DP8A 5IYTA 1V2NT 2GV6A 4XFQA 4B74A 1Y59T 1ZOMA 2KFWA 2FPZA 1DDJA 5A8YA 5IDKA 2H6MA 1P3CA 3P17H 4A1VA 1WCZA 3KIDU 5L6NH 5DGJA 1P2JA 5C67A 2Y81A 3FVFB 1BTXA 1UTJA 2XC0A 1CHGA 2FX4A 1MKWK 1AVWA 1MU6B 1CGJE 3MHWU 2A4QA 2J98B 2ZC9H 1QBVH 1TPAE 2F9BH 2G51A 3PLBA 1HV7A 1HCGA 1G30B 3ITIA 1PQ8A 1YM0A 3NKKA 4FUIA 2PTNA 3A7VA 2ZWLH 3PMJA 1O3AA 1MTNB 2W7UA 4WJG2 1LHFH 1WOFA 1SOTA 4WH8A 1GG6C 1GDUA 2FWWA 3GCHC 2FYRA 3KNXA 3GYLB 4IS5A 2F9VA 5A0BA 2F4LA 1O2NA 3F9EA 3PB1E 2PLXA 4AOQA 3W94A 1GBIA 1NFWA 3BTFE 3ZIAD 1O2IA 2Q6GA 2HWLB 4ABGA 3URCA 1MCVA 2OINA 1CBWC 1BB0B 1GBMA 2VIOA 1K1LA 3PV4A 1GI4A 4NA7A 4E7NA 2ZCHP 4AC9A 1Y5AT 2HRVA 1GMCG 2YMSC 4OS6A 2IJD1 1H9IE 3NZIA 1FUJA 3C27B 1GBAA 1D6RA 3O8DA 4INHA 3ZZ7A 4AFZA 1G2MA 2AMDA 1F0SA 1WSSH 1TPOA 1Q31A 3ZZ6A 2Y5HA 4ZMAH 2STAE 4IN2A 3EAJA 3ZVEA 1MABB 4AX9H 2XNDD 4JYVH 1O3EA 2EY4C 5IK2D 1JXPA 2O8TA 1L4DA 2BDGA 4NIWA 1ZRKA 1AY6H 3LJOA 5F8ZA 5A0AE 2BZ6H 1O32A 1ZZZA 1GJ9B 1Z1IA 5EW2H 1LQDB 1GBKA 4WMFA 1H8ED 1RTKA 2OC8A 3BN9A 2GP9B 3OE7D 2P94A 3PRDA 2O8LA 2CJIA 3PMBB
chains in the Genus database with same CATH topology
1XVMA 2FESH 4B75A 3U1IB 2F9UA 4Y8YA 1EAIA 4MPXA 1DS2E 4ZROA 4CHAB 4OGYA 4X1RU 1GCDA 4RKOB 1DLKB 1KTTB 1NFXA 3RUOA 1HJ8A 1CQQA 2ZFFH 3PLPA 1XKBC 4Y10E 1FY1A 1O2TA 1A61H 1AFEH 1QHRB 5DP9A 1O37A 3KF2A 3LJJA 7ESTE 1YF4A 1O3FA 2ZQ1A 3GYMA 3H5CB 1VJAU 3TITA 2CHAB 1Z6JH 4Y76A 4ZKOU 1BMMH 1V2MT 4ABJA 4BOHA 9ESTA 1AE5A 1E38B 1KXAA 1O2SA 1O2KA 1C5MD 2EA3A 5JYIA 1J8AA 1LVBA 3UNSA 1GHBG 1QB1A 1O3CA 3Q3XA 2BXUH 1IQLA 1BBRK 5C1YA 1F0TA 3DA9B 3SI3H 4DW2U 2W26A 1P9SA 3VGCB 3RXRA 3UQOA 1GI9B 3FP8E 3RM0H 4X6PA 2Z3CA 1BDAA 3UNRA 3HGNA 1BTZA 3VEQB 2A7CA 3HATH 4X2VA 3ZZ3A 4YO9A 3KQEA 4I8KA 4O3TA 5JPMH 5HMAA 5C1UA 4MDSA 1O31A 1C2FA 3ODFA 1SGFG 4TWWA 5GPIB 2SGEE 4ABFA 3SZNA 4AZ2B 1L1JA 2XBWA 1P8VC 3ZZDA 2AIQA 2BX3A 1G3CA 2XBVA 4J1YA 2RDLA 1O3BA 4JK5A 3V13A 2FO9A 4OS7A 4NFEA 1FPHH 1IQNA 3UREA 5T6DA 1BZXE 2H5CA 4U2WA 1C4U2 4GAWA 2ZO3H 1W14U 1BJVA 4Q2KA 4THNH 1GBEA 1ZJDA 1C5VA 1VGCC 3FAOA 1T7CA 4UEHH 5EG4A 2CN0H 2BHGA 1TGTA 1P01A 3RXBA 4GUXA 3RXHA 2Q6FA 2ZU2A 5K7RA 2ZDMA 1TONA 1FY4A 2Z94A 1W3CA 1GWAA 4UDWH 1MU8B 5DJ7A 1PPGE 2JH5D 4NFFA 2AIPA 2XBYA 3PMAB 5EPNA 5HM9A 2CMYA 3G01A 1SBWA 3HK3B 1KXCA 2OQUA 1EB2A 1H1BA 3MO9A 4XSKU 2VGCC 3VB5A 1SR5C 1MAXA 2BDBA 1EOJA 4KTCA 3SGQE 1FY8E 1O35A 3M5OA 1PYTD 3V7TA 2BQ7B 1HAPH 2NWNA 4JCNA 1W12U 2Y5GA 7LPRA 1KY9A 1S82A 4YOIA 1K1JA 3SN8A 4BANB 1NY22 1C9TA 2C8XB 2GCHG 1KXDA 1SOZA 1Z8RA 3KCGH 4IC6A 4PROA 4U30A 1WU1A 5FXLA 2BDIA 4ZHLU 1PQ7A 2Z9LA 1C1RA 2GGVB 3T27A 3SV9A 1ZTLA 1ELEE 3A86A 1QNJA 1J9CH 1BHXF 1K1NA 2VIPA 3A8AA 1P10A 1VCPA 1UVSH 4XBCA 4NWKA 2BOHB 3QGJA 3LGIA 3S9AA 1MZDA 5HGGA 1QB9A 3GCTG 3EA7A 1OX1A 1TNJA 2ZDVH 3SUDA 1GDNA 1ZPBA 4MPWA 1GHAF 1RXPA 1A1RA 1C2MA 1J17T 1O5DH 5TJXA 2Z3EA 3KQCA 1AUTC 2ANMH 4WF8A 5E8EH 2C8YB 1P11E 2BY7X 5K0HA 1QA0A 1TX6A 3ZZ8A 4FVDA 1GL1A 1S5SA 1JWTA 3ZZ4A 1HGTH 1UTPA 3P8NA 1ZHPA 1JRTA 5GCHF 4BAMB 1DY8A 1UK3A 1ZMLA 1W13U 3EGKH 4AG2A 1NFUA 4WXVA 1ANBA 1A0JA 1BTYA 1O2YA 2WV4A 3RDZA 4X2WA 1TPSA 1FXYA 2GDEH 1YLDA 1WBGB 1YGCH 2ZU3A 3ATLA 4DGJA 5E2PA 3GY3A 2PUXB 2OBOA 5FCRA 4BNRA 1WUNH 2FM2A 4HI3A 1MD8A 4FVBA 3SNEA 4DIIH 1V2WT 1TMTH 2XWAA 1Y3YA 4B1TA 4X2YA 4OGXA 5A09A 2P3TB 2ZGJA 1Y3VA 5FCKA 2G00A 2ZTXA 1CO7E 3EA9A 3DHKH 1EZQA 1SC8U 2VWLA 1D3TB 1RIWB 1IQHA 3U1JB 3ZVFA 1P02A 2NU2E 3D62A 5ETXA 1G3EA 4AFSA 3QX5H 3TJNA 3O8BA 1QTFA 3GDVA 4ZUHA 2AGIX 4TY7A 1AHTH 5J4SA 2SGDE 4D9RA 2BQWB 1XXFA 2FOGA 1AKSA 2FOHA 1AMHA 3ATIA 3SJ9A 4AFUA 1MD7A 4XE4A 2H2ZA 4JK6A 1G9IE 2ESTE 1C2EA 2KAIA 5T3HA 3JZ1B 4BTIB 3UR9A 2ANKH 1P03A 1FN6A 1UCYH 3P6ZB 5F03A 1XXDA 3RC5A 1BT7A 1F0RA 3MH4A 2A45B 2VIQA 1PQ5A 1JOUB 3LH3A 2P8OC 3LT3A 4MQAA 1Z7KA 5B6OA 5I25A 4FUGA 3RMMH 3RXJA 1GMCF 2JKHA 4I31A 1QQ4A 1SHYA 3RXTA 2AMPA 3T2NA 1B0EA 1QFKH 4I8LA 1C5UA 1KXFA 6GCHG 1V2OT 2QV1A 1DWBH 3Q76A 1DE7H 5C3NA 4X1PU 3Q00A 1N8OC 4I8GA 5BPEA 3ZVGA 2XCFA 1W7XH 1SL3A 4CRDA 2Y7ZA 2BY5X 2ASUB 2ZA5A 1O2VA 1A3EH 4GPGA 4DY7B 1S83A 1ABJH 1UTOA 3Q3YA 1CE5A 1S0QA 4IMQA 1K28D 1BHXB 1O3IA 4ISLA 1YPHC 5LGOA 2G5NA 2BLOA 1NC6A 2Q1JA 2BB4A 1DXWA 1ZYOA 4ZAEA 5EU8A 1TA6A 2FMJA 3BTGE 1EP6A 1FJSA 6CHAB 2THFB 4MVNA 1RD3B 3B8JA 1XUKA 2VB0A 2RG3A 1DSTA 3FP6E 1QL8A 2ZFQH 2Z9IA 1TOMH 1QQUA 1X7AC 5F8TA 4Y8XA 3PROA 2SGQE 1W10U 1MZAA 3MO6A 4A1XA 1ELBA 2WV5A 1QJ1B 2ZPSA 4UE7H 4FUHA 4NCYA 1OWDA 1LKAA 5E0GA 3T5FH 4ISIH 1EPTA 5BRRE 1AKSB 1QA7A 2AH4X 5JBCS 3CP7A 5L2YH 4JZFH 1OPHB 2QXGA 3I78A 1GI8B 2BVRH 1ZSJA 1IQMA 1AFQB 2XRCA 1SSXA 2Z7FE 1K2I1 2OCVB 2KAIB 1CHOG 2H5DA 2ZGBH 2BY9X 6ESTA 2VNTA 1SFQB 3ZYEA 4NGAH 2WPJS 1C4V2 1QY6A 1GHXH 4YLUA 1C5ZB 3RXMA 1CVWH 2WYJA 1O2MA 2FDAA 1DWDH 2ZFTA 2P16A 1T8NA 4NSYA 4CRCA 1P3EA 1XMNB 3VB3A 4VGCB 3A8DA 4ABIA 3ZVCA 5CHAB 3Q3KA 5E0HA 4A92A 1HXEH 3F68H 4WMEA 3V0XA 4CH2B 2LPRA 4K60A 1YPGH 2VH6A 1GMHF 1L1NA 1VR1H 4GCHG 2QF0A 3QTVH 1AVGH 1WV7H 3VB6A 1TNKA 1SQTA 2Q6DA 1YCPK 1S85A 3OTJE 2BVSH 4A5TS 2AERH 1ARBA 1SGYE 2RCEA 5DKMA 1C2JA 3U8RH 1LHCH 1C5RA 3MO3A 4AYYB 2UWPA 1A46H 2FP7B 1KXBA 2QXHA 5EGMA 4BTUB 2YNAA 4KTUA 2JETB 1VZQH 1NROH 2XC5A 3GY4A 2A0QB 4CBNA 8LPRA 1OP0A 4JMYA 1GJCB 1C2IA 4NWLA 1ESTA 1G3BA 1P06A 3QZRA 2OQ5A 2BYAX 2TRMA 2I6SA 2GD4B 2OC1A 3LH1A 1VITG 4CBOA 2PTCE 1KYNA 2A5IA 1FLEE 2QF3A 1KTSB 1D3PB 5J4QA 1NESE 1FZZA 1EZSC 1XUIA 2FOAA 2XNIA 2WPMS 3D49H 3UWIA 3R0FA 1TYNA 4JZIA 1EPTB 1DT2A 1E34B 1YKTA 3TJOA 3AVZA 2GVFA 3QK1A 1BTHH 2A2QH 3EA8A 3UOPA 1T8LA 4XDEA 1TMUH 5JBAS 1V2KT 2GMTB 1HAYB 3SV6A 3D65E 1EATA 2AEIH 1DPOA 2ZQ2A 2TGDA 1ZPCA 5DK1A 3N7OA 1G3DA 5DPAA 3BG8A 2AGGX 3LGUA 1O3OA 1SGQE 1WAYB 2ZCKP 3LC3A 3RMNH 1FV9A 1O2GH 2AMQA 4ZKRU 1TE0A 3A80A 2BQ6B 3MWIU 3TU7H 1O3KA 2GCHF 1GJ4H 1O5GH 3F6UH 4M7GA 1C2KA 3T62A 3OX7U 7GCHG 1GI5A 2EI7A 1YPJH 2HPQH 4X8VH 2ZF0H 1F92A 4DCDA 3OU0A 4IMZA 1EKBB 1TLDA 5PTPA 1O2OA 1AWFH 1BMNH 3VB7A 2FODA 1SPJA 4E05H 3ZVDA 2EI6A 3T28A 1NRRH 3SU3A 1NU7B 5C5OA 1MQ6A 3GY7A 3Q77A 3RXGA 3E0PB 4Y0ZE 4F49A 5DP4A 1GG6B 2VJ1A 3GCHB 4LOYH 1C5YB 2SGAA 1OYQA 5EQQA 1ANEA 3GICB 2TGTA 4BAQB 1C1TA 3M3VA 2J92A 3DT0H 1P0SH 1LPZB 1Q3XA 1TOCB 4HGCA 1NRQH 3A7WA 2H1UA 1L1GA 3MU8A 1QJ7B 1CBWB 2ZFSA 4CR5A 1C1VH 1GBDA 2PHBA 3RXDA 2VINA 2BX4A 1Y3XA 2B7DH 1INCA 3F1SB 4Y7BA 1MTUA 1O3MA 5JBBS 2O8MA 3AW1A 1H8DH 1IHSH 1ZTJA 3M3TA 3ZVAA 3RXOA 1O5BB 1HAVA 1IQIA 2NU3E 3BG4C 4NSVA 4RKJB 1TBQH 1S0RA 1ETRH 5FPYA 1KIGH 4BXWA 3UPEA 1A3BH 1GHVH 1TNIA 3SO3A 1J15A 2QGRA 4MTBA 3OY6U 1HJ9A 2P3UB 4CRFA 2UUKB 2GZ7A 1UO6A 3TH2H 4SGAE 1ANDA 1YPHE 2QXJA 5FX5A 1OWKA 1ELVA 3TVJB 4NG9H 5EXMA 1ELCA 1UCYE 2ODYB 1GBBA 4Y11E 2ZFRH 4AGJA 2VU8E 3SBKA 5DP5A 3UUZA 3QO6A 1B7XB 2CF8H 1FY3A 2AS9A 1O2XA 1EX3A 2W3KA 5C1XA 2FEQH 1TGSZ 2A2XH 2ZHDA 4TWYA 3MNXA 1C5OH 1FQ3A 2UUFB 4ZHMU 3SUGA 1ZHMA 3MTYA 1P57B 3GY2A 1SGRE 2ZIQH 4ABHA 4BAOB 1MMJN 1PYTC 1DITH 3SV8A 2C8ZB 1LCYA 2Z3DA 4FUDA 1NT1A 1OYTH 2IN2A 1JRSA 2SNVA 4X1QU 5F8XA 3O8CA 3S69A 1O2WA 2A5AA 4UFEH 2HPPH 1ORFA 5AVDA 3UWJH 1JIRA 4H42U 1OOKB 1QURH 2ZI2H 5GDSH 1H8IH 6GCHF 1K22H 1T8MA 2PKSC 1N1LA 4YTAA 1BA8B 1DFPA 1ZSKA 1T31A 4MNVA 4UONA 1GBJA 1HAHH 5EXNA 1LO6A 1LVMA 1HRTH 2VIVA 2XW9A 1O3DA 1T4VH 3ZZ9A 3M5NA 1GI3A 1HAVB 4AB9A 1GI6A 3LPRA 1W8BH 1UTNA 1B5GH 1D6WA 1HJAC 1OP8A 3SQHE 4GVUA 3BTDE 3U8TH 2ODQA 2AYWA 1TABE 3EQ0H 1L2EA 1KLTA 2NU1E 1HB0B 1K1OA 1QRWA 3ZZAA 4Y71A 3E6PH 1TALA 2BD2A 3IG6B 2PKSB 5JBTA 3RXLA 2WUBA 1CGIE 3CS0A 4Y8ZA 2DUCA 2ZCLP 1LKBA 3M5LA 4BTTB 1EB1H 1SLVB 2J4IA 4B2BA 2PSXA 2OTVA 2HOBA 4Y7AA 4B2CA 4D76A 1VGCB 3E16B 4I7YH 4K1EA 2R2MB 3BV9B 3TK6A 3PTBA 3ATMA 1QB6A 2BMGB 1O5FH 1C5SA 1SI5H 4FUEA 3TH3H 1LDTT 4IGDA 2WYGA 4I33A 1GBLA 1GJDB 1CHOF 1F2SE 4AORA 4FUFA 3TGKE 4FUCA 1BQYA 1C1NA 1AD8H 1O39A 2J2UA 4U01A 1ZTKA 1CT0E 1ELDE 1SLUB 2VIWA 2R3YA 1LHDH 2VGCB 2XWBI 1GL0E 3U98H 1O3HA 1DUAA 1G36A 2TPIZ 4O9VA 8KME2 1HYLA 1HIAA 2V6NA 4ABAA 3L3TA 1O38A 1MQ5A 1RGQA 4GCHF 1TRMA 1PPBH 1Y5BT 2FOEA 3TIUA 2ZECA 3VXFH 1AUJA 1BTUA 3A7YA 1EAWA 2GZ9A 3WY8A 3CS7A 1GJ6A 1HUTH 4GHQA 5C20A 2J95A 1AO5A 1E36B 1P05A 3TNSA 2UWOA 1LPKB 1IHTH 2ANWA 3E90B 1QR3E 4MPUA 4INKA 1AB9C 1E0FD 3MNCA 1OWJA 1VCWA 2OC7A 4ISNA 4A6LA 4AN7A 1G32B 1KDQA 2R0KA 1AIXH 4JYUH 3F9HA 1THRH 4K3JA 2BOKA 2ZU1A 1GJ7B 4WH6A 1S6HA 2BDAA 1YLCA 1VITF 2A4RA 3LC5A 4I8JA 1AI8H 2SGFE 1YYY1 1W0YH 2ZGXH 4CRAA 1JIMA 1TNLA 2HALA 2O8UA 1NRPH 3SJIA 3MNSA 1SFIA 4MNYA 4X1SU 3SJKA 2FOMB 1ELGA 1XUGA 4E06H 3IITA 1YP9A 2BD3A 4X2XA 1TRYA 3V3MA 2DE9A 2C4FH 4RN6A 3AW0A 1UHBA 4CRBA 3RXUA 2BVXH 5A0CA 2OLGA 1QRXA 4BXSA 1O3PB 1SQAA 3ATWA 1E35B 1V2LT 1IQFA 3LDXH 3P92A 4LZ1H 3PO1C 4TPIZ 2QYIA 2FX6A 3MH6A 3ZZ5A 1T4UH 4JZ1A 4YZUA 3AAVA 2WPLS 3KQDA 3OY5U 3MOCA 3NPSA 3RP2A 4X6OA 1GI1A 3O8RA 3HKJB 1IQJA 3RXEA 2BD4A 1JMOH 1EAXA 1MKXK 4E7RG 5A8ZA 1ZLRA 3U9AH 4K1SA 4Q80A 4YOJA 5FPSA 1VITH 1NO9H 1CA0C 1HIAB 3A85A 3BTME 1MTSA 5FPTA 1SGEE 3GOVB 3M7UA 1XUJA 2FZZA 2IPHA 3I77A 3MU5A 3EE0B 3K65B 3QZQA 5FBIA 2Y82A 2D2DA 1MKWH 1YPLH 2J94A 4Q7YA 1GJBB 4BAKB 1C4Y2 1P09A 5SGAE 3DD2H 3CENA 5A8XA 1C5NH 1GGDC 1H4WA 4NZQA 2VH0A 2HLCA 3SGAE 3SU5A 5F6MA 3K2UA