4I98B

Crystal structure of the complex between scpa(residues 1-160)-scpb(residues 1-183)
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
167
structure length
167
Chain Sequence
STLAKIEALLFVAGEDGIRVRQLAELLSLPPTGIQQSLGKLAQKYEKDPDSSLALIETSGAYRLVTKPQFAEILKEYSKAPINQSLSRAALETLSIIAYKQPITRIEIDAIRGVNSSGALAKLQAFDLIKEDGKKEVLGRPNLYVTTDYFLDYMGINHLEELPVIDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An asymmetric SMC-kleisin bridge in prokaryotic condensin
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Cell cycle
molecule keywords Segregation and condensation protein A
total genus 44
structure length 167
sequence length 167
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04079 SMC_ScpB Segregation and condensation complex subunit ScpB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4i98B02
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4i98B01
5AIQA 1T2KA 2CGPA 4WK8F 4EJVA 4EVIA 1LVAA 4WF2A 1R1VA 2ESHA 1MDMB 2GIVA 2YR2A 1YQAA 3VODA 4G7OF 2DK8A 2PQ8A 4MHGA 3WTUC 3ECOA 4HZFA 3IRRA 5D5XB 1PP8F 4Q4ZF 1PP7U 3H92A 2KJCA 2VXZA 1B9MA 5LEJA 2M1BA 3V7RA 1U2WA 2MC3A 2QBYA 5D8KB 3R6SA 1LDKB 3GFMA 1J0RA 4DQ2A 5CLSA 4G6DA 5E17F 3DFGA 4ENJA 2LF8A 1SAXA 3JSOA 2BBYA 2VOPA 1STZA 1QZZA 2CG4A 5E1XA 1W7PD 5ILVA 1D3YA 2FNPA 3GF2A 3E6BA 2PBIA 1SD4A 1RIOH 3GEZA 5D6EA 4DNCA 4KA4A 2Q2EA 5DDGA 1FT9A 1P92A 2OQRA 2VE9A 1WI9A 3I54A 1W7PB 4U7BA 3E5XA 2JPCA 3QP5A 4LLNA 1O7FA 5D8LB 3M8FA 2UXNA 3K9TA 3GX4X 2DAOA 1ZG1A 4KDPA 1S8NA 4M6YA 1TBXA 3ML6A 3LA3A 4ENMA 1XCVA 4HDVA 3Q5FA 1YW8A 4L9JA 1XGNA 2FE3A 4L9VA 1FP2A 2DQLA 3C18A 1FNNA 4OMZA 5LRRA 1MD0A 3J7AO 3E6MA 1G4DA 2X0LA 4KT5C 4RAYA 3HSRA 4ZYHA 1B59A 2XAFA 2W25A 3TO7A 3SXYA 4QLCU 4KIBA 3F6OA 3BDDA 2VT3A 1E2XA 1Z6RA 2ETHA 1I6XA 5CVUA 3WG9A 3ULQB 2YX7A 5L3BA 1BN5A 2BGCA 4I7HA 4WCGA 5CVVA 1YYVA 2Q0OA 2H27A 4ENNA 2Y48A 3E3VA 1ZLJA 1XGSA 1RI7A 3JAMK 2XAGA 1BI1A 4LB6B 4KMFA 2RKHA 3FMSA 3KE2A 4I0BA 4UXNA 5ICCA 1T0FA 2CFXA 4P5OA 4L5IA 3HIFA 4Q47A 2Z3YA 2IVMA 4RB2C 5FB2A 3VFZA 3KLOA 3WTVC 3I0TA 1K6OA 1FZPB 2A61A 4ZZLA 4ETSA 1FP1D 4OOIA 4ZYDA 3COAC 4CGZA 1ZYRF 4JQFA 4TV7A 4M9ZA 1R22A 2EFNA 4PDKA 1FPQA 2IA2A 1YO5C 2IRFG 3CUOA 4HF0A 4RB0A 1R58A 2LDUA 1U8RA 5F6FA 2X4HA 1U3EM 2OAZA 2JSCA 1YLFA 2FMYA 4I2OA 2P8TA 3F8FA 5FD5A 2CQKA 5DCFA 2UXXA 2E1CA 4R1HA 2M30A 5KK1A 5J8FA 1J9IA 1OYYA 2E7XA 2YPRA 1KU2A 2DO7A 1B6AA 2DU9A 3ABUA 4OMYA 2ZNYA 2P6SA 3ZP5A 2ISZA 1XB4A 3LWFA 4HX4A 1LEBA 2HOEA 3LQRA 5AIPA 2RVCA 4U88A 2ISYA 4RB1A 3GVAA 3CO6C 2YX4A 2KJBA 1D8KA 1KQ8A 2EFQA 4A5MA 4A2UA 4ASNA 4EM1A 2FF4A 5FLXZ 3ZN1A 2YU3A 1VTNC 4O6JA 2OA4A 3GLXA 4A0XA 3KP3A 3D5LA 3L09A 1DPRA 3QAHA 1O57A 2A68F 3DPLC 1L3LA 3SQNA 2HR3A 3FF5A 2V1XA 4HQMA 5D4RA 1T6SA 3RYRA 1LNWA 3BOQA 3DEUA 1R36A 1X3UA 3BWGA 3FM3A 3KCCA 3P9KA 1ZREA 3BPXA 1FBSA 2P5KA 2FNAA 4LG0B 1JGSA 2PEXA 3F3XA 4L18B 3J80K 3EYYA 2XGXA 1O3RA 5DYMA 1O3QA 2Z5UA 1D8JA 1XCBA 2LSOA 3HSFA 1TLHB 3GZ6A 5H6RA 1PUEE 4PGHA 2V6CA 4GXOA 2VONA 2Z9OA 3IKVA 3MZHA 5DUIA 2IW5A 2VN2A 4CZZA 2XAJA 1TQMA 2Y0MA 1V4RA 1Z9CA 1BI2A 2ZFWA 4L0ZB 1CGPA 1J5YA 1BOAA 1LDJA 2NRAC 5LGTA 3W6JB 4NB5A 1QPMA 2DK5A 4GGGA 3ECHA 2L01A 1H0MA 2JT1A 4LB5A 2FOKA 1ULYA 1R23A 2ESNA 2QQAA 4R8HA 4ESBA 4L9NA 1XSVA 2P4WA 3K69A 3QPHA 5IT9Z 3RYPA 1UHWA 2O0YA 5CVJA 5TRDA 4ESJA 2VC0A 1SFEA 2HYGD 4KIGA 4S05A 3PQKA 1QNTA 3K2ZA 4OIQF 1OYWA 2ZBKA 2O8XA 2ELHA 5E1ZB 3F8BA 4Q48A 4HV5A 3I71A 1FSEA 4OINF 2OZUA 2D1VA 2KRFA 3FHZA 2EFPA 1JXSA 5BS6A 1IXRC 5AONA 2LF7A 3K1PA 4HLXA 3IL2A 2W24A 3QOPA 1YFHA 2ZMEB 3C7JA 4KFCA 4Q5SF 1J75A 4HDUA 4GCVA 4PCQA 2EWNA 3NEUA 1MJ9A 1ZRDA 3MWMA 4G94A 3FMQA 2BE5F 3EDPA 2HQNA 4E70A 2DQRA 4LGWA 1S7OA 3KP5A 3MAJA 2Z33A 3P9IA 3EUHA 3Q9SA 3M9AA 2EA2A 4S04A 3IHUA 2A07F 1FLIA 1FC3A 1KU9A 5HS9A 3VEPA 3QRFF 4HX7A 4ON0A 2G7UA 3F8CA 2XAQA 1QBJA 3SZPA 1TQPA 1R5HA 3HTUA 1GXPA 3FMRA 3WGHA 1FWZA 2ZKZA 1BBYA 1Z6TA 1HW1A 3J81Z 2MH9A 1DPUA 4RGSA 3WGGA 4RS8A 4UUVA 2FBHA 1OPCA 2WC2A 1OMIA 2CW0F 2HDCA 1WSUA 4AWXB 3G3ZA 3K1MA 2MLGA 1TNSA 2V79A 2L4MA 4PZJA 3KETA 4JK1X 2J5PA 1ON1A 2P6TA 5F64A 4EQQA 1CF7B 3CUQA 5FGMA 5LEKA 4M74A 3T1BA 5JVTA 2HTSA 4H0EA 4MTDA 6PAXA 5FO5A 3GXOA 5ILSA 2E7WA 2GWRA 2L3DA 2RC4A 4LLLA 3RKXA 1YW7A 3RPQA 4G6QA 4BYYA 1WQ2A 5FLXK 5HDNA 4YG2F 2XIGA 3V8LA 3PQJA 3QPTA 5DV5A 3WTTC 3WODF 2HZTA 1S7AA 5L3DA 2BYVE 1ZG5A 3KZZA 1ZGJA 4JBAA 3BP8A 4Z2YA 3BJAA 1IN4A 1O7LA 3CTAA 2FRHA 1CF7A 3HRTA 2RGVA 1R5GA 1G3WA 1W7PA 1FYLA 2HGCA 1ZLKA 3RTRA 4HOBA 1KQ0A 1FY7A 1XD7A 4IRGA 1BIBA 3TGNA 1HXDA 2XRNA 4R79A 3WU0A 4KN4X 3HHHA 4BHCA 5JI6A 2K27A 2XKPA 5J6XA 2HKOA 3RKYA 4I0AA 1J59A 1R1TA 2HQRA 3HRMA 3GFLA 1SMYF 1YS6A 3JTHA 2R7FA 2JRTA 5HDKA 3E5UA 4U0WA 1WKMA 1B9NA 3K0LA 2TDXA 4K2EA 1HQCA 4U0VA 1NHAA 3TO9A 4ZH4F 3ZMVA 1F5TA 3N4MA 3P9CA 2EFOA 5H6QA 2O03A 2XKOA 1REPC 3WTYC 2DPDA 1G3YA 1T98A 2D2WA 1TNTA 1ZAOA 2L02A 2MH2A 3J81K 4HQEA 3RPUA 3FXQA 3ROUA 1EH6A 3SHFA 4BHBA 1YIOA 3AAFA 4KNYA 1Z1DA 3GFJA 3G73A 3ZPLA 1A04A 3LAJA 1FBQA 2IA1A 3WE3A 3H3UA 5K5RA 3HOTA 4RGUA 2VE8A 1JHHA 1IN7A 2K86A 3R0AA 1ZARA 2GA1A 3F8NA 4CXFA 2K02A 4UVAA 4AIJA 4G7ZF 2OQGA 3VOEA 2LNBA 4LMYA 1EH7A 3N97A 2QENA 4EGYA 2PFBA 5LGNA 4A0YA 2EK5A 3JW4A 3SFZA 2GZWA 2J5OA 1B4AA 2C6YA 2YSRA 1KU7A 5FD6A 2O3FA 1LDDA 4FX4A 2EV5A 4M72A 1QZYA 4B09A 5LRSA 1F9NA 4YIFA 2V1UA 2JTVA 2Y75A 2L4AA 5F1RA 1IW7F 2XASA 3HUGA 2VODA 3B73A 2DBBA 3HRUA 1XGMA 4HAMA 1KYWA 4WX9A 3SZTA 1W5SA 4BHPA 1G3TA 3JSPA 4UVCA 3IRQA 4YFKF 2W85A 5DEQA 1U5TB 1UHMA 1JE8A 4ESFA 2ZMEA 3WTSC 1ZRFA 1SD5A 2IT0A 5EEGA 2WV0A 3HRSA 5CVRA 2PJPA 5L3CA 2V9VA 1YW9A 1GXQA 3QU6A 2GAUA 1HW5A 3RI4A 3CUQC 2COMA 5JR3A 5L3EA 5DCMA 4UHTA 2HWVA 5HS8A 1MJAA 3CO7C 1E17A 4FHTA 1B1BA 1R1UA 2QM3A 4MGRA 1S3JA 4AVPA 1HBXG 2OZ6A 4G7HF 2EA4A 4UV8A 1BC8C 3MCZA 3U2RA 5A2QK 2QQBA 2WTEA 1I1GA 4XBFA 4LD5A 1G6NA 4NHJA 3DKWA 3EYIA 5CJ9A 2QBYB 3ZMUA 3HSEA 4QWQA 1TW3A 2D1HA 2QWWA 3IWZA 4A6DA 4CICA 1ZN2A 3M1EA 3LA7A 3D0SA 2IJLA 3RIRA 2M8EA 4WXHA 1S29A 3E97A 3I4PA 3L7WA 1H9TA 3V8KA 4BAYA 1SFUA 4M73A 3QU3A 3KLNA 1MKMA 3DV8A 2HS5A 3ZQ7A 2EV0A 4XSZF 3WE2A 2DPUA 3R4KA 3F23A 3CLOA 3TDZC 3NRVA 2FQ3A 1RUNA 2NAZA 1DDNA 1IXCA 3V7CA 5TJJA 2MLKA 4MQVA 5DUKA 1YG2A 2QZ8A 4OIPF 2PG4A 3IC7A 4MEXF 3WTZA 1XDUA 2OBPA 3L00A 3HTSB 4P9UA 3ZN0A 4LK0F 4KUMA 5LHIA 3V4GA 4WXCA 4LG0A 3OV8A 3O3KA 1FOKA 1I27A 2EV6A 4UV9A 1BI0A 5HVQC 2FSWA 1AWCA 4I09A 4HW0A 2P7VB 1RUOA 3J80Z 2KIUA 1SMTA 1QO0D 2F5FA 1MJBA 2EB7A 3ABTA 2FMLA 5D5WB 5FFXA 2AXLA 1BIAA 2H6BA 1O3TA 2NYXA 1T38A 4Y15A 2VBXA 1HKSA 1GVJA 3TO6A 4IRIA 2JZYA 2LKPA 4M6XA 4A6EA 2KKOA 2FBIA 3E6DA 1I5ZA 3R0JA 2DLLA 2VBZA 4IPAA 2A69F 2HKXA 1IUYA 4L5JA 3T8TA 3T8RA 3KEOA 4HV6A 1KGSA 5HLHA 4N9HA 3QP6A 2E1NA 5ERIA 3VB2A 3R61A 4A0ZA 1F4KA 2VOOA 1IXSB 3H3ZA 1BJAA 1U5TC 3E6CC 2PLYA 4B8XA 2PI0A 1ZH5A 4G9YA 1MZBA 3KEQA 2V1DA 1MGTA 5JHUA 3P7NA 4CDGA 2FEZA 1J2XA 5E1WA 2RDPA 3V8JA 4A5NA 2K7LA 2R3SA 5L3GA 2DT5A 2HYFA 2KIFA 4ZZDA 4HLYA 5DCMB 1D5VA 4P55A 2WWYA 2XHKA 4YFNF 4UVBA 5DD8A 2QQ9A 3F8MA 2M45A 1HW2A 2G9WA 1Y0UA 2DW4A 2XV4S 1YTYA 3KZYA 3ELKA 3BZ6A 1ODDA 1BM9A 2M87A 5LGUA 4EJTA 5BPDA 4MQ9F 2F5EA 2KIMA 3RKWA 1S6LA 3I5UA 4MEYF 1TTYA 1T39A 3GWZA 4EJWA 1KQ9A 3F21A 2STWA 2MA3A 5CYVA 3T0YA 1KYZA 3DPTA 4KICA 2AS5F 1ZGAA 2R7DA 2IA0A 2K4BA 5HLIA 5E8GA 3ERED 3U9GA 2XROA 3GUDA 1XGOA 5KVRA 2B0LA 1HSJA 5HLGA 4P9FA 2P7CB 2BV6A 1P4AA 3DF8A 1XSDA 2STTA 1EV7A 2OU2A 5HOOA 2PMUA 2Z99A 5E20A 3WTWC 1USTA 4Y13A 3PFIA 4N0BA 2ACJA 4IHSA 2H09A 1WWXA 5ICEA 3BJ6A 4ZYEA 5ILUA 2G7HA 3M7GA 1FYKA 1IN8A 2F5CA 4GO1A 4KMUX 3RDIA 3KP4A 1HSTA 5LBQA 1ZG3A 2FXAA 2EJRA 1FX7A 3F6VA 3TDUC 4PGGA 5A2QZ 1KU3A 4L0YB 5EEHA 1G3SA 1XMKA 4RGXA 1OKRA 4CYDA 1JHFA 1DP7P 3C1DA 2XUBA 2NNNA 2HTJA 2A3SA 1P6RA 2RV8A 1XDSA 1RNLA 2CO5A 3I58A 2BEOA 2DI3A 4U7DA 3O6BB 3FXUA 3HOSA 1FYMA 1SD7A 3MEXA 2M5WA 3GFIA 3L2CA 2VBYA 5E8IA 4O3MA 2O6GE 2A6EF 3TQNA 1IAWA 2CSOA 1U78A 4Y17A 1U5TA 5IT3A 4D0PA 2XVCA 3FX3A 4HBLA 3DQVC 5H20A 4FX0A 3GZ5A 4GYIA 4KIFA 1K79A 1W4MA 3ZMTA 4F7ZA 4HYEA 3LAPA 5K5OA 3WTXC 2HFHA 4LJZF 2A5YB 3FXRA 2ZXJA 1GHCA 5HS7A 1ZHFA 2VT2A 1USSA 3CUQB 3LSTA 4ZYGA 1ZRCA 3EQLF 3HYIA 1Z91A 4KN7X 3RJPA 3LQQA 3KP2A 4O5VA 3B02A 3R60A 2GXBA 2MD5A 4RB3C 2NNYA 1P2FA 4CHUA 2IP2A 3DXJF 3GW2A 4XRFA 1PDNC 4HA8A 5LHGA 3HHGA 1O3SA 2RQPA 3MQ0A 4A12A 1UB9A 4HX8A 2VC1A 4GYGA 1R00A 3BROA 1IN5A 4FT8A 1SFXA 1Z05A 2L54A 4M9XA 3JAMZ 4EM2A 1AOYA 1OYIA 5IT9K 3ISPA 4XSXF 3ZMDA 3KP6A 3T5XA 1P4WA 2PMHA 4XLNF 2UWMA 3MZYA 4YIIA 4AIHA 1Q1HA 4M71A 1LEAA 3C3WA 3CDHA 1QGPA 3KP7A 4OU0A 3IKTA 1FBUA 5FFZA 4EJUA 1K7AA 4RGRA 3ZMZA 2CWEA 1BC7C 4IF4A 3TOAA 1HKQA 5D6FA 4U0YA 3FZVA 3Q9VA 2XAHA 3OOPA 2H6CA 3L9FA 1SD6A 5L3FA 4I02A 1LJ9A 2NS0A 4EM0B 1Z7UA 4G8XA 1H9GA 2GA2A 3F22A 3BJOA 2ZNZA 1IN6A 3U1DA 3BY6A 3DP7A 2QYOA 2QLZA 4BQAA 2Q8KA 4M9SA 2VBWA 4I98B 2D45A 5CVIA 1W5TA 5JFRA 3FM5A 1IZ1A 2QVOA 4NQWA 2ZJ2A 3I59A 2W57A 2W84A 4HF1A 1RZ4A 5D5UB 1IRFA 1QQIA 4RAZA 2A6HF 4P96A 2FA5A 4EJOA 2ZCWA 2F5DA 3GYHX 1LQ1A 1ONVA 5D5VB 2RNJA 2P5LC 3GO5A 4BH9A 4BXUA 2O61A 4UNOA 1KA8A 4EGZA 2OD5A 2EFWA 5LLQA 3EETA 4IRHA 1IRGA 4EV0A 4OIRF 4BNCA 1ON2A 5K1YA 4EMSA 3S2WA 2IPQX 3M8EA 5ICGA 5K5QA 2GQQA 2HEOA 5LHHA 1R7JA 4LFUA 1LB2A 1EH8A 3LFKA 1MDMA 3WGIA 3WU1B 2QUFA 2MBFA 1HKTA 1XMAA 4OIOF 1OR7A 4I01A 3JTGA 5BOXA 3W6KB 3TOBA 2DTRA 2DFIA 4IJAA 3E5QA 1YS7A 3NQOA 3REOA 1FSHA 5D4SA 4MNUA 4IXAA 5J8CA 3LA2A 4YFXF 5BMZA 3K1NA 3O2PE 5E18F 1U6GA 2F2EA 4L9TA 2FBKA 3F72A 1V3FA 3V7SA 1TW2A 2GXGA 2H94A 4KYWA 3TKYA 4HF2A 1UFMA 4AIKA 1K78A 3IWFA 2UZKA 1F1ZA 1IF1A 4LLGF 3CJNA 1TQIA 5DD4A 1L0OC 3KFWX 1P4XA 1DUXC 4IHTA 3I53A 2PN6A 2JPBA 3ZMSA 4XLPF 1XN7A 4MTEA 3FWEA 2RN7A 4WXDA 2CYYA 2ZO4A 2ADUA 3I64A 4WWCA 1XSXA 2P5VA 1UCRA 5BQTA 5BPIA 1WRJA 4ENKA 5ICFA 2K4JA 1K78B 3BPVA 5ED4A 4N9IA 4AD9A 5HDGA 4CO8A 1J7KA 1C0WA 3I59B 1BI3A 4IVNA 4LK1F 1I1SA 2FU4A 3MFKA
chains in the Genus database with same CATH superfamily
5AIQA 1T2KA 3JRFA 2CGPA 4WK8F 3A01B 3RSNA 1WJCA 4EJVA 4EVIA 5H2FC 1LVAA 4WF2A 5TGTA 5M5WJ 2DA6A 9ANTA 1R1VA 1I3QJ 2ESHA 1MDMB 4HNVA 1OISA 2GIVA 3PNTA 2YR2A 5FROA 3E1SA 2GIZA 1YQAA 3VODA 4G7OF 2DK8A 5FKLA 1VQ8I 2PQ8A 4MHGA 1LFBA 3WTUC 3ECOA 4HZFA 5B1AH 2E34A 4L5EA 3OYDA 4XLCA 3IRRA 2HU9A 2Q2EB 4UB6C 5D5XB 3S3NA 2EZLA 3KYDB 1PP8F 2K9MA 4BEHB 4Q4ZF 1PP7U 2KIQA 3H92A 2KJCA 2VXZA 1B9MA 3KPHA 5LEJA 4MFEA 2M1BA 3V7RA 1U2WA 2MC3A 3S3MA 2QBYA 1X4PA 2AHQA 2NVYJ 5D8KB 3OYFA 2EIJH 2HQAA 3JRCA 3R6SA 3SJMA 2MD0A 2JA5J 1LDKB 3GFMA 1J0RA 4DQ2A 4F55A 1BC7C 5CLSA 4BXXJ 1JTXA 4G6DA 5E17F 3DFGA 4D5FA 5GTIC 3GTPJ 4ENJA 2LF8A 1SAXA 3JSOA 2BBYA 1ETWA 2VOPA 1STZA 4E7HA 3CC7I 5E3OA 4A93J 1QZZA 2CG4A 5E1XA 1W7PD 5ILVA 1D3YA 2FNPA 2R4GA 3GF2A 5E3LA 3E6BA 2PBIA 3ZOBA 5DM7F 1SD4A 3BTLA 1E0EA 1RIOH 3GEZA 5D6EA 4DNCA 2QF7A 2XC7A 1H8AC 4XICA 2EPFA 3ABMH 3F9KA 3ZXSA 4KA4A 2Q2EA 3LSKA 2E2IJ 2HI3A 2YS9A 5DDGA 2V9PA 1FT9A 1QVTA 1P92A 2EIMH 1XG1A 3IAM2 5JLXA 2OQRA 2VE9A 4XKCA 1WI9A 3I54A 5J3LA 1HC8A 2ZFUA 1W7PB 1ZGWA 3JCUC 4U7BA 3E5XA 2JPCA 3QP5A 4LLNA 1QU3A 1O7FA 3S8PA 5D8LB 1YRNB 4DJAA 1OR7C 3M8FA 2X6YA 2YU9J 3E0JB 2UXNA 4XLEA 3K9TA 4B48A 3GX4X 2EH3A 4BS9A 1X1BA 2JMWA 2JWTA 2DAOA 1ZG1A 4KDPA 1S8NA 4M6YA 4Y3OA 1TBXA 2QGUA 4HSTA 5FRMA 3BZCA 1TWCJ 3ML6A 2EZIA 5CPRB 4DBQA 3LA3A 2KRCA 2LY2A 1XCVA 3CCUI 4HDVA 1WPKA 4ENMA 3Q5FA 1Z21A 3FISA 1YW8A 3S15J 3FXMA 3JREA 3BR3A 4L9JA 1XGNA 3UNGC 4B4CA 1JT6A 2FE3A 2XF7A 4L9VA 1FP2A 1MMGA 1IJWC 1YITI 2DQLA 1JUMA 3C18A 4ITVA 2ZC2A 4LIUA 1FNNA 4CCJA 4OMZA 5EZHA 5LRRA 4A3LJ 1MD0A 2E5ZA 3J7AO 3E6MA 1K4TA 3GTQJ 3E7LA 2X6OA 4UUSA 2GBYA 1G4DA 2X0LA 5B1BH 4C3IJ 3OY9A 4KT5C 4RAYA 2HDDA 3HSRA 4MO7A 4ZYHA 1B59A 1K6YA 2OJED 2XAFA 3G6EI 2DDAA 4UUTA 3RZOJ 2W25A 5IP7J 3A0BC 3TO7A 3SXYA 4QLCU 4KIBA 5GPAA 3F6OA 3BDDA 1ETVA 2DMUA 2VT3A 1E2XA 2GOMA 4KT6A 1Z6RA 2ETHA 1I6XA 3BG9A 1Z7LA 1HA8A 2IGNA 2ZB9A 3BQYA 2ZXIA 5CVUA 1Y6IA 3WG9A 3ULQB 2YX7A 4ZDLA 1U8BA 5L3BA 1BN5A 3ZQGA 2BGCA 4A3GJ 1FEXA 4I7HA 4WCGA 5CVVA 1X2MA 1YYVA 2Q0OA 2H27A 4ENNA 3E3VA 2Y48A 3BCBA 3BG3A 1ZLJA 3OWTA 1XGSA 1W36D 1WZ2A 4YEJA 3ESWB 4PJNA 4A69C 3CC2I 1RI7A 3HEFA 2HXOA 3JAMK 3OR1C 1I3AA 2XAGA 4G6TB 3K7AJ 1BI1A 2F4OB 2DMNA 4MLOA 4LB6B 4KMFA 2K40A 3KEYA 2NOGA 2RKHA 3FMSA 3KE2A 4I0BA 3NARA 3CESA 2X1EA 3MMYB 4UXNA 5ICCA 1T0FA 4C9YA 2BW3A 3Q0UA 3KYLA 2DXIA 2CFXA 4BQNA 4P5OA 2VXDA 4L5IA 2FJ1A 4XM3A 2HQ5A 5E3MA 3HIFA 2R7TA 4Q47A 1HLVA 2Z3YA 1TZLA 3DKXA 3O8HA 4JX6A 2IVMA 4RB2C 5FB2A 2EBIA 1ZKGA 1KZHA 4YRVA 3VFZA 3KLOA 3PL8A 3WTVC 3I0TA 1K6OA 2L7ZA 1FZPB 3WHCA 2A61A 2OCCH 4ZZLA 1G2HA 4B44A 1FP1D 4OOIA 4ETSA 4IHXA 3I4MJ 4C2UA 2DA3A 4ZYDA 4E7ZA 2DYSH 1LKXA 1FTZA 3COAC 3OYKA 2ELJA 4CGZA 1ZYRF 3BG6A 4JQFA 4TV7A 4M9ZA 3BQZA 2ZJPF 1R22A 3CZ6A 3A03A 3GTLJ 2QKLB 1R9TJ 4AM3A 3CMMA 2OC6A 2E2HJ 1TT5B 3NWTA 2EFNA 4PDKA 1FPQA 3FKIJ 2IA2A 3CCMI 1YO5C 3RPUD 2IRFG 2XGCA 4PSWA 3H1CA 3CUOA 4HF0A 4RB0A 2M4KA 3BC8A 2I8DA 2EINH 5CKTA 4HNUA 1R58A 1ZTRA 2LDUA 3OSFA 1U8RA 1HF0A 3OYEA 5F6FA 2X4HA 3K10A 1U3EM 2OAZA 5GP9A 2JSCA 2IGMA 1YLFA 2Y9YA 1MNEA 2FMYA 2P8TA 1Y39A 1O4XA 3F8FA 4C2MJ 5FD5A 3KIOA 2CQKA 4I2OA 2IS1A 1WH7A 1WJEA 5DCFA 2UXXA 2KDZA 2E1CA 4R1HA 2M30A 5KK1A 4RA2A 5J8FA 2NVTJ 1J9IA 1OYYA 1BL0A 2E7XA 3J7ZI 3PJRA 2YPRA 1KU2A 3CCYA 2DO7A 1B6AA 1I50J 2DU9A 1FOYA 3ABUA 2L9SA 4OMYA 2ZNYA 2VI6A 2P6SA 3ZP5A 1XB4A 3ASNH 3LWFA 4RAFA 2ISZA 2EQRA 4HX4A 1MMDA 1LEBA 2HOEA 3CCJI 3G1MA 3LQRA 5AIPA 2RVCA 3JRBA 4U88A 2EIKH 1QPIA 1XMXA 2CJJA 4BJTA 4YIRX 2ISYA 3BZKA 4RB1A 3GVAA 3CO6C 2YX4A 2KJBA 3FKJA 1D8KA 2H1LA 2EFQA 2X48A 2Y31A 1KQ8A 4A5MA 4A2UA 4ASNA 4EM1A 2KMUA 2FF4A 2LVSA 4IHVA 1ACIA 1OCZH 5FLXZ 2ICWG 4XOTA 3ZN1A 3OYCA 1JT0A 2DA7A 2YU3A 1VTNC 4O6JA 2OA4A 3GLXA 4A0XA 1ERDA 1V5EA 3KP3A 3D5LA 3L09A 4V19K 3GTGJ 1DPRA 3QAHA 1O57A 2A68F 3A02A 3DPLC 1L3LA 2VASA 3DU6A 1BOBA 3SQNA 3RQIA 2HR3A 3FF5A 2V1XA 4HQMA 4CH7A 1G59A 5D4RA 1T6SA 3RYRA 1LNWA 3BOQA 3DEUA 1R36A 4DIQA 1X3UA 1GV5A 3BWGA 2VQHA 4DBRA 1UHSA 2BW3B 3FM3A 4DW6A 3W2AA 5EF6A 3KCCA 3ZQLA 3AG1H 1XS9A 3P9KA 3UKGA 1ZREA 2CW8A 3LOCA 3BPXA 1FBSA 2P5KA 2FNAA 3CJTB 1S72I 2CUZA 2VPLA 2W7NA 3L2VA 4LG0B 1JGSA 2WY7Q 2OPTA 1YRNA 2PEXA 3FK7A 1WJBA 3F3XA 3ERMA 3JRHA 1AHDP 4L18B 2LTPA 3J80K 4QTRA 2LD5A 3EYYA 3LSIA 3OOUA 4IZZA 4C2TA 4IOAF 5M5XJ 3G2BA 3BR5A 2XGXA 1HOMA 3JRAA 3S17J 3OYBA 1O3RA 5DYMA 1O3QA 2Z5UA 1D8JA 1XCBA 2ZXHA 3CCEI 2LSOA 3HSFA 1LPQA 5FJ8J 1R71A 2LC2A 1TLHB 1V54H 1SAUA 3GZ6A 1VQLI 4HRIA 5H6RA 1PUEE 4PGHA 2V6CA 1ZR4A 4GXOA 4ZYAA 2DTZA 2VQLA 2VONA 2WAFA 2VJ5A 2Z9OA 4AVZA 3IKVA 3MZHA 3B6AA 5DUIA 3PNVA 2IW5A 5KNLA 3MKWB 1WHUA 2VN2A 5KAFC 1F36A 4CZZA 2NS8A 3EUAA 2XAJA 3A01A 1TQMA 3DCFA 2Y0MA 1UZCA 3OYIA 3FIWA 1V4RA 1Z9CA 1BI2A 1DGWY 3SEQA 2ZFWA 4L0ZB 1JUSA 3FK6A 1CGPA 1J5YA 5M3MJ 4NC8A 1BOAA 1LDJA 3EUKL 2NRAC 3AKZA 2M34A 2XB0X 2FOWA 4DYQA 5LGTA 3W6JB 3AL0C 1GDTA 2KDOA 4NB5A 1QPMA 2F4IA 3HB9A 3K70C 2E19A 1ITYA 2I5UA 2DCEA 2DK5A 2ECBA 4GGGA 4QSHA 1K83J 3ECHA 2L01A 1ENHA 1N25A 2JT1A 5EEAA 1H0MA 4LB5A 2I10A 1OFCX 2R7WA 4ZDOA 2FOKA 3HOWJ 1I6HJ 1ULYA 5KCMA 1A6QA 1R23A 2ESNA 2QQAA 5KAIC 4R8HA 4ESBA 4L9NA 1DU0A 1XSVA 2P4WA 2Y69H 2P81A 3K69A 4D7MA 2NS7A 3QPHA 2R7XA 5IT9Z 5FRNA 3AG4H 3U21A 2BVLA 1MNDA 5EGOA 2NVXJ 2M2EA 3RYPA 1UHWA 2M0CA 2O0YA 5CVJA 5TRDA 2E60A 4ESJA 2VC0A 1SFEA 3OYGA 2KZGA 2HYGD 4KIGA 4S05A 4Y33A 4PFPA 1ETKA 3PQKA 2QSGX 2VLAA 5IYDJ 1RKTA 4NBQA 1QNTA 3D5SC 3K2ZA 2CH0A 5FKNA 4OIQF 3F0CA 3HGYA 1HCRA 1OYWA 3L2RA 1N77A 2K3FA 3V42A 1SFKA 3CD6I 2ZBKA 2O8XA 4XN3A 3CCRI 2ELHA 5E1ZB 3A2KA 2XAUA 3S1RJ 3F8BA 3G1LA 4Q48A 3HOYJ 4HV5A 3PFYA 3VPRA 3TEDA 1UAAA 5C44J 4DGWB 3I71A 1FSEA 3CMAI 4OINF 2E1OA 2OZUA 5J4VA 3K70D 2XF6A 4IKFA 2D1VA 3GCMA 2KRFA 3FHZA 1FOXA 2CS3A 2EFPA 5M3FJ 5BS6A 1JXSA 1IXRC 5AONA 1K61A 2NOJB 2COBA 4LIVA 2CUEA 1P7IA 2LF7A 1RR8C 1RPWA 3K1PA 4HLXA 3IL2A 2W24A 3QOPA 1YFHA 2ZMEB 5J47A 3C7JA 4C3JJ 1A6IA 3QOEA 3OIQA 4KFCA 1N75A 4NC6A 5IY5H 4Q5SF 1J75A 3LSJA 4HDUA 4GCVA 4PCQA 1LE8B 2EWNA 3CF2A 2R7QA 3NEUA 2O9LA 1MJ9A 3TBIA 5EGOB 1ZRDA 3MWMA 4G94A 5IPAA 1RC9A 3L2UA 1DGRM 3FMQA 1BA5A 2BE5F 1WVRA 1T95A 3EDPA 2HQNA 2Z16A 4X1EA 2DQRA 4E70A 2VB6A 3QYBA 2EZKA 4LGWA 2DFEA 1S7OA 2VJ4A 3KP5A 3MAJA 2Z33A 3P9IA 1P9QC 3EUHA 3W2VA 3Q9SA 4N4OB 3M9AA 2EA2A 2KQRA 4S04A 3ONQA 3IHUA 2A07F 1FLIA 4M3FA 1FC3A 1KU9A 5HS9A 2NVQJ 3VEPA 3QRFF 3CLQA 4HX7A 4ON0A 2VUMJ 4IQ4A 1DP3A 2G7UA 3C2BA 3F8CA 4CCOA 3BLYA 3DPUA 2XAQA 1QBJA 3SZPA 1TQPA 4UY8I 4FE7A 1R5HA 3CC4I 1JTYA 3HTUA 2ID3A 1TWFJ 4BACA 2OV7A 1GXPA 3FMRA 3LSPA 4PJ0C 3X2QH 2FX0A 3WGHA 1FWZA 2BHYA 2HVQA 1YHQI 3CCLI 1Z3XA 3FXKA 1NG6A 2VKDA 3K4LA 4J00A 2ZKZA 1BBYA 2Y30A 4H4KC 1A35A 5F0FA 3H0DA 1XTAA 2JRMA 1Z6TA 1T56A 5FLVA 1HW1A 5GAEJ 3LSRA 3J81Z 4BE1A 2MH9A 1DPUA 1VZ0A 2CQ7A 3ZCOA 4RGSA 3WGGA 3PSFA 4RS8A 4UUVA 2FBHA 1OPCA 2V1NA 4BE0A 3I9V2 2WC2A 1OMIA 2CW0F 1WSUA 2HDCA 2W00A 4AWXB 3G3ZA 3K1MA 3HL2A 2HOTA 2MLGA 1D0XA 1TNSA 2V79A 2KFDA 2KLOA 2L4MA 4PZJA 3KETA 4JK1X 5E79C 2J5PA 1ON1A 2P6TA 5F64A 3K4BA 4EQQA 1IC8A 1CF7B 3CUQA 5FGMA 2CUJA 3ASOH 4M74A 5LEKA 3T1BA 5JVTA 1TP4A 2HTSA 2WY8Q 4H0EA 4MTDA 1XPXA 1YJWI 6PAXA 5FO5A 4CYCA 3GXOA 2BHZA 2E5NA 4N4NB 5ILSA 2XPVA 1OLTA 2E7WA 4EATA 2GWRA 3HXLA 1U9OA 2L3DA 2RC4A 4LLLA 3RKXA 1YW7A 3RPQA 2VPRA 5K7FA 4G6QA 1X1CA 2M7AA 4BYYA 4PUSA 4IO9F 2HVSA 1WQ2A 1Z0XA 3I3LA 5FLXK 1AKHA 5HDNA 3H3VK 4YG2F 3HBLA 2XIGA 3HDDA 3V8LA 3IH3A 3PQJA 4XRMA 3QPTA 2DA2A 5DV5A 3H9JA 3WTTC 5FKMA 3WODF 3MKLA 2HZTA 4D7NA 1S7AA 5L3DA 3FXLA 2IGKA 2BYVE 1ZG5A 3KZZA 5F08A 1J09A 2KT0A 3HKZN 1ZGJA 4JBAA 3J7AY 3BP8A 4BBRJ 1LFUP 2N8GA 4Z2YA 3MKZA 3BJAA 4E7JA 1VQKI 1IN4A 2P0WA 1O7LA 2QCOA 3CTAA 2FRHA 4B47A 3H0GJ 3BR0A 2K9SA 3DBLB 4F92B 3S93A 2ZSIB 1CF7A 1W1WE 1TT0A 4BJ5C 4OWRB 3HRTA 4F91B 3QPLA 2RGVA 3FBIB 1VQ4I 2GXAA 2H8WA 1R5GA 1VQNI 1G3WA 1W7PA 2CQXA 3GTMJ 1ETOA 1FYLA 2F48A 2HGCA 3D1NI 1JKRC 3TL4X 4D5CA 2O5RA 2BY0A 3W6VA 1ZLKA 4FCYA 3RTRA 4HOBA 1KQ0A 2VJJA 2B9SA 1FY7A 3GMEA 3S2DJ 1XD7A 4IRGA 1BIBA 3TGNA 1HXDA 2XRNA 3H5NA 4R79A 1TC3C 3WU0A 4KN4X 3HHHA 4W97A 4BHCA 5JI6A 2K27A 3SYTA 4CCMA 2XKPA 3BR1A 5J6XA 4XIDA 2V4JC 2HKOA 3RKYA 4I0AA 2M9HA 2LKSA 2H1KA 1J59A 4Y52J 3W2WA 1R1TA 2HQRA 3HRMA 2RAEA 3MKYB 3GFLA 1SMYF 1YS6A 3AG2H 2WBMA 3JTHA 2R7FA 5F04A 2JRTA 1T0FC 3W3CA 1PYVA 5HDKA 5LFAA 1R49A 1BW6A 1A5JA 3E5UA 4U0WA 1WKMA 1B9NA 1FOWA 3VYRB 2CQQA 3K0LA 4BEHA 2BY1A 2TDXA 3OS1A 4K2EA 1HQCA 4U0VA 1Z77A 1NHAA 3TO9A 4ZH4F 3S1MJ 3TP3A 5J4YA 3DU5A 2JQ7A 2JK3A 3ZMVA 3CMYA 3KZIC 5J1UA 4UB8C 2IXSA 3P9CA 2EFOA 3N4MA 1F5TA 4P1WA 5H6QA 1JJ8C 4QIWN 5J1YA 2O03A 4I6ZA 4OAYA 2XKOA 1REPC 3LSHA 2OCEA 3WTYC 2DPDA 1G3YA 1T98A 2D2WA 1TNTA 5IOZA 1TWAJ 1YE9A 1ZAOA 2L02A 3QWLA 2MH2A 3MZ8A 2BZTA 3ABLH 1M1EB 3DKYA 3ZQHA 2VKHA 3J81K 1D1AA 4HQEA 1H89C 1S9HA 3RPUA 4FE4A 1MSEC 2X85A 3FXQA 1MIJA 2DDBA 3ROUA 3FBNB 1EH6A 3IH4A 2KPMA 3SHFA 1UG0A 4XR6A 5HODA 4BHBA 1YIOA 3AAFA 5LD2C 3ZQQA 4D9JA 4KNYA 1Z1DA 4AIDA 2A05A 3GFJA 3HPHA 3G73A 4M3BA 3PO2J 3ZPLA 4JX5A 2DA4A 1BJZA 1MBGA 1A04A 1X1AA 3LAJA 1FBQA 2IA1A 4IOCF 3HUGB 3WE3A 2X1DA 3BG7A 2DA5A 3H3UA 1OCOH 4CZCA 5K5RA 1IV6A 3HOTA 4RGUA 2VE8A 3NAUA 1JHHA 1IN7A 5F1JA 2K86A 3DEEA 3R0AA 1ZARA 3G71I 2L9RA 2ELKA 2GA1A 2XSDC 3F8NA 3VWBA 4CXFA 1I39A 2K02A 4UVAA 4AIJA 4G7ZF 2OQGA 3VOEA 2LNBA 4LMYA 4FQGA 1QA6A 1EH7A 3N97A 2QENA 4EGYA 2R5ZA 2R7SA 2JUCA 2PFBA 2YUSA 5LGNA 1Q1VA 4A0YA 3OMYA 2EK5A 3TW6A 3JW4A 3H36A 2TRTA 3M3YJ 4U87A 2R7OA 3SFZA 2GZWA 5JLWA 2J5OA 4RM2A 4II2A 2XDVA 1B4AA 2C6YA 3U1KA 1BR1A 3H5AA 2ZXWH 2YSRA 1MNMC 1KU7A 4DZPA 1Y0NA 4II3A 4J19A 5M5YJ 5FD6A 2O3FA 3BG5A 1QRYA 1LDDA 1P7JA 2B63J 4FX4A 2EV5A 2DJNA 4M72A 3GLLA 1QZYA 4B09A 5LRSA 2JA7J 1F9NA 4YIFA 2Y9ZA 4Y4RA 2V1UA 2JTVA 2Y75A 2L4AA 3TW7A 5F1RA 1IW7F 2XASA 3FXJA 3HUGA 3CP8A 2ZJQF 2VODA 1YX5A 3JRDA 3B73A 4JP0A 2DBBA 1K4SA 3HRUA 1XGMA 1D0YA 2DOEA 4HAMA 1KYWA 3BR6A 4PJLA 1AU7A 2F6CA 3OYHA 4WX9A 3SZTA 3GTKJ 1W5SA 2KISA 1MMNA 4BHPA 1G3TA 4IHYA 3JSPA 1A31A 3Q3SA 4UVCA 3IRQA 3D5RC 4YFKF 2W85A 4IX7A 3HPGA 5DEQA 2QA4I 1U5TB 3OL4A 1UHMA 1JE8A 2F5VA 3SDBA 2VJIA 4ESFA 2L9VA 2MC4A 2ZMEA 2X6WA 2LKXA 1JKPC 1YOVB 2MABA 5FKOA 3WTSC 1ZRFA 1SD5A 2IT0A 5EEGA 2WV0A 3OYLA 2L7MP 3HRSA 1IRXA 1NG7A 3CJRB 5CVRA 3HG9A 1LE8A 2PJPA 2JN6A 2ZMEC 2TCTA 5L3CA 2V9VA 4A3IJ 1YW9A 1GXQA 4CCLA 1AKHB 3QU6A 1HW5A 2GAUA 3LL7A 3RI4A 1ZK8A 2AQFA 3CUQC 2COMA 5JR3A 1R4NB 5L3EA 5DCMA 5DM6F 4UHTA 4F93B 2RREA 2HWVA 1OCCH 5HS8A 1MJAA 3CO7C 2R7UA 1E17A 1JKOC 3DTKA 1SVLA 4CSWA 4FHTA 3HOXJ 4F52A 4XKBA 1EF4A 1B1BA 4DZJA 1R1UA 2QM3A 4MGRA 4XK4A 1U9NA 1S3JA 3IAS2 4AVPA 2FQ4A 3VDXA 2XPWA 2ID6A 1F43A 3VYUB 3G1OA 1HBXG 2LFBA 2OZ6A 2K3PA 4G7HF 2EA4A 2CW7A 4UV8A 1BC8C 2PX9A 3MCZA 3U2RA 5A2QK 2OUMA 3C2HA 2QQBA 3Q0VA 2WTEA 3BTIA 1I1GA 4XBFA 4LD5A 1G6NA 3CMEI 4NHJA 2Y0SN 4V2FA 2DYRH 3DKWA 3EYIA 2L5QA 4BJ6C 2IBDA 4XKWA 2DODA 1SFOJ 1IV8A 2B7EA 5CJ9A 2QBYB 3ZMUA 3HSEA 4QWQA 1TW3A 1E3OC 4X6AJ 2D1HA 2AQEA 2QWWA 3IWZA 4A6DA 1WI3A 1RKWA 2MW8A 4CICA 1ZN2A 2QQ8A 3M1EA 2R7VA 2V26A 3LA7A 3D0SA 4RAGA 2IJLA 1NH3A 3RIRA 2ME0A 1FIAA 3RZDJ 2M8EA 2K85A 4WXHA 1S29A 2BY3A 4BKXA 3E97A 3I4PA 3L7WA 1VQOI 1H9TA 4A3MJ 3V8KA 4BAYA 3DTEA 1SFUA 4M73A 3QU3A 1U0JA 4DOZA 3KLNA 1MKMA 2ECCA 3DV8A 3AG3H 4CYCB 1ETXA 2HS5A 3ZQ7A 5GPCA 2EV0A 3H9QA 4XSZF 4E6KG 3HZJA 2V7FA 3WE2A 2DPUA 5J40A 2WB1N 3R4KA 1EKEA 3F23A 3ZGKA 2DFFA 3CLOA 4BU2A 3GTOJ 3TDZC 4J01A 2W82A 3NRVA 4PK4A 2LY9A 2FQ3A 2IS6A 1RUNA 2NAZA 1DDNA 2KRHA 1POGA 1MBHA 1IXCA 4FETA 3V7CA 5TJJA 4HNTA 3KYCB 2JA6J 2MLKA 4MQVA 5IOYA 1IUFA 4DYRA 4M3DA 1FJLA 5DUKA 1WCMJ 1YG2A 3AL0B 2QZ8A 4C30A 4G12A 1R4MB 1PVEA 4OIPF 2PG4A 3IC7A 4MEXF 3WTZA 1XDUA 2OBPA 2KL4A 3S1NJ 3L00A 3HTSB 4P9UA 1MMSA 4HPQA 3ZN0A 3OIOA 1B72A 3OYNA 4LK0F 4RMNA 4KUMA 5LHIA 1BW5A 2PMZA 4UUSB 2OTJI 1WGXA 4WXCA 1X58A 4ZC3A 4PJMA 4LG0A 3V4GA 1W36C 1MSFC 3OV8A 4E7SA 1AA7A 2ME6A 1RR7A 1IRZA 2MG4A 3O3KA 1FOKA 1I27A 2EV6A 2MSYA 5B3SH 4UV9A 1BI0A 5HVQC 2FSWA 5EYRA 4I09A 1AWCA 4HW0A 1VQ6I 5E3NA 2P7VB 1RUOA 1VQPI 2H8RA 3J80Z 2KIUA 2GM4A 1SMTA 1QO0D 2F5FA 1MJBA 2EB7A 3FDYA 3ABTA 1HDPA 3KX2A 3K4NA 4QPQA 3AFHA 1YX3A 2FMLA 5D5WB 2HOSA 2NVUB 2LR8A 4DYCA 5FFXA 2AXLA 1BIAA 1EJ9A 2H6BA 3CP2A 3S14J 1O3TA 2VQCA 2NYXA 2UUZA 4Y15A 2VBXA 3LSGA 1T38A 1HKSA 2LY1A 1GVJA 3A1YA 3TO6A 4IRIA 3ZR8X 4KITB 2JZYA 1JGGA 2IS4A 2LKPA 1WH5A 4M6XA 4A6EA 2KKOA 5J1RA 3QODA 4NNJA 1CQTA 2LH9A 4CUGA 1Y8RB 2FBIA 3E6DA 1I5ZA 3R0JA 2DLLA 1LVKA 2VBZA 4IPAA 3ZRGA 4IHWA 1XC5A 2CQNA 5F27A 2A69F 2HKXA 1IUYA 1QVUA 1X1DA 2LRDA 4L5JA 2LBFB 3T8TA 1D1BA 3T8RA 3KEOA 4HV6A 1KGSA 3OYJA 2QEXI 5HLHA 3VSKA 5K7HA 1Y56A 3QPSA 4N9HA 1B72B 3QP6A 2E1NA 2AO9A 3I4NJ 5DTDA 2HVRA 4NQWB 4AYBN 5ERIA 3VB2A 3R61A 2WB1A 4A0ZA 1F4KA 2CV1A 3PNYA 2VOOA 4NDLA 1IXSB 3H3ZA 4AYBA 1BJAA 3HC7A 1U5TC 3E6CC 3FXOA 2PLYA 4E7KA 3O8GA 4B8XA 2PI0A 3VYSB 1ZH5A 4G9YA 2EZHA 1MZBA 3WG7H 4JX4A 3I55I 1X2NA 3KEQA 2V1DA 3PIPF 1MGTA 5JHUA 3P7NA 1VQ9I 4CDGA 2FEZA 1J2XA 5E1WA 1KONA 5EDNA 4BE2A 2RDPA 3BTJA 3OR2C 3V8JA 1D1CA 4A5NA 2K7LA 2R3SA 5L3GA 3ZQCA 4A3BJ 1VNDA 2OTLI 2CV2A 4JOMA 1JJ6C 2DT5A 2RNGA 4E4HA 3WU2C 2HYFA 2KIFA 4M6VA 1W5CC 4ZZDA 4HLYA 3RQ4A 5DCMB 1X3WB 1D5VA 2CFOA 4P55A 2WWYA 2XHKA 4YFNF 4B3AA 4UVBA 5DD8A 2Q1ZB 3M1CA 3CCVI 4BDYA 1ORKA 2QQ9A 3F8MA 2M45A 1HW2A 2G9WA 1OCTC 1Y0UA 2DW4A 2XV4S 2LMDA 4A3EJ 1YTYA 3KZYA 1YJ9I 3ELKA 2K9NA 2LLKA 3BZ6A 1ODDA 1BM9A 4GDFA 3N05A 4CA0A 2M87A 5LGUA 2R7ZJ 3BR2A 3OSGA 4EJTA 5BPDA 2BOLA 4RM3A 4MQ9F 5GAHJ 4BY7J 1Z67A 2F5EA 2HNHA 5EJCA 3VYTB 4RLQA 2KIMA 3RKWA 4A3DJ 1S6LA 1VI0A 4CCKA 3I5UA 4MIMA 4MEYF 1TTYA 1T39A 3A4CA 2M8GX 3GWZA 2WAQN 4EJWA 1KQ9A 3F21A 2STWA 2MA3A 2O7OA 2WAQA 5CYVA 3T0YA 1G8XA 1KYZA 3DPTA 2HPIA 4KICA 4XN0A 3TP0A 2AS5F 1WJAA 1OCRH 2VQGA 1VQ7I 1D0ZA 1RETA 4RLFA 1ZGAA 1QHHD 2R7DA 3JRGA 2IA0A 2R5YA 1SVOA 2K9QA 1X3ZB 2K4BA 5HLIA 3PIOF 5E8GA 2HYJA 2DMPA 1NK3P 3ERED 3U9GA 2XROA 3GUDA 3SEZA 1XGOA 1OQYA 2DA1A 2JA2A 2L2OA 5KVRA 2B0LA 1HSJA 1WJFA 2Y2ZA 2M7BA 2XGDA 2UV1A 3G4SI 2LG4A 5HLGA 4P9FA 2P7CB 4E7IA 1IDZA 2GOXB 2BY2A 2BV6A 1P4AA 2LP0A 3DF8A 1XSDA 2STTA 1EV7A 2OU2A 5HOOA 2F4MB 1MW7A 2PMUA 2Z99A 4HEA2 5E20A 3WTWC 1USTA 3RCOA 4Y13A 2E1MC 3PFIA 4N0BA 3LFUA 2ACJA 4IHSA 4JYKA 2H09A 1WWXA 5ICEA 2XGEA 3BJ6A 1R5ID 4M3GA 4FASD 2G7HA 3K6GA 4ZYEA 5ILUA 3M7GA 1FYKA 1IN8A 2F5CA 2DOFA 4GO1A 4XLAA 2X51A 4KMUX 2QKMB 3RDIA 1JI8A 1LFPA 3KP4A 1HSTA 5LBQA 4ABZA 2K9LA 1PJRA 1ZG3A 2FXAA 2PJRB 5EZGA 1GV2A 1T33A 2EJRA 1FX7A 2VL8A 3F6VA 1HDDC 3TDUC 4BGDA 2XRLA 2JUGA 4PGGA 1GT0C 5A2QZ 1KU3A 5HNFA 2XSJC 1YIJI 3DEWA 4L0YB 2WV1A 4ZTJA 1MBEA 4XMYA 5EEHA 1G3SA 1XMKA 3DBHB 2BVMA 3JRIA 4AC0A 4RGXA 1Z3YA 1FIPA 1R6RA 3K4JA 1OKRA 4CYDA 1JHFA 2W1OA 1T08B 2LBFA 3K4CA 1UG2A 3OIPA 5C3EJ 3S3OA 1FMWA 2L7FP 3C1DA 1DP7P 1NK2P 4AUXA 2XUBA 2NNNA 4FISA 3VSLA 2HTJA 2A3SA 5IP9J 1P6RA 4XRSG 2RV8A 2Z1DA 1XDSA 1PUFA 1RNLA 2CO5A 1SANA 2BEOA 2DI3A 3DTIA 3I58A 3O6BB 3FXUA 5FLMJ 4U7DA 5F0CA 3HOSA 2MGQA 1FYMA 4GFBA 4AU7A 4X0GA 1B8IA 1X1PA 4B43A 1YI2I 2DT7B 5GTHC 1SD7A 2DMQA 4BBSJ 1V55H 3MEXA 2M4GA 2M5WA 3GFIA 5BNGA 3L2CA 3ZQIA 2VBYA 5E8IA 2X9DA 3DWLE 5B66C 3L2WA 2CU7A 1OJLA 3GTJJ 2A6TA 1WJDA 3HJEA 4D1QA 4O3MA 2A5WA 4C3HJ 2O6GE 4HSRA 2DOAA 2E36A 2A6EF 3TQNA 1Y1WJ 2WAEA 1IAWA 2CSOA 1DU6A 1U78A 3L1PA 4XL9A 4Y17A 1U5TA 3CQZJ 5IT3A 4D0PA 1X19A 2XVCA 3FX3A 3P5JA 4BUPA 4HBLA 3DQVC 4CCNA 5H20A 4FX0A 4XOPA 3GZ5A 2XB5A 4GYIA 3GBGA 4KIFA 4M3EA 3OS2A 1K79A 1W4MA 1ZR2A 3HOVJ 1V5GA 1S7EA 4LOCA 3ZMTA 4Y7NJ 3PO3J 4F7ZA 3RKQA 2JVGA 4HYEA 3LAPA 5K5OA 3WTXC 2HFHA 4EEFG 4W1UA 3J7YJ 4LJZF 4BY1J 2A5YB 4QPOA 3FXRA 3MVPA 2ZXJA 1VF9A 5EG0B 2VIXA 3SZGA 3CCQI 1GHCA 4XONA 1WFXA 5HS7A 1ZHFA 3ABKH 5GADJ 2VT2A 1USSA 2ZSHB 3CUQB 3IH2A 3LSTA 4ZJZA 4ZYGA 1BR2A 1ZRCA 3EQLF 3HYIA 1B8IB 1Z91A 4KN7X 2DN0A 3A0HC 3RJPA 5JVGF 2E35A 3LQQA 3KP2A 4O5VA 3B02A 3R60A 2GXBA 2XPUA 2MD5A 4LITA 3SDGA 4RB3C 2NNYA 1P2FA 4CHUA 2IP2A 3CF5F 2XF5A 3DXJF 3GW2A 4BL0B 4ZTFA 1JKQC 3K2AA 4XRFA 5CQEA 1PDNC 3CDIA 1APLC 4HA8A 4A3CJ 1IO2A 1IDYA 3ZQFA 3DLAA 5LHGA 3HHGA 3S16J 1O3SA 1RESA 2RQPA 3MQ0A 4MFDA 4A12A 1UB9A 2R5ZB 4HX8A 2VC1A 4GYGA 1JUPA 1QZEA 5JHFA 2M3AA 1R00A 3BROA 1IN5A 4FT8A 2IAIA 1SFXA 3PM1A 1Z05A 2L54A 4M9XA 3JAMZ 2KHMA 4EM2A 1AOYA 1OYIA 5IT9K 3BTCA 2OF7A 5B5EC 4IEJA 3ISPA 4ZDPA 4XSXF 4BXFA 3ZMDA 5C4XJ 3KP6A 3T5XA 1FMVA 1OCPA 2HPMA 1P4WA 4I99C 4E7LA 2PMHA 4XLNF 2O8KA 2UWMA 1ETYA 3MZYA 1GLNA 4S0HB 4YIIA 4AIHA 1Q1HA 2W48A 4M71A 1TL8A 1LEAA 1X4OA 3DLLF 5TISC 3HGGA 2L9NA 4XKVA 4GRIA 3C3WA 3CDHA 1QGPA 2Y0SA 3KP7A 4OU0A 2QSFX 3OL3A 3IKTA 1FBUA 5FFZA 3TMOA 4EJUA 1UELB 1K7AA 4RGRA 3IP4B 3ZMZA 2CWEA 3UR3C 4IF4A 4ANJA 5C4JJ 3TOAA 3PUBA 2R0QC 1HKQA 1QHGA 5D6FA 2E2JJ 4U0YA 3FZVA 3Q9VA 2XAHA 1N78A 5CQGA 3OOPA 2H6CA 3L9FA 1YJNI 1SD6A 2JVHA 1UJ8A 5L3FA 4I02A 1LJ9A 2IGOA 4PJJA 2NS0A 4EM0B 1Z7UA 1SC7A 3K4KA 2L7KA 1S5LC 4G8XA 4XNFA 1H9GA 3H35A 1A36A 2GA2A 3F22A 3BJOA 2R5YB 2ZNZA 3IV5A 1IN6A 3U1DA 4A3FJ 3HOZJ 3BY6A 3DP7A 3PSIA 4LG3A 4V2GA 2MYSA 1Y1VJ 2IS2A 2QYOA 2W4SA 3DBRB 2QLZA 2EILH 3S32A 4BQAA 4NUBA 2Q8KA 5F0HA 5DS9A 3QYEA 4M9SA 2K5CA 3S2HJ 2VBWA 4I98B 2D45A 5CVIA 1W5TA 5EG0A 5JFRA 3FM5A 4XORA 5HLTA 1IZ1A 2HXIA 2QVOA 4NQWA 1ZELA 4XLHA 2NXNB 2ZJ2A 3PUFA 1IGNA 1TWHJ 2V6EA 3I59A 2W57A 2CRGA 3FHNA 4KJZA 5K7ZA 2W84A 4I76A 2PJRA 4HF1A 1RZ4A 4XQFA 5D5UB 1IRFA 3B6CA 4XLFA 1QQIA 2KP6A 4RAZA 2A6HF 4P96A 2FA5A 3QYFA 4EJOA 2ZCWA 2F5DA 1ETQA 2DFHA 5FKKA 2Z2SB 1Y8QB 2V9KA 3GYHX 1LQ1A 1ONVA 5D5VB 2RNJA 2BXZA 2P5LC 3GO5A 4BH9A 3Q0WA 4BXUA 3M07A 3EUHC 4RBOA 2O61A 2R92J 4UNOA 1KA8A 2PMZN 3M8JA 3I56I 2ZJRF 4EGZA 2OD5A 2EFWA 2X1CA 5LLQA 3EETA 1GVDA 4IRHA 1PUFB 2FD5A 2M0MA 1EA3A 2D5VA 2HZDA 4EV0A 4OIRF 1IRGA 2BXYA 4BNCA 1ON2A 5K1YA 4EMSA 3S2WA 3H5RA 4Z6YA 2IPQX 3WHBA 2VKVA 2HDWA 4IL6C 3M8EA 5ICGA 5K5QA 3K4MA 2GQQA 4FTHA 1ZQ3P 2HEOA 5LHHA 2R93J 1R7JA 1H88C 2DMTA 2LK2A 4LFUA 2L0KA 1EH8A 1LB2A 2DJIA 2VKEA 3LFKA 2R7RA 2AXTC 1SVMA 1MDMA 3WGIA 3WU1B 2QUFA 2MBFA 1GUUA 1XMAA 4XRSA 1HKTA 3CJQB 4OIOF 1OR7A 1WJ5A 4I01A 4KISA 3JTGA 1V5FA 5BOXA 3W6KB 2CUFA 3TOBA 2DTRA 2DFIA 1BR4A 4IJAA 3E5QA 3M4OJ 1YS7A 3NQOA 2JSPA 3REOA 1TWGJ 1FSHA 3LSMA 2KZVA 5D4SA 4MNUA 4IXAA 2GLOA 1E3PA 5J8CA 1UMQA 3LA2A 1MBJA 2WA0A 4A3JJ 1D5YA 2X6XA 4YFXF 5BMZA 3MD2A 3K1NA 1VQMI 1MBFA 3O2PE 5E18F 1U6GA 2F2EA 4L9TA 4F3QA 2CV0A 2FBKA 3HOUJ 2LYCA 1DQUA 1NTCA 2MFZA 1LUJB 3F72A 1V3FA 3V7SA 1TW2A 2GXGA 2H94A 2RQQA 3SFIA 3QQAA 4IQJA 3NWSA 1W0TA 3TKYA 4KYWA 5IP6A 4HF2A 1UFMA 4AIKA 3C2GA 1K78A 3IWFA 2E71A 2UZKA 1F1ZA 1IF1A 1MMAA 4LLGF 3CJNA 4NC7A 3OYMA 1TQIA 5DD4A 1L0OC 3MN2A 5IYBJ 4BQQA 3OS0A 3LNQA 4OAZA 3KFWX 2HOAA 1P4XA 2WADA 2IEKA 1DUXC 2QSHX 2LREA 1MH4A 4IHTA 4BDZA 3CDLA 3I53A 2PN6A 2JPBA 4RDUA 3ZMSA 1MH3A 1MBKA 2JJ7A 3H9GA 2E1MB 4XLPF 1XN7A 2JA8J 4HG2A 1W0UA 3EPZA 4MTEA 3FWEA 2LOOA 3HM5A 2RN7A 4WXDA 3OYAA 2CYYA 2ZO4A 4BQOA 2DT6A 2ADUA 3I64A 5HNHA 4WWCA 4B1RA 1XSXA 4PFOA 2P5VA 1UCRA 5KHDA 3S1QJ 5BQTA 1E3HA 1T8IA 2FUG2 3BCAA 5BPIA 1WRJA 4ENKA 1IG7A 5ICFA 1VFCA 1XX5A 1SEUA 2K4JA 1K78B 3BPVA 3IUOA 3BT9A 5ED4A 2CMPA 4N9IA 4YELA 4PSXA 3GZNB 4AD9A 5HDGA 3HKZA 3L2QA 2G0EA 4CO8A 1VQ5I 4A3KJ 3CCSI 1RRJA 1J7KA 1FTTA 5GAGJ 3JR9A 3I59B 1C0WA 5IYCJ 1BI3A 4IVNA 4LK1F 1I1SA 3LMMA 2FU4A 3MFKA 4B3XA
chains in the Genus database with same CATH topology
5AIQA 1T2KA 2CGPA 4WK8F 4EJVA 4EVIA 1LVAA 4WF2A 1R1VA 2ESHA 1MDMB 2GIVA 2YR2A 1YQAA 3VODA 4G7OF 2DK8A 2PQ8A 4MHGA 3WTUC 3ECOA 4HZFA 3IRRA 5D5XB 1PP8F 4Q4ZF 1PP7U 3H92A 2KJCA 2VXZA 1B9MA 5LEJA 2M1BA 3V7RA 1U2WA 2MC3A 2QBYA 5D8KB 3R6SA 1LDKB 3GFMA 1J0RA 4DQ2A 5CLSA 4G6DA 5E17F 3DFGA 4ENJA 2LF8A 1SAXA 3JSOA 2BBYA 2VOPA 1STZA 1QZZA 2CG4A 5E1XA 1W7PD 5ILVA 1D3YA 2FNPA 3GF2A 3E6BA 2PBIA 1SD4A 1RIOH 3GEZA 5D6EA 4DNCA 4KA4A 2Q2EA 5DDGA 1FT9A 1P92A 2OQRA 2VE9A 1WI9A 3I54A 1W7PB 4U7BA 3E5XA 2JPCA 3QP5A 4LLNA 1O7FA 5D8LB 3M8FA 2UXNA 3K9TA 3GX4X 2DAOA 1ZG1A 4KDPA 1S8NA 4M6YA 1TBXA 3ML6A 3LA3A 4ENMA 1XCVA 4HDVA 3Q5FA 1YW8A 4L9JA 1XGNA 2FE3A 4L9VA 1FP2A 2DQLA 3C18A 1FNNA 4OMZA 5LRRA 1MD0A 3J7AO 3E6MA 1G4DA 2X0LA 4KT5C 4RAYA 3HSRA 4ZYHA 1B59A 2XAFA 2W25A 3TO7A 3SXYA 4QLCU 4KIBA 3F6OA 3BDDA 2VT3A 1E2XA 1Z6RA 2ETHA 1I6XA 5CVUA 3WG9A 3ULQB 2YX7A 5L3BA 1BN5A 2BGCA 4I7HA 4WCGA 5CVVA 1YYVA 2Q0OA 2H27A 4ENNA 2Y48A 3E3VA 1ZLJA 1XGSA 1RI7A 3JAMK 2XAGA 1BI1A 4LB6B 4KMFA 2RKHA 3FMSA 3KE2A 4I0BA 4UXNA 5ICCA 1T0FA 2CFXA 4P5OA 4L5IA 3HIFA 4Q47A 2Z3YA 2IVMA 4RB2C 5FB2A 3VFZA 3KLOA 3WTVC 3I0TA 1K6OA 1FZPB 2A61A 4ZZLA 4ETSA 1FP1D 4OOIA 4ZYDA 3COAC 4CGZA 1ZYRF 4JQFA 4TV7A 4M9ZA 1R22A 2EFNA 4PDKA 1FPQA 2IA2A 1YO5C 2IRFG 3CUOA 4HF0A 4RB0A 1R58A 2LDUA 1U8RA 5F6FA 2X4HA 1U3EM 2OAZA 2JSCA 1YLFA 2FMYA 4I2OA 2P8TA 3F8FA 5FD5A 2CQKA 5DCFA 2UXXA 2E1CA 4R1HA 2M30A 5KK1A 5J8FA 1J9IA 1OYYA 2E7XA 2YPRA 1KU2A 2DO7A 1B6AA 2DU9A 3ABUA 4OMYA 2ZNYA 2P6SA 3ZP5A 2ISZA 1XB4A 3LWFA 4HX4A 1LEBA 2HOEA 3LQRA 5AIPA 2RVCA 4U88A 2ISYA 4RB1A 3GVAA 3CO6C 2YX4A 2KJBA 1D8KA 1KQ8A 2EFQA 4A5MA 4A2UA 4ASNA 4EM1A 2FF4A 5FLXZ 3ZN1A 2YU3A 1VTNC 4O6JA 2OA4A 3GLXA 4A0XA 3KP3A 3D5LA 3L09A 1DPRA 3QAHA 1O57A 2A68F 3DPLC 1L3LA 3SQNA 2HR3A 3FF5A 2V1XA 4HQMA 5D4RA 1T6SA 3RYRA 1LNWA 3BOQA 3DEUA 1R36A 1X3UA 3BWGA 3FM3A 3KCCA 3P9KA 1ZREA 3BPXA 1FBSA 2P5KA 2FNAA 4LG0B 1JGSA 2PEXA 3F3XA 4L18B 3J80K 3EYYA 2XGXA 1O3RA 5DYMA 1O3QA 2Z5UA 1D8JA 1XCBA 2LSOA 3HSFA 1TLHB 3GZ6A 5H6RA 1PUEE 4PGHA 2V6CA 4GXOA 2VONA 2Z9OA 3IKVA 3MZHA 5DUIA 2IW5A 2VN2A 4CZZA 2XAJA 1TQMA 2Y0MA 1V4RA 1Z9CA 1BI2A 2ZFWA 4L0ZB 1CGPA 1J5YA 1BOAA 1LDJA 2NRAC 5LGTA 3W6JB 4NB5A 1QPMA 2DK5A 4GGGA 3ECHA 2L01A 1H0MA 2JT1A 4LB5A 2FOKA 1ULYA 1R23A 2ESNA 2QQAA 4R8HA 4ESBA 4L9NA 1XSVA 2P4WA 3K69A 3QPHA 5IT9Z 3RYPA 1UHWA 2O0YA 5CVJA 5TRDA 4ESJA 2VC0A 1SFEA 2HYGD 4KIGA 4S05A 3PQKA 1QNTA 3K2ZA 4OIQF 1OYWA 2ZBKA 2O8XA 2ELHA 5E1ZB 3F8BA 4Q48A 4HV5A 3I71A 1FSEA 4OINF 2OZUA 2D1VA 2KRFA 3FHZA 2EFPA 1JXSA 5BS6A 1IXRC 5AONA 2LF7A 3K1PA 4HLXA 3IL2A 2W24A 3QOPA 1YFHA 2ZMEB 3C7JA 4KFCA 4Q5SF 1J75A 4HDUA 4GCVA 4PCQA 2EWNA 3NEUA 1MJ9A 1ZRDA 3MWMA 4G94A 3FMQA 2BE5F 3EDPA 2HQNA 4E70A 2DQRA 4LGWA 1S7OA 3KP5A 3MAJA 2Z33A 3P9IA 3EUHA 3Q9SA 3M9AA 2EA2A 4S04A 3IHUA 2A07F 1FLIA 1FC3A 1KU9A 5HS9A 3VEPA 3QRFF 4HX7A 4ON0A 2G7UA 3F8CA 2XAQA 1QBJA 3SZPA 1TQPA 1R5HA 3HTUA 1GXPA 3FMRA 3WGHA 1FWZA 2ZKZA 1BBYA 1Z6TA 1HW1A 3J81Z 2MH9A 1DPUA 4RGSA 3WGGA 4RS8A 4UUVA 2FBHA 1OPCA 2WC2A 1OMIA 2CW0F 2HDCA 1WSUA 4AWXB 3G3ZA 3K1MA 2MLGA 1TNSA 2V79A 2L4MA 4PZJA 3KETA 4JK1X 2J5PA 1ON1A 2P6TA 5F64A 4EQQA 1CF7B 3CUQA 5FGMA 5LEKA 4M74A 3T1BA 5JVTA 2HTSA 4H0EA 4MTDA 6PAXA 5FO5A 3GXOA 5ILSA 2E7WA 2GWRA 2L3DA 2RC4A 4LLLA 3RKXA 1YW7A 3RPQA 4G6QA 4BYYA 1WQ2A 5FLXK 5HDNA 4YG2F 2XIGA 3V8LA 3PQJA 3QPTA 5DV5A 3WTTC 3WODF 2HZTA 1S7AA 5L3DA 2BYVE 1ZG5A 3KZZA 1ZGJA 4JBAA 3BP8A 4Z2YA 3BJAA 1IN4A 1O7LA 3CTAA 2FRHA 1CF7A 3HRTA 2RGVA 1R5GA 1G3WA 1W7PA 1FYLA 2HGCA 1ZLKA 3RTRA 4HOBA 1KQ0A 1FY7A 1XD7A 4IRGA 1BIBA 3TGNA 1HXDA 2XRNA 4R79A 3WU0A 4KN4X 3HHHA 4BHCA 5JI6A 2K27A 2XKPA 5J6XA 2HKOA 3RKYA 4I0AA 1J59A 1R1TA 2HQRA 3HRMA 3GFLA 1SMYF 1YS6A 3JTHA 2R7FA 2JRTA 5HDKA 3E5UA 4U0WA 1WKMA 1B9NA 3K0LA 2TDXA 4K2EA 1HQCA 4U0VA 1NHAA 3TO9A 4ZH4F 3ZMVA 1F5TA 3N4MA 3P9CA 2EFOA 5H6QA 2O03A 2XKOA 1REPC 3WTYC 2DPDA 1G3YA 1T98A 2D2WA 1TNTA 1ZAOA 2L02A 2MH2A 3J81K 4HQEA 3RPUA 3FXQA 3ROUA 1EH6A 3SHFA 4BHBA 1YIOA 3AAFA 4KNYA 1Z1DA 3GFJA 3G73A 3ZPLA 1A04A 3LAJA 1FBQA 2IA1A 3WE3A 3H3UA 5K5RA 3HOTA 4RGUA 2VE8A 1JHHA 1IN7A 2K86A 3R0AA 1ZARA 2GA1A 3F8NA 4CXFA 2K02A 4UVAA 4AIJA 4G7ZF 2OQGA 3VOEA 2LNBA 4LMYA 1EH7A 3N97A 2QENA 4EGYA 2PFBA 5LGNA 4A0YA 2EK5A 3JW4A 3SFZA 2GZWA 2J5OA 1B4AA 2C6YA 2YSRA 1KU7A 5FD6A 2O3FA 1LDDA 4FX4A 2EV5A 4M72A 1QZYA 4B09A 5LRSA 1F9NA 4YIFA 2V1UA 2JTVA 2Y75A 2L4AA 5F1RA 1IW7F 2XASA 3HUGA 2VODA 3B73A 2DBBA 3HRUA 1XGMA 4HAMA 1KYWA 4WX9A 3SZTA 1W5SA 4BHPA 1G3TA 3JSPA 4UVCA 3IRQA 4YFKF 2W85A 5DEQA 1U5TB 1UHMA 1JE8A 4ESFA 2ZMEA 3WTSC 1ZRFA 1SD5A 2IT0A 5EEGA 2WV0A 3HRSA 5CVRA 2PJPA 5L3CA 2V9VA 1YW9A 1GXQA 3QU6A 2GAUA 1HW5A 3RI4A 3CUQC 2COMA 5JR3A 5L3EA 5DCMA 4UHTA 2HWVA 5HS8A 1MJAA 3CO7C 1E17A 4FHTA 1B1BA 1R1UA 2QM3A 4MGRA 1S3JA 4AVPA 1HBXG 2OZ6A 4G7HF 2EA4A 4UV8A 1BC8C 3MCZA 3U2RA 5A2QK 2QQBA 2WTEA 1I1GA 4XBFA 4LD5A 1G6NA 4NHJA 3DKWA 3EYIA 5CJ9A 2QBYB 3ZMUA 3HSEA 4QWQA 1TW3A 2D1HA 2QWWA 3IWZA 4A6DA 4CICA 1ZN2A 3M1EA 3LA7A 3D0SA 2IJLA 3RIRA 2M8EA 4WXHA 1S29A 3E97A 3I4PA 3L7WA 1H9TA 3V8KA 4BAYA 1SFUA 4M73A 3QU3A 3KLNA 1MKMA 3DV8A 2HS5A 3ZQ7A 2EV0A 4XSZF 3WE2A 2DPUA 3R4KA 3F23A 3CLOA 3TDZC 3NRVA 2FQ3A 1RUNA 2NAZA 1DDNA 1IXCA 3V7CA 5TJJA 2MLKA 4MQVA 5DUKA 1YG2A 2QZ8A 4OIPF 2PG4A 3IC7A 4MEXF 3WTZA 1XDUA 2OBPA 3L00A 3HTSB 4P9UA 3ZN0A 4LK0F 4KUMA 5LHIA 3V4GA 4WXCA 4LG0A 3OV8A 3O3KA 1FOKA 1I27A 2EV6A 4UV9A 1BI0A 5HVQC 2FSWA 1AWCA 4I09A 4HW0A 2P7VB 1RUOA 3J80Z 2KIUA 1SMTA 1QO0D 2F5FA 1MJBA 2EB7A 3ABTA 2FMLA 5D5WB 5FFXA 2AXLA 1BIAA 2H6BA 1O3TA 2NYXA 1T38A 4Y15A 2VBXA 1HKSA 1GVJA 3TO6A 4IRIA 2JZYA 2LKPA 4M6XA 4A6EA 2KKOA 2FBIA 3E6DA 1I5ZA 3R0JA 2DLLA 2VBZA 4IPAA 2A69F 2HKXA 1IUYA 4L5JA 3T8TA 3T8RA 3KEOA 4HV6A 1KGSA 5HLHA 4N9HA 3QP6A 2E1NA 5ERIA 3VB2A 3R61A 4A0ZA 1F4KA 2VOOA 1IXSB 3H3ZA 1BJAA 1U5TC 3E6CC 2PLYA 4B8XA 2PI0A 1ZH5A 4G9YA 1MZBA 3KEQA 2V1DA 1MGTA 5JHUA 3P7NA 4CDGA 2FEZA 1J2XA 5E1WA 2RDPA 3V8JA 4A5NA 2K7LA 2R3SA 5L3GA 2DT5A 2HYFA 2KIFA 4ZZDA 4HLYA 5DCMB 1D5VA 4P55A 2WWYA 2XHKA 4YFNF 4UVBA 5DD8A 2QQ9A 3F8MA 2M45A 1HW2A 2G9WA 1Y0UA 2DW4A 2XV4S 1YTYA 3KZYA 3ELKA 3BZ6A 1ODDA 1BM9A 2M87A 5LGUA 4EJTA 5BPDA 4MQ9F 2F5EA 2KIMA 3RKWA 1S6LA 3I5UA 4MEYF 1TTYA 1T39A 3GWZA 4EJWA 1KQ9A 3F21A 2STWA 2MA3A 5CYVA 3T0YA 1KYZA 3DPTA 4KICA 2AS5F 1ZGAA 2R7DA 2IA0A 2K4BA 5HLIA 5E8GA 3ERED 3U9GA 2XROA 3GUDA 1XGOA 5KVRA 2B0LA 1HSJA 5HLGA 4P9FA 2P7CB 2BV6A 1P4AA 3DF8A 1XSDA 2STTA 1EV7A 2OU2A 5HOOA 2PMUA 2Z99A 5E20A 3WTWC 1USTA 4Y13A 3PFIA 4N0BA 2ACJA 4IHSA 2H09A 1WWXA 5ICEA 3BJ6A 4ZYEA 5ILUA 2G7HA 3M7GA 1FYKA 1IN8A 2F5CA 4GO1A 4KMUX 3RDIA 3KP4A 1HSTA 5LBQA 1ZG3A 2FXAA 2EJRA 1FX7A 3F6VA 3TDUC 4PGGA 5A2QZ 1KU3A 4L0YB 5EEHA 1G3SA 1XMKA 4RGXA 1OKRA 4CYDA 1JHFA 1DP7P 3C1DA 2XUBA 2NNNA 2HTJA 2A3SA 1P6RA 2RV8A 1XDSA 1RNLA 2CO5A 3I58A 2BEOA 2DI3A 4U7DA 3O6BB 3FXUA 3HOSA 1FYMA 1SD7A 3MEXA 2M5WA 3GFIA 3L2CA 2VBYA 5E8IA 4O3MA 2O6GE 2A6EF 3TQNA 1IAWA 2CSOA 1U78A 4Y17A 1U5TA 5IT3A 4D0PA 2XVCA 3FX3A 4HBLA 3DQVC 5H20A 4FX0A 3GZ5A 4GYIA 4KIFA 1K79A 1W4MA 3ZMTA 4F7ZA 4HYEA 3LAPA 5K5OA 3WTXC 2HFHA 4LJZF 2A5YB 3FXRA 2ZXJA 1GHCA 5HS7A 1ZHFA 2VT2A 1USSA 3CUQB 3LSTA 4ZYGA 1ZRCA 3EQLF 3HYIA 1Z91A 4KN7X 3RJPA 3LQQA 3KP2A 4O5VA 3B02A 3R60A 2GXBA 2MD5A 4RB3C 2NNYA 1P2FA 4CHUA 2IP2A 3DXJF 3GW2A 4XRFA 1PDNC 4HA8A 5LHGA 3HHGA 1O3SA 2RQPA 3MQ0A 4A12A 1UB9A 4HX8A 2VC1A 4GYGA 1R00A 3BROA 1IN5A 4FT8A 1SFXA 1Z05A 2L54A 4M9XA 3JAMZ 4EM2A 1AOYA 1OYIA 5IT9K 3ISPA 4XSXF 3ZMDA 3KP6A 3T5XA 1P4WA 2PMHA 4XLNF 2UWMA 3MZYA 4YIIA 4AIHA 1Q1HA 4M71A 1LEAA 3C3WA 3CDHA 1QGPA 3KP7A 4OU0A 3IKTA 1FBUA 5FFZA 4EJUA 1K7AA 4RGRA 3ZMZA 2CWEA 1BC7C 4IF4A 3TOAA 1HKQA 5D6FA 4U0YA 3FZVA 3Q9VA 2XAHA 3OOPA 2H6CA 3L9FA 1SD6A 5L3FA 4I02A 1LJ9A 2NS0A 4EM0B 1Z7UA 4G8XA 1H9GA 2GA2A 3F22A 3BJOA 2ZNZA 1IN6A 3U1DA 3BY6A 3DP7A 2QYOA 2QLZA 4BQAA 2Q8KA 4M9SA 2VBWA 4I98B 2D45A 5CVIA 1W5TA 5JFRA 3FM5A 1IZ1A 2QVOA 4NQWA 2ZJ2A 3I59A 2W57A 2W84A 4HF1A 1RZ4A 5D5UB 1IRFA 1QQIA 4RAZA 2A6HF 4P96A 2FA5A 4EJOA 2ZCWA 2F5DA 3GYHX 1LQ1A 1ONVA 5D5VB 2RNJA 2P5LC 3GO5A 4BH9A 4BXUA 2O61A 4UNOA 1KA8A 4EGZA 2OD5A 2EFWA 5LLQA 3EETA 4IRHA 1IRGA 4EV0A 4OIRF 4BNCA 1ON2A 5K1YA 4EMSA 3S2WA 2IPQX 3M8EA 5ICGA 5K5QA 2GQQA 2HEOA 5LHHA 1R7JA 4LFUA 1LB2A 1EH8A 3LFKA 1MDMA 3WGIA 3WU1B 2QUFA 2MBFA 1HKTA 1XMAA 4OIOF 1OR7A 4I01A 3JTGA 5BOXA 3W6KB 3TOBA 2DTRA 2DFIA 4IJAA 3E5QA 1YS7A 3NQOA 3REOA 1FSHA 5D4SA 4MNUA 4IXAA 5J8CA 3LA2A 4YFXF 5BMZA 3K1NA 3O2PE 5E18F 1U6GA 2F2EA 4L9TA 2FBKA 3F72A 1V3FA 3V7SA 1TW2A 2GXGA 2H94A 4KYWA 3TKYA 4HF2A 1UFMA 4AIKA 1K78A 3IWFA 2UZKA 1F1ZA 1IF1A 4LLGF 3CJNA 1TQIA 5DD4A 1L0OC 3KFWX 1P4XA 1DUXC 4IHTA 3I53A 2PN6A 2JPBA 3ZMSA 4XLPF 1XN7A 4MTEA 3FWEA 2RN7A 4WXDA 2CYYA 2ZO4A 2ADUA 3I64A 4WWCA 1XSXA 2P5VA 1UCRA 5BQTA 5BPIA 1WRJA 4ENKA 5ICFA 2K4JA 1K78B 3BPVA 5ED4A 4N9IA 4AD9A 5HDGA 4CO8A 1J7KA 1C0WA 3I59B 1BI3A 4IVNA 4LK1F 1I1SA 2FU4A 3MFKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AIQ A;  1T2K A;  2CGP A;  4WK8 F;  4EJV A;  4EVI A;  1LVA A;  4WF2 A;  1R1V A;  2ESH A;  1MDM B;  2GIV A;  2YR2 A;  1YQA A;  3VOD A;  4G7O F;  2DK8 A;  2PQ8 A;  4MHG A;  3WTU C;  3ECO A;  4HZF A;  3IRR A;  5D5X B;  1PP8 F;  4Q4Z F;  1PP7 U;  3H92 A;  2KJC A;  2VXZ A;  1B9M A;  5LEJ A;  2M1B A;  3V7R A;  1U2W A;  2MC3 A;  2QBY A;  5D8K B;  3R6S A;  1LDK B;  3GFM A;  1J0R A;  4DQ2 A;  5CLS A;  4G6D A;  5E17 F;  3DFG A;  4ENJ A;  2LF8 A;  1SAX A;  3JSO A;  2BBY A;  2VOP A;  1STZ A;  1QZZ A;  2CG4 A;  5E1X A;  1W7P D;  5ILV A;  1D3Y A;  2FNP A;  3GF2 A;  3E6B A;  2PBI A;  1SD4 A;  1RIO H;  3GEZ A;  5D6E A;  4DNC A;  4KA4 A;  2Q2E A;  5DDG A;  1FT9 A;  1P92 A;  2OQR A;  2VE9 A;  1WI9 A;  3I54 A;  1W7P B;  4U7B A;  3E5X A;  2JPC A;  3QP5 A;  4LLN A;  1O7F A;  5D8L B;  3M8F A;  2UXN A;  3K9T A;  3GX4 X;  2DAO A;  1ZG1 A;  4KDP A;  1S8N A;  4M6Y A;  1TBX A;  3ML6 A;  3LA3 A;  4ENM A;  1XCV A;  4HDV A;  3Q5F A;  1YW8 A;  4L9J A;  1XGN A;  2FE3 A;  4L9V A;  1FP2 A;  2DQL A;  3C18 A;  1FNN A;  4OMZ A;  5LRR A;  1MD0 A;  3J7A O;  3E6M A;  1G4D A;  2X0L A;  4KT5 C;  4RAY A;  3HSR A;  4ZYH A;  1B59 A;  2XAF A;  2W25 A;  3TO7 A;  3SXY A;  4QLC U;  4KIB A;  3F6O A;  3BDD A;  2VT3 A;  1E2X A;  1Z6R A;  2ETH A;  1I6X A;  5CVU A;  3WG9 A;  3ULQ B;  2YX7 A;  5L3B A;  1BN5 A;  2BGC A;  4I7H A;  4WCG A;  5CVV A;  1YYV A;  2Q0O A;  2H27 A;  4ENN A;  2Y48 A;  3E3V A;  1ZLJ A;  1XGS A;  1RI7 A;  3JAM K;  2XAG A;  1BI1 A;  4LB6 B;  4KMF A;  2RKH A;  3FMS A;  3KE2 A;  4I0B A;  4UXN A;  5ICC A;  1T0F A;  2CFX A;  4P5O A;  4L5I A;  3HIF A;  4Q47 A;  2Z3Y A;  2IVM A;  4RB2 C;  5FB2 A;  3VFZ A;  3KLO A;  3WTV C;  3I0T A;  1K6O A;  1FZP B;  2A61 A;  4ZZL A;  4ETS A;  1FP1 D;  4OOI A;  4ZYD A;  3COA C;  4CGZ A;  1ZYR F;  4JQF A;  4TV7 A;  4M9Z A;  1R22 A;  2EFN A;  4PDK A;  1FPQ A;  2IA2 A;  1YO5 C;  2IRF G;  3CUO A;  4HF0 A;  4RB0 A;  1R58 A;  2LDU A;  1U8R A;  5F6F A;  2X4H A;  1U3E M;  2OAZ A;  2JSC A;  1YLF A;  2FMY A;  4I2O A;  2P8T A;  3F8F A;  5FD5 A;  2CQK A;  5DCF A;  2UXX A;  2E1C A;  4R1H A;  2M30 A;  5KK1 A;  5J8F A;  1J9I A;  1OYY A;  2E7X A;  2YPR A;  1KU2 A;  2DO7 A;  1B6A A;  2DU9 A;  3ABU A;  4OMY A;  2ZNY A;  2P6S A;  3ZP5 A;  2ISZ A;  1XB4 A;  3LWF A;  4HX4 A;  1LEB A;  2HOE A;  3LQR A;  5AIP A;  2RVC A;  4U88 A;  2ISY A;  4RB1 A;  3GVA A;  3CO6 C;  2YX4 A;  2KJB A;  1D8K A;  1KQ8 A;  2EFQ A;  4A5M A;  4A2U A;  4ASN A;  4EM1 A;  2FF4 A;  5FLX Z;  3ZN1 A;  2YU3 A;  1VTN C;  4O6J A;  2OA4 A;  3GLX A;  4A0X A;  3KP3 A;  3D5L A;  3L09 A;  1DPR A;  3QAH A;  1O57 A;  2A68 F;  3DPL C;  1L3L A;  3SQN A;  2HR3 A;  3FF5 A;  2V1X A;  4HQM A;  5D4R A;  1T6S A;  3RYR A;  1LNW A;  3BOQ A;  3DEU A;  1R36 A;  1X3U A;  3BWG A;  3FM3 A;  3KCC A;  3P9K A;  1ZRE A;  3BPX A;  1FBS A;  2P5K A;  2FNA A;  4LG0 B;  1JGS A;  2PEX A;  3F3X A;  4L18 B;  3J80 K;  3EYY A;  2XGX A;  1O3R A;  5DYM A;  1O3Q A;  2Z5U A;  1D8J A;  1XCB A;  2LSO A;  3HSF A;  1TLH B;  3GZ6 A;  5H6R A;  1PUE E;  4PGH A;  2V6C A;  4GXO A;  2VON A;  2Z9O A;  3IKV A;  3MZH A;  5DUI A;  2IW5 A;  2VN2 A;  4CZZ A;  2XAJ A;  1TQM A;  2Y0M A;  1V4R A;  1Z9C A;  1BI2 A;  2ZFW A;  4L0Z B;  1CGP A;  1J5Y A;  1BOA A;  1LDJ A;  2NRA C;  5LGT A;  3W6J B;  4NB5 A;  1QPM A;  2DK5 A;  4GGG A;  3ECH A;  2L01 A;  1H0M A;  2JT1 A;  4LB5 A;  2FOK A;  1ULY A;  1R23 A;  2ESN A;  2QQA A;  4R8H A;  4ESB A;  4L9N A;  1XSV A;  2P4W A;  3K69 A;  3QPH A;  5IT9 Z;  3RYP A;  1UHW A;  2O0Y A;  5CVJ A;  5TRD A;  4ESJ A;  2VC0 A;  1SFE A;  2HYG D;  4KIG A;  4S05 A;  3PQK A;  1QNT A;  3K2Z A;  4OIQ F;  1OYW A;  2ZBK A;  2O8X A;  2ELH A;  5E1Z B;  3F8B A;  4Q48 A;  4HV5 A;  3I71 A;  1FSE A;  4OIN F;  2OZU A;  2D1V A;  2KRF A;  3FHZ A;  2EFP A;  1JXS A;  5BS6 A;  1IXR C;  5AON A;  2LF7 A;  3K1P A;  4HLX A;  3IL2 A;  2W24 A;  3QOP A;  1YFH A;  2ZME B;  3C7J A;  4KFC A;  4Q5S F;  1J75 A;  4HDU A;  4GCV A;  4PCQ A;  2EWN A;  3NEU A;  1MJ9 A;  1ZRD A;  3MWM A;  4G94 A;  3FMQ A;  2BE5 F;  3EDP A;  2HQN A;  4E70 A;  2DQR A;  4LGW A;  1S7O A;  3KP5 A;  3MAJ A;  2Z33 A;  3P9I A;  3EUH A;  3Q9S A;  3M9A A;  2EA2 A;  4S04 A;  3IHU A;  2A07 F;  1FLI A;  1FC3 A;  1KU9 A;  5HS9 A;  3VEP A;  3QRF F;  4HX7 A;  4ON0 A;  2G7U A;  3F8C A;  2XAQ A;  1QBJ A;  3SZP A;  1TQP A;  1R5H A;  3HTU A;  1GXP A;  3FMR A;  3WGH A;  1FWZ A;  2ZKZ A;  1BBY A;  1Z6T A;  1HW1 A;  3J81 Z;  2MH9 A;  1DPU A;  4RGS A;  3WGG A;  4RS8 A;  4UUV A;  2FBH A;  1OPC A;  2WC2 A;  1OMI A;  2CW0 F;  2HDC A;  1WSU A;  4AWX B;  3G3Z A;  3K1M A;  2MLG A;  1TNS A;  2V79 A;  2L4M A;  4PZJ A;  3KET A;  4JK1 X;  2J5P A;  1ON1 A;  2P6T A;  5F64 A;  4EQQ A;  1CF7 B;  3CUQ A;  5FGM A;  5LEK A;  4M74 A;  3T1B A;  5JVT A;  2HTS A;  4H0E A;  4MTD A;  6PAX A;  5FO5 A;  3GXO A;  5ILS A;  2E7W A;  2GWR A;  2L3D A;  2RC4 A;  4LLL A;  3RKX A;  1YW7 A;  3RPQ A;  4G6Q A;  4BYY A;  1WQ2 A;  5FLX K;  5HDN A;  4YG2 F;  2XIG A;  3V8L A;  3PQJ A;  3QPT A;  5DV5 A;  3WTT C;  3WOD F;  2HZT A;  1S7A A;  5L3D A;  2BYV E;  1ZG5 A;  3KZZ A;  1ZGJ A;  4JBA A;  3BP8 A;  4Z2Y A;  3BJA A;  1IN4 A;  1O7L A;  3CTA A;  2FRH A;  1CF7 A;  3HRT A;  2RGV A;  1R5G A;  1G3W A;  1W7P A;  1FYL A;  2HGC A;  1ZLK A;  3RTR A;  4HOB A;  1KQ0 A;  1FY7 A;  1XD7 A;  4IRG A;  1BIB A;  3TGN A;  1HXD A;  2XRN A;  4R79 A;  3WU0 A;  4KN4 X;  3HHH A;  4BHC A;  5JI6 A;  2K27 A;  2XKP A;  5J6X A;  2HKO A;  3RKY A;  4I0A A;  1J59 A;  1R1T A;  2HQR A;  3HRM A;  3GFL A;  1SMY F;  1YS6 A;  3JTH A;  2R7F A;  2JRT A;  5HDK A;  3E5U A;  4U0W A;  1WKM A;  1B9N A;  3K0L A;  2TDX A;  4K2E A;  1HQC A;  4U0V A;  1NHA A;  3TO9 A;  4ZH4 F;  3ZMV A;  1F5T A;  3N4M A;  3P9C A;  2EFO A;  5H6Q A;  2O03 A;  2XKO A;  1REP C;  3WTY C;  2DPD A;  1G3Y A;  1T98 A;  2D2W A;  1TNT A;  1ZAO A;  2L02 A;  2MH2 A;  3J81 K;  4HQE A;  3RPU A;  3FXQ A;  3ROU A;  1EH6 A;  3SHF A;  4BHB A;  1YIO A;  3AAF A;  4KNY A;  1Z1D A;  3GFJ A;  3G73 A;  3ZPL A;  1A04 A;  3LAJ A;  1FBQ A;  2IA1 A;  3WE3 A;  3H3U A;  5K5R A;  3HOT A;  4RGU A;  2VE8 A;  1JHH A;  1IN7 A;  2K86 A;  3R0A A;  1ZAR A;  2GA1 A;  3F8N A;  4CXF A;  2K02 A;  4UVA A;  4AIJ A;  4G7Z F;  2OQG A;  3VOE A;  2LNB A;  4LMY A;  1EH7 A;  3N97 A;  2QEN A;  4EGY A;  2PFB A;  5LGN A;  4A0Y A;  2EK5 A;  3JW4 A;  3SFZ A;  2GZW A;  2J5O A;  1B4A A;  2C6Y A;  2YSR A;  1KU7 A;  5FD6 A;  2O3F A;  1LDD A;  4FX4 A;  2EV5 A;  4M72 A;  1QZY A;  4B09 A;  5LRS A;  1F9N A;  4YIF A;  2V1U A;  2JTV A;  2Y75 A;  2L4A A;  5F1R A;  1IW7 F;  2XAS A;  3HUG A;  2VOD A;  3B73 A;  2DBB A;  3HRU A;  1XGM A;  4HAM A;  1KYW A;  4WX9 A;  3SZT A;  1W5S A;  4BHP A;  1G3T A;  3JSP A;  4UVC A;  3IRQ A;  4YFK F;  2W85 A;  5DEQ A;  1U5T B;  1UHM A;  1JE8 A;  4ESF A;  2ZME A;  3WTS C;  1ZRF A;  1SD5 A;  2IT0 A;  5EEG A;  2WV0 A;  3HRS A;  5CVR A;  2PJP A;  5L3C A;  2V9V A;  1YW9 A;  1GXQ A;  3QU6 A;  2GAU A;  1HW5 A;  3RI4 A;  3CUQ C;  2COM A;  5JR3 A;  5L3E A;  5DCM A;  4UHT A;  2HWV A;  5HS8 A;  1MJA A;  3CO7 C;  1E17 A;  4FHT A;  1B1B A;  1R1U A;  2QM3 A;  4MGR A;  1S3J A;  4AVP A;  1HBX G;  2OZ6 A;  4G7H F;  2EA4 A;  4UV8 A;  1BC8 C;  3MCZ A;  3U2R A;  5A2Q K;  2QQB A;  2WTE A;  1I1G A;  4XBF A;  4LD5 A;  1G6N A;  4NHJ A;  3DKW A;  3EYI A;  5CJ9 A;  2QBY B;  3ZMU A;  3HSE A;  4QWQ A;  1TW3 A;  2D1H A;  2QWW A;  3IWZ A;  4A6D A;  4CIC A;  1ZN2 A;  3M1E A;  3LA7 A;  3D0S A;  2IJL A;  3RIR A;  2M8E A;  4WXH A;  1S29 A;  3E97 A;  3I4P A;  3L7W A;  1H9T A;  3V8K A;  4BAY A;  1SFU A;  4M73 A;  3QU3 A;  3KLN A;  1MKM A;  3DV8 A;  2HS5 A;  3ZQ7 A;  2EV0 A;  4XSZ F;  3WE2 A;  2DPU A;  3R4K A;  3F23 A;  3CLO A;  3TDZ C;  3NRV A;  2FQ3 A;  1RUN A;  2NAZ A;  1DDN A;  1IXC A;  3V7C A;  5TJJ A;  2MLK A;  4MQV A;  5DUK A;  1YG2 A;  2QZ8 A;  4OIP F;  2PG4 A;  3IC7 A;  4MEX F;  3WTZ A;  1XDU A;  2OBP A;  3L00 A;  3HTS B;  4P9U A;  3ZN0 A;  4LK0 F;  4KUM A;  5LHI A;  3V4G A;  4WXC A;  4LG0 A;  3OV8 A;  3O3K A;  1FOK A;  1I27 A;  2EV6 A;  4UV9 A;  1BI0 A;  5HVQ C;  2FSW A;  1AWC A;  4I09 A;  4HW0 A;  2P7V B;  1RUO A;  3J80 Z;  2KIU A;  1SMT A;  1QO0 D;  2F5F A;  1MJB A;  2EB7 A;  3ABT A;  2FML A;  5D5W B;  5FFX A;  2AXL A;  1BIA A;  2H6B A;  1O3T A;  2NYX A;  1T38 A;  4Y15 A;  2VBX A;  1HKS A;  1GVJ A;  3TO6 A;  4IRI A;  2JZY A;  2LKP A;  4M6X A;  4A6E A;  2KKO A;  2FBI A;  3E6D A;  1I5Z A;  3R0J A;  2DLL A;  2VBZ A;  4IPA A;  2A69 F;  2HKX A;  1IUY A;  4L5J A;  3T8T A;  3T8R A;  3KEO A;  4HV6 A;  1KGS A;  5HLH A;  4N9H A;  3QP6 A;  2E1N A;  5ERI A;  3VB2 A;  3R61 A;  4A0Z A;  1F4K A;  2VOO A;  1IXS B;  3H3Z A;  1BJA A;  1U5T C;  3E6C C;  2PLY A;  4B8X A;  2PI0 A;  1ZH5 A;  4G9Y A;  1MZB A;  3KEQ A;  2V1D A;  1MGT A;  5JHU A;  3P7N A;  4CDG A;  2FEZ A;  1J2X A;  5E1W A;  2RDP A;  3V8J A;  4A5N A;  2K7L A;  2R3S A;  5L3G A;  2DT5 A;  2HYF A;  2KIF A;  4ZZD A;  4HLY A;  5DCM B;  1D5V A;  4P55 A;  2WWY A;  2XHK A;  4YFN F;  4UVB A;  5DD8 A;  2QQ9 A;  3F8M A;  2M45 A;  1HW2 A;  2G9W A;  1Y0U A;  2DW4 A;  2XV4 S;  1YTY A;  3KZY A;  3ELK A;  3BZ6 A;  1ODD A;  1BM9 A;  2M87 A;  5LGU A;  4EJT A;  5BPD A;  4MQ9 F;  2F5E A;  2KIM A;  3RKW A;  1S6L A;  3I5U A;  4MEY F;  1TTY A;  1T39 A;  3GWZ A;  4EJW A;  1KQ9 A;  3F21 A;  2STW A;  2MA3 A;  5CYV A;  3T0Y A;  1KYZ A;  3DPT A;  4KIC A;  2AS5 F;  1ZGA A;  2R7D A;  2IA0 A;  2K4B A;  5HLI A;  5E8G A;  3ERE D;  3U9G A;  2XRO A;  3GUD A;  1XGO A;  5KVR A;  2B0L A;  1HSJ A;  5HLG A;  4P9F A;  2P7C B;  2BV6 A;  1P4A A;  3DF8 A;  1XSD A;  2STT A;  1EV7 A;  2OU2 A;  5HOO A;  2PMU A;  2Z99 A;  5E20 A;  3WTW C;  1UST A;  4Y13 A;  3PFI A;  4N0B A;  2ACJ A;  4IHS A;  2H09 A;  1WWX A;  5ICE A;  3BJ6 A;  4ZYE A;  5ILU A;  2G7H A;  3M7G A;  1FYK A;  1IN8 A;  2F5C A;  4GO1 A;  4KMU X;  3RDI A;  3KP4 A;  1HST A;  5LBQ A;  1ZG3 A;  2FXA A;  2EJR A;  1FX7 A;  3F6V A;  3TDU C;  4PGG A;  5A2Q Z;  1KU3 A;  4L0Y B;  5EEH A;  1G3S A;  1XMK A;  4RGX A;  1OKR A;  4CYD A;  1JHF A;  1DP7 P;  3C1D A;  2XUB A;  2NNN A;  2HTJ A;  2A3S A;  1P6R A;  2RV8 A;  1XDS A;  1RNL A;  2CO5 A;  3I58 A;  2BEO A;  2DI3 A;  4U7D A;  3O6B B;  3FXU A;  3HOS A;  1FYM A;  1SD7 A;  3MEX A;  2M5W A;  3GFI A;  3L2C A;  2VBY A;  5E8I A;  4O3M A;  2O6G E;  2A6E F;  3TQN A;  1IAW A;  2CSO A;  1U78 A;  4Y17 A;  1U5T A;  5IT3 A;  4D0P A;  2XVC A;  3FX3 A;  4HBL A;  3DQV C;  5H20 A;  4FX0 A;  3GZ5 A;  4GYI A;  4KIF A;  1K79 A;  1W4M A;  3ZMT A;  4F7Z A;  4HYE A;  3LAP A;  5K5O A;  3WTX C;  2HFH A;  4LJZ F;  2A5Y B;  3FXR A;  2ZXJ A;  1GHC A;  5HS7 A;  1ZHF A;  2VT2 A;  1USS A;  3CUQ B;  3LST A;  4ZYG A;  1ZRC A;  3EQL F;  3HYI A;  1Z91 A;  4KN7 X;  3RJP A;  3LQQ A;  3KP2 A;  4O5V A;  3B02 A;  3R60 A;  2GXB A;  2MD5 A;  4RB3 C;  2NNY A;  1P2F A;  4CHU A;  2IP2 A;  3DXJ F;  3GW2 A;  4XRF A;  1PDN C;  4HA8 A;  5LHG A;  3HHG A;  1O3S A;  2RQP A;  3MQ0 A;  4A12 A;  1UB9 A;  4HX8 A;  2VC1 A;  4GYG A;  1R00 A;  3BRO A;  1IN5 A;  4FT8 A;  1SFX A;  1Z05 A;  2L54 A;  4M9X A;  3JAM Z;  4EM2 A;  1AOY A;  1OYI A;  5IT9 K;  3ISP A;  4XSX F;  3ZMD A;  3KP6 A;  3T5X A;  1P4W A;  2PMH A;  4XLN F;  2UWM A;  3MZY A;  4YII A;  4AIH A;  1Q1H A;  4M71 A;  1LEA A;  3C3W A;  3CDH A;  1QGP A;  3KP7 A;  4OU0 A;  3IKT A;  1FBU A;  5FFZ A;  4EJU A;  1K7A A;  4RGR A;  3ZMZ A;  2CWE A;  1BC7 C;  4IF4 A;  3TOA A;  1HKQ A;  5D6F A;  4U0Y A;  3FZV A;  3Q9V A;  2XAH A;  3OOP A;  2H6C A;  3L9F A;  1SD6 A;  5L3F A;  4I02 A;  1LJ9 A;  2NS0 A;  4EM0 B;  1Z7U A;  4G8X A;  1H9G A;  2GA2 A;  3F22 A;  3BJO A;  2ZNZ A;  1IN6 A;  3U1D A;  3BY6 A;  3DP7 A;  2QYO A;  2QLZ A;  4BQA A;  2Q8K A;  4M9S A;  2VBW A;  4I98 B;  2D45 A;  5CVI A;  1W5T A;  5JFR A;  3FM5 A;  1IZ1 A;  2QVO A;  4NQW A;  2ZJ2 A;  3I59 A;  2W57 A;  2W84 A;  4HF1 A;  1RZ4 A;  5D5U B;  1IRF A;  1QQI A;  4RAZ A;  2A6H F;  4P96 A;  2FA5 A;  4EJO A;  2ZCW A;  2F5D A;  3GYH X;  1LQ1 A;  1ONV A;  5D5V B;  2RNJ A;  2P5L C;  3GO5 A;  4BH9 A;  4BXU A;  2O61 A;  4UNO A;  1KA8 A;  4EGZ A;  2OD5 A;  2EFW A;  5LLQ A;  3EET A;  4IRH A;  1IRG A;  4EV0 A;  4OIR F;  4BNC A;  1ON2 A;  5K1Y A;  4EMS A;  3S2W A;  2IPQ X;  3M8E A;  5ICG A;  5K5Q A;  2GQQ A;  2HEO A;  5LHH A;  1R7J A;  4LFU A;  1LB2 A;  1EH8 A;  3LFK A;  1MDM A;  3WGI A;  3WU1 B;  2QUF A;  2MBF A;  1HKT A;  1XMA A;  4OIO F;  1OR7 A;  4I01 A;  3JTG A;  5BOX A;  3W6K B;  3TOB A;  2DTR A;  2DFI A;  4IJA A;  3E5Q A;  1YS7 A;  3NQO A;  3REO A;  1FSH A;  5D4S A;  4MNU A;  4IXA A;  5J8C A;  3LA2 A;  4YFX F;  5BMZ A;  3K1N A;  3O2P E;  5E18 F;  1U6G A;  2F2E A;  4L9T A;  2FBK A;  3F72 A;  1V3F A;  3V7S A;  1TW2 A;  2GXG A;  2H94 A;  4KYW A;  3TKY A;  4HF2 A;  1UFM A;  4AIK A;  1K78 A;  3IWF A;  2UZK A;  1F1Z A;  1IF1 A;  4LLG F;  3CJN A;  1TQI A;  5DD4 A;  1L0O C;  3KFW X;  1P4X A;  1DUX C;  4IHT A;  3I53 A;  2PN6 A;  2JPB A;  3ZMS A;  4XLP F;  1XN7 A;  4MTE A;  3FWE A;  2RN7 A;  4WXD A;  2CYY A;  2ZO4 A;  2ADU A;  3I64 A;  4WWC A;  1XSX A;  2P5V A;  1UCR A;  5BQT A;  5BPI A;  1WRJ A;  4ENK A;  5ICF A;  2K4J A;  1K78 B;  3BPV A;  5ED4 A;  4N9I A;  4AD9 A;  5HDG A;  4CO8 A;  1J7K A;  1C0W A;  3I59 B;  1BI3 A;  4IVN A;  4LK1 F;  1I1S A;  2FU4 A;  3MFK A; 
#chains in the Genus database with same CATH topology
 5AIQ A;  1T2K A;  3JRF A;  2CGP A;  4WK8 F;  3A01 B;  3RSN A;  1WJC A;  4EJV A;  4EVI A;  5H2F C;  1LVA A;  4WF2 A;  5TGT A;  5M5W J;  2DA6 A;  9ANT A;  1R1V A;  1I3Q J;  2ESH A;  1MDM B;  4HNV A;  1OIS A;  2GIV A;  3PNT A;  2YR2 A;  5FRO A;  3E1S A;  2GIZ A;  1YQA A;  3VOD A;  4G7O F;  2DK8 A;  5FKL A;  1VQ8 I;  2PQ8 A;  4MHG A;  1LFB A;  3WTU C;  3ECO A;  4HZF A;  5B1A H;  2E34 A;  4L5E A;  3OYD A;  4XLC A;  3IRR A;  2HU9 A;  2Q2E B;  4UB6 C;  5D5X B;  3S3N A;  2EZL A;  3KYD B;  1PP8 F;  2K9M A;  4BEH B;  4Q4Z F;  1PP7 U;  2KIQ A;  3H92 A;  2KJC A;  2VXZ A;  1B9M A;  3KPH A;  5LEJ A;  4MFE A;  2M1B A;  3V7R A;  1U2W A;  2MC3 A;  3S3M A;  2QBY A;  1X4P A;  2AHQ A;  2NVY J;  5D8K B;  3OYF A;  2EIJ H;  2HQA A;  3JRC A;  3R6S A;  3SJM A;  2MD0 A;  2JA5 J;  1LDK B;  3GFM A;  1J0R A;  4DQ2 A;  4F55 A;  1BC7 C;  5CLS A;  4BXX J;  1JTX A;  4G6D A;  5E17 F;  3DFG A;  4D5F A;  5GTI C;  3GTP J;  4ENJ A;  2LF8 A;  1SAX A;  3JSO A;  2BBY A;  1ETW A;  2VOP A;  1STZ A;  4E7H A;  3CC7 I;  5E3O A;  4A93 J;  1QZZ A;  2CG4 A;  5E1X A;  1W7P D;  5ILV A;  1D3Y A;  2FNP A;  2R4G A;  3GF2 A;  5E3L A;  3E6B A;  2PBI A;  3ZOB A;  5DM7 F;  1SD4 A;  3BTL A;  1E0E A;  1RIO H;  3GEZ A;  5D6E A;  4DNC A;  2QF7 A;  2XC7 A;  1H8A C;  4XIC A;  2EPF A;  3ABM H;  3F9K A;  3ZXS A;  4KA4 A;  2Q2E A;  3LSK A;  2E2I J;  2HI3 A;  2YS9 A;  5DDG A;  2V9P A;  1FT9 A;  1QVT A;  1P92 A;  2EIM H;  1XG1 A;  3IAM 2;  5JLX A;  2OQR A;  2VE9 A;  4XKC A;  1WI9 A;  3I54 A;  5J3L A;  1HC8 A;  2ZFU A;  1W7P B;  1ZGW A;  3JCU C;  4U7B A;  3E5X A;  2JPC A;  3QP5 A;  4LLN A;  1QU3 A;  1O7F A;  3S8P A;  5D8L B;  1YRN B;  4DJA A;  1OR7 C;  3M8F A;  2X6Y A;  2YU9 J;  3E0J B;  2UXN A;  4XLE A;  3K9T A;  4B48 A;  3GX4 X;  2EH3 A;  4BS9 A;  1X1B A;  2JMW A;  2JWT A;  2DAO A;  1ZG1 A;  4KDP A;  1S8N A;  4M6Y A;  4Y3O A;  1TBX A;  2QGU A;  4HST A;  5FRM A;  3BZC A;  1TWC J;  3ML6 A;  2EZI A;  5CPR B;  4DBQ A;  3LA3 A;  2KRC A;  2LY2 A;  1XCV A;  3CCU I;  4HDV A;  1WPK A;  4ENM A;  3Q5F A;  1Z21 A;  3FIS A;  1YW8 A;  3S15 J;  3FXM A;  3JRE A;  3BR3 A;  4L9J A;  1XGN A;  3UNG C;  4B4C A;  1JT6 A;  2FE3 A;  2XF7 A;  4L9V A;  1FP2 A;  1MMG A;  1IJW C;  1YIT I;  2DQL A;  1JUM A;  3C18 A;  4ITV A;  2ZC2 A;  4LIU A;  1FNN A;  4CCJ A;  4OMZ A;  5EZH A;  5LRR A;  4A3L J;  1MD0 A;  2E5Z A;  3J7A O;  3E6M A;  1K4T A;  3GTQ J;  3E7L A;  2X6O A;  4UUS A;  2GBY A;  1G4D A;  2X0L A;  5B1B H;  4C3I J;  3OY9 A;  4KT5 C;  4RAY A;  2HDD A;  3HSR A;  4MO7 A;  4ZYH A;  1B59 A;  1K6Y A;  2OJE D;  2XAF A;  3G6E I;  2DDA A;  4UUT A;  3RZO J;  2W25 A;  5IP7 J;  3A0B C;  3TO7 A;  3SXY A;  4QLC U;  4KIB A;  5GPA A;  3F6O A;  3BDD A;  1ETV A;  2DMU A;  2VT3 A;  1E2X A;  2GOM A;  4KT6 A;  1Z6R A;  2ETH A;  1I6X A;  3BG9 A;  1Z7L A;  1HA8 A;  2IGN A;  2ZB9 A;  3BQY A;  2ZXI A;  5CVU A;  1Y6I A;  3WG9 A;  3ULQ B;  2YX7 A;  4ZDL A;  1U8B A;  5L3B A;  1BN5 A;  3ZQG A;  2BGC A;  4A3G J;  1FEX A;  4I7H A;  4WCG A;  5CVV A;  1X2M A;  1YYV A;  2Q0O A;  2H27 A;  4ENN A;  3E3V A;  2Y48 A;  3BCB A;  3BG3 A;  1ZLJ A;  3OWT A;  1XGS A;  1W36 D;  1WZ2 A;  4YEJ A;  3ESW B;  4PJN A;  4A69 C;  3CC2 I;  1RI7 A;  3HEF A;  2HXO A;  3JAM K;  3OR1 C;  1I3A A;  2XAG A;  4G6T B;  3K7A J;  1BI1 A;  2F4O B;  2DMN A;  4MLO A;  4LB6 B;  4KMF A;  2K40 A;  3KEY A;  2NOG A;  2RKH A;  3FMS A;  3KE2 A;  4I0B A;  3NAR A;  3CES A;  2X1E A;  3MMY B;  4UXN A;  5ICC A;  1T0F A;  4C9Y A;  2BW3 A;  3Q0U A;  3KYL A;  2DXI A;  2CFX A;  4BQN A;  4P5O A;  2VXD A;  4L5I A;  2FJ1 A;  4XM3 A;  2HQ5 A;  5E3M A;  3HIF A;  2R7T A;  4Q47 A;  1HLV A;  2Z3Y A;  1TZL A;  3DKX A;  3O8H A;  4JX6 A;  2IVM A;  4RB2 C;  5FB2 A;  2EBI A;  1ZKG A;  1KZH A;  4YRV A;  3VFZ A;  3KLO A;  3PL8 A;  3WTV C;  3I0T A;  1K6O A;  2L7Z A;  1FZP B;  3WHC A;  2A61 A;  2OCC H;  4ZZL A;  1G2H A;  4B44 A;  1FP1 D;  4OOI A;  4ETS A;  4IHX A;  3I4M J;  4C2U A;  2DA3 A;  4ZYD A;  4E7Z A;  2DYS H;  1LKX A;  1FTZ A;  3COA C;  3OYK A;  2ELJ A;  4CGZ A;  1ZYR F;  3BG6 A;  4JQF A;  4TV7 A;  4M9Z A;  3BQZ A;  2ZJP F;  1R22 A;  3CZ6 A;  3A03 A;  3GTL J;  2QKL B;  1R9T J;  4AM3 A;  3CMM A;  2OC6 A;  2E2H J;  1TT5 B;  3NWT A;  2EFN A;  4PDK A;  1FPQ A;  3FKI J;  2IA2 A;  3CCM I;  1YO5 C;  3RPU D;  2IRF G;  2XGC A;  4PSW A;  3H1C A;  3CUO A;  4HF0 A;  4RB0 A;  2M4K A;  3BC8 A;  2I8D A;  2EIN H;  5CKT A;  4HNU A;  1R58 A;  1ZTR A;  2LDU A;  3OSF A;  1U8R A;  1HF0 A;  3OYE A;  5F6F A;  2X4H A;  3K10 A;  1U3E M;  2OAZ A;  5GP9 A;  2JSC A;  2IGM A;  1YLF A;  2Y9Y A;  1MNE A;  2FMY A;  2P8T A;  1Y39 A;  1O4X A;  3F8F A;  4C2M J;  5FD5 A;  3KIO A;  2CQK A;  4I2O A;  2IS1 A;  1WH7 A;  1WJE A;  5DCF A;  2UXX A;  2KDZ A;  2E1C A;  4R1H A;  2M30 A;  5KK1 A;  4RA2 A;  5J8F A;  2NVT J;  1J9I A;  1OYY A;  1BL0 A;  2E7X A;  3J7Z I;  3PJR A;  2YPR A;  1KU2 A;  3CCY A;  2DO7 A;  1B6A A;  1I50 J;  2DU9 A;  1FOY A;  3ABU A;  2L9S A;  4OMY A;  2ZNY A;  2VI6 A;  2P6S A;  3ZP5 A;  1XB4 A;  3ASN H;  3LWF A;  4RAF A;  2ISZ A;  2EQR A;  4HX4 A;  1MMD A;  1LEB A;  2HOE A;  3CCJ I;  3G1M A;  3LQR A;  5AIP A;  2RVC A;  3JRB A;  4U88 A;  2EIK H;  1QPI A;  1XMX A;  2CJJ A;  4BJT A;  4YIR X;  2ISY A;  3BZK A;  4RB1 A;  3GVA A;  3CO6 C;  2YX4 A;  2KJB A;  3FKJ A;  1D8K A;  2H1L A;  2EFQ A;  2X48 A;  2Y31 A;  1KQ8 A;  4A5M A;  4A2U A;  4ASN A;  4EM1 A;  2KMU A;  2FF4 A;  2LVS A;  4IHV A;  1ACI A;  1OCZ H;  5FLX Z;  2ICW G;  4XOT A;  3ZN1 A;  3OYC A;  1JT0 A;  2DA7 A;  2YU3 A;  1VTN C;  4O6J A;  2OA4 A;  3GLX A;  4A0X A;  1ERD A;  1V5E A;  3KP3 A;  3D5L A;  3L09 A;  4V19 K;  3GTG J;  1DPR A;  3QAH A;  1O57 A;  2A68 F;  3A02 A;  3DPL C;  1L3L A;  2VAS A;  3DU6 A;  1BOB A;  3SQN A;  3RQI A;  2HR3 A;  3FF5 A;  2V1X A;  4HQM A;  4CH7 A;  1G59 A;  5D4R A;  1T6S A;  3RYR A;  1LNW A;  3BOQ A;  3DEU A;  1R36 A;  4DIQ A;  1X3U A;  1GV5 A;  3BWG A;  2VQH A;  4DBR A;  1UHS A;  2BW3 B;  3FM3 A;  4DW6 A;  3W2A A;  5EF6 A;  3KCC A;  3ZQL A;  3AG1 H;  1XS9 A;  3P9K A;  3UKG A;  1ZRE A;  2CW8 A;  3LOC A;  3BPX A;  1FBS A;  2P5K A;  2FNA A;  3CJT B;  1S72 I;  2CUZ A;  2VPL A;  2W7N A;  3L2V A;  4LG0 B;  1JGS A;  2WY7 Q;  2OPT A;  1YRN A;  2PEX A;  3FK7 A;  1WJB A;  3F3X A;  3ERM A;  3JRH A;  1AHD P;  4L18 B;  2LTP A;  3J80 K;  4QTR A;  2LD5 A;  3EYY A;  3LSI A;  3OOU A;  4IZZ A;  4C2T A;  4IOA F;  5M5X J;  3G2B A;  3BR5 A;  2XGX A;  1HOM A;  3JRA A;  3S17 J;  3OYB A;  1O3R A;  5DYM A;  1O3Q A;  2Z5U A;  1D8J A;  1XCB A;  2ZXH A;  3CCE I;  2LSO A;  3HSF A;  1LPQ A;  5FJ8 J;  1R71 A;  2LC2 A;  1TLH B;  1V54 H;  1SAU A;  3GZ6 A;  1VQL I;  4HRI A;  5H6R A;  1PUE E;  4PGH A;  2V6C A;  1ZR4 A;  4GXO A;  4ZYA A;  2DTZ A;  2VQL A;  2VON A;  2WAF A;  2VJ5 A;  2Z9O A;  4AVZ A;  3IKV A;  3MZH A;  3B6A A;  5DUI A;  3PNV A;  2IW5 A;  5KNL A;  3MKW B;  1WHU A;  2VN2 A;  5KAF C;  1F36 A;  4CZZ A;  2NS8 A;  3EUA A;  2XAJ A;  3A01 A;  1TQM A;  3DCF A;  2Y0M A;  1UZC A;  3OYI A;  3FIW A;  1V4R A;  1Z9C A;  1BI2 A;  1DGW Y;  3SEQ A;  2ZFW A;  4L0Z B;  1JUS A;  3FK6 A;  1CGP A;  1J5Y A;  5M3M J;  4NC8 A;  1BOA A;  1LDJ A;  3EUK L;  2NRA C;  3AKZ A;  2M34 A;  2XB0 X;  2FOW A;  4DYQ A;  5LGT A;  3W6J B;  3AL0 C;  1GDT A;  2KDO A;  4NB5 A;  1QPM A;  2F4I A;  3HB9 A;  3K70 C;  2E19 A;  1ITY A;  2I5U A;  2DCE A;  2DK5 A;  2ECB A;  4GGG A;  4QSH A;  1K83 J;  3ECH A;  2L01 A;  1ENH A;  1N25 A;  2JT1 A;  5EEA A;  1H0M A;  4LB5 A;  2I10 A;  1OFC X;  2R7W A;  4ZDO A;  2FOK A;  3HOW J;  1I6H J;  1ULY A;  5KCM A;  1A6Q A;  1R23 A;  2ESN A;  2QQA A;  5KAI C;  4R8H A;  4ESB A;  4L9N A;  1DU0 A;  1XSV A;  2P4W A;  2Y69 H;  2P81 A;  3K69 A;  4D7M A;  2NS7 A;  3QPH A;  2R7X A;  5IT9 Z;  5FRN A;  3AG4 H;  3U21 A;  2BVL A;  1MND A;  5EGO A;  2NVX J;  2M2E A;  3RYP A;  1UHW A;  2M0C A;  2O0Y A;  5CVJ A;  5TRD A;  2E60 A;  4ESJ A;  2VC0 A;  1SFE A;  3OYG A;  2KZG A;  2HYG D;  4KIG A;  4S05 A;  4Y33 A;  4PFP A;  1ETK A;  3PQK A;  2QSG X;  2VLA A;  5IYD J;  1RKT A;  4NBQ A;  1QNT A;  3D5S C;  3K2Z A;  2CH0 A;  5FKN A;  4OIQ F;  3F0C A;  3HGY A;  1HCR A;  1OYW A;  3L2R A;  1N77 A;  2K3F A;  3V42 A;  1SFK A;  3CD6 I;  2ZBK A;  2O8X A;  4XN3 A;  3CCR I;  2ELH A;  5E1Z B;  3A2K A;  2XAU A;  3S1R J;  3F8B A;  3G1L A;  4Q48 A;  3HOY J;  4HV5 A;  3PFY A;  3VPR A;  3TED A;  1UAA A;  5C44 J;  4DGW B;  3I71 A;  1FSE A;  3CMA I;  4OIN F;  2E1O A;  2OZU A;  5J4V A;  3K70 D;  2XF6 A;  4IKF A;  2D1V A;  3GCM A;  2KRF A;  3FHZ A;  1FOX A;  2CS3 A;  2EFP A;  5M3F J;  5BS6 A;  1JXS A;  1IXR C;  5AON A;  1K61 A;  2NOJ B;  2COB A;  4LIV A;  2CUE A;  1P7I A;  2LF7 A;  1RR8 C;  1RPW A;  3K1P A;  4HLX A;  3IL2 A;  2W24 A;  3QOP A;  1YFH A;  2ZME B;  5J47 A;  3C7J A;  4C3J J;  1A6I A;  3QOE A;  3OIQ A;  4KFC A;  1N75 A;  4NC6 A;  5IY5 H;  4Q5S F;  1J75 A;  3LSJ A;  4HDU A;  4GCV A;  4PCQ A;  1LE8 B;  2EWN A;  3CF2 A;  2R7Q A;  3NEU A;  2O9L A;  1MJ9 A;  3TBI A;  5EGO B;  1ZRD A;  3MWM A;  4G94 A;  5IPA A;  1RC9 A;  3L2U A;  1DGR M;  3FMQ A;  1BA5 A;  2BE5 F;  1WVR A;  1T95 A;  3EDP A;  2HQN A;  2Z16 A;  4X1E A;  2DQR A;  4E70 A;  2VB6 A;  3QYB A;  2EZK A;  4LGW A;  2DFE A;  1S7O A;  2VJ4 A;  3KP5 A;  3MAJ A;  2Z33 A;  3P9I A;  1P9Q C;  3EUH A;  3W2V A;  3Q9S A;  4N4O B;  3M9A A;  2EA2 A;  2KQR A;  4S04 A;  3ONQ A;  3IHU A;  2A07 F;  1FLI A;  4M3F A;  1FC3 A;  1KU9 A;  5HS9 A;  2NVQ J;  3VEP A;  3QRF F;  3CLQ A;  4HX7 A;  4ON0 A;  2VUM J;  4IQ4 A;  1DP3 A;  2G7U A;  3C2B A;  3F8C A;  4CCO A;  3BLY A;  3DPU A;  2XAQ A;  1QBJ A;  3SZP A;  1TQP A;  4UY8 I;  4FE7 A;  1R5H A;  3CC4 I;  1JTY A;  3HTU A;  2ID3 A;  1TWF J;  4BAC A;  2OV7 A;  1GXP A;  3FMR A;  3LSP A;  4PJ0 C;  3X2Q H;  2FX0 A;  3WGH A;  1FWZ A;  2BHY A;  2HVQ A;  1YHQ I;  3CCL I;  1Z3X A;  3FXK A;  1NG6 A;  2VKD A;  3K4L A;  4J00 A;  2ZKZ A;  1BBY A;  2Y30 A;  4H4K C;  1A35 A;  5F0F A;  3H0D A;  1XTA A;  2JRM A;  1Z6T A;  1T56 A;  5FLV A;  1HW1 A;  5GAE J;  3LSR A;  3J81 Z;  4BE1 A;  2MH9 A;  1DPU A;  1VZ0 A;  2CQ7 A;  3ZCO A;  4RGS A;  3WGG A;  3PSF A;  4RS8 A;  4UUV A;  2FBH A;  1OPC A;  2V1N A;  4BE0 A;  3I9V 2;  2WC2 A;  1OMI A;  2CW0 F;  1WSU A;  2HDC A;  2W00 A;  4AWX B;  3G3Z A;  3K1M A;  3HL2 A;  2HOT A;  2MLG A;  1D0X A;  1TNS A;  2V79 A;  2KFD A;  2KLO A;  2L4M A;  4PZJ A;  3KET A;  4JK1 X;  5E79 C;  2J5P A;  1ON1 A;  2P6T A;  5F64 A;  3K4B A;  4EQQ A;  1IC8 A;  1CF7 B;  3CUQ A;  5FGM A;  2CUJ A;  3ASO H;  4M74 A;  5LEK A;  3T1B A;  5JVT A;  1TP4 A;  2HTS A;  2WY8 Q;  4H0E A;  4MTD A;  1XPX A;  1YJW I;  6PAX A;  5FO5 A;  4CYC A;  3GXO A;  2BHZ A;  2E5N A;  4N4N B;  5ILS A;  2XPV A;  1OLT A;  2E7W A;  4EAT A;  2GWR A;  3HXL A;  1U9O A;  2L3D A;  2RC4 A;  4LLL A;  3RKX A;  1YW7 A;  3RPQ A;  2VPR A;  5K7F A;  4G6Q A;  1X1C A;  2M7A A;  4BYY A;  4PUS A;  4IO9 F;  2HVS A;  1WQ2 A;  1Z0X A;  3I3L A;  5FLX K;  1AKH A;  5HDN A;  3H3V K;  4YG2 F;  3HBL A;  2XIG A;  3HDD A;  3V8L A;  3IH3 A;  3PQJ A;  4XRM A;  3QPT A;  2DA2 A;  5DV5 A;  3H9J A;  3WTT C;  5FKM A;  3WOD F;  3MKL A;  2HZT A;  4D7N A;  1S7A A;  5L3D A;  3FXL A;  2IGK A;  2BYV E;  1ZG5 A;  3KZZ A;  5F08 A;  1J09 A;  2KT0 A;  3HKZ N;  1ZGJ A;  4JBA A;  3J7A Y;  3BP8 A;  4BBR J;  1LFU P;  2N8G A;  4Z2Y A;  3MKZ A;  3BJA A;  4E7J A;  1VQK I;  1IN4 A;  2P0W A;  1O7L A;  2QCO A;  3CTA A;  2FRH A;  4B47 A;  3H0G J;  3BR0 A;  2K9S A;  3DBL B;  4F92 B;  3S93 A;  2ZSI B;  1CF7 A;  1W1W E;  1TT0 A;  4BJ5 C;  4OWR B;  3HRT A;  4F91 B;  3QPL A;  2RGV A;  3FBI B;  1VQ4 I;  2GXA A;  2H8W A;  1R5G A;  1VQN I;  1G3W A;  1W7P A;  2CQX A;  3GTM J;  1ETO A;  1FYL A;  2F48 A;  2HGC A;  3D1N I;  1JKR C;  3TL4 X;  4D5C A;  2O5R A;  2BY0 A;  3W6V A;  1ZLK A;  4FCY A;  3RTR A;  4HOB A;  1KQ0 A;  2VJJ A;  2B9S A;  1FY7 A;  3GME A;  3S2D J;  1XD7 A;  4IRG A;  1BIB A;  3TGN A;  1HXD A;  2XRN A;  3H5N A;  4R79 A;  1TC3 C;  3WU0 A;  4KN4 X;  3HHH A;  4W97 A;  4BHC A;  5JI6 A;  2K27 A;  3SYT A;  4CCM A;  2XKP A;  3BR1 A;  5J6X A;  4XID A;  2V4J C;  2HKO A;  3RKY A;  4I0A A;  2M9H A;  2LKS A;  2H1K A;  1J59 A;  4Y52 J;  3W2W A;  1R1T A;  2HQR A;  3HRM A;  2RAE A;  3MKY B;  3GFL A;  1SMY F;  1YS6 A;  3AG2 H;  2WBM A;  3JTH A;  2R7F A;  5F04 A;  2JRT A;  1T0F C;  3W3C A;  1PYV A;  5HDK A;  5LFA A;  1R49 A;  1BW6 A;  1A5J A;  3E5U A;  4U0W A;  1WKM A;  1B9N A;  1FOW A;  3VYR B;  2CQQ A;  3K0L A;  4BEH A;  2BY1 A;  2TDX A;  3OS1 A;  4K2E A;  1HQC A;  4U0V A;  1Z77 A;  1NHA A;  3TO9 A;  4ZH4 F;  3S1M J;  3TP3 A;  5J4Y A;  3DU5 A;  2JQ7 A;  2JK3 A;  3ZMV A;  3CMY A;  3KZI C;  5J1U A;  4UB8 C;  2IXS A;  3P9C A;  2EFO A;  3N4M A;  1F5T A;  4P1W A;  5H6Q A;  1JJ8 C;  4QIW N;  5J1Y A;  2O03 A;  4I6Z A;  4OAY A;  2XKO A;  1REP C;  3LSH A;  2OCE A;  3WTY C;  2DPD A;  1G3Y A;  1T98 A;  2D2W A;  1TNT A;  5IOZ A;  1TWA J;  1YE9 A;  1ZAO A;  2L02 A;  3QWL A;  2MH2 A;  3MZ8 A;  2BZT A;  3ABL H;  1M1E B;  3DKY A;  3ZQH A;  2VKH A;  3J81 K;  1D1A A;  4HQE A;  1H89 C;  1S9H A;  3RPU A;  4FE4 A;  1MSE C;  2X85 A;  3FXQ A;  1MIJ A;  2DDB A;  3ROU A;  3FBN B;  1EH6 A;  3IH4 A;  2KPM A;  3SHF A;  1UG0 A;  4XR6 A;  5HOD A;  4BHB A;  1YIO A;  3AAF A;  5LD2 C;  3ZQQ A;  4D9J A;  4KNY A;  1Z1D A;  4AID A;  2A05 A;  3GFJ A;  3HPH A;  3G73 A;  4M3B A;  3PO2 J;  3ZPL A;  4JX5 A;  2DA4 A;  1BJZ A;  1MBG A;  1A04 A;  1X1A A;  3LAJ A;  1FBQ A;  2IA1 A;  4IOC F;  3HUG B;  3WE3 A;  2X1D A;  3BG7 A;  2DA5 A;  3H3U A;  1OCO H;  4CZC A;  5K5R A;  1IV6 A;  3HOT A;  4RGU A;  2VE8 A;  3NAU A;  1JHH A;  1IN7 A;  5F1J A;  2K86 A;  3DEE A;  3R0A A;  1ZAR A;  3G71 I;  2L9R A;  2ELK A;  2GA1 A;  2XSD C;  3F8N A;  3VWB A;  4CXF A;  1I39 A;  2K02 A;  4UVA A;  4AIJ A;  4G7Z F;  2OQG A;  3VOE A;  2LNB A;  4LMY A;  4FQG A;  1QA6 A;  1EH7 A;  3N97 A;  2QEN A;  4EGY A;  2R5Z A;  2R7S A;  2JUC A;  2PFB A;  2YUS A;  5LGN A;  1Q1V A;  4A0Y A;  3OMY A;  2EK5 A;  3TW6 A;  3JW4 A;  3H36 A;  2TRT A;  3M3Y J;  4U87 A;  2R7O A;  3SFZ A;  2GZW A;  5JLW A;  2J5O A;  4RM2 A;  4II2 A;  2XDV A;  1B4A A;  2C6Y A;  3U1K A;  1BR1 A;  3H5A A;  2ZXW H;  2YSR A;  1MNM C;  1KU7 A;  4DZP A;  1Y0N A;  4II3 A;  4J19 A;  5M5Y J;  5FD6 A;  2O3F A;  3BG5 A;  1QRY A;  1LDD A;  1P7J A;  2B63 J;  4FX4 A;  2EV5 A;  2DJN A;  4M72 A;  3GLL A;  1QZY A;  4B09 A;  5LRS A;  2JA7 J;  1F9N A;  4YIF A;  2Y9Z A;  4Y4R A;  2V1U A;  2JTV A;  2Y75 A;  2L4A A;  3TW7 A;  5F1R A;  1IW7 F;  2XAS A;  3FXJ A;  3HUG A;  3CP8 A;  2ZJQ F;  2VOD A;  1YX5 A;  3JRD A;  3B73 A;  4JP0 A;  2DBB A;  1K4S A;  3HRU A;  1XGM A;  1D0Y A;  2DOE A;  4HAM A;  1KYW A;  3BR6 A;  4PJL A;  1AU7 A;  2F6C A;  3OYH A;  4WX9 A;  3SZT A;  3GTK J;  1W5S A;  2KIS A;  1MMN A;  4BHP A;  1G3T A;  4IHY A;  3JSP A;  1A31 A;  3Q3S A;  4UVC A;  3IRQ A;  3D5R C;  4YFK F;  2W85 A;  4IX7 A;  3HPG A;  5DEQ A;  2QA4 I;  1U5T B;  3OL4 A;  1UHM A;  1JE8 A;  2F5V A;  3SDB A;  2VJI A;  4ESF A;  2L9V A;  2MC4 A;  2ZME A;  2X6W A;  2LKX A;  1JKP C;  1YOV B;  2MAB A;  5FKO A;  3WTS C;  1ZRF A;  1SD5 A;  2IT0 A;  5EEG A;  2WV0 A;  3OYL A;  2L7M P;  3HRS A;  1IRX A;  1NG7 A;  3CJR B;  5CVR A;  3HG9 A;  1LE8 A;  2PJP A;  2JN6 A;  2ZME C;  2TCT A;  5L3C A;  2V9V A;  4A3I J;  1YW9 A;  1GXQ A;  4CCL A;  1AKH B;  3QU6 A;  1HW5 A;  2GAU A;  3LL7 A;  3RI4 A;  1ZK8 A;  2AQF A;  3CUQ C;  2COM A;  5JR3 A;  1R4N B;  5L3E A;  5DCM A;  5DM6 F;  4UHT A;  4F93 B;  2RRE A;  2HWV A;  1OCC H;  5HS8 A;  1MJA A;  3CO7 C;  2R7U A;  1E17 A;  1JKO C;  3DTK A;  1SVL A;  4CSW A;  4FHT A;  3HOX J;  4F52 A;  4XKB A;  1EF4 A;  1B1B A;  4DZJ A;  1R1U A;  2QM3 A;  4MGR A;  4XK4 A;  1U9N A;  1S3J A;  3IAS 2;  4AVP A;  2FQ4 A;  3VDX A;  2XPW A;  2ID6 A;  1F43 A;  3VYU B;  3G1O A;  1HBX G;  2LFB A;  2OZ6 A;  2K3P A;  4G7H F;  2EA4 A;  2CW7 A;  4UV8 A;  1BC8 C;  2PX9 A;  3MCZ A;  3U2R A;  5A2Q K;  2OUM A;  3C2H A;  2QQB A;  3Q0V A;  2WTE A;  3BTI A;  1I1G A;  4XBF A;  4LD5 A;  1G6N A;  3CME I;  4NHJ A;  2Y0S N;  4V2F A;  2DYR H;  3DKW A;  3EYI A;  2L5Q A;  4BJ6 C;  2IBD A;  4XKW A;  2DOD A;  1SFO J;  1IV8 A;  2B7E A;  5CJ9 A;  2QBY B;  3ZMU A;  3HSE A;  4QWQ A;  1TW3 A;  1E3O C;  4X6A J;  2D1H A;  2AQE A;  2QWW A;  3IWZ A;  4A6D A;  1WI3 A;  1RKW A;  2MW8 A;  4CIC A;  1ZN2 A;  2QQ8 A;  3M1E A;  2R7V A;  2V26 A;  3LA7 A;  3D0S A;  4RAG A;  2IJL A;  1NH3 A;  3RIR A;  2ME0 A;  1FIA A;  3RZD J;  2M8E A;  2K85 A;  4WXH A;  1S29 A;  2BY3 A;  4BKX A;  3E97 A;  3I4P A;  3L7W A;  1VQO I;  1H9T A;  4A3M J;  3V8K A;  4BAY A;  3DTE A;  1SFU A;  4M73 A;  3QU3 A;  1U0J A;  4DOZ A;  3KLN A;  1MKM A;  2ECC A;  3DV8 A;  3AG3 H;  4CYC B;  1ETX A;  2HS5 A;  3ZQ7 A;  5GPC A;  2EV0 A;  3H9Q A;  4XSZ F;  4E6K G;  3HZJ A;  2V7F A;  3WE2 A;  2DPU A;  5J40 A;  2WB1 N;  3R4K A;  1EKE A;  3F23 A;  3ZGK A;  2DFF A;  3CLO A;  4BU2 A;  3GTO J;  3TDZ C;  4J01 A;  2W82 A;  3NRV A;  4PK4 A;  2LY9 A;  2FQ3 A;  2IS6 A;  1RUN A;  2NAZ A;  1DDN A;  2KRH A;  1POG A;  1MBH A;  1IXC A;  4FET A;  3V7C A;  5TJJ A;  4HNT A;  3KYC B;  2JA6 J;  2MLK A;  4MQV A;  5IOY A;  1IUF A;  4DYR A;  4M3D A;  1FJL A;  5DUK A;  1WCM J;  1YG2 A;  3AL0 B;  2QZ8 A;  4C30 A;  4G12 A;  1R4M B;  1PVE A;  4OIP F;  2PG4 A;  3IC7 A;  4MEX F;  3WTZ A;  1XDU A;  2OBP A;  2KL4 A;  3S1N J;  3L00 A;  3HTS B;  4P9U A;  1MMS A;  4HPQ A;  3ZN0 A;  3OIO A;  1B72 A;  3OYN A;  4LK0 F;  4RMN A;  4KUM A;  5LHI A;  1BW5 A;  2PMZ A;  4UUS B;  2OTJ I;  1WGX A;  4WXC A;  1X58 A;  4ZC3 A;  4PJM A;  4LG0 A;  3V4G A;  1W36 C;  1MSF C;  3OV8 A;  4E7S A;  1AA7 A;  2ME6 A;  1RR7 A;  1IRZ A;  2MG4 A;  3O3K A;  1FOK A;  1I27 A;  2EV6 A;  2MSY A;  5B3S H;  4UV9 A;  1BI0 A;  5HVQ C;  2FSW A;  5EYR A;  4I09 A;  1AWC A;  4HW0 A;  1VQ6 I;  5E3N A;  2P7V B;  1RUO A;  1VQP I;  2H8R A;  3J80 Z;  2KIU A;  2GM4 A;  1SMT A;  1QO0 D;  2F5F A;  1MJB A;  2EB7 A;  3FDY A;  3ABT A;  1HDP A;  3KX2 A;  3K4N A;  4QPQ A;  3AFH A;  1YX3 A;  2FML A;  5D5W B;  2HOS A;  2NVU B;  2LR8 A;  4DYC A;  5FFX A;  2AXL A;  1BIA A;  1EJ9 A;  2H6B A;  3CP2 A;  3S14 J;  1O3T A;  2VQC A;  2NYX A;  2UUZ A;  4Y15 A;  2VBX A;  3LSG A;  1T38 A;  1HKS A;  2LY1 A;  1GVJ A;  3A1Y A;  3TO6 A;  4IRI A;  3ZR8 X;  4KIT B;  2JZY A;  1JGG A;  2IS4 A;  2LKP A;  1WH5 A;  4M6X A;  4A6E A;  2KKO A;  5J1R A;  3QOD A;  4NNJ A;  1CQT A;  2LH9 A;  4CUG A;  1Y8R B;  2FBI A;  3E6D A;  1I5Z A;  3R0J A;  2DLL A;  1LVK A;  2VBZ A;  4IPA A;  3ZRG A;  4IHW A;  1XC5 A;  2CQN A;  5F27 A;  2A69 F;  2HKX A;  1IUY A;  1QVU A;  1X1D A;  2LRD A;  4L5J A;  2LBF B;  3T8T A;  1D1B A;  3T8R A;  3KEO A;  4HV6 A;  1KGS A;  3OYJ A;  2QEX I;  5HLH A;  3VSK A;  5K7H A;  1Y56 A;  3QPS A;  4N9H A;  1B72 B;  3QP6 A;  2E1N A;  2AO9 A;  3I4N J;  5DTD A;  2HVR A;  4NQW B;  4AYB N;  5ERI A;  3VB2 A;  3R61 A;  2WB1 A;  4A0Z A;  1F4K A;  2CV1 A;  3PNY A;  2VOO A;  4NDL A;  1IXS B;  3H3Z A;  4AYB A;  1BJA A;  3HC7 A;  1U5T C;  3E6C C;  3FXO A;  2PLY A;  4E7K A;  3O8G A;  4B8X A;  2PI0 A;  3VYS B;  1ZH5 A;  4G9Y A;  2EZH A;  1MZB A;  3WG7 H;  4JX4 A;  3I55 I;  1X2N A;  3KEQ A;  2V1D A;  3PIP F;  1MGT A;  5JHU A;  3P7N A;  1VQ9 I;  4CDG A;  2FEZ A;  1J2X A;  5E1W A;  1KON A;  5EDN A;  4BE2 A;  2RDP A;  3BTJ A;  3OR2 C;  3V8J A;  1D1C A;  4A5N A;  2K7L A;  2R3S A;  5L3G A;  3ZQC A;  4A3B J;  1VND A;  2OTL I;  2CV2 A;  4JOM A;  1JJ6 C;  2DT5 A;  2RNG A;  4E4H A;  3WU2 C;  2HYF A;  2KIF A;  4M6V A;  1W5C C;  4ZZD A;  4HLY A;  3RQ4 A;  5DCM B;  1X3W B;  1D5V A;  2CFO A;  4P55 A;  2WWY A;  2XHK A;  4YFN F;  4B3A A;  4UVB A;  5DD8 A;  2Q1Z B;  3M1C A;  3CCV I;  4BDY A;  1ORK A;  2QQ9 A;  3F8M A;  2M45 A;  1HW2 A;  2G9W A;  1OCT C;  1Y0U A;  2DW4 A;  2XV4 S;  2LMD A;  4A3E J;  1YTY A;  3KZY A;  1YJ9 I;  3ELK A;  2K9N A;  2LLK A;  3BZ6 A;  1ODD A;  1BM9 A;  4GDF A;  3N05 A;  4CA0 A;  2M87 A;  5LGU A;  2R7Z J;  3BR2 A;  3OSG A;  4EJT A;  5BPD A;  2BOL A;  4RM3 A;  4MQ9 F;  5GAH J;  4BY7 J;  1Z67 A;  2F5E A;  2HNH A;  5EJC A;  3VYT B;  4RLQ A;  2KIM A;  3RKW A;  4A3D J;  1S6L A;  1VI0 A;  4CCK A;  3I5U A;  4MIM A;  4MEY F;  1TTY A;  1T39 A;  3A4C A;  2M8G X;  3GWZ A;  2WAQ N;  4EJW A;  1KQ9 A;  3F21 A;  2STW A;  2MA3 A;  2O7O A;  2WAQ A;  5CYV A;  3T0Y A;  1G8X A;  1KYZ A;  3DPT A;  2HPI A;  4KIC A;  4XN0 A;  3TP0 A;  2AS5 F;  1WJA A;  1OCR H;  2VQG A;  1VQ7 I;  1D0Z A;  1RET A;  4RLF A;  1ZGA A;  1QHH D;  2R7D A;  3JRG A;  2IA0 A;  2R5Y A;  1SVO A;  2K9Q A;  1X3Z B;  2K4B A;  5HLI A;  3PIO F;  5E8G A;  2HYJ A;  2DMP A;  1NK3 P;  3ERE D;  3U9G A;  2XRO A;  3GUD A;  3SEZ A;  1XGO A;  1OQY A;  2DA1 A;  2JA2 A;  2L2O A;  5KVR A;  2B0L A;  1HSJ A;  1WJF A;  2Y2Z A;  2M7B A;  2XGD A;  2UV1 A;  3G4S I;  2LG4 A;  5HLG A;  4P9F A;  2P7C B;  4E7I A;  1IDZ A;  2GOX B;  2BY2 A;  2BV6 A;  1P4A A;  2LP0 A;  3DF8 A;  1XSD A;  2STT A;  1EV7 A;  2OU2 A;  5HOO A;  2F4M B;  1MW7 A;  2PMU A;  2Z99 A;  4HEA 2;  5E20 A;  3WTW C;  1UST A;  3RCO A;  4Y13 A;  2E1M C;  3PFI A;  4N0B A;  3LFU A;  2ACJ A;  4IHS A;  4JYK A;  2H09 A;  1WWX A;  5ICE A;  2XGE A;  3BJ6 A;  1R5I D;  4M3G A;  4FAS D;  2G7H A;  3K6G A;  4ZYE A;  5ILU A;  3M7G A;  1FYK A;  1IN8 A;  2F5C A;  2DOF A;  4GO1 A;  4XLA A;  2X51 A;  4KMU X;  2QKM B;  3RDI A;  1JI8 A;  1LFP A;  3KP4 A;  1HST A;  5LBQ A;  4ABZ A;  2K9L A;  1PJR A;  1ZG3 A;  2FXA A;  2PJR B;  5EZG A;  1GV2 A;  1T33 A;  2EJR A;  1FX7 A;  2VL8 A;  3F6V A;  1HDD C;  3TDU C;  4BGD A;  2XRL A;  2JUG A;  4PGG A;  1GT0 C;  5A2Q Z;  1KU3 A;  5HNF A;  2XSJ C;  1YIJ I;  3DEW A;  4L0Y B;  2WV1 A;  4ZTJ A;  1MBE A;  4XMY A;  5EEH A;  1G3S A;  1XMK A;  3DBH B;  2BVM A;  3JRI A;  4AC0 A;  4RGX A;  1Z3Y A;  1FIP A;  1R6R A;  3K4J A;  1OKR A;  4CYD A;  1JHF A;  2W1O A;  1T08 B;  2LBF A;  3K4C A;  1UG2 A;  3OIP A;  5C3E J;  3S3O A;  1FMW A;  2L7F P;  3C1D A;  1DP7 P;  1NK2 P;  4AUX A;  2XUB A;  2NNN A;  4FIS A;  3VSL A;  2HTJ A;  2A3S A;  5IP9 J;  1P6R A;  4XRS G;  2RV8 A;  2Z1D A;  1XDS A;  1PUF A;  1RNL A;  2CO5 A;  1SAN A;  2BEO A;  2DI3 A;  3DTI A;  3I58 A;  3O6B B;  3FXU A;  5FLM J;  4U7D A;  5F0C A;  3HOS A;  2MGQ A;  1FYM A;  4GFB A;  4AU7 A;  4X0G A;  1B8I A;  1X1P A;  4B43 A;  1YI2 I;  2DT7 B;  5GTH C;  1SD7 A;  2DMQ A;  4BBS J;  1V55 H;  3MEX A;  2M4G A;  2M5W A;  3GFI A;  5BNG A;  3L2C A;  3ZQI A;  2VBY A;  5E8I A;  2X9D A;  3DWL E;  5B66 C;  3L2W A;  2CU7 A;  1OJL A;  3GTJ J;  2A6T A;  1WJD A;  3HJE A;  4D1Q A;  4O3M A;  2A5W A;  4C3H J;  2O6G E;  4HSR A;  2DOA A;  2E36 A;  2A6E F;  3TQN A;  1Y1W J;  2WAE A;  1IAW A;  2CSO A;  1DU6 A;  1U78 A;  3L1P A;  4XL9 A;  4Y17 A;  1U5T A;  3CQZ J;  5IT3 A;  4D0P A;  1X19 A;  2XVC A;  3FX3 A;  3P5J A;  4BUP A;  4HBL A;  3DQV C;  4CCN A;  5H20 A;  4FX0 A;  4XOP A;  3GZ5 A;  2XB5 A;  4GYI A;  3GBG A;  4KIF A;  4M3E A;  3OS2 A;  1K79 A;  1W4M A;  1ZR2 A;  3HOV J;  1V5G A;  1S7E A;  4LOC A;  3ZMT A;  4Y7N J;  3PO3 J;  4F7Z A;  3RKQ A;  2JVG A;  4HYE A;  3LAP A;  5K5O A;  3WTX C;  2HFH A;  4EEF G;  4W1U A;  3J7Y J;  4LJZ F;  4BY1 J;  2A5Y B;  4QPO A;  3FXR A;  3MVP A;  2ZXJ A;  1VF9 A;  5EG0 B;  2VIX A;  3SZG A;  3CCQ I;  1GHC A;  4XON A;  1WFX A;  5HS7 A;  1ZHF A;  3ABK H;  5GAD J;  2VT2 A;  1USS A;  2ZSH B;  3CUQ B;  3IH2 A;  3LST A;  4ZJZ A;  4ZYG A;  1BR2 A;  1ZRC A;  3EQL F;  3HYI A;  1B8I B;  1Z91 A;  4KN7 X;  2DN0 A;  3A0H C;  3RJP A;  5JVG F;  2E35 A;  3LQQ A;  3KP2 A;  4O5V A;  3B02 A;  3R60 A;  2GXB A;  2XPU A;  2MD5 A;  4LIT A;  3SDG A;  4RB3 C;  2NNY A;  1P2F A;  4CHU A;  2IP2 A;  3CF5 F;  2XF5 A;  3DXJ F;  3GW2 A;  4BL0 B;  4ZTF A;  1JKQ C;  3K2A A;  4XRF A;  5CQE A;  1PDN C;  3CDI A;  1APL C;  4HA8 A;  4A3C J;  1IO2 A;  1IDY A;  3ZQF A;  3DLA A;  5LHG A;  3HHG A;  3S16 J;  1O3S A;  1RES A;  2RQP A;  3MQ0 A;  4MFD A;  4A12 A;  1UB9 A;  2R5Z B;  4HX8 A;  2VC1 A;  4GYG A;  1JUP A;  1QZE A;  5JHF A;  2M3A A;  1R00 A;  3BRO A;  1IN5 A;  4FT8 A;  2IAI A;  1SFX A;  3PM1 A;  1Z05 A;  2L54 A;  4M9X A;  3JAM Z;  2KHM A;  4EM2 A;  1AOY A;  1OYI A;  5IT9 K;  3BTC A;  2OF7 A;  5B5E C;  4IEJ A;  3ISP A;  4ZDP A;  4XSX F;  4BXF A;  3ZMD A;  5C4X J;  3KP6 A;  3T5X A;  1FMV A;  1OCP A;  2HPM A;  1P4W A;  4I99 C;  4E7L A;  2PMH A;  4XLN F;  2O8K A;  2UWM A;  1ETY A;  3MZY A;  1GLN A;  4S0H B;  4YII A;  4AIH A;  1Q1H A;  2W48 A;  4M71 A;  1TL8 A;  1LEA A;  1X4O A;  3DLL F;  5TIS C;  3HGG A;  2L9N A;  4XKV A;  4GRI A;  3C3W A;  3CDH A;  1QGP A;  2Y0S A;  3KP7 A;  4OU0 A;  2QSF X;  3OL3 A;  3IKT A;  1FBU A;  5FFZ A;  3TMO A;  4EJU A;  1UEL B;  1K7A A;  4RGR A;  3IP4 B;  3ZMZ A;  2CWE A;  3UR3 C;  4IF4 A;  4ANJ A;  5C4J J;  3TOA A;  3PUB A;  2R0Q C;  1HKQ A;  1QHG A;  5D6F A;  2E2J J;  4U0Y A;  3FZV A;  3Q9V A;  2XAH A;  1N78 A;  5CQG A;  3OOP A;  2H6C A;  3L9F A;  1YJN I;  1SD6 A;  2JVH A;  1UJ8 A;  5L3F A;  4I02 A;  1LJ9 A;  2IGO A;  4PJJ A;  2NS0 A;  4EM0 B;  1Z7U A;  1SC7 A;  3K4K A;  2L7K A;  1S5L C;  4G8X A;  4XNF A;  1H9G A;  3H35 A;  1A36 A;  2GA2 A;  3F22 A;  3BJO A;  2R5Y B;  2ZNZ A;  3IV5 A;  1IN6 A;  3U1D A;  4A3F J;  3HOZ J;  3BY6 A;  3DP7 A;  3PSI A;  4LG3 A;  4V2G A;  2MYS A;  1Y1V J;  2IS2 A;  2QYO A;  2W4S A;  3DBR B;  2QLZ A;  2EIL H;  3S32 A;  4BQA A;  4NUB A;  2Q8K A;  5F0H A;  5DS9 A;  3QYE A;  4M9S A;  2K5C A;  3S2H J;  2VBW A;  4I98 B;  2D45 A;  5CVI A;  1W5T A;  5EG0 A;  5JFR A;  3FM5 A;  4XOR A;  5HLT A;  1IZ1 A;  2HXI A;  2QVO A;  4NQW A;  1ZEL A;  4XLH A;  2NXN B;  2ZJ2 A;  3PUF A;  1IGN A;  1TWH J;  2V6E A;  3I59 A;  2W57 A;  2CRG A;  3FHN A;  4KJZ A;  5K7Z A;  2W84 A;  4I76 A;  2PJR A;  4HF1 A;  1RZ4 A;  4XQF A;  5D5U B;  1IRF A;  3B6C A;  4XLF A;  1QQI A;  2KP6 A;  4RAZ A;  2A6H F;  4P96 A;  2FA5 A;  3QYF A;  4EJO A;  2ZCW A;  2F5D A;  1ETQ A;  2DFH A;  5FKK A;  2Z2S B;  1Y8Q B;  2V9K A;  3GYH X;  1LQ1 A;  1ONV A;  5D5V B;  2RNJ A;  2BXZ A;  2P5L C;  3GO5 A;  4BH9 A;  3Q0W A;  4BXU A;  3M07 A;  3EUH C;  4RBO A;  2O61 A;  2R92 J;  4UNO A;  1KA8 A;  2PMZ N;  3M8J A;  3I56 I;  2ZJR F;  4EGZ A;  2OD5 A;  2EFW A;  2X1C A;  5LLQ A;  3EET A;  1GVD A;  4IRH A;  1PUF B;  2FD5 A;  2M0M A;  1EA3 A;  2D5V A;  2HZD A;  4EV0 A;  4OIR F;  1IRG A;  2BXY A;  4BNC A;  1ON2 A;  5K1Y A;  4EMS A;  3S2W A;  3H5R A;  4Z6Y A;  2IPQ X;  3WHB A;  2VKV A;  2HDW A;  4IL6 C;  3M8E A;  5ICG A;  5K5Q A;  3K4M A;  2GQQ A;  4FTH A;  1ZQ3 P;  2HEO A;  5LHH A;  2R93 J;  1R7J A;  1H88 C;  2DMT A;  2LK2 A;  4LFU A;  2L0K A;  1EH8 A;  1LB2 A;  2DJI A;  2VKE A;  3LFK A;  2R7R A;  2AXT C;  1SVM A;  1MDM A;  3WGI A;  3WU1 B;  2QUF A;  2MBF A;  1GUU A;  1XMA A;  4XRS A;  1HKT A;  3CJQ B;  4OIO F;  1OR7 A;  1WJ5 A;  4I01 A;  4KIS A;  3JTG A;  1V5F A;  5BOX A;  3W6K B;  2CUF A;  3TOB A;  2DTR A;  2DFI A;  1BR4 A;  4IJA A;  3E5Q A;  3M4O J;  1YS7 A;  3NQO A;  2JSP A;  3REO A;  1TWG J;  1FSH A;  3LSM A;  2KZV A;  5D4S A;  4MNU A;  4IXA A;  2GLO A;  1E3P A;  5J8C A;  1UMQ A;  3LA2 A;  1MBJ A;  2WA0 A;  4A3J J;  1D5Y A;  2X6X A;  4YFX F;  5BMZ A;  3MD2 A;  3K1N A;  1VQM I;  1MBF A;  3O2P E;  5E18 F;  1U6G A;  2F2E A;  4L9T A;  4F3Q A;  2CV0 A;  2FBK A;  3HOU J;  2LYC A;  1DQU A;  1NTC A;  2MFZ A;  1LUJ B;  3F72 A;  1V3F A;  3V7S A;  1TW2 A;  2GXG A;  2H94 A;  2RQQ A;  3SFI A;  3QQA A;  4IQJ A;  3NWS A;  1W0T A;  3TKY A;  4KYW A;  5IP6 A;  4HF2 A;  1UFM A;  4AIK A;  3C2G A;  1K78 A;  3IWF A;  2E71 A;  2UZK A;  1F1Z A;  1IF1 A;  1MMA A;  4LLG F;  3CJN A;  4NC7 A;  3OYM A;  1TQI A;  5DD4 A;  1L0O C;  3MN2 A;  5IYB J;  4BQQ A;  3OS0 A;  3LNQ A;  4OAZ A;  3KFW X;  2HOA A;  1P4X A;  2WAD A;  2IEK A;  1DUX C;  2QSH X;  2LRE A;  1MH4 A;  4IHT A;  4BDZ A;  3CDL A;  3I53 A;  2PN6 A;  2JPB A;  4RDU A;  3ZMS A;  1MH3 A;  1MBK A;  2JJ7 A;  3H9G A;  2E1M B;  4XLP F;  1XN7 A;  2JA8 J;  4HG2 A;  1W0U A;  3EPZ A;  4MTE A;  3FWE A;  2LOO A;  3HM5 A;  2RN7 A;  4WXD A;  3OYA A;  2CYY A;  2ZO4 A;  4BQO A;  2DT6 A;  2ADU A;  3I64 A;  5HNH A;  4WWC A;  4B1R A;  1XSX A;  4PFO A;  2P5V A;  1UCR A;  5KHD A;  3S1Q J;  5BQT A;  1E3H A;  1T8I A;  2FUG 2;  3BCA A;  5BPI A;  1WRJ A;  4ENK A;  1IG7 A;  5ICF A;  1VFC A;  1XX5 A;  1SEU A;  2K4J A;  1K78 B;  3BPV A;  3IUO A;  3BT9 A;  5ED4 A;  2CMP A;  4N9I A;  4YEL A;  4PSX A;  3GZN B;  4AD9 A;  5HDG A;  3HKZ A;  3L2Q A;  2G0E A;  4CO8 A;  1VQ5 I;  4A3K J;  3CCS I;  1RRJ A;  1J7K A;  1FTT A;  5GAG J;  3JR9 A;  3I59 B;  1C0W A;  5IYC J;  1BI3 A;  4IVN A;  4LK1 F;  1I1S A;  3LMM A;  2FU4 A;  3MFK A;  4B3X A; 
#chains in the Genus database with same CATH homology
 5AIQ A;  1T2K A;  2CGP A;  4WK8 F;  4EJV A;  4EVI A;  1LVA A;  4WF2 A;  1R1V A;  2ESH A;  1MDM B;  2GIV A;  2YR2 A;  1YQA A;  3VOD A;  4G7O F;  2DK8 A;  2PQ8 A;  4MHG A;  3WTU C;  3ECO A;  4HZF A;  3IRR A;  5D5X B;  1PP8 F;  4Q4Z F;  1PP7 U;  3H92 A;  2KJC A;  2VXZ A;  1B9M A;  5LEJ A;  2M1B A;  3V7R A;  1U2W A;  2MC3 A;  2QBY A;  5D8K B;  3R6S A;  1LDK B;  3GFM A;  1J0R A;  4DQ2 A;  5CLS A;  4G6D A;  5E17 F;  3DFG A;  4ENJ A;  2LF8 A;  1SAX A;  3JSO A;  2BBY A;  2VOP A;  1STZ A;  1QZZ A;  2CG4 A;  5E1X A;  1W7P D;  5ILV A;  1D3Y A;  2FNP A;  3GF2 A;  3E6B A;  2PBI A;  1SD4 A;  1RIO H;  3GEZ A;  5D6E A;  4DNC A;  4KA4 A;  2Q2E A;  5DDG A;  1FT9 A;  1P92 A;  2OQR A;  2VE9 A;  1WI9 A;  3I54 A;  1W7P B;  4U7B A;  3E5X A;  2JPC A;  3QP5 A;  4LLN A;  1O7F A;  5D8L B;  3M8F A;  2UXN A;  3K9T A;  3GX4 X;  2DAO A;  1ZG1 A;  4KDP A;  1S8N A;  4M6Y A;  1TBX A;  3ML6 A;  3LA3 A;  4ENM A;  1XCV A;  4HDV A;  3Q5F A;  1YW8 A;  4L9J A;  1XGN A;  2FE3 A;  4L9V A;  1FP2 A;  2DQL A;  3C18 A;  1FNN A;  4OMZ A;  5LRR A;  1MD0 A;  3J7A O;  3E6M A;  1G4D A;  2X0L A;  4KT5 C;  4RAY A;  3HSR A;  4ZYH A;  1B59 A;  2XAF A;  2W25 A;  3TO7 A;  3SXY A;  4QLC U;  4KIB A;  3F6O A;  3BDD A;  2VT3 A;  1E2X A;  1Z6R A;  2ETH A;  1I6X A;  5CVU A;  3WG9 A;  3ULQ B;  2YX7 A;  5L3B A;  1BN5 A;  2BGC A;  4I7H A;  4WCG A;  5CVV A;  1YYV A;  2Q0O A;  2H27 A;  4ENN A;  2Y48 A;  3E3V A;  1ZLJ A;  1XGS A;  1RI7 A;  3JAM K;  2XAG A;  1BI1 A;  4LB6 B;  4KMF A;  2RKH A;  3FMS A;  3KE2 A;  4I0B A;  4UXN A;  5ICC A;  1T0F A;  2CFX A;  4P5O A;  4L5I A;  3HIF A;  4Q47 A;  2Z3Y A;  2IVM A;  4RB2 C;  5FB2 A;  3VFZ A;  3KLO A;  3WTV C;  3I0T A;  1K6O A;  1FZP B;  2A61 A;  4ZZL A;  4ETS A;  1FP1 D;  4OOI A;  4ZYD A;  3COA C;  4CGZ A;  1ZYR F;  4JQF A;  4TV7 A;  4M9Z A;  1R22 A;  2EFN A;  4PDK A;  1FPQ A;  2IA2 A;  1YO5 C;  2IRF G;  3CUO A;  4HF0 A;  4RB0 A;  1R58 A;  2LDU A;  1U8R A;  5F6F A;  2X4H A;  1U3E M;  2OAZ A;  2JSC A;  1YLF A;  2FMY A;  4I2O A;  2P8T A;  3F8F A;  5FD5 A;  2CQK A;  5DCF A;  2UXX A;  2E1C A;  4R1H A;  2M30 A;  5KK1 A;  5J8F A;  1J9I A;  1OYY A;  2E7X A;  2YPR A;  1KU2 A;  2DO7 A;  1B6A A;  2DU9 A;  3ABU A;  4OMY A;  2ZNY A;  2P6S A;  3ZP5 A;  2ISZ A;  1XB4 A;  3LWF A;  4HX4 A;  1LEB A;  2HOE A;  3LQR A;  5AIP A;  2RVC A;  4U88 A;  2ISY A;  4RB1 A;  3GVA A;  3CO6 C;  2YX4 A;  2KJB A;  1D8K A;  1KQ8 A;  2EFQ A;  4A5M A;  4A2U A;  4ASN A;  4EM1 A;  2FF4 A;  5FLX Z;  3ZN1 A;  2YU3 A;  1VTN C;  4O6J A;  2OA4 A;  3GLX A;  4A0X A;  3KP3 A;  3D5L A;  3L09 A;  1DPR A;  3QAH A;  1O57 A;  2A68 F;  3DPL C;  1L3L A;  3SQN A;  2HR3 A;  3FF5 A;  2V1X A;  4HQM A;  5D4R A;  1T6S A;  3RYR A;  1LNW A;  3BOQ A;  3DEU A;  1R36 A;  1X3U A;  3BWG A;  3FM3 A;  3KCC A;  3P9K A;  1ZRE A;  3BPX A;  1FBS A;  2P5K A;  2FNA A;  4LG0 B;  1JGS A;  2PEX A;  3F3X A;  4L18 B;  3J80 K;  3EYY A;  2XGX A;  1O3R A;  5DYM A;  1O3Q A;  2Z5U A;  1D8J A;  1XCB A;  2LSO A;  3HSF A;  1TLH B;  3GZ6 A;  5H6R A;  1PUE E;  4PGH A;  2V6C A;  4GXO A;  2VON A;  2Z9O A;  3IKV A;  3MZH A;  5DUI A;  2IW5 A;  2VN2 A;  4CZZ A;  2XAJ A;  1TQM A;  2Y0M A;  1V4R A;  1Z9C A;  1BI2 A;  2ZFW A;  4L0Z B;  1CGP A;  1J5Y A;  1BOA A;  1LDJ A;  2NRA C;  5LGT A;  3W6J B;  4NB5 A;  1QPM A;  2DK5 A;  4GGG A;  3ECH A;  2L01 A;  1H0M A;  2JT1 A;  4LB5 A;  2FOK A;  1ULY A;  1R23 A;  2ESN A;  2QQA A;  4R8H A;  4ESB A;  4L9N A;  1XSV A;  2P4W A;  3K69 A;  3QPH A;  5IT9 Z;  3RYP A;  1UHW A;  2O0Y A;  5CVJ A;  5TRD A;  4ESJ A;  2VC0 A;  1SFE A;  2HYG D;  4KIG A;  4S05 A;  3PQK A;  1QNT A;  3K2Z A;  4OIQ F;  1OYW A;  2ZBK A;  2O8X A;  2ELH A;  5E1Z B;  3F8B A;  4Q48 A;  4HV5 A;  3I71 A;  1FSE A;  4OIN F;  2OZU A;  2D1V A;  2KRF A;  3FHZ A;  2EFP A;  1JXS A;  5BS6 A;  1IXR C;  5AON A;  2LF7 A;  3K1P A;  4HLX A;  3IL2 A;  2W24 A;  3QOP A;  1YFH A;  2ZME B;  3C7J A;  4KFC A;  4Q5S F;  1J75 A;  4HDU A;  4GCV A;  4PCQ A;  2EWN A;  3NEU A;  1MJ9 A;  1ZRD A;  3MWM A;  4G94 A;  3FMQ A;  2BE5 F;  3EDP A;  2HQN A;  4E70 A;  2DQR A;  4LGW A;  1S7O A;  3KP5 A;  3MAJ A;  2Z33 A;  3P9I A;  3EUH A;  3Q9S A;  3M9A A;  2EA2 A;  4S04 A;  3IHU A;  2A07 F;  1FLI A;  1FC3 A;  1KU9 A;  5HS9 A;  3VEP A;  3QRF F;  4HX7 A;  4ON0 A;  2G7U A;  3F8C A;  2XAQ A;  1QBJ A;  3SZP A;  1TQP A;  1R5H A;  3HTU A;  1GXP A;  3FMR A;  3WGH A;  1FWZ A;  2ZKZ A;  1BBY A;  1Z6T A;  1HW1 A;  3J81 Z;  2MH9 A;  1DPU A;  4RGS A;  3WGG A;  4RS8 A;  4UUV A;  2FBH A;  1OPC A;  2WC2 A;  1OMI A;  2CW0 F;  2HDC A;  1WSU A;  4AWX B;  3G3Z A;  3K1M A;  2MLG A;  1TNS A;  2V79 A;  2L4M A;  4PZJ A;  3KET A;  4JK1 X;  2J5P A;  1ON1 A;  2P6T A;  5F64 A;  4EQQ A;  1CF7 B;  3CUQ A;  5FGM A;  5LEK A;  4M74 A;  3T1B A;  5JVT A;  2HTS A;  4H0E A;  4MTD A;  6PAX A;  5FO5 A;  3GXO A;  5ILS A;  2E7W A;  2GWR A;  2L3D A;  2RC4 A;  4LLL A;  3RKX A;  1YW7 A;  3RPQ A;  4G6Q A;  4BYY A;  1WQ2 A;  5FLX K;  5HDN A;  4YG2 F;  2XIG A;  3V8L A;  3PQJ A;  3QPT A;  5DV5 A;  3WTT C;  3WOD F;  2HZT A;  1S7A A;  5L3D A;  2BYV E;  1ZG5 A;  3KZZ A;  1ZGJ A;  4JBA A;  3BP8 A;  4Z2Y A;  3BJA A;  1IN4 A;  1O7L A;  3CTA A;  2FRH A;  1CF7 A;  3HRT A;  2RGV A;  1R5G A;  1G3W A;  1W7P A;  1FYL A;  2HGC A;  1ZLK A;  3RTR A;  4HOB A;  1KQ0 A;  1FY7 A;  1XD7 A;  4IRG A;  1BIB A;  3TGN A;  1HXD A;  2XRN A;  4R79 A;  3WU0 A;  4KN4 X;  3HHH A;  4BHC A;  5JI6 A;  2K27 A;  2XKP A;  5J6X A;  2HKO A;  3RKY A;  4I0A A;  1J59 A;  1R1T A;  2HQR A;  3HRM A;  3GFL A;  1SMY F;  1YS6 A;  3JTH A;  2R7F A;  2JRT A;  5HDK A;  3E5U A;  4U0W A;  1WKM A;  1B9N A;  3K0L A;  2TDX A;  4K2E A;  1HQC A;  4U0V A;  1NHA A;  3TO9 A;  4ZH4 F;  3ZMV A;  1F5T A;  3N4M A;  3P9C A;  2EFO A;  5H6Q A;  2O03 A;  2XKO A;  1REP C;  3WTY C;  2DPD A;  1G3Y A;  1T98 A;  2D2W A;  1TNT A;  1ZAO A;  2L02 A;  2MH2 A;  3J81 K;  4HQE A;  3RPU A;  3FXQ A;  3ROU A;  1EH6 A;  3SHF A;  4BHB A;  1YIO A;  3AAF A;  4KNY A;  1Z1D A;  3GFJ A;  3G73 A;  3ZPL A;  1A04 A;  3LAJ A;  1FBQ A;  2IA1 A;  3WE3 A;  3H3U A;  5K5R A;  3HOT A;  4RGU A;  2VE8 A;  1JHH A;  1IN7 A;  2K86 A;  3R0A A;  1ZAR A;  2GA1 A;  3F8N A;  4CXF A;  2K02 A;  4UVA A;  4AIJ A;  4G7Z F;  2OQG A;  3VOE A;  2LNB A;  4LMY A;  1EH7 A;  3N97 A;  2QEN A;  4EGY A;  2PFB A;  5LGN A;  4A0Y A;  2EK5 A;  3JW4 A;  3SFZ A;  2GZW A;  2J5O A;  1B4A A;  2C6Y A;  2YSR A;  1KU7 A;  5FD6 A;  2O3F A;  1LDD A;  4FX4 A;  2EV5 A;  4M72 A;  1QZY A;  4B09 A;  5LRS A;  1F9N A;  4YIF A;  2V1U A;  2JTV A;  2Y75 A;  2L4A A;  5F1R A;  1IW7 F;  2XAS A;  3HUG A;  2VOD A;  3B73 A;  2DBB A;  3HRU A;  1XGM A;  4HAM A;  1KYW A;  4WX9 A;  3SZT A;  1W5S A;  4BHP A;  1G3T A;  3JSP A;  4UVC A;  3IRQ A;  4YFK F;  2W85 A;  5DEQ A;  1U5T B;  1UHM A;  1JE8 A;  4ESF A;  2ZME A;  3WTS C;  1ZRF A;  1SD5 A;  2IT0 A;  5EEG A;  2WV0 A;  3HRS A;  5CVR A;  2PJP A;  5L3C A;  2V9V A;  1YW9 A;  1GXQ A;  3QU6 A;  2GAU A;  1HW5 A;  3RI4 A;  3CUQ C;  2COM A;  5JR3 A;  5L3E A;  5DCM A;  4UHT A;  2HWV A;  5HS8 A;  1MJA A;  3CO7 C;  1E17 A;  4FHT A;  1B1B A;  1R1U A;  2QM3 A;  4MGR A;  1S3J A;  4AVP A;  1HBX G;  2OZ6 A;  4G7H F;  2EA4 A;  4UV8 A;  1BC8 C;  3MCZ A;  3U2R A;  5A2Q K;  2QQB A;  2WTE A;  1I1G A;  4XBF A;  4LD5 A;  1G6N A;  4NHJ A;  3DKW A;  3EYI A;  5CJ9 A;  2QBY B;  3ZMU A;  3HSE A;  4QWQ A;  1TW3 A;  2D1H A;  2QWW A;  3IWZ A;  4A6D A;  4CIC A;  1ZN2 A;  3M1E A;  3LA7 A;  3D0S A;  2IJL A;  3RIR A;  2M8E A;  4WXH A;  1S29 A;  3E97 A;  3I4P A;  3L7W A;  1H9T A;  3V8K A;  4BAY A;  1SFU A;  4M73 A;  3QU3 A;  3KLN A;  1MKM A;  3DV8 A;  2HS5 A;  3ZQ7 A;  2EV0 A;  4XSZ F;  3WE2 A;  2DPU A;  3R4K A;  3F23 A;  3CLO A;  3TDZ C;  3NRV A;  2FQ3 A;  1RUN A;  2NAZ A;  1DDN A;  1IXC A;  3V7C A;  5TJJ A;  2MLK A;  4MQV A;  5DUK A;  1YG2 A;  2QZ8 A;  4OIP F;  2PG4 A;  3IC7 A;  4MEX F;  3WTZ A;  1XDU A;  2OBP A;  3L00 A;  3HTS B;  4P9U A;  3ZN0 A;  4LK0 F;  4KUM A;  5LHI A;  3V4G A;  4WXC A;  4LG0 A;  3OV8 A;  3O3K A;  1FOK A;  1I27 A;  2EV6 A;  4UV9 A;  1BI0 A;  5HVQ C;  2FSW A;  1AWC A;  4I09 A;  4HW0 A;  2P7V B;  1RUO A;  3J80 Z;  2KIU A;  1SMT A;  1QO0 D;  2F5F A;  1MJB A;  2EB7 A;  3ABT A;  2FML A;  5D5W B;  5FFX A;  2AXL A;  1BIA A;  2H6B A;  1O3T A;  2NYX A;  1T38 A;  4Y15 A;  2VBX A;  1HKS A;  1GVJ A;  3TO6 A;  4IRI A;  2JZY A;  2LKP A;  4M6X A;  4A6E A;  2KKO A;  2FBI A;  3E6D A;  1I5Z A;  3R0J A;  2DLL A;  2VBZ A;  4IPA A;  2A69 F;  2HKX A;  1IUY A;  4L5J A;  3T8T A;  3T8R A;  3KEO A;  4HV6 A;  1KGS A;  5HLH A;  4N9H A;  3QP6 A;  2E1N A;  5ERI A;  3VB2 A;  3R61 A;  4A0Z A;  1F4K A;  2VOO A;  1IXS B;  3H3Z A;  1BJA A;  1U5T C;  3E6C C;  2PLY A;  4B8X A;  2PI0 A;  1ZH5 A;  4G9Y A;  1MZB A;  3KEQ A;  2V1D A;  1MGT A;  5JHU A;  3P7N A;  4CDG A;  2FEZ A;  1J2X A;  5E1W A;  2RDP A;  3V8J A;  4A5N A;  2K7L A;  2R3S A;  5L3G A;  2DT5 A;  2HYF A;  2KIF A;  4ZZD A;  4HLY A;  5DCM B;  1D5V A;  4P55 A;  2WWY A;  2XHK A;  4YFN F;  4UVB A;  5DD8 A;  2QQ9 A;  3F8M A;  2M45 A;  1HW2 A;  2G9W A;  1Y0U A;  2DW4 A;  2XV4 S;  1YTY A;  3KZY A;  3ELK A;  3BZ6 A;  1ODD A;  1BM9 A;  2M87 A;  5LGU A;  4EJT A;  5BPD A;  4MQ9 F;  2F5E A;  2KIM A;  3RKW A;  1S6L A;  3I5U A;  4MEY F;  1TTY A;  1T39 A;  3GWZ A;  4EJW A;  1KQ9 A;  3F21 A;  2STW A;  2MA3 A;  5CYV A;  3T0Y A;  1KYZ A;  3DPT A;  4KIC A;  2AS5 F;  1ZGA A;  2R7D A;  2IA0 A;  2K4B A;  5HLI A;  5E8G A;  3ERE D;  3U9G A;  2XRO A;  3GUD A;  1XGO A;  5KVR A;  2B0L A;  1HSJ A;  5HLG A;  4P9F A;  2P7C B;  2BV6 A;  1P4A A;  3DF8 A;  1XSD A;  2STT A;  1EV7 A;  2OU2 A;  5HOO A;  2PMU A;  2Z99 A;  5E20 A;  3WTW C;  1UST A;  4Y13 A;  3PFI A;  4N0B A;  2ACJ A;  4IHS A;  2H09 A;  1WWX A;  5ICE A;  3BJ6 A;  4ZYE A;  5ILU A;  2G7H A;  3M7G A;  1FYK A;  1IN8 A;  2F5C A;  4GO1 A;  4KMU X;  3RDI A;  3KP4 A;  1HST A;  5LBQ A;  1ZG3 A;  2FXA A;  2EJR A;  1FX7 A;  3F6V A;  3TDU C;  4PGG A;  5A2Q Z;  1KU3 A;  4L0Y B;  5EEH A;  1G3S A;  1XMK A;  4RGX A;  1OKR A;  4CYD A;  1JHF A;  1DP7 P;  3C1D A;  2XUB A;  2NNN A;  2HTJ A;  2A3S A;  1P6R A;  2RV8 A;  1XDS A;  1RNL A;  2CO5 A;  3I58 A;  2BEO A;  2DI3 A;  4U7D A;  3O6B B;  3FXU A;  3HOS A;  1FYM A;  1SD7 A;  3MEX A;  2M5W A;  3GFI A;  3L2C A;  2VBY A;  5E8I A;  4O3M A;  2O6G E;  2A6E F;  3TQN A;  1IAW A;  2CSO A;  1U78 A;  4Y17 A;  1U5T A;  5IT3 A;  4D0P A;  2XVC A;  3FX3 A;  4HBL A;  3DQV C;  5H20 A;  4FX0 A;  3GZ5 A;  4GYI A;  4KIF A;  1K79 A;  1W4M A;  3ZMT A;  4F7Z A;  4HYE A;  3LAP A;  5K5O A;  3WTX C;  2HFH A;  4LJZ F;  2A5Y B;  3FXR A;  2ZXJ A;  1GHC A;  5HS7 A;  1ZHF A;  2VT2 A;  1USS A;  3CUQ B;  3LST A;  4ZYG A;  1ZRC A;  3EQL F;  3HYI A;  1Z91 A;  4KN7 X;  3RJP A;  3LQQ A;  3KP2 A;  4O5V A;  3B02 A;  3R60 A;  2GXB A;  2MD5 A;  4RB3 C;  2NNY A;  1P2F A;  4CHU A;  2IP2 A;  3DXJ F;  3GW2 A;  4XRF A;  1PDN C;  4HA8 A;  5LHG A;  3HHG A;  1O3S A;  2RQP A;  3MQ0 A;  4A12 A;  1UB9 A;  4HX8 A;  2VC1 A;  4GYG A;  1R00 A;  3BRO A;  1IN5 A;  4FT8 A;  1SFX A;  1Z05 A;  2L54 A;  4M9X A;  3JAM Z;  4EM2 A;  1AOY A;  1OYI A;  5IT9 K;  3ISP A;  4XSX F;  3ZMD A;  3KP6 A;  3T5X A;  1P4W A;  2PMH A;  4XLN F;  2UWM A;  3MZY A;  4YII A;  4AIH A;  1Q1H A;  4M71 A;  1LEA A;  3C3W A;  3CDH A;  1QGP A;  3KP7 A;  4OU0 A;  3IKT A;  1FBU A;  5FFZ A;  4EJU A;  1K7A A;  4RGR A;  3ZMZ A;  2CWE A;  1BC7 C;  4IF4 A;  3TOA A;  1HKQ A;  5D6F A;  4U0Y A;  3FZV A;  3Q9V A;  2XAH A;  3OOP A;  2H6C A;  3L9F A;  1SD6 A;  5L3F A;  4I02 A;  1LJ9 A;  2NS0 A;  4EM0 B;  1Z7U A;  4G8X A;  1H9G A;  2GA2 A;  3F22 A;  3BJO A;  2ZNZ A;  1IN6 A;  3U1D A;  3BY6 A;  3DP7 A;  2QYO A;  2QLZ A;  4BQA A;  2Q8K A;  4M9S A;  2VBW A;  4I98 B;  2D45 A;  5CVI A;  1W5T A;  5JFR A;  3FM5 A;  1IZ1 A;  2QVO A;  4NQW A;  2ZJ2 A;  3I59 A;  2W57 A;  2W84 A;  4HF1 A;  1RZ4 A;  5D5U B;  1IRF A;  1QQI A;  4RAZ A;  2A6H F;  4P96 A;  2FA5 A;  4EJO A;  2ZCW A;  2F5D A;  3GYH X;  1LQ1 A;  1ONV A;  5D5V B;  2RNJ A;  2P5L C;  3GO5 A;  4BH9 A;  4BXU A;  2O61 A;  4UNO A;  1KA8 A;  4EGZ A;  2OD5 A;  2EFW A;  5LLQ A;  3EET A;  4IRH A;  1IRG A;  4EV0 A;  4OIR F;  4BNC A;  1ON2 A;  5K1Y A;  4EMS A;  3S2W A;  2IPQ X;  3M8E A;  5ICG A;  5K5Q A;  2GQQ A;  2HEO A;  5LHH A;  1R7J A;  4LFU A;  1LB2 A;  1EH8 A;  3LFK A;  1MDM A;  3WGI A;  3WU1 B;  2QUF A;  2MBF A;  1HKT A;  1XMA A;  4OIO F;  1OR7 A;  4I01 A;  3JTG A;  5BOX A;  3W6K B;  3TOB A;  2DTR A;  2DFI A;  4IJA A;  3E5Q A;  1YS7 A;  3NQO A;  3REO A;  1FSH A;  5D4S A;  4MNU A;  4IXA A;  5J8C A;  3LA2 A;  4YFX F;  5BMZ A;  3K1N A;  3O2P E;  5E18 F;  1U6G A;  2F2E A;  4L9T A;  2FBK A;  3F72 A;  1V3F A;  3V7S A;  1TW2 A;  2GXG A;  2H94 A;  4KYW A;  3TKY A;  4HF2 A;  1UFM A;  4AIK A;  1K78 A;  3IWF A;  2UZK A;  1F1Z A;  1IF1 A;  4LLG F;  3CJN A;  1TQI A;  5DD4 A;  1L0O C;  3KFW X;  1P4X A;  1DUX C;  4IHT A;  3I53 A;  2PN6 A;  2JPB A;  3ZMS A;  4XLP F;  1XN7 A;  4MTE A;  3FWE A;  2RN7 A;  4WXD A;  2CYY A;  2ZO4 A;  2ADU A;  3I64 A;  4WWC A;  1XSX A;  2P5V A;  1UCR A;  5BQT A;  5BPI A;  1WRJ A;  4ENK A;  5ICF A;  2K4J A;  1K78 B;  3BPV A;  5ED4 A;  4N9I A;  4AD9 A;  5HDG A;  4CO8 A;  1J7K A;  1C0W A;  3I59 B;  1BI3 A;  4IVN A;  4LK1 F;  1I1S A;  2FU4 A;  3MFK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...