4I98B

Crystal structure of the complex between scpa(residues 1-160)-scpb(residues 1-183)
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
167
structure length
167
Chain Sequence
b'STLAKIEALLFVAGEDGIRVRQLAELLSLPPTGIQQSLGKLAQKYEKDPDSSLALIETSGAYRLVTKPQFAEILKEYSKAPINQSLSRAALETLSIIAYKQPITRIEIDAIRGVNSSGALAKLQAFDLIKEDGKKEVLGRPNLYVTTDYFLDYMGINHLEELPVIDE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Segregation and condensation protein A
publication title An asymmetric SMC-kleisin bridge in prokaryotic condensin
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Cell cycle
total genus 44
structure length 167
sequence length 167
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04079 SMC_ScpB Segregation and condensation complex subunit ScpB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4i98B02
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4i98B01
5ILSA 3N4MA 2V1UA 5CVRA 2OZUA 4PDKA 3GW2A 5ILVA 3T1BA 1ZN2A 4R8HA 3IL2A 4EM2A 1K78A 3W6JB 3LAJA 2NNNA 2UZKA 2HFHA 2DLLA 2W57A 3GZ5A 5KVRA 3CTAA 4LB6B 1FBUA 3EQLF 4UVAA 5D5XB 4RAYA 4G8XA 1QBJA 2HYGD 1LB2A 1LJ9A 1FY7A 2XVCA 4GYGA 3KP2A 5ILUA 2Z9OA 4AIKA 2PEXA 4BH9A 3JAMK 2K4BA 4TV7A 1BI2A 2K7LA 1XCBA 2M1BA 3IRQA 4HDVA 5IT3A 2JPCA 1ZG3A 2MH2A 2VOOA 1LEBA 5HOOA 1Z05A 1TW3A 1XSVA 4G9YA 1FOKA 4MGRA 1R1UA 3WGIA 1CGPA 5LRSA 1R36A 1GXPA 3ULQB 3I58A 3CO7C 3L2CA 5L3DA 1W7PA 1J75A 3DV8A 5H6RA 1KYWA 2W84A 3HSRA 1TNTA 4A6DA 3V7RA 3WTYC 4WCGA 4U7BA 3WU0A 2EWNA 3ABTA 2DI3A 2L4AA 5ICFA 3QAHA 1DUXC 2W85A 1BBYA 5DD8A 4Y13A 5JVTA 2O03A 3MEXA 4ENJA 3IRRA 1S7OA 1YS7A 4ESFA 2A6HF 2VBZA 2P6SA 2CGPA 4EJTA 2ZJ2A 2PN6A 3VEPA 3QPTA 5LLQA 4KDPA 3TQNA 3WG9A 4RB2C 2QQBA 2Z3YA 2O0YA 4L9NA 3RKWA 1PUEE 1XN7A 4OMZA 1LVAA 2YX7A 3JAMZ 3HYIA 2IT0A 3F6VA 1XGSA 1Z91A 4I09A 3P9IA 4KT5C 1KQ9A 4L9JA 2OZ6A 2P8TA 1KYZA 5LRRA 1IXCA 1QNTA 1H9GA 5AIQA 2PBIA 3JSOA 2W25A 3ZQ7A 1ZREA 1P92A 3I59B 4M73A 3F6OA 1ODDA 2DT5A 4WXHA 5CVIA 2HYFA 2QYOA 4N9HA 1G3SA 3GWZA 2F5FA 3RKYA 2DK5A 1Z9CA 3T8RA 1WKMA 2MH9A 4LMYA 3COAC 5D4SA 2HKXA 4LG0A 1T98A 3WE2A 5DEQA 4UV8A 4CGZA 1FP1D 2BBYA 1DPUA 4RS8A 4GYIA 1MJ9A 2JPBA 1TBXA 2KIUA 1K78B 2H6CA 2ADUA 1SMYF 3LQQA 4LLNA 4EVIA 3FWEA 1HW2A 3ECOA 2JT1A 3I54A 1U5TB 1TTYA 3ZMVA 2NNYA 4U88A 4M6YA 4CXFA 3M7GA 2M45A 2HGCA 1HKTA 3CJNA 4MTDA 4EMSA 3M8FA 1T2KA 4KA4A 2P6TA 1T0FA 4A0ZA 3CUQC 4I98B 4PGGA 1D3YA 2X0LA 2A6EF 3IHUA 3BOQA 1ONVA 3DP7A 2VXZA 1FP2A 3FXUA 1TQIA 1U3EM 1SD5A 3PFIA 1S6LA 2KKOA 2ZXJA 3WTSC 2R7DA 2STTA 4IHSA 4KNYA 3H92A 5HDNA 3BDDA 4ENKA 3QU6A 3NQOA 4UVCA 1UFMA 1D5VA 3R0JA 4AVPA 1MDMB 3I4PA 2EFQA 1IUYA 1SFUA 1IRGA 4R1HA 2HOEA 1IW7F 3MZYA 3E3VA 4HF1A 3FXRA 4G7HF 4M72A 1XDUA 2KJBA 2MC3A 1XMKA 4WWCA 2PJPA 3KE2A 1OYYA 3K69A 2MBFA 3CO6C 1FWZA 3ECHA 3V8KA 3KP5A 3J81K 1QPMA 2FNPA 5F64A 1MZBA 1ZRDA 4XLNF 3SHFA 4L5IA 2V1XA 3IKVA 1MJAA 3G73A 4BNCA 2YPRA 3KLNA 1REPC 5LEJA 2HS5A 1IN6A 2PQ8A 2G7UA 3ABUA 4RB1A 3E6MA 3HHGA 5J6XA 3BPVA 1PP7U 4FHTA 1STZA 4UXNA 3L00A 4LB5A 1S3JA 3LA3A 4LFUA 1ZG1A 2VOPA 5E1XA 4A6EA 3KETA 2VONA 4I7HA 1F4KA 1Z6RA 2LKPA 4A12A 3F21A 4LG0B 5HVQC 3C1DA 2DFIA 5E17F 2FBKA 3PQKA 2A68F 3SZPA 2RGVA 4P9UA 1W5TA 1IN4A 3IWFA 2LNBA 2HDCA 1LNWA 4Q5SF 1R58A 4S05A 4KFCA 1QGPA 3LA7A 2CSOA 1YO5C 3TDUC 2H27A 3BROA 3WGGA 2VBYA 2XAHA 3F8FA 1BI3A 2UXXA 1HKSA 4ESJA 3TDZC 1ZARA 3J81Z 2DTRA 3GUDA 4ZH4F 1YS6A 2Q8KA 1XD7A 4CO8A 1WSUA 4GXOA 3J7AO 3LAPA 1YQAA 4OU0A 1U78A 2HWVA 4P9FA 5E8IA 4EJOA 3TO7A 2XAFA 4M74A 2D1HA 2DQLA 2FU4A 5AIPA 2IW5A 1W7PD 3WTWC 2STWA 1F5TA 3IWZA 2QZ8A 1U8RA 1F1ZA 3KZZA 2NS0A 2HR3A 1XDSA 2DW4A 3T0YA 3F8NA 1MGTA 4EJUA 1XMAA 4FX0A 3ZP5A 1O7FA 4Y17A 2HTJA 2QWWA 1SMTA 3ISPA 5ED4A 3K1PA 3JTHA 1G3WA 2VC1A 4YG2F 1TQPA 2P7CB 2K27A 4ASNA 1YW8A 1XSDA 4M9ZA 2V1DA 1BI1A 1JE8A 2F5EA 1MKMA 1O3SA 3MAJA 2O3FA 3RIRA 1PP8F 1F9NA 3P7NA 3GFIA 1EH7A 1D8KA 5BPIA 3JW4A 2IJLA 2O8XA 2P4WA 4LK1F 2DQRA 1EV7A 2OQGA 2Z33A 4IF4A 1J5YA 2QBYB 2J5PA 4F7ZA 3HHHA 2GWRA 2MLGA 1IN5A 3F22A 1I1GA 3H3ZA 2ETHA 4OIPF 4IRHA 1ON1A 2D2WA 3P9KA 4AIHA 2A07F 1XB4A 1UHMA 1PDNC 1ZRFA 4EGYA 3ZMTA 4JBAA 4KIBA 4P55A 3RI4A 5K5QA 3TOBA 4O3MA 5ERIA 3EDPA 3Q9SA 2E1NA 5TRDA 2ISZA 2CW0F 5D5WB 1YFHA 3E6BA 4UHTA 2RV8A 2KIFA 3F72A 2FSWA 2OD5A 3F8MA 2IA0A 1P4AA 1TQMA 3KP3A 5DCMA 3R60A 5D8KB 3EYIA 1J7KA 5DCFA 4I0AA 2RVCA 3TO9A 1O57A 1USTA 1P2FA 2IA1A 3GO5A 4O6JA 4HW0A 4XBFA 1P4XA 2DK8A 2DO7A 2GA1A 5K5OA 3R0AA 2LSOA 1V4RA 2JRTA 2ZMEB 5BQTA 4L9TA 1IZ1A 4ZYHA 3CDHA 3HSFA 4HV5A 5HDKA 1I5ZA 2HZTA 3GYHX 4RGSA 2RC4A 3QPHA 1Z6TA 3JSPA 2L3DA 3QRFF 2XV4S 4LLLA 3CUQB 4U7DA 2BEOA 4YIFA 2GQQA 3S2WA 1S8NA 3E5UA 2K86A 4OOIA 3GXOA 4Q4ZF 2NYXA 3F8CA 2QQ9A 4IPAA 5FFZA 5FO5A 3GFJA 4MQ9F 5EEGA 2ZNYA 3CLOA 1I1SA 1EH8A 1KA8A 2F5CA 2VT2A 4I01A 3MCZA 3MQ0A 5JI6A 2GXBA 1B6AA 5FD6A 1E17A 5K1YA 1FYKA 1ZLJA 4LJZF 5JFRA 4K2EA 3ZMSA 2FBHA 2EA4A 2PLYA 1CF7A 4ZZDA 3K1MA 3HSEA 1E2XA 3LA2A 5LBQA 5HLIA 1B1BA 2Q2EA 2K4JA 4MNUA 4XLPF 4WX9A 3SXYA 1MD0A 3WTUC 2MA3A 1R1TA 3GLXA 2EFNA 5AONA 1FBSA 1SD7A 1WQ2A 4JK1X 1L0OC 2YX4A 5CLSA 3E5XA 1W4MA 5LGUA 3B73A 5BMZA 1WRJA 2IPQX 1JHFA 3BZ6A 2GAUA 3KEOA 3C18A 1ZG5A 2E1CA 3KEQA 3RYRA 5HS9A 1R00A 3EUHA 1J59A 5LGNA 5J8CA 1USSA 3B02A 2JZYA 5LGTA 1U6GA 3BPXA 1QZYA 5H20A 4A2UA 2A69F 4U0WA 4AD9A 1XGOA 3GZ6A 3KCCA 4KIGA 4WK8F 1BC7C 2EB7A 2OA4A 2PMUA 5D8LB 2NRAC 1XSXA 3Q9VA 4G7OF 1O3TA 2VBXA 2QVOA 1G6NA 1ZRCA 1W7PB 2ESNA 2V6CA 4IVNA 1MJBA 3WTVC 3V8LA 4L9VA 2WWYA 2IA2A 2O6GE 1G3YA 4M9SA 1IXRC 3HOTA 4CYDA 5BOXA 5FD5A 1O7LA 3C3WA 3W6KB 1KU2A 3BWGA 1ZGAA 1BI0A 2CFXA 2F5DA 2QM3A 1AWCA 5KK1A 3LQRA 4HF2A 2LDUA 4OIOF 1B4AA 2DPUA 2XRNA 2CYYA 2W24A 1ZGJA 1JHHA 2FE3A 4WXCA 4AIJA 4MEXF 4IHTA 4P5OA 3WTXC 4UVBA 3O6BB 2KJCA 2R7FA 3DF8A 2ZCWA 2FA5A 4A0XA 5D4RA 6PAXA 1BIBA 3GEZA 5DUIA 2OBPA 2RQPA 3BP8A 4XSXF 2DU9A 1HBXG 1QZZA 1UB9A 1R7JA 2P5KA 2HKOA 1I6XA 3TKYA 3FXQA 1R1VA 2MLKA 3I5UA 4L0ZB 4YIIA 3WU1B 3EYYA 4EGZA 2NAZA 1O3RA 2ZO4A 4HQEA 4UV9A 5CVJA 1FC3A 2EA2A 1KQ8A 1HQCA 1OR7A 5ICEA 2M30A 1SD6A 1R5GA 2GZWA 1YYVA 2FEZA 4Q48A 2CG4A 1TNSA 3ROUA 2ZBKA 1IAWA 3JTGA 2ELHA 2AXLA 4CICA 5ICGA 1ON2A 1C0WA 1BOAA 1HSJA 3ZPLA 3WGHA 4IRGA 3ZMUA 1RNLA 4RAZA 3L9FA 2FQ3A 2CO5A 4Q47A 3I71A 5D5UB 4A5MA 4U0YA 2ZNZA 3ERED 4FT8A 5H6QA 3V4GA 3REOA 3KP7A 4HYEA 2WTEA 4H0EA 2A3SA 1RUOA 2F2EA 4GO1A 3WE3A 3OOPA 4A5NA 1A04A 3VODA 4HAMA 4LGWA 3SFZA 2Q0OA 3WTTC 2ACJA 4FX4A 4MHGA 5J8FA 2IVMA 2XASA 5IT9K 2Z99A 4LK0F 5ICCA 1B9MA 1R22A 2XAQA 4ENNA 2XUBA 3ZMZA 4G94A 1KGSA 5E1ZB 2UWMA 3FMRA 2E7XA 5L3EA 5L3BA 1FPQA 4G6QA 4O5VA 2PI0A 3R4KA 2FXAA 5BPDA 4HOBA 3RDIA 4PZJA 4B8XA 1LQ1A 4E70A 2COMA 4LD5A 2A61A 5HS7A 2X4HA 4MEYF 4I2OA 3K9TA 1HW1A 1OPCA 5CVUA 1VTNC 2BYVE 4RGRA 3HRUA 3E6DA 3F8BA 3FZVA 1KQ0A 1T6SA 1TW2A 3LFKA 1H9TA 3HOSA 3O3KA 2Y48A 1FZPB 2HEOA 5FLXK 4HBLA 4ZYDA 1BC8C 3BJOA 2KRFA 4OINF 4BHPA 3G3ZA 3HTSB 2GIVA 5DD4A 3H3UA 3GF2A 3R6SA 2VT3A 2EK5A 2L54A 1KU9A 1BM9A 3BY6A 2RN7A 5IT9Z 3F23A 3MFKA 3TGNA 4BAYA 1WWXA 4ON0A 1YG2A 4HZFA 2G7HA 1U5TA 1GHCA 5K5RA 2ESHA 3FF5A 1H0MA 2ISYA 3LWFA 3D0SA 2FF4A 1DDNA 2CWEA 2JSCA 4YFKF 4EJVA 5DDGA 1HSTA 2H09A 3RPUA 3DFGA 3FHZA 4IJAA 3QP6A 2EJRA 4HA8A 1ZLKA 2XAJA 2IP2A 2VE8A 2L01A 4KIFA 4IXAA 2RNJA 2HQRA 4XSZF 1DP7P 3DEUA 4CZZA 4MTEA 4DQ2A 1RZ4A 3DPLC 5LHGA 2LF7A 3VB2A 4KMUX 5FGMA 4YFXF 5FLXZ 3GX4X 1MDMA 2UXNA 2FMYA 4HF0A 2PMHA 4L5JA 1IRFA 4Z2YA 4BQAA 1YW7A 5BS6A 2J5OA 4YFNF 5E20A 5JHUA 1S29A 5F6FA 4L0YB 1B9NA 4KUMA 1DPRA 5CYVA 2M87A 2QUFA 3U9GA 2OAZA 3E6CC 2Z5UA 4WXDA 4A0YA 2OU2A 1V3FA 2DPDA 4HX4A 3VFZA 5HDGA 3DQVC 5DV5A 3ZN0A 4ZYEA 4RB3C 2L4MA 4BHCA 2PG4A 1P4WA 2EFWA 2QENA 2BV6A 2GXGA 2XHKA 2XROA 3I53A 1J9IA 4B09A 4ZYGA 1P6RA 1Q1HA 3BJ6A 4G6DA 3F3XA 1G4DA 4EM0B 5CJ9A 3HRSA 4S04A 3FM3A 2FBIA 3N97A 4I02A 1D8JA 3RTRA 2AS5F 1SFEA 1X3UA 3HRTA 3E5QA 1IF1A 1AOYA 3ZMDA 1EH6A 3TO6A 2CQKA 2V79A 2C6YA 1LDKB 2HQNA 5D6EA 4UUVA 1B59A 1ZAOA 2HTSA 3ZN1A 1NHAA 2VE9A 5E1WA 2P7VB 2P5LC 2P5VA 5TJJA 1QO0D 1ZH5A 1BN5A 4EM1A 2KIMA 2Y0MA 4LLGF 2DBBA 1Z1DA 2YSRA 4NHJA 3FM5A 3ML6A 2B0LA 2BGCA 3ELKA 3U2RA 4BHBA 2H94A 2EFPA 2M5WA 4OIRF 4P96A 3FMQA 4KICA 2LF8A 1KU3A 1ULYA 4XRFA 4I0BA 2D1VA 1FT9A 1LDJA 4GGGA 3C7JA 3Q5FA 1BJAA 1K6OA 4BYYA 5A2QK 2V9VA 4WF2A 5E8GA 1RUNA 5DCMB 4KN7X 4KMFA 1KU7A 3V7SA 1OMIA 2GA2A 2YR2A 3GVAA 2QLZA 5DUKA 3OV8A 1O3QA 2MD5A 2ZKZA 1UCRA 1UHWA 1T38A 2JTVA 4KN4X 1T39A 5F1RA 4HDUA 5CVVA 1FSEA 3EETA 5L3FA 1OKRA 2DAOA 1TLHB 1IN8A 2YU3A 1K7AA 3RKXA 3V7CA 4HLXA 3NEUA 2WC2A 2FOKA 1R5HA 2XKOA 3KZYA 3P9CA 3GFMA 4M9XA 2FRHA 1HKQA 4EV0A 4GCVA 3HIFA 5LHIA 4D0PA 3KFWX 3GFLA 4PGHA 4R79A 2XIGA 2H6BA 3J80K 1YIOA 4HX7A 4PCQA 4HQMA 1YLFA 2QQAA 3QP5A 3WODF 5LEKA 2VC0A 3MZHA 1Y0UA 1GVJA 1U2WA 1OYIA 4M71A 3T8TA 3U1DA 5A2QZ 2EV6A 2EV5A 1J2XA 3DPTA 1FYMA 4RB0A 1XGNA 3PQJA 3D5LA 4HLYA 4EQQA 3AAFA 3K2ZA 3RJPA 1SD4A 4DNCA 3SZTA 4CDGA 2QBYA 2RKHA 5E18F 4N9IA 3WTZA 4NB5A 1U5TC 1XCVA 5HS8A 3FX3A 5DYMA 1YW9A 3IC7A 1FLIA 1FNNA 4ENMA 4JQFA 3KLOA 1FX7A 5D6FA 1CF7B 3RYPA 2R3SA 1IXSB 2L02A 2RDPA 3I64A 3QOPA 2XKPA 3FMSA 4OIQF 3T5XA 1ZYRF 4ZZLA 2A5YB 4CHUA 5FFXA 1S7AA 3HUGA 4ETSA 4U0VA 1LDDA 1OYWA 2FNAA 1BIAA 1HXDA 3DKWA 1FSHA 3J80Z 4AWXB 2BE5F 2IRFG 1LEAA 5HLGA 3IKTA 3LSTA 1HW5A 1R23A 2EV0A 1FYLA 5L3GA 1XGMA 2O61A 1I27A 3NRVA 3R61A 2XGXA 4OMYA 2Y75A 1SFXA 1FBQA 5LHHA 1QQIA 3V8JA 1ZHFA 3VOEA 3I0TA 1K79A 4NQWA 5FB2A 2VBWA 3HRMA 2ZMEA 3L09A 1JXSA 5L3CA 4KYWA 1IN7A 3KP6A 1RIOH 2PFBA 3CUOA 4L18B 4M6XA 4BXUA 5HLHA 2WV0A 2FMLA 2TDXA 4IRIA 2G9WA 3MWMA 4QWQA 3E97A 1JGSA 3DXJF 3O2PE 1J0RA 3TOAA 4ESBA 1Z7UA 4QLCU 1YTYA 4UNOA 3CUQA 3RPQA 3SQNA 4Y15A 2K02A 1WI9A 1W5SA 3HTUA 3BJAA 5D5VB 2VN2A 4RGUA 1G3TA 2E7WA 1SAXA 5EEHA 4RGXA 3K0LA 4MQVA 4G7ZF 5JR3A 4N0BA 3I59A 2D45A 1GXQA 2XAGA 3QU3A 2VODA 3L7WA 3M1EA 4HV6A 3K1NA 1RI7A 2EFOA 4HX8A 2ZFWA 3M9AA 4EJWA 2M8EA 2OQRA 1L3LA 3M8EA 3KP4A
chains in the Genus database with same CATH superfamily
5ILSA 3N4MA 2V1UA 5CVRA 3PFYA 2BXYA 4DYCA 2OZUA 4PDKA 4RA2A 3GW2A 5ILVA 2QQ8A 4XLCA 3T1BA 4BGDA 1ZN2A 4R8HA 2R4GA 3IL2A 4FISA 1ZQ3P 3AKZA 1W36D 4FQGA 4EM2A 1K78A 4B4CA 3W6JB 4AIDA 3LAJA 2NNNA 2UZKA 3CC7I 4RM3A 2HFHA 2DLLA 2W57A 3GZ5A 5KVRA 2R7RA 3CTAA 4Z6YA 2EZHA 4LB6B 5GP9A 2V4JC 1FBUA 3EQLF 1WJEA 4M3EA 1HOMA 1R71A 4UVAA 3BG3A 5D5XB 4E7HA 4RAYA 4G8XA 1QBJA 2B9SA 2HYGD 4KISA 1J09A 1LB2A 2X51A 1LJ9A 2X6WA 1FY7A 2XVCA 4GYGA 4BJTA 3MD2A 3KP2A 2WB1A 5ILUA 1RKTA 1YJNI 2Z9OA 1TT5B 4AIKA 2CUJA 2O5RA 2PEXA 3RKQA 2K9LA 2HQAA 4BH9A 3JAMK 2K4BA 4TV7A 2H8RA 1BI2A 2K7LA 3OYBA 3K4LA 1XCBA 2M1BA 4LITA 3IRQA 4HDVA 3OS0A 5IT3A 3HUGB 2NVXJ 2JPCA 1E3PA 2K85A 3I9V2 1ZG3A 1MMAA 2MH2A 2VOOA 1LEBA 5HOOA 3BTJA 2VJ4A 3JR9A 1Z05A 2V6EA 1TW3A 1XSVA 2FQ4A 2DFFA 4G9YA 1FOKA 4MGRA 2GLOA 3K4CA 2Y9YA 1BOBA 1Y8RB 1R1UA 2MFZA 3MKWB 3WGIA 1CGPA 5LRSA 1R36A 1YX3A 1GXPA 4ZC3A 4G6TB 2EZIA 3ULQB 1Y0NA 3I58A 2JVHA 2DA2A 3L2CA 3CO7C 2A5WA 2BW3B 2K5CA 5L3DA 1U9NA 5EGOA 1W7PA 4MIMA 4AYBN 1J75A 3FXJA 3DV8A 5H6RA 1POGA 2CUZA 1V5EA 1UAAA 1KYWA 2W84A 3IH2A 3A2KA 4NQWB 3HSRA 3CCEI 2HXOA 2DFEA 3BG7A 1A36A 1TNTA 4A6DA 3V7RA 3OYFA 3WTYC 3VYTB 4WCGA 4U7BA 2LBFB 3WU0A 2EWNA 3ABTA 3X2QH 3BG5A 4C30A 4AC0A 2DI3A 2L4AA 5ICFA 3QAHA 1DUXC 1FOXA 2MG4A 2W85A 1BBYA 3A01B 1FJLA 1V5GA 3RSNA 2R5ZA 5DD8A 2O7OA 1K61A 3NARA 4Y13A 5JVTA 2O03A 3MEXA 4YEJA 4ENJA 3IRRA 1S7OA 1YS7A 4ESFA 1BW5A 2A6HF 2VBZA 4BEHB 2P6SA 2CGPA 3JCUC 2ZJ2A 3OR2C 4EJTA 2PN6A 3FK7A 3QPTA 2DDAA 3VEPA 5LLQA 3OS2A 4KDPA 5F0FA 3TQNA 3WG9A 3OYAA 1A35A 3V42A 3PO3J 4RB2C 2QQBA 4XLAA 2Z3YA 2O0YA 3PM1A 4L9NA 2VJJA 3RKWA 3DBLB 1PUEE 1JGGA 1XN7A 4OMZA 3K70D 1LVAA 2YX7A 3JAMZ 3HYIA 2IT0A 5CQEA 3F6VA 1AA7A 4XKCA 2PJRA 1XGSA 1Z91A 2KP6A 2XPWA 4I09A 3P9IA 4KT5C 1KQ9A 4L9JA 2OV7A 3DWLE 2OZ6A 2P8TA 1HCRA 4XN3A 1KYZA 1IUFA 5LRRA 3CQZJ 2XPVA 2B63J 1IXCA 3H3VK 1X1PA 1QNTA 1H9GA 5AIQA 1IRZA 2PBIA 2CV1A 2Y0SA 3RCOA 1GV5A 5FRMA 2MSYA 3JSOA 2W25A 4F91B 2M34A 5J1YA 3ZQ7A 4E6KG 1ZREA 1VQPI 1P92A 3BR0A 3I59B 4M73A 1YOVB 3F6OA 3U21A 5GTHC 1ODDA 2DT5A 4WXHA 3ZRGA 1MNMC 3S14J 3S16J 5CVIA 1ZKGA 2HYFA 2QYOA 9ANTA 3ZQLA 4N9HA 1G3SA 3GWZA 2F5FA 3RKYA 2ZJQF 5KAIC 3GLLA 4XKBA 2DK5A 1MMGA 1Z9CA 4AUXA 1VQ9I 1UHSA 3T8RA 3HZJA 1WKMA 2CFOA 3CD6I 4BY1J 2MH9A 3QOEA 4LMYA 3COAC 5D4SA 2MD0A 2HKXA 2VXDA 4LG0A 3HG9A 4NC6A 1T98A 2L5QA 3WE2A 5DEQA 3RQ4A 4UV8A 2JA6J 4CGZA 1FP1D 1IO2A 3ZQCA 2BBYA 1DPUA 2IBDA 4RS8A 2QF7A 1P7JA 5DM7F 2ECCA 4GYIA 2W4SA 4N4NB 4UUSB 1MJ9A 2L2OA 2JPBA 2BHYA 2NS7A 3PNTA 3S3MA 3BT9A 1TBXA 2KIUA 3F0CA 1K78B 1X2MA 2H6CA 1VF9A 4GRIA 2E1OA 1I3QJ 1Z7LA 1SMYF 2ADUA 3CDIA 3LQQA 4LLNA 4RDUA 4QIWN 3NWTA 4EVIA 3FWEA 2HOSA 1PYVA 1PUFA 4J00A 1HW2A 2ZMEC 3ECOA 1ZGWA 5FKOA 2JT1A 1Z0XA 1OISA 3I54A 3IP4B 1JI8A 1U5TB 1FOYA 1TTYA 4JX4A 3ZMVA 1X19A 2NNYA 1RR7A 4U88A 4A3EJ 4M6YA 3S1QJ 4A69C 4CXFA 1MBGA 3ZOBA 3M7GA 3W3CA 2M45A 3JRFA 2JA7J 2HGCA 2LY2A 1HKTA 3DPUA 3OR1C 3CJNA 2W48A 4MTDA 4EMSA 3M8FA 2JA8J 4A3GJ 1T2KA 1SANA 3KEYA 3OIOA 4KA4A 3CLQA 2E2JJ 5F27A 2L7KA 2P6TA 3HOYJ 1X3WB 1RETA 1T0FA 4A0ZA 1MSEC 3CUQC 4I98B 4PGGA 1D3YA 2X0LA 2A6EF 3IHUA 2VKHA 3BOQA 4NBQA 1Y39A 1ONVA 3UR3C 3DP7A 2CJJA 4V19K 2VXZA 1FP2A 1MNDA 4LG3A 2CUEA 3FXUA 1TQIA 1BR1A 3SDGA 3PIPF 1U3EM 2LC2A 1SD5A 5FKMA 2E1MC 3PFIA 1S6LA 2KKOA 2ZXJA 3C2BA 3W6VA 3WTSC 2R7DA 2XGEA 2STTA 4IHSA 4KNYA 3H92A 5HDNA 1R5ID 4B44A 3BDDA 4ENKA 1WJDA 1WJAA 3QU6A 3NQOA 4UVCA 1UFMA 3S32A 1D5VA 3R0JA 1B72A 4AVPA 1MDMB 3I4PA 2EFQA 1IUYA 1SFUA 1IRGA 3FKIJ 1E0EA 2KRCA 1MH4A 1TZLA 4R1HA 5TGTA 2HOEA 5B1AH 1IW7F 2X6YA 3MZYA 2ZC2A 3E3VA 3FXOA 1B8IA 1S7EA 5IPAA 4HF1A 3FXRA 1K4TA 4G7HF 1DQUA 2MC4A 4M72A 1XDUA 2VPLA 1CQTA 2KJBA 2COBA 1XMKA 2MC3A 2E35A 4QSHA 1P9QC 5GPCA 1FIPA 3K4JA 2DTZA 3KYCB 4WWCA 5J40A 2PJPA 2VIXA 3S15J 4BQOA 3ABKH 3KE2A 3MZ8A 3HB9A 1OYYA 2H8WA 2MBFA 3K69A 4CYCA 3CO6C 1FWZA 1DP3A 1OLTA 2L7ZA 3VWBA 3ECHA 1MMNA 2BY3A 3V8KA 2E5ZA 4PSXA 2DOAA 2IGMA 3KP5A 3J81K 1QPMA 2FJ1A 3BC8A 2FNPA 5F64A 3DLLF 1MZBA 1OCCH 3LSGA 2F4MB 3HGGA 4B47A 1ZRDA 2B7EA 4XLNF 3SHFA 4L5IA 2HU9A 4HNUA 1GVDA 4HEA2 4PSWA 2R7VA 2V1XA 3IKVA 1MJAA 3CJQB 2Y30A 2L9SA 3G73A 2WA0A 3BR1A 1XS9A 2PJRB 4BNCA 2YPRA 1R6RA 3KLNA 1REPC 2K3PA 3IH3A 5LEJA 3RZOJ 2HS5A 3VYUB 1IN6A 1MNEA 2PQ8A 1X1BA 2HYJA 2G7UA 3ABUA 1UG0A 2X1DA 5B66C 2EH3A 4XRSG 4RB1A 3E6MA 4NC8A 3L2WA 3HHGA 5J6XA 1WCMJ 4BACA 3BPVA 1PP7U 4FHTA 3TP0A 1STZA 2VQLA 4PJJA 4UXNA 3L00A 1ZK8A 3BR6A 1TWCJ 3IV5A 4LB5A 1S3JA 3LA3A 1WJFA 4LFUA 2E2IJ 1X1DA 2JVGA 4NUBA 1ZG1A 2VOPA 3CMEI 1AHDP 3OYJA 2IAIA 1U9OA 1OCZH 1MBKA 2JMWA 5E1XA 4A6EA 4E7ZA 3NAUA 3PUBA 3KETA 2VONA 3GTGJ 4I7HA 5B5EC 1NH3A 1F4KA 1SVMA 1Z6RA 2LKPA 3DKXA 4A12A 3S93A 3F21A 2R7QA 4LG0B 3AL0C 5HVQC 3C1DA 4MFDA 2DFIA 4BKXA 5E17F 2FBKA 3PQKA 4UB8C 2A68F 4RBOA 1X1AA 3SZPA 3P5JA 4D5FA 2RGVA 1XG1A 4P9UA 1W5TA 1IN4A 3IWFA 2LNBA 3D5RC 3LOCA 1LNWA 3FIWA 4MLOA 4DIQA 2HDCA 4Q5SF 4M6VA 4ITVA 1SC7A 1LFBA 3IAM2 3I56I 2QA4I 1R58A 1XX5A 5F04A 2QCOA 4S05A 4KFCA 1QGPA 3LA7A 2CSOA 1YO5C 3TDUC 3A4CA 2H27A 2MGQA 3BROA 3BTIA 4II2A 3WGGA 2JSPA 2VBYA 2XAHA 4B48A 3F8FA 1BI3A 3W2WA 4A3JJ 2UXXA 4QPQA 4X0GA 1HKSA 4ESJA 3TDZC 1ZARA 3J81Z 5DM6F 4A3DJ 3SDBA 2DTRA 4FETA 2OCCH 3DBHB 2D5VA 3B6CA 3GUDA 2XAUA 4ZH4F 1LFUP 1YS6A 3S1MJ 2X1CA 4XR6A 2LG4A 4B1RA 1RC9A 2Q8KA 1XD7A 1NTCA 4CO8A 4BDYA 1WSUA 4GXOA 1JKOC 3J7AO 2L0KA 3LAPA 1YQAA 3IH4A 1EJ9A 2I5UA 3E1SA 3N05A 4OU0A 1EF4A 1U78A 2HWVA 4HNTA 1ZTRA 4P9FA 4UY8I 1Z67A 3ZQFA 3QPLA 3H9GA 5E8IA 4EJOA 3TO7A 2XAFA 4C3JJ 3M1CA 4M74A 4RLFA 4OWRB 4DYQA 2D1HA 4C2MJ 2DQLA 1VQ6I 2FU4A 5AIPA 2IW5A 2AO9A 1W7PD 3WTWC 4C2UA 2STWA 1F5TA 3DU6A 3IWZA 1VQOI 2WY7Q 2QZ8A 1D1AA 1ZR4A 1U8RA 4A3BJ 1F1ZA 1D0XA 3KZZA 3G4SI 2NS0A 2HR3A 1XDSA 2DW4A 2L9RA 3T0YA 5FJ8J 2Z2SB 3F8NA 1MGTA 3U1KA 1ITYA 4EJUA 1B72B 5CKTA 1XMAA 3BLYA 4FX0A 1JKQC 1W36C 3ZP5A 1TC3C 5EZHA 1O7FA 4XK4A 3S1RJ 4Y17A 3OL4A 3CCQI 4BE2A 2E19A 2BZTA 2HTJA 2VQCA 2QWWA 1SMTA 3ISPA 5ED4A 3K1PA 3JTHA 1VQNI 1G3WA 2VC1A 4YG2F 1TQPA 2P7CB 4F52A 2YS9A 5EYRA 1R9TJ 5FKLA 2K27A 4ASNA 3HXLA 1YW8A 1XSDA 3DEWA 4M9ZA 2V1DA 2HOAA 1BI1A 4IKFA 1JE8A 5E79C 3BTCA 5E3OA 3LSRA 4XRSA 2F5EA 1MKMA 1O3SA 1OCTC 4BU2A 2BHZA 2A6TA 3MAJA 3FXKA 3CJTB 2K9QA 2IS4A 4F93B 2O3FA 3KX2A 3RIRA 4M3GA 1BL0A 1PP8F 4ANJA 2BVLA 2V26A 2JWTA 2RREA 3E7LA 3L2VA 1F9NA 3JRHA 3PNYA 3P7NA 3GFIA 1EH7A 2R7ZJ 1D8KA 5BPIA 2XSJC 2IJLA 3JW4A 2O8XA 2P4WA 3DU5A 4LK1F 2DQRA 3DTEA 2ZJRF 1EV7A 2OQGA 2Z33A 3WU2C 2F4OB 4IF4A 2NVTJ 1J5YA 2QBYB 2J5PA 2DJIA 4F7ZA 3OYLA 3S17J 3HHHA 1N78A 2GWRA 4A3LJ 2MLGA 2QKLB 1IN5A 3L2QA 3F22A 4IHYA 2WV1A 1I1GA 1LVKA 2LYCA 3H3ZA 4RMNA 3G1MA 2ETHA 2KMUA 1VQLI 4OIPF 4IRHA 2LLKA 1ON1A 2D2WA 2E5NA 3P9KA 4AIHA 2A07F 2FUG2 1XB4A 1HF0A 3CDLA 5EF6A 1UHMA 1PDNC 3CCUI 1ZRFA 4EGYA 3ZMTA 4FE7A 4JBAA 4KIBA 4P55A 4ZDPA 2XDVA 3PSFA 3RI4A 5K5QA 3BQYA 3TOBA 4O3MA 5ERIA 3EDPA 4BUPA 4FASD 2WB1N 1T0FC 3Q9SA 2E1NA 5GAGJ 5TRDA 2ISZA 5M5YJ 1YI2I 1X1CA 1YE9A 3OYIA 2HVSA 2CRGA 2VKDA 2CW0F 3OWTA 3Q0UA 1U8BA 3AG2H 3CCVI 5D5WB 1YFHA 2NS8A 3E6BA 1K6YA 4UHTA 2RV8A 2KIFA 1ETVA 4W1UA 3F72A 2FSWA 2OD5A 3K6GA 3KZIC 4XLEA 3F8MA 2IA0A 1P4AA 2QGUA 5FKKA 1QA6A 3IUOA 1TQMA 3SEZA 3KP3A 4BL0B 3NWSA 5DCMA 2BXZA 3R60A 3ERMA 2CW7A 5D8KB 3EYIA 4B3XA 2E2HJ 1HA8A 1J7KA 2CMPA 2L7FP 5DCFA 4I0AA 2RVCA 1LE8A 1IG7A 2EIJH 3OYKA 4D5CA 3TO9A 1O57A 1USTA 3K70C 1P2FA 1NG7A 1Z21A 3BG6A 4I76A 3FBIB 2IA1A 3CZ6A 4IX7A 3GO5A 4O6JA 4HW0A 2XRLA 4XBFA 2XF5A 2CS3A 1P4XA 2YUSA 2DK8A 3MMYB 2DO7A 2GA1A 5K5OA 4BBSJ 3R0AA 3M07A 5C3EJ 2WADA 2XSDC 4X1EA 2LSOA 3RZDJ 4CCLA 1V4RA 2P81A 2JRTA 2ZMEB 5BQTA 4PFPA 4L9TA 1IZ1A 3I4MJ 3EPZA 4ZYHA 2DMNA 4AYBA 2QSHX 2M0MA 1T8IA 3CDHA 3LMMA 2NVQJ 5M3FJ 3HSFA 3DBRB 2HXIA 4HV5A 5HDKA 2OUMA 1ZELA 1OJLA 1I5ZA 4FE4A 2HZTA 3GYHX 1LFPA 3DCFA 3GBGA 4RGSA 3J7AY 5LD2C 2Y9ZA 1JT0A 2RC4A 1SFKA 3CJRB 4BXFA 1X4OA 1R4MB 3ZQQA 4CCKA 3QPHA 1Z6TA 3IAS2 4A93J 1TWHJ 3JSPA 2DOEA 2L3DA 3QRFF 2XV4S 4LLLA 1BW6A 3CUQB 2XGDA 4U7DA 2BEOA 2LTPA 4YIFA 3HKZN 2GQQA 3S2WA 5GTIC 2Z16A 1S8NA 3E5UA 2K86A 2UV1A 2GOXB 4OOIA 4F55A 3GXOA 2F5VA 3CCYA 4Q4ZF 2NYXA 1WPKA 3FKJA 3F8CA 2E1MB 4C9YA 4ZDLA 1NK3P 1QVUA 2QQ9A 4IPAA 4RLQA 1JUMA 3H9JA 5FFZA 1QVTA 5FO5A 3JRDA 3GFJA 4XL9A 4MQ9F 5EEGA 3DEEA 3K7AJ 2ZNYA 3CLOA 3LSHA 1I1SA 4ZDOA 1EH8A 1KA8A 2F5CA 3Q0VA 4Y3OA 2VT2A 3S2DJ 1DU6A 5M5XJ 1JT6A 3MCZA 4I01A 2JQ7A 5J3LA 3OS1A 4F92B 2FOWA 3HOXJ 3ZGKA 3AG1H 3MQ0A 2V1NA 3QYFA 3S3NA 5F1JA 5JI6A 2GXBA 4A3MJ 1B6AA 5FD6A 1Y1WJ 1E17A 5K1YA 1FYKA 1ZLJA 3KIOA 2LFBA 4LJZF 5JFRA 2BVMA 4K2EA 3ZMSA 4Y4RA 1G2HA 4ZJZA 2GM4A 2FBHA 2XB5A 3H9QA 4PFOA 2EA4A 5HNHA 2NVYJ 2PLYA 1CF7A 1JKPC 4ZZDA 3K1MA 3WHCA 3HSEA 1E2XA 3TEDA 4D1QA 5IOZA 3SJMA 3LA2A 5LBQA 5HLIA 1B1BA 1MMDA 2Q2EA 2K4JA 2JRMA 3CMMA 4BDZA 1MBEA 4MNUA 4XLPF 5M3MJ 4WX9A 1JTXA 2EPFA 1MBFA 3SXYA 1MD0A 3WTUC 2MA3A 1R1TA 3GLXA 2KDZA 2EFNA 3GCMA 2XF7A 5AONA 2A05A 4XKVA 1FBSA 1SD7A 3CMYA 1BR4A 1WQ2A 2VJ5A 4JK1X 3JRGA 1L0OC 2ME0A 2NXNB 1T95A 2EQRA 2YX4A 5GAHJ 1ETOA 3ASOH 2AQEA 5CLSA 1XPXA 3BR5A 3E5XA 2XB0X 3VYRB 3K4NA 1W4MA 3CMAI 1E3OC 5LGUA 3B73A 5BMZA 1WRJA 2IPQX 3PUFA 1JHFA 1Y6IA 1T56A 2KRHA 2L9VA 4BY7J 4E7SA 1H88C 3BZ6A 2GAUA 3KEOA 3LNQA 3PJRA 1ETQA 2ELJA 2MABA 3BR2A 1R49A 2FX0A 3OYCA 3C18A 1ZG5A 3CP2A 1QPIA 2E1CA 3QWLA 3KEQA 1WH5A 2VI6A 3RYRA 2DYRH 5HS9A 3CCLI 3HGYA 1R00A 3EUHA 4IEJA 3BQZA 3E0JB 1WHUA 1J59A 3FXLA 3I3LA 1P7IA 4DZJA 5LGNA 1WZ2A 1MMSA 2OF7A 1Y56A 5J8CA 1USSA 3B02A 2ZSHB 2JZYA 3BPXA 1U6GA 5LGTA 5E3MA 2W7NA 1YJWI 1QZYA 5H20A 4AVZA 3AL0B 4A2UA 2A69F 3GTLJ 4U0WA 4AD9A 3GTOJ 2CQ7A 3KP4A 1XGOA 5FROA 1APLC 3GZ6A 3ABMH 3KCCA 4KIGA 4EEFG 4WK8F 1BC7C 2EB7A 3LSMA 1WFXA 3ZQHA 2OA4A 2PMUA 4BQQA 5D8LB 2NRAC 1XSXA 3Q9VA 3VYSB 4G7OF 1O3TA 2OC6A 2VBXA 2QVOA 2DA5A 3CP8A 1G6NA 1ZRCA 4ZTJA 5EGOB 1W7PB 2WAFA 1RKWA 1QHGA 2ESNA 2V6CA 1OCPA 1ACIA 4IVNA 1V5FA 1MJBA 3WTVC 3V8LA 4NC7A 4L9VA 4A3FJ 5KCMA 2M7BA 2WWYA 2CW8A 2IA2A 2O6GE 4M3FA 2VQGA 4V2GA 1IC8A 2CV2A 1G3YA 1YITI 3BCAA 4M9SA 2XPUA 1X4PA 1GLNA 1IXRC 3TP3A 3HOTA 2HVRA 4CYDA 5BOXA 1ERDA 4AM3A 1BR2A 3H36A 5FD5A 1O7LA 3C3WA 4CCJA 2R5ZB 3W6KB 1KU2A 3BWGA 1EA3A 4J01A 1ZGAA 1BI0A 2CFXA 1BA5A 5C4XJ 1OFCX 2L9NA 3VSLA 3A02A 3K4KA 5LFAA 4KT6A 2F5DA 3HJEA 2QM3A 4FCYA 1AWCA 1AU7A 5KK1A 4GDFA 1FIAA 2M8GX 1A6QA 3BR3A 3AFHA 4LIUA 3LQRA 3H5RA 4HF2A 1G8XA 2LDUA 3QQAA 2DMTA 4OIOF 4QPOA 1B4AA 3SFIA 1AKHA 2DPUA 4XLHA 2XRNA 4HNVA 3AG4H 2NOGA 3RQIA 2VLAA 2CYYA 2W24A 1ZGJA 1JHHA 2VPRA 4E7JA 2FE3A 4WXCA 2H1KA 2Y2ZA 4AIJA 4MEXF 4IHTA 4P5OA 1IRXA 3WTXC 4UVBA 3O6BB 2KJCA 3LSIA 3C2GA 2NVUB 3HC7A 1HC8A 2R7FA 1WJCA 2DFHA 2ZCWA 3DF8A 2FA5A 4A0XA 5D4RA 1A31A 6PAXA 2LR8A 1BIBA 2K9SA 3GEZA 5CQGA 1K83J 1XMXA 5DUIA 2OBPA 2RQPA 3AG3H 3BP8A 4XSXF 1MBHA 3OIQA 2DU9A 4XICA 2QKMB 2P0WA 1HBXG 3FHNA 1QZZA 1UB9A 1R7JA 2P5KA 4XKWA 2HKOA 1MH3A 1I6XA 4NNJA 3TKYA 2HI3A 3FXQA 1R1VA 2DT6A 4XORA 1VZ0A 2MLKA 1XC5A 4HG2A 3I5UA 2EILH 4L0ZB 4YIIA 3S1NJ 3WU1B 5HODA 3EYYA 4EGZA 2NAZA 2R7OA 1O3RA 2ZO4A 4HQEA 4E7LA 2QSFX 4UV9A 2PMZN 5CVJA 1FC3A 4F3QA 1H8AC 2EA2A 1DU0A 1KQ8A 3MVPA 4IQJA 1HQCA 1OR7A 4PJLA 5ICEA 3HPHA 2M30A 1SD6A 4JP0A 4PUSA 1R5GA 2E36A 4IHWA 2GZWA 1HDDC 1YYVA 4BJ5C 2HOTA 2FEZA 4Q48A 2CG4A 3TW6A 1X3ZB 3ZQGA 4M3DA 1HLVA 1TNSA 3ROUA 3JRCA 2ZBKA 1X58A 2OCEA 3MKZA 2IGOA 1IAWA 3KPHA 3W2AA 3SZGA 1PUFB 3K2AA 4YELA 2R7UA 1LUJB 2XGCA 5J4VA 5KHDA 3JTGA 2I8DA 2ELHA 3ASNH 4DBQA 5F0HA 2AXLA 4CICA 5KAFC 5ICGA 2GBYA 1ON2A 3PIOF 1U0JA 4XRMA 2ZSIB 5IP6A 1C0WA 2W00A 1ENHA 1S9HA 1F36A 1YJ9I 2O9LA 1BOAA 1HSJA 2N8GA 2VKVA 3ZPLA 1ETXA 1OQYA 2KPMA 1W0UA 3O8GA 2HPMA 3WGHA 2M4GA 4IRGA 3ZMUA 2NOJB 1RNLA 4PK4A 4RAZA 4D9JA 3MKYB 5DTDA 1JUPA 3L9FA 2WAQA 4NDLA 2FQ3A 2Q1ZB 2CO5A 3K4MA 2Z1DA 4Q47A 3I71A 2VQHA 1V54H 1S5LC 5D5UB 4U87A 3GTKJ 1HDPA 4A5MA 5IP7J 1W0TA 3KYDB 3OSGA 2WY8Q 5K7HA 2CQXA 3CCMI 2ZXWH 4U0YA 4J19A 2ZNZA 2GIZA 2RAEA 4FT8A 5H6QA 3V4GA 3ERED 1LKXA 3REOA 3TW7A 3A0HC 3KP7A 1WVRA 4HYEA 2ME6A 3A03A 5E3LA 3A01A 2DA6A 2WTEA 4H0EA 3BZCA 2CH0A 2A3SA 1RUOA 4DOZA 2F2EA 4GO1A 3WE3A 4V2FA 3OOPA 4A5NA 2VJIA 1A04A 4HAMA 4LGWA 3SFZA 4L5EA 3VODA 5IYBJ 2Q0OA 2ELKA 3WTTC 2ACJA 4BXXJ 2VKEA 4MHGA 1UZCA 5J8FA 4FX4A 1ETWA 4UUTA 2IVMA 2XASA 5IT9K 2Z99A 4LK0F 4I99C 5ICCA 3CCRI 1B9MA 1R22A 2Y69H 2XAQA 3HOUJ 3VPRA 5J47A 4ENNA 2XUBA 4OAYA 3ZMZA 4G94A 1I39A 1KGSA 5E1ZB 2UWMA 3FMRA 2E7XA 5L3EA 2R93J 5L3BA 1RPWA 1FPQA 3M8JA 4EATA 1B8IB 4G6QA 4OAZA 2EZKA 4O5VA 2ZJPF 1VQ5I 2PI0A 3R4KA 1M1EB 2FXAA 5BPDA 5F08A 2XC7A 4HOBA 4JOMA 3RDIA 4PZJA 1QZEA 1UMQA 3VSKA 4B8XA 1LQ1A 4E70A 5HNFA 5JLXA 3GTQJ 2COMA 4MFEA 1VNDA 2I10A 2IEKA 4LD5A 4CYCB 1Z3YA 2A61A 1L3LA 5HS7A 2X4HA 4IOCF 2LP0A 1TWFJ 4MEYF 5EEAA 4I2OA 1ETYA 1Y8QB 3K9TA 1NK2P 1HW1A 4FTHA 3H5AA 1OPCA 2R92J 2E34A 5CVUA 1VTNC 2BYVE 4RGRA 3HRUA 2VB6A 2RQQA 2HQ5A 2WAEA 3E6DA 3F8BA 3G2BA 1PVEA 2IXSA 3FZVA 1KQ0A 3FXMA 1T6SA 1TW2A 2KFDA 3LFKA 5C4JJ 1H9TA 1AKHB 1RR8C 2LK2A 4ZYAA 5EG0A 1LPQA 3HOSA 4XN0A 3TMOA 4HRIA 3O3KA 4RAFA 4DYRA 3I55I 1TWAJ 3DTKA 3PNVA 4Y7NJ 1YRNA 3Q3SA 2OPTA 2ZB9A 2LD5A 2Y48A 1FZPB 4S0HB 2HEOA 3H5NA 4PJMA 3A0BC 2VL8A 5FLXK 4HBLA 2R5YA 3LFUA 4ZYDA 4IZZA 5E3NA 1N75A 3JREA 1BC8C 3BJOA 5HLTA 2KRFA 4OINF 4BHPA 3G3ZA 3HTSB 1D1CA 3OOUA 4XLFA 1D0ZA 2GIVA 4W97A 3Q0WA 5DD4A 4UUSA 2ID6A 3GF2A 3H3UA 3HL2A 3R6SA 2X1EA 2F48A 1MSFC 3OL3A 3HPGA 2VT3A 1VQKI 3EUHC 2EK5A 2M3AA 3MN2A 2L54A 1KU9A 1BM9A 2OTJI 3L1PA 3BY6A 3DKYA 2RN7A 5IT9Z 2M9HA 1TWGJ 3MFKA 3F23A 3TGNA 3FK6A 4DBRA 4BAYA 2DXIA 1WWXA 5DS9A 1RRJA 1QHHD 1GDTA 2AQFA 3H0DA 4ON0A 1YG2A 4HZFA 2G7HA 1U5TA 3GTJJ 5K5RA 1GHCA 3DTIA 2ESHA 3FF5A 1H0MA 3M4OJ 4CCOA 3H0GJ 2ISYA 2IGKA 2KL4A 3D0SA 3LWFA 2FF4A 1DDNA 2QEXI 3FBNB 2CWEA 2JSCA 1QRYA 4YFKF 4EJVA 5DDGA 1HSTA 4N4OB 1O4XA 2H09A 3RPUA 3G6EI 1QU3A 3OYNA 4GFBA 3DFGA 3ZR8X 4IJAA 3J7YJ 3FHZA 3QP6A 4PJ0C 4E7KA 3JRBA 1A6IA 1IV8A 2EJRA 4HA8A 4B3AA 1ZLKA 4P1WA 3FDYA 2XAJA 1SVLA 2ID3A 2IP2A 2VE8A 2L01A 4KIFA 2CQNA 5GAEJ 2DOFA 4IXAA 2RNJA 2HQRA 4XSZF 1DP7P 1I6HJ 2EINH 2F4IA 1W1WE 3DEUA 4MTEA 4CZZA 2ECBA 1Q1VA 4DQ2A 1RZ4A 3DPLC 5LHGA 2LF7A 4H4KC 2GOMA 3VB2A 2IS2A 4KMUX 5FGMA 4YFXF 5FLXZ 3GX4X 1MDMA 2LMDA 1BJZA 2KZGA 2UXNA 2FMYA 4HF0A 2PMHA 4L5JA 3W2VA 3CF2A 4RAGA 1IRFA 3JRIA 4XMYA 4Z2YA 4BQAA 1YW7A 5BS6A 2J5OA 4YFNF 5E20A 5JHUA 1S29A 3PO2J 5IYDJ 5F6FA 2DA4A 4DZPA 4L0YB 1B9NA 4KUMA 1DPRA 4KJZA 5CYVA 2M87A 2QUFA 5FLVA 3OYGA 3U9GA 1KZHA 1VFCA 2OAZA 1FOWA 5FLMJ 3E6CC 2Z5UA 3CCSI 4WXDA 3F9KA 4A0YA 2OU2A 3WHBA 3S3OA 1V3FA 2DPDA 4HX4A 3VFZA 4BS9A 5HDGA 3DQVC 1UG2A 2FD5A 5DV5A 3ZN0A 2LH9A 4G12A 4ZYEA 4RB3C 3CCJI 2QSGX 2L4MA 4BHCA 4JX5A 1GT0C 4CCNA 2BY0A 2PG4A 1P4WA 2E71A 3K4BA 4JX6A 3OSFA 2X6OA 2EFWA 2EIMH 2QENA 2BV6A 3HKZA 2GXGA 2XHKA 2XROA 3I53A 4PJNA 3M3YJ 1J9IA 1FMWA 4B09A 2Y0SN 4M3BA 4ZYGA 2LOOA 1IGNA 2LKXA 4XONA 5GADJ 4E7IA 1P6RA 1Q1HA 4IHXA 3BJ6A 1JUSA 4A3CJ 4G6DA 3F3XA 3SYTA 1G4DA 4EM0B 1I3AA 1SVOA 5CJ9A 3HRSA 4S04A 3FM3A 2FBIA 3N97A 2KQRA 4I02A 4D7MA 3UKGA 1D8JA 2R7WA 2YU9J 3RTRA 2AS5F 1SFEA 1MIJA 1X3UA 3HRTA 3E5QA 1IF1A 3TBIA 1OR7C 2JJ7A 2TRTA 1AOYA 3JRAA 1SEUA 5B1BH 3ZMDA 1EH6A 3TO6A 2CQKA 2V79A 5FKNA 2C6YA 4DJAA 1LDKB 2JA2A 2HQNA 5D6EA 5BNGA 4UUVA 1B59A 3CESA 1ZAOA 1DGWY 5EG0B 1JTYA 1ORKA 3EUAA 2HTSA 3ZN1A 4XNFA 1NHAA 2VE9A 5E1WA 4II3A 2P7VB 1YRNB 2HDDA 2P5LC 2KIQA 2P5VA 5TJJA 1QO0D 2K40A 2VASA 1ZH5A 1BN5A 1X2NA 1GV2A 4EM1A 1WJ5A 3G71I 2R5YB 2KIMA 2Y0MA 2O8KA 1D0YA 1S72I 4LLGF 2DBBA 2XF6A 1Z1DA 2YSRA 1T08B 4NHJA 3FM5A 4HSTA 1F43A 3ABLH 3ML6A 1MBJA 2B0LA 2TCTA 2W1OA 2BGCA 3ELKA 4XM3A 3U2RA 4BHBA 2H94A 2EFPA 3A1YA 1GUUA 2M5WA 5K7ZA 4OIRF 3HEFA 4P96A 4CCMA 4HSRA 1TT0A 3FMQA 4KICA 5H2FC 2LF8A 1KU3A 2DDBA 1ULYA 4XRFA 2IGNA 2VUMJ 4Y33A 2HVQA 5JVGF 4I0BA 2D1VA 3VDXA 1FT9A 1LDJA 4UB6C 4GGGA 1VQ8I 3C7JA 3Q5FA 1BJAA 3OYDA 3D1NI 5EZGA 1K6OA 3QYBA 1OCOH 4BYYA 1ZR2A 5A2QK 5CPRB 2V9VA 4C2TA 2R7TA 3HBLA 1Y1VJ 4YRVA 4WF2A 5E8GA 3HM5A 1VQMI 1RUNA 5DCMB 2CV0A 3LSPA 4IHVA 4XIDA 2RNGA 1WGXA 2R7SA 4KN7X 4KMFA 1KU7A 4QTRA 3V7SA 1OMIA 2DYSH 2GA2A 2JK3A 2YR2A 3G1LA 3GVAA 4I6ZA 4LOCA 2QLZA 5DUKA 3OV8A 1O3QA 4CSWA 2MD5A 1LE8B 2ZKZA 1UCRA 5TISC 2KHMA 1G59A 1UHWA 1T38A 2DMQA 2LKSA 2JTVA 4KN4X 1T39A 1ETKA 5F1RA 4HDUA 4ABZA 3ZXSA 2KISA 5CVVA 4JYKA 1FSEA 1WI3A 2EZLA 3EETA 5L3FA 3GTPJ 1OKRA 2DAOA 1TLHB 2EBIA 3PSIA 3TL4X 1IN8A 2YU3A 3CF5F 1K7AA 2HDWA 1SFOJ 2AHQA 3RKXA 3V7CA 3S2HJ 4HLXA 1TL8A 3NEUA 2WC2A 1Z3XA 4CH7A 4BE0A 2FOKA 1R5HA 2LY1A 5IP9J 2R0QC 2XKOA 3KZYA 3P9CA 3GFMA 4M9XA 3DLAA 3OIPA 2V7FA 2FRHA 2M0CA 1JJ6C 5KNLA 1EKEA 1HKQA 4EV0A 1SAUA 2V9PA 4GCVA 3HIFA 5LHIA 3QPSA 1NG6A 4D0PA 1FTTA 3KFWX 2JUCA 3GFLA 4PGHA 4R79A 3PL8A 2XIGA 3BCBA 2H6BA 3J80K 1YIOA 5J4YA 1D1BA 2G0EA 4AU7A 2OJED 4HX7A 4PCQA 2OTLI 3S8PA 1UJ8A 4BE1A 3L2UA 2HPIA 1YX5A 1WJBA 2JUGA 4HQMA 1YLFA 2QQAA 3QP5A 3WODF 4E4HA 2DODA 5LEKA 4RM2A 4XQFA 2DA3A 2VC0A 3MZHA 1Y0UA 1GVJA 1MW7A 2F6CA 1U2WA 1OYIA 1XTAA 2MW8A 2HNHA 4M71A 3T8TA 3U1DA 5A2QZ 2V9KA 1VI0A 2EV6A 2EV5A 1J2XA 3DPTA 3BTLA 1FYMA 4RB0A 2AXTC 1XGNA 2IS1A 2DCEA 3PQJA 3D5LA 4HLYA 4YIRX 4EQQA 3B6AA 3AAFA 3K2ZA 3RJPA 1SD4A 4KITB 4DNCA 3SZTA 1TP4A 4B43A 4CDGA 1N77A 2QBYA 2RKHA 3UNGC 2M7AA 3ONQA 5E18F 4N9IA 3WTZA 1R4NB 4NB5A 3HOZJ 3H35A 4A3KJ 5F0CA 5IY5H 5J1RA 1U5TC 1XCVA 5HS8A 3FX3A 5DYMA 3ZQIA 1YW9A 4D7NA 3IC7A 1FLIA 1FNNA 4ENMA 4JQFA 1IDYA 3KLOA 3QYEA 1FX7A 1IDZA 5D6FA 1CF7B 3RYPA 2W82A 2K3FA 2R3SA 3GZNB 1IXSB 2L02A 2RDPA 3I64A 2Q2EB 3LSJA 3QOPA 3CC2I 2XKPA 2CQQA 3FMSA 2X48A 3T5XA 4OIQF 4MO7A 5EDNA 2L7MP 1ZYRF 4CZCA 4ZZLA 2KLOA 2BY1A 2KT0A 5IOYA 2A5YB 4CHUA 5FFXA 1S7AA 2M4KA 5C44J 3HUGA 3LL7A 4ETSA 2CU7A 2UUZA 5EJCA 4U0VA 2DJNA 2PMZA 1LDDA 4XOPA 3HOWJ 1OYWA 2FNAA 1BIAA 1HXDA 3DKWA 1FSHA 3D5SC 2HZDA 4XOTA 3J80Z 1UELB 4AWXB 2PX9A 4IL6C 2BE5F 2IRFG 1LEAA 3OY9A 3HDDA 5HLGA 3WG7H 1Z77A 4BBRJ 1K4SA 3IKTA 3LSTA 1HW5A 1R23A 2EV0A 1YHQI 2K9MA 1FYLA 5B3SH 2DMPA 5L3GA 1XGMA 2O61A 1I27A 4BQNA 3NRVA 2DA7A 3R61A 3KYLA 2BW3A 2XGXA 4OMYA 2BY2A 2DT7B 2Y75A 2WAQN 1SFXA 3H1CA 1FBQA 3MKLA 3RPUD 1E3HA 5LHHA 1QQIA 2DMUA 3ESWB 3V8JA 3FISA 1ZHFA 2EIKH 2LREA 3GMEA 5JLWA 3VOEA 2ZXIA 3I0TA 1K79A 4NQWA 4C3IJ 5FB2A 2VBWA 3BG9A 3HRMA 2ZMEA 3O8HA 1JJ8C 2DA1A 3L09A 4IOAF 4DGWB 3ZCOA 1JXSA 5L3CA 4KYWA 1IN7A 3KP6A 2LVSA 2LBFA 1RIOH 2PFBA 3CUOA 4L18B 4M6XA 4BXUA 5HLHA 2GXAA 1IJWC 4IO9F 2WV0A 4LIVA 2MYSA 4IQ4A 2FMLA 2ZFUA 4CUGA 2TDXA 2K9NA 2LY9A 4IRIA 2G9WA 3K10A 3MWMA 1V55H 5IYCJ 4QWQA 1N25A 3E97A 3L2RA 4ZTFA 1KONA 1JGSA 3DXJF 4BEHA 3HOVJ 3G1OA 3OYEA 3O2PE 1J0RA 2WBMA 1PJRA 2X9DA 2ICWG 2ZXHA 3TOAA 4A3IJ 1VQ7I 4ESBA 2IS6A 1Z7UA 4QLCU 3LSKA 1FEXA 1YTYA 4UNOA 3CUQA 1A5JA 2JA5J 5JHFA 2Y31A 3RPQA 1JKRC 3SQNA 4Y15A 2K02A 1WI9A 1W5SA 1FMVA 3C2HA 3HTUA 3BJAA 3GTMJ 5D5VB 2VN2A 4RGUA 1G3TA 2BOLA 2E7WA 1YIJI 1D5YA 2X6XA 4Y52J 1SAXA 5EEHA 3QODA 5FRNA 4RGXA 2R7XA 3K0LA 3SEQA 5M5WJ 3CC4I 3EUKL 4C3HJ 1WH7A 2KZVA 4MQVA 4G7ZF 2CUFA 5JR3A 4N0BA 1VQ4I 2E60A 2H1LA 5GPAA 1T33A 3I59A 1OCRH 1RESA 3J7ZI 4DW6A 1GXQA 2D45A 2XAGA 3OMYA 3OYMA 5K7FA 3QU3A 2VODA 3L7WA 3BZKA 2KDOA 1IV6A 3M1EA 1FTZA 4HV6A 1DGRM 4HPQA 2DN0A 2LRDA 3OYHA 3K1NA 2JN6A 1RI7A 2EFOA 4CA0A 2M2EA 4HX8A 5J1UA 3I4NJ 1H89C 2ZFWA 1I50J 3M9AA 4EJWA 2M8EA 2OQRA 2X85A 4BJ6C 4X6AJ 3M8EA 1W5CC
chains in the Genus database with same CATH topology
5ILSA 3N4MA 2V1UA 5CVRA 2OZUA 4PDKA 3GW2A 5ILVA 3T1BA 1ZN2A 4R8HA 3IL2A 4EM2A 1K78A 3W6JB 3LAJA 2NNNA 2UZKA 2HFHA 2DLLA 2W57A 3GZ5A 5KVRA 3CTAA 4LB6B 1FBUA 3EQLF 4UVAA 5D5XB 4RAYA 4G8XA 1QBJA 2HYGD 1LB2A 1LJ9A 1FY7A 2XVCA 4GYGA 3KP2A 5ILUA 2Z9OA 4AIKA 2PEXA 4BH9A 3JAMK 2K4BA 4TV7A 1BI2A 2K7LA 1XCBA 2M1BA 3IRQA 4HDVA 5IT3A 2JPCA 1ZG3A 2MH2A 2VOOA 1LEBA 5HOOA 1Z05A 1TW3A 1XSVA 4G9YA 1FOKA 4MGRA 1R1UA 3WGIA 1CGPA 5LRSA 1R36A 1GXPA 3ULQB 3I58A 3CO7C 3L2CA 5L3DA 1W7PA 1J75A 3DV8A 5H6RA 1KYWA 2W84A 3HSRA 1TNTA 4A6DA 3V7RA 3WTYC 4WCGA 4U7BA 3WU0A 2EWNA 3ABTA 2DI3A 2L4AA 5ICFA 3QAHA 1DUXC 2W85A 1BBYA 5DD8A 4Y13A 5JVTA 2O03A 3MEXA 4ENJA 3IRRA 1S7OA 1YS7A 4ESFA 2A6HF 2VBZA 2P6SA 2CGPA 4EJTA 2ZJ2A 2PN6A 3VEPA 3QPTA 5LLQA 4KDPA 3TQNA 3WG9A 4RB2C 2QQBA 2Z3YA 2O0YA 4L9NA 3RKWA 1PUEE 1XN7A 4OMZA 1LVAA 2YX7A 3JAMZ 3HYIA 2IT0A 3F6VA 1XGSA 1Z91A 4I09A 3P9IA 4KT5C 1KQ9A 4L9JA 2OZ6A 2P8TA 1KYZA 5LRRA 1IXCA 1QNTA 1H9GA 5AIQA 2PBIA 3JSOA 2W25A 3ZQ7A 1ZREA 1P92A 3I59B 4M73A 3F6OA 1ODDA 2DT5A 4WXHA 5CVIA 2HYFA 2QYOA 4N9HA 1G3SA 3GWZA 2F5FA 3RKYA 2DK5A 1Z9CA 3T8RA 1WKMA 2MH9A 4LMYA 3COAC 5D4SA 2HKXA 4LG0A 1T98A 3WE2A 5DEQA 4UV8A 4CGZA 1FP1D 2BBYA 1DPUA 4RS8A 4GYIA 1MJ9A 2JPBA 1TBXA 2KIUA 1K78B 2H6CA 2ADUA 1SMYF 3LQQA 4LLNA 4EVIA 3FWEA 1HW2A 3ECOA 2JT1A 3I54A 1U5TB 1TTYA 3ZMVA 2NNYA 4U88A 4M6YA 4CXFA 3M7GA 2M45A 2HGCA 1HKTA 3CJNA 4MTDA 4EMSA 3M8FA 1T2KA 4KA4A 2P6TA 1T0FA 4A0ZA 3CUQC 4I98B 4PGGA 1D3YA 2X0LA 2A6EF 3IHUA 3BOQA 1ONVA 3DP7A 2VXZA 1FP2A 3FXUA 1TQIA 1U3EM 1SD5A 3PFIA 1S6LA 2KKOA 2ZXJA 3WTSC 2R7DA 2STTA 4IHSA 4KNYA 3H92A 5HDNA 3BDDA 4ENKA 3QU6A 3NQOA 4UVCA 1UFMA 1D5VA 3R0JA 4AVPA 1MDMB 3I4PA 2EFQA 1IUYA 1SFUA 1IRGA 4R1HA 2HOEA 1IW7F 3MZYA 3E3VA 4HF1A 3FXRA 4G7HF 4M72A 1XDUA 2KJBA 2MC3A 1XMKA 4WWCA 2PJPA 3KE2A 1OYYA 3K69A 2MBFA 3CO6C 1FWZA 3ECHA 3V8KA 3KP5A 3J81K 1QPMA 2FNPA 5F64A 1MZBA 1ZRDA 4XLNF 3SHFA 4L5IA 2V1XA 3IKVA 1MJAA 3G73A 4BNCA 2YPRA 3KLNA 1REPC 5LEJA 2HS5A 1IN6A 2PQ8A 2G7UA 3ABUA 4RB1A 3E6MA 3HHGA 5J6XA 3BPVA 1PP7U 4FHTA 1STZA 4UXNA 3L00A 4LB5A 1S3JA 3LA3A 4LFUA 1ZG1A 2VOPA 5E1XA 4A6EA 3KETA 2VONA 4I7HA 1F4KA 1Z6RA 2LKPA 4A12A 3F21A 4LG0B 5HVQC 3C1DA 2DFIA 5E17F 2FBKA 3PQKA 2A68F 3SZPA 2RGVA 4P9UA 1W5TA 1IN4A 3IWFA 2LNBA 2HDCA 1LNWA 4Q5SF 1R58A 4S05A 4KFCA 1QGPA 3LA7A 2CSOA 1YO5C 3TDUC 2H27A 3BROA 3WGGA 2VBYA 2XAHA 3F8FA 1BI3A 2UXXA 1HKSA 4ESJA 3TDZC 1ZARA 3J81Z 2DTRA 3GUDA 4ZH4F 1YS6A 2Q8KA 1XD7A 4CO8A 1WSUA 4GXOA 3J7AO 3LAPA 1YQAA 4OU0A 1U78A 2HWVA 4P9FA 5E8IA 4EJOA 3TO7A 2XAFA 4M74A 2D1HA 2DQLA 2FU4A 5AIPA 2IW5A 1W7PD 3WTWC 2STWA 1F5TA 3IWZA 2QZ8A 1U8RA 1F1ZA 3KZZA 2NS0A 2HR3A 1XDSA 2DW4A 3T0YA 3F8NA 1MGTA 4EJUA 1XMAA 4FX0A 3ZP5A 1O7FA 4Y17A 2HTJA 2QWWA 1SMTA 3ISPA 5ED4A 3K1PA 3JTHA 1G3WA 2VC1A 4YG2F 1TQPA 2P7CB 2K27A 4ASNA 1YW8A 1XSDA 4M9ZA 2V1DA 1BI1A 1JE8A 2F5EA 1MKMA 1O3SA 3MAJA 2O3FA 3RIRA 1PP8F 1F9NA 3P7NA 3GFIA 1EH7A 1D8KA 5BPIA 3JW4A 2IJLA 2O8XA 2P4WA 4LK1F 2DQRA 1EV7A 2OQGA 2Z33A 4IF4A 1J5YA 2QBYB 2J5PA 4F7ZA 3HHHA 2GWRA 2MLGA 1IN5A 3F22A 1I1GA 3H3ZA 2ETHA 4OIPF 4IRHA 1ON1A 2D2WA 3P9KA 4AIHA 2A07F 1XB4A 1UHMA 1PDNC 1ZRFA 4EGYA 3ZMTA 4JBAA 4KIBA 4P55A 3RI4A 5K5QA 3TOBA 4O3MA 5ERIA 3EDPA 3Q9SA 2E1NA 5TRDA 2ISZA 2CW0F 5D5WB 1YFHA 3E6BA 4UHTA 2RV8A 2KIFA 3F72A 2FSWA 2OD5A 3F8MA 2IA0A 1P4AA 1TQMA 3KP3A 5DCMA 3R60A 5D8KB 3EYIA 1J7KA 5DCFA 4I0AA 2RVCA 3TO9A 1O57A 1USTA 1P2FA 2IA1A 3GO5A 4O6JA 4HW0A 4XBFA 1P4XA 2DK8A 2DO7A 2GA1A 5K5OA 3R0AA 2LSOA 1V4RA 2JRTA 2ZMEB 5BQTA 4L9TA 1IZ1A 4ZYHA 3CDHA 3HSFA 4HV5A 5HDKA 1I5ZA 2HZTA 3GYHX 4RGSA 2RC4A 3QPHA 1Z6TA 3JSPA 2L3DA 3QRFF 2XV4S 4LLLA 3CUQB 4U7DA 2BEOA 4YIFA 2GQQA 3S2WA 1S8NA 3E5UA 2K86A 4OOIA 3GXOA 4Q4ZF 2NYXA 3F8CA 2QQ9A 4IPAA 5FFZA 5FO5A 3GFJA 4MQ9F 5EEGA 2ZNYA 3CLOA 1I1SA 1EH8A 1KA8A 2F5CA 2VT2A 4I01A 3MCZA 3MQ0A 5JI6A 2GXBA 1B6AA 5FD6A 1E17A 5K1YA 1FYKA 1ZLJA 4LJZF 5JFRA 4K2EA 3ZMSA 2FBHA 2EA4A 2PLYA 1CF7A 4ZZDA 3K1MA 3HSEA 1E2XA 3LA2A 5LBQA 5HLIA 1B1BA 2Q2EA 2K4JA 4MNUA 4XLPF 4WX9A 3SXYA 1MD0A 3WTUC 2MA3A 1R1TA 3GLXA 2EFNA 5AONA 1FBSA 1SD7A 1WQ2A 4JK1X 1L0OC 2YX4A 5CLSA 3E5XA 1W4MA 5LGUA 3B73A 5BMZA 1WRJA 2IPQX 1JHFA 3BZ6A 2GAUA 3KEOA 3C18A 1ZG5A 2E1CA 3KEQA 3RYRA 5HS9A 1R00A 3EUHA 1J59A 5LGNA 5J8CA 1USSA 3B02A 2JZYA 5LGTA 1U6GA 3BPXA 1QZYA 5H20A 4A2UA 2A69F 4U0WA 4AD9A 1XGOA 3GZ6A 3KCCA 4KIGA 4WK8F 1BC7C 2EB7A 2OA4A 2PMUA 5D8LB 2NRAC 1XSXA 3Q9VA 4G7OF 1O3TA 2VBXA 2QVOA 1G6NA 1ZRCA 1W7PB 2ESNA 2V6CA 4IVNA 1MJBA 3WTVC 3V8LA 4L9VA 2WWYA 2IA2A 2O6GE 1G3YA 4M9SA 1IXRC 3HOTA 4CYDA 5BOXA 5FD5A 1O7LA 3C3WA 3W6KB 1KU2A 3BWGA 1ZGAA 1BI0A 2CFXA 2F5DA 2QM3A 1AWCA 5KK1A 3LQRA 4HF2A 2LDUA 4OIOF 1B4AA 2DPUA 2XRNA 2CYYA 2W24A 1ZGJA 1JHHA 2FE3A 4WXCA 4AIJA 4MEXF 4IHTA 4P5OA 3WTXC 4UVBA 3O6BB 2KJCA 2R7FA 3DF8A 2ZCWA 2FA5A 4A0XA 5D4RA 6PAXA 1BIBA 3GEZA 5DUIA 2OBPA 2RQPA 3BP8A 4XSXF 2DU9A 1HBXG 1QZZA 1UB9A 1R7JA 2P5KA 2HKOA 1I6XA 3TKYA 3FXQA 1R1VA 2MLKA 3I5UA 4L0ZB 4YIIA 3WU1B 3EYYA 4EGZA 2NAZA 1O3RA 2ZO4A 4HQEA 4UV9A 5CVJA 1FC3A 2EA2A 1KQ8A 1HQCA 1OR7A 5ICEA 2M30A 1SD6A 1R5GA 2GZWA 1YYVA 2FEZA 4Q48A 2CG4A 1TNSA 3ROUA 2ZBKA 1IAWA 3JTGA 2ELHA 2AXLA 4CICA 5ICGA 1ON2A 1C0WA 1BOAA 1HSJA 3ZPLA 3WGHA 4IRGA 3ZMUA 1RNLA 4RAZA 3L9FA 2FQ3A 2CO5A 4Q47A 3I71A 5D5UB 4A5MA 4U0YA 2ZNZA 3ERED 4FT8A 5H6QA 3V4GA 3REOA 3KP7A 4HYEA 2WTEA 4H0EA 2A3SA 1RUOA 2F2EA 4GO1A 3WE3A 3OOPA 4A5NA 1A04A 3VODA 4HAMA 4LGWA 3SFZA 2Q0OA 3WTTC 2ACJA 4FX4A 4MHGA 5J8FA 2IVMA 2XASA 5IT9K 2Z99A 4LK0F 5ICCA 1B9MA 1R22A 2XAQA 4ENNA 2XUBA 3ZMZA 4G94A 1KGSA 5E1ZB 2UWMA 3FMRA 2E7XA 5L3EA 5L3BA 1FPQA 4G6QA 4O5VA 2PI0A 3R4KA 2FXAA 5BPDA 4HOBA 3RDIA 4PZJA 4B8XA 1LQ1A 4E70A 2COMA 4LD5A 2A61A 5HS7A 2X4HA 4MEYF 4I2OA 3K9TA 1HW1A 1OPCA 5CVUA 1VTNC 2BYVE 4RGRA 3HRUA 3E6DA 3F8BA 3FZVA 1KQ0A 1T6SA 1TW2A 3LFKA 1H9TA 3HOSA 3O3KA 2Y48A 1FZPB 2HEOA 5FLXK 4HBLA 4ZYDA 1BC8C 3BJOA 2KRFA 4OINF 4BHPA 3G3ZA 3HTSB 2GIVA 5DD4A 3H3UA 3GF2A 3R6SA 2VT3A 2EK5A 2L54A 1KU9A 1BM9A 3BY6A 2RN7A 5IT9Z 3F23A 3MFKA 3TGNA 4BAYA 1WWXA 4ON0A 1YG2A 4HZFA 2G7HA 1U5TA 1GHCA 5K5RA 2ESHA 3FF5A 1H0MA 2ISYA 3LWFA 3D0SA 2FF4A 1DDNA 2CWEA 2JSCA 4YFKF 4EJVA 5DDGA 1HSTA 2H09A 3RPUA 3DFGA 3FHZA 4IJAA 3QP6A 2EJRA 4HA8A 1ZLKA 2XAJA 2IP2A 2VE8A 2L01A 4KIFA 4IXAA 2RNJA 2HQRA 4XSZF 1DP7P 3DEUA 4CZZA 4MTEA 4DQ2A 1RZ4A 3DPLC 5LHGA 2LF7A 3VB2A 4KMUX 5FGMA 4YFXF 5FLXZ 3GX4X 1MDMA 2UXNA 2FMYA 4HF0A 2PMHA 4L5JA 1IRFA 4Z2YA 4BQAA 1YW7A 5BS6A 2J5OA 4YFNF 5E20A 5JHUA 1S29A 5F6FA 4L0YB 1B9NA 4KUMA 1DPRA 5CYVA 2M87A 2QUFA 3U9GA 2OAZA 3E6CC 2Z5UA 4WXDA 4A0YA 2OU2A 1V3FA 2DPDA 4HX4A 3VFZA 5HDGA 3DQVC 5DV5A 3ZN0A 4ZYEA 4RB3C 2L4MA 4BHCA 2PG4A 1P4WA 2EFWA 2QENA 2BV6A 2GXGA 2XHKA 2XROA 3I53A 1J9IA 4B09A 4ZYGA 1P6RA 1Q1HA 3BJ6A 4G6DA 3F3XA 1G4DA 4EM0B 5CJ9A 3HRSA 4S04A 3FM3A 2FBIA 3N97A 4I02A 1D8JA 3RTRA 2AS5F 1SFEA 1X3UA 3HRTA 3E5QA 1IF1A 1AOYA 3ZMDA 1EH6A 3TO6A 2CQKA 2V79A 2C6YA 1LDKB 2HQNA 5D6EA 4UUVA 1B59A 1ZAOA 2HTSA 3ZN1A 1NHAA 2VE9A 5E1WA 2P7VB 2P5LC 2P5VA 5TJJA 1QO0D 1ZH5A 1BN5A 4EM1A 2KIMA 2Y0MA 4LLGF 2DBBA 1Z1DA 2YSRA 4NHJA 3FM5A 3ML6A 2B0LA 2BGCA 3ELKA 3U2RA 4BHBA 2H94A 2EFPA 2M5WA 4OIRF 4P96A 3FMQA 4KICA 2LF8A 1KU3A 1ULYA 4XRFA 4I0BA 2D1VA 1FT9A 1LDJA 4GGGA 3C7JA 3Q5FA 1BJAA 1K6OA 4BYYA 5A2QK 2V9VA 4WF2A 5E8GA 1RUNA 5DCMB 4KN7X 4KMFA 1KU7A 3V7SA 1OMIA 2GA2A 2YR2A 3GVAA 2QLZA 5DUKA 3OV8A 1O3QA 2MD5A 2ZKZA 1UCRA 1UHWA 1T38A 2JTVA 4KN4X 1T39A 5F1RA 4HDUA 5CVVA 1FSEA 3EETA 5L3FA 1OKRA 2DAOA 1TLHB 1IN8A 2YU3A 1K7AA 3RKXA 3V7CA 4HLXA 3NEUA 2WC2A 2FOKA 1R5HA 2XKOA 3KZYA 3P9CA 3GFMA 4M9XA 2FRHA 1HKQA 4EV0A 4GCVA 3HIFA 5LHIA 4D0PA 3KFWX 3GFLA 4PGHA 4R79A 2XIGA 2H6BA 3J80K 1YIOA 4HX7A 4PCQA 4HQMA 1YLFA 2QQAA 3QP5A 3WODF 5LEKA 2VC0A 3MZHA 1Y0UA 1GVJA 1U2WA 1OYIA 4M71A 3T8TA 3U1DA 5A2QZ 2EV6A 2EV5A 1J2XA 3DPTA 1FYMA 4RB0A 1XGNA 3PQJA 3D5LA 4HLYA 4EQQA 3AAFA 3K2ZA 3RJPA 1SD4A 4DNCA 3SZTA 4CDGA 2QBYA 2RKHA 5E18F 4N9IA 3WTZA 4NB5A 1U5TC 1XCVA 5HS8A 3FX3A 5DYMA 1YW9A 3IC7A 1FLIA 1FNNA 4ENMA 4JQFA 3KLOA 1FX7A 5D6FA 1CF7B 3RYPA 2R3SA 1IXSB 2L02A 2RDPA 3I64A 3QOPA 2XKPA 3FMSA 4OIQF 3T5XA 1ZYRF 4ZZLA 2A5YB 4CHUA 5FFXA 1S7AA 3HUGA 4ETSA 4U0VA 1LDDA 1OYWA 2FNAA 1BIAA 1HXDA 3DKWA 1FSHA 3J80Z 4AWXB 2BE5F 2IRFG 1LEAA 5HLGA 3IKTA 3LSTA 1HW5A 1R23A 2EV0A 1FYLA 5L3GA 1XGMA 2O61A 1I27A 3NRVA 3R61A 2XGXA 4OMYA 2Y75A 1SFXA 1FBQA 5LHHA 1QQIA 3V8JA 1ZHFA 3VOEA 3I0TA 1K79A 4NQWA 5FB2A 2VBWA 3HRMA 2ZMEA 3L09A 1JXSA 5L3CA 4KYWA 1IN7A 3KP6A 1RIOH 2PFBA 3CUOA 4L18B 4M6XA 4BXUA 5HLHA 2WV0A 2FMLA 2TDXA 4IRIA 2G9WA 3MWMA 4QWQA 3E97A 1JGSA 3DXJF 3O2PE 1J0RA 3TOAA 4ESBA 1Z7UA 4QLCU 1YTYA 4UNOA 3CUQA 3RPQA 3SQNA 4Y15A 2K02A 1WI9A 1W5SA 3HTUA 3BJAA 5D5VB 2VN2A 4RGUA 1G3TA 2E7WA 1SAXA 5EEHA 4RGXA 3K0LA 4MQVA 4G7ZF 5JR3A 4N0BA 3I59A 2D45A 1GXQA 2XAGA 3QU3A 2VODA 3L7WA 3M1EA 4HV6A 3K1NA 1RI7A 2EFOA 4HX8A 2ZFWA 3M9AA 4EJWA 2M8EA 2OQRA 1L3LA 3M8EA 3KP4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ILS A;  3N4M A;  2V1U A;  5CVR A;  2OZU A;  4PDK A;  3GW2 A;  5ILV A;  3T1B A;  1ZN2 A;  4R8H A;  3IL2 A;  4EM2 A;  1K78 A;  3W6J B;  3LAJ A;  2NNN A;  2UZK A;  2HFH A;  2DLL A;  2W57 A;  3GZ5 A;  5KVR A;  3CTA A;  4LB6 B;  1FBU A;  3EQL F;  4UVA A;  5D5X B;  4RAY A;  4G8X A;  1QBJ A;  2HYG D;  1LB2 A;  1LJ9 A;  1FY7 A;  2XVC A;  4GYG A;  3KP2 A;  5ILU A;  2Z9O A;  4AIK A;  2PEX A;  4BH9 A;  3JAM K;  2K4B A;  4TV7 A;  1BI2 A;  2K7L A;  1XCB A;  2M1B A;  3IRQ A;  4HDV A;  5IT3 A;  2JPC A;  1ZG3 A;  2MH2 A;  2VOO A;  1LEB A;  5HOO A;  1Z05 A;  1TW3 A;  1XSV A;  4G9Y A;  1FOK A;  4MGR A;  1R1U A;  3WGI A;  1CGP A;  5LRS A;  1R36 A;  1GXP A;  3ULQ B;  3I58 A;  3CO7 C;  3L2C A;  5L3D A;  1W7P A;  1J75 A;  3DV8 A;  5H6R A;  1KYW A;  2W84 A;  3HSR A;  1TNT A;  4A6D A;  3V7R A;  3WTY C;  4WCG A;  4U7B A;  3WU0 A;  2EWN A;  3ABT A;  2DI3 A;  2L4A A;  5ICF A;  3QAH A;  1DUX C;  2W85 A;  1BBY A;  5DD8 A;  4Y13 A;  5JVT A;  2O03 A;  3MEX A;  4ENJ A;  3IRR A;  1S7O A;  1YS7 A;  4ESF A;  2A6H F;  2VBZ A;  2P6S A;  2CGP A;  4EJT A;  2ZJ2 A;  2PN6 A;  3VEP A;  3QPT A;  5LLQ A;  4KDP A;  3TQN A;  3WG9 A;  4RB2 C;  2QQB A;  2Z3Y A;  2O0Y A;  4L9N A;  3RKW A;  1PUE E;  1XN7 A;  4OMZ A;  1LVA A;  2YX7 A;  3JAM Z;  3HYI A;  2IT0 A;  3F6V A;  1XGS A;  1Z91 A;  4I09 A;  3P9I A;  4KT5 C;  1KQ9 A;  4L9J A;  2OZ6 A;  2P8T A;  1KYZ A;  5LRR A;  1IXC A;  1QNT A;  1H9G A;  5AIQ A;  2PBI A;  3JSO A;  2W25 A;  3ZQ7 A;  1ZRE A;  1P92 A;  3I59 B;  4M73 A;  3F6O A;  1ODD A;  2DT5 A;  4WXH A;  5CVI A;  2HYF A;  2QYO A;  4N9H A;  1G3S A;  3GWZ A;  2F5F A;  3RKY A;  2DK5 A;  1Z9C A;  3T8R A;  1WKM A;  2MH9 A;  4LMY A;  3COA C;  5D4S A;  2HKX A;  4LG0 A;  1T98 A;  3WE2 A;  5DEQ A;  4UV8 A;  4CGZ A;  1FP1 D;  2BBY A;  1DPU A;  4RS8 A;  4GYI A;  1MJ9 A;  2JPB A;  1TBX A;  2KIU A;  1K78 B;  2H6C A;  2ADU A;  1SMY F;  3LQQ A;  4LLN A;  4EVI A;  3FWE A;  1HW2 A;  3ECO A;  2JT1 A;  3I54 A;  1U5T B;  1TTY A;  3ZMV A;  2NNY A;  4U88 A;  4M6Y A;  4CXF A;  3M7G A;  2M45 A;  2HGC A;  1HKT A;  3CJN A;  4MTD A;  4EMS A;  3M8F A;  1T2K A;  4KA4 A;  2P6T A;  1T0F A;  4A0Z A;  3CUQ C;  4I98 B;  4PGG A;  1D3Y A;  2X0L A;  2A6E F;  3IHU A;  3BOQ A;  1ONV A;  3DP7 A;  2VXZ A;  1FP2 A;  3FXU A;  1TQI A;  1U3E M;  1SD5 A;  3PFI A;  1S6L A;  2KKO A;  2ZXJ A;  3WTS C;  2R7D A;  2STT A;  4IHS A;  4KNY A;  3H92 A;  5HDN A;  3BDD A;  4ENK A;  3QU6 A;  3NQO A;  4UVC A;  1UFM A;  1D5V A;  3R0J A;  4AVP A;  1MDM B;  3I4P A;  2EFQ A;  1IUY A;  1SFU A;  1IRG A;  4R1H A;  2HOE A;  1IW7 F;  3MZY A;  3E3V A;  4HF1 A;  3FXR A;  4G7H F;  4M72 A;  1XDU A;  2KJB A;  2MC3 A;  1XMK A;  4WWC A;  2PJP A;  3KE2 A;  1OYY A;  3K69 A;  2MBF A;  3CO6 C;  1FWZ A;  3ECH A;  3V8K A;  3KP5 A;  3J81 K;  1QPM A;  2FNP A;  5F64 A;  1MZB A;  1ZRD A;  4XLN F;  3SHF A;  4L5I A;  2V1X A;  3IKV A;  1MJA A;  3G73 A;  4BNC A;  2YPR A;  3KLN A;  1REP C;  5LEJ A;  2HS5 A;  1IN6 A;  2PQ8 A;  2G7U A;  3ABU A;  4RB1 A;  3E6M A;  3HHG A;  5J6X A;  3BPV A;  1PP7 U;  4FHT A;  1STZ A;  4UXN A;  3L00 A;  4LB5 A;  1S3J A;  3LA3 A;  4LFU A;  1ZG1 A;  2VOP A;  5E1X A;  4A6E A;  3KET A;  2VON A;  4I7H A;  1F4K A;  1Z6R A;  2LKP A;  4A12 A;  3F21 A;  4LG0 B;  5HVQ C;  3C1D A;  2DFI A;  5E17 F;  2FBK A;  3PQK A;  2A68 F;  3SZP A;  2RGV A;  4P9U A;  1W5T A;  1IN4 A;  3IWF A;  2LNB A;  2HDC A;  1LNW A;  4Q5S F;  1R58 A;  4S05 A;  4KFC A;  1QGP A;  3LA7 A;  2CSO A;  1YO5 C;  3TDU C;  2H27 A;  3BRO A;  3WGG A;  2VBY A;  2XAH A;  3F8F A;  1BI3 A;  2UXX A;  1HKS A;  4ESJ A;  3TDZ C;  1ZAR A;  3J81 Z;  2DTR A;  3GUD A;  4ZH4 F;  1YS6 A;  2Q8K A;  1XD7 A;  4CO8 A;  1WSU A;  4GXO A;  3J7A O;  3LAP A;  1YQA A;  4OU0 A;  1U78 A;  2HWV A;  4P9F A;  5E8I A;  4EJO A;  3TO7 A;  2XAF A;  4M74 A;  2D1H A;  2DQL A;  2FU4 A;  5AIP A;  2IW5 A;  1W7P D;  3WTW C;  2STW A;  1F5T A;  3IWZ A;  2QZ8 A;  1U8R A;  1F1Z A;  3KZZ A;  2NS0 A;  2HR3 A;  1XDS A;  2DW4 A;  3T0Y A;  3F8N A;  1MGT A;  4EJU A;  1XMA A;  4FX0 A;  3ZP5 A;  1O7F A;  4Y17 A;  2HTJ A;  2QWW A;  1SMT A;  3ISP A;  5ED4 A;  3K1P A;  3JTH A;  1G3W A;  2VC1 A;  4YG2 F;  1TQP A;  2P7C B;  2K27 A;  4ASN A;  1YW8 A;  1XSD A;  4M9Z A;  2V1D A;  1BI1 A;  1JE8 A;  2F5E A;  1MKM A;  1O3S A;  3MAJ A;  2O3F A;  3RIR A;  1PP8 F;  1F9N A;  3P7N A;  3GFI A;  1EH7 A;  1D8K A;  5BPI A;  3JW4 A;  2IJL A;  2O8X A;  2P4W A;  4LK1 F;  2DQR A;  1EV7 A;  2OQG A;  2Z33 A;  4IF4 A;  1J5Y A;  2QBY B;  2J5P A;  4F7Z A;  3HHH A;  2GWR A;  2MLG A;  1IN5 A;  3F22 A;  1I1G A;  3H3Z A;  2ETH A;  4OIP F;  4IRH A;  1ON1 A;  2D2W A;  3P9K A;  4AIH A;  2A07 F;  1XB4 A;  1UHM A;  1PDN C;  1ZRF A;  4EGY A;  3ZMT A;  4JBA A;  4KIB A;  4P55 A;  3RI4 A;  5K5Q A;  3TOB A;  4O3M A;  5ERI A;  3EDP A;  3Q9S A;  2E1N A;  5TRD A;  2ISZ A;  2CW0 F;  5D5W B;  1YFH A;  3E6B A;  4UHT A;  2RV8 A;  2KIF A;  3F72 A;  2FSW A;  2OD5 A;  3F8M A;  2IA0 A;  1P4A A;  1TQM A;  3KP3 A;  5DCM A;  3R60 A;  5D8K B;  3EYI A;  1J7K A;  5DCF A;  4I0A A;  2RVC A;  3TO9 A;  1O57 A;  1UST A;  1P2F A;  2IA1 A;  3GO5 A;  4O6J A;  4HW0 A;  4XBF A;  1P4X A;  2DK8 A;  2DO7 A;  2GA1 A;  5K5O A;  3R0A A;  2LSO A;  1V4R A;  2JRT A;  2ZME B;  5BQT A;  4L9T A;  1IZ1 A;  4ZYH A;  3CDH A;  3HSF A;  4HV5 A;  5HDK A;  1I5Z A;  2HZT A;  3GYH X;  4RGS A;  2RC4 A;  3QPH A;  1Z6T A;  3JSP A;  2L3D A;  3QRF F;  2XV4 S;  4LLL A;  3CUQ B;  4U7D A;  2BEO A;  4YIF A;  2GQQ A;  3S2W A;  1S8N A;  3E5U A;  2K86 A;  4OOI A;  3GXO A;  4Q4Z F;  2NYX A;  3F8C A;  2QQ9 A;  4IPA A;  5FFZ A;  5FO5 A;  3GFJ A;  4MQ9 F;  5EEG A;  2ZNY A;  3CLO A;  1I1S A;  1EH8 A;  1KA8 A;  2F5C A;  2VT2 A;  4I01 A;  3MCZ A;  3MQ0 A;  5JI6 A;  2GXB A;  1B6A A;  5FD6 A;  1E17 A;  5K1Y A;  1FYK A;  1ZLJ A;  4LJZ F;  5JFR A;  4K2E A;  3ZMS A;  2FBH A;  2EA4 A;  2PLY A;  1CF7 A;  4ZZD A;  3K1M A;  3HSE A;  1E2X A;  3LA2 A;  5LBQ A;  5HLI A;  1B1B A;  2Q2E A;  2K4J A;  4MNU A;  4XLP F;  4WX9 A;  3SXY A;  1MD0 A;  3WTU C;  2MA3 A;  1R1T A;  3GLX A;  2EFN A;  5AON A;  1FBS A;  1SD7 A;  1WQ2 A;  4JK1 X;  1L0O C;  2YX4 A;  5CLS A;  3E5X A;  1W4M A;  5LGU A;  3B73 A;  5BMZ A;  1WRJ A;  2IPQ X;  1JHF A;  3BZ6 A;  2GAU A;  3KEO A;  3C18 A;  1ZG5 A;  2E1C A;  3KEQ A;  3RYR A;  5HS9 A;  1R00 A;  3EUH A;  1J59 A;  5LGN A;  5J8C A;  1USS A;  3B02 A;  2JZY A;  5LGT A;  1U6G A;  3BPX A;  1QZY A;  5H20 A;  4A2U A;  2A69 F;  4U0W A;  4AD9 A;  1XGO A;  3GZ6 A;  3KCC A;  4KIG A;  4WK8 F;  1BC7 C;  2EB7 A;  2OA4 A;  2PMU A;  5D8L B;  2NRA C;  1XSX A;  3Q9V A;  4G7O F;  1O3T A;  2VBX A;  2QVO A;  1G6N A;  1ZRC A;  1W7P B;  2ESN A;  2V6C A;  4IVN A;  1MJB A;  3WTV C;  3V8L A;  4L9V A;  2WWY A;  2IA2 A;  2O6G E;  1G3Y A;  4M9S A;  1IXR C;  3HOT A;  4CYD A;  5BOX A;  5FD5 A;  1O7L A;  3C3W A;  3W6K B;  1KU2 A;  3BWG A;  1ZGA A;  1BI0 A;  2CFX A;  2F5D A;  2QM3 A;  1AWC A;  5KK1 A;  3LQR A;  4HF2 A;  2LDU A;  4OIO F;  1B4A A;  2DPU A;  2XRN A;  2CYY A;  2W24 A;  1ZGJ A;  1JHH A;  2FE3 A;  4WXC A;  4AIJ A;  4MEX F;  4IHT A;  4P5O A;  3WTX C;  4UVB A;  3O6B B;  2KJC A;  2R7F A;  3DF8 A;  2ZCW A;  2FA5 A;  4A0X A;  5D4R A;  6PAX A;  1BIB A;  3GEZ A;  5DUI A;  2OBP A;  2RQP A;  3BP8 A;  4XSX F;  2DU9 A;  1HBX G;  1QZZ A;  1UB9 A;  1R7J A;  2P5K A;  2HKO A;  1I6X A;  3TKY A;  3FXQ A;  1R1V A;  2MLK A;  3I5U A;  4L0Z B;  4YII A;  3WU1 B;  3EYY A;  4EGZ A;  2NAZ A;  1O3R A;  2ZO4 A;  4HQE A;  4UV9 A;  5CVJ A;  1FC3 A;  2EA2 A;  1KQ8 A;  1HQC A;  1OR7 A;  5ICE A;  2M30 A;  1SD6 A;  1R5G A;  2GZW A;  1YYV A;  2FEZ A;  4Q48 A;  2CG4 A;  1TNS A;  3ROU A;  2ZBK A;  1IAW A;  3JTG A;  2ELH A;  2AXL A;  4CIC A;  5ICG A;  1ON2 A;  1C0W A;  1BOA A;  1HSJ A;  3ZPL A;  3WGH A;  4IRG A;  3ZMU A;  1RNL A;  4RAZ A;  3L9F A;  2FQ3 A;  2CO5 A;  4Q47 A;  3I71 A;  5D5U B;  4A5M A;  4U0Y A;  2ZNZ A;  3ERE D;  4FT8 A;  5H6Q A;  3V4G A;  3REO A;  3KP7 A;  4HYE A;  2WTE A;  4H0E A;  2A3S A;  1RUO A;  2F2E A;  4GO1 A;  3WE3 A;  3OOP A;  4A5N A;  1A04 A;  3VOD A;  4HAM A;  4LGW A;  3SFZ A;  2Q0O A;  3WTT C;  2ACJ A;  4FX4 A;  4MHG A;  5J8F A;  2IVM A;  2XAS A;  5IT9 K;  2Z99 A;  4LK0 F;  5ICC A;  1B9M A;  1R22 A;  2XAQ A;  4ENN A;  2XUB A;  3ZMZ A;  4G94 A;  1KGS A;  5E1Z B;  2UWM A;  3FMR A;  2E7X A;  5L3E A;  5L3B A;  1FPQ A;  4G6Q A;  4O5V A;  2PI0 A;  3R4K A;  2FXA A;  5BPD A;  4HOB A;  3RDI A;  4PZJ A;  4B8X A;  1LQ1 A;  4E70 A;  2COM A;  4LD5 A;  2A61 A;  5HS7 A;  2X4H A;  4MEY F;  4I2O A;  3K9T A;  1HW1 A;  1OPC A;  5CVU A;  1VTN C;  2BYV E;  4RGR A;  3HRU A;  3E6D A;  3F8B A;  3FZV A;  1KQ0 A;  1T6S A;  1TW2 A;  3LFK A;  1H9T A;  3HOS A;  3O3K A;  2Y48 A;  1FZP B;  2HEO A;  5FLX K;  4HBL A;  4ZYD A;  1BC8 C;  3BJO A;  2KRF A;  4OIN F;  4BHP A;  3G3Z A;  3HTS B;  2GIV A;  5DD4 A;  3H3U A;  3GF2 A;  3R6S A;  2VT3 A;  2EK5 A;  2L54 A;  1KU9 A;  1BM9 A;  3BY6 A;  2RN7 A;  5IT9 Z;  3F23 A;  3MFK A;  3TGN A;  4BAY A;  1WWX A;  4ON0 A;  1YG2 A;  4HZF A;  2G7H A;  1U5T A;  1GHC A;  5K5R A;  2ESH A;  3FF5 A;  1H0M A;  2ISY A;  3LWF A;  3D0S A;  2FF4 A;  1DDN A;  2CWE A;  2JSC A;  4YFK F;  4EJV A;  5DDG A;  1HST A;  2H09 A;  3RPU A;  3DFG A;  3FHZ A;  4IJA A;  3QP6 A;  2EJR A;  4HA8 A;  1ZLK A;  2XAJ A;  2IP2 A;  2VE8 A;  2L01 A;  4KIF A;  4IXA A;  2RNJ A;  2HQR A;  4XSZ F;  1DP7 P;  3DEU A;  4CZZ A;  4MTE A;  4DQ2 A;  1RZ4 A;  3DPL C;  5LHG A;  2LF7 A;  3VB2 A;  4KMU X;  5FGM A;  4YFX F;  5FLX Z;  3GX4 X;  1MDM A;  2UXN A;  2FMY A;  4HF0 A;  2PMH A;  4L5J A;  1IRF A;  4Z2Y A;  4BQA A;  1YW7 A;  5BS6 A;  2J5O A;  4YFN F;  5E20 A;  5JHU A;  1S29 A;  5F6F A;  4L0Y B;  1B9N A;  4KUM A;  1DPR A;  5CYV A;  2M87 A;  2QUF A;  3U9G A;  2OAZ A;  3E6C C;  2Z5U A;  4WXD A;  4A0Y A;  2OU2 A;  1V3F A;  2DPD A;  4HX4 A;  3VFZ A;  5HDG A;  3DQV C;  5DV5 A;  3ZN0 A;  4ZYE A;  4RB3 C;  2L4M A;  4BHC A;  2PG4 A;  1P4W A;  2EFW A;  2QEN A;  2BV6 A;  2GXG A;  2XHK A;  2XRO A;  3I53 A;  1J9I A;  4B09 A;  4ZYG A;  1P6R A;  1Q1H A;  3BJ6 A;  4G6D A;  3F3X A;  1G4D A;  4EM0 B;  5CJ9 A;  3HRS A;  4S04 A;  3FM3 A;  2FBI A;  3N97 A;  4I02 A;  1D8J A;  3RTR A;  2AS5 F;  1SFE A;  1X3U A;  3HRT A;  3E5Q A;  1IF1 A;  1AOY A;  3ZMD A;  1EH6 A;  3TO6 A;  2CQK A;  2V79 A;  2C6Y A;  1LDK B;  2HQN A;  5D6E A;  4UUV A;  1B59 A;  1ZAO A;  2HTS A;  3ZN1 A;  1NHA A;  2VE9 A;  5E1W A;  2P7V B;  2P5L C;  2P5V A;  5TJJ A;  1QO0 D;  1ZH5 A;  1BN5 A;  4EM1 A;  2KIM A;  2Y0M A;  4LLG F;  2DBB A;  1Z1D A;  2YSR A;  4NHJ A;  3FM5 A;  3ML6 A;  2B0L A;  2BGC A;  3ELK A;  3U2R A;  4BHB A;  2H94 A;  2EFP A;  2M5W A;  4OIR F;  4P96 A;  3FMQ A;  4KIC A;  2LF8 A;  1KU3 A;  1ULY A;  4XRF A;  4I0B A;  2D1V A;  1FT9 A;  1LDJ A;  4GGG A;  3C7J A;  3Q5F A;  1BJA A;  1K6O A;  4BYY A;  5A2Q K;  2V9V A;  4WF2 A;  5E8G A;  1RUN A;  5DCM B;  4KN7 X;  4KMF A;  1KU7 A;  3V7S A;  1OMI A;  2GA2 A;  2YR2 A;  3GVA A;  2QLZ A;  5DUK A;  3OV8 A;  1O3Q A;  2MD5 A;  2ZKZ A;  1UCR A;  1UHW A;  1T38 A;  2JTV A;  4KN4 X;  1T39 A;  5F1R A;  4HDU A;  5CVV A;  1FSE A;  3EET A;  5L3F A;  1OKR A;  2DAO A;  1TLH B;  1IN8 A;  2YU3 A;  1K7A A;  3RKX A;  3V7C A;  4HLX A;  3NEU A;  2WC2 A;  2FOK A;  1R5H A;  2XKO A;  3KZY A;  3P9C A;  3GFM A;  4M9X A;  2FRH A;  1HKQ A;  4EV0 A;  4GCV A;  3HIF A;  5LHI A;  4D0P A;  3KFW X;  3GFL A;  4PGH A;  4R79 A;  2XIG A;  2H6B A;  3J80 K;  1YIO A;  4HX7 A;  4PCQ A;  4HQM A;  1YLF A;  2QQA A;  3QP5 A;  3WOD F;  5LEK A;  2VC0 A;  3MZH A;  1Y0U A;  1GVJ A;  1U2W A;  1OYI A;  4M71 A;  3T8T A;  3U1D A;  5A2Q Z;  2EV6 A;  2EV5 A;  1J2X A;  3DPT A;  1FYM A;  4RB0 A;  1XGN A;  3PQJ A;  3D5L A;  4HLY A;  4EQQ A;  3AAF A;  3K2Z A;  3RJP A;  1SD4 A;  4DNC A;  3SZT A;  4CDG A;  2QBY A;  2RKH A;  5E18 F;  4N9I A;  3WTZ A;  4NB5 A;  1U5T C;  1XCV A;  5HS8 A;  3FX3 A;  5DYM A;  1YW9 A;  3IC7 A;  1FLI A;  1FNN A;  4ENM A;  4JQF A;  3KLO A;  1FX7 A;  5D6F A;  1CF7 B;  3RYP A;  2R3S A;  1IXS B;  2L02 A;  2RDP A;  3I64 A;  3QOP A;  2XKP A;  3FMS A;  4OIQ F;  3T5X A;  1ZYR F;  4ZZL A;  2A5Y B;  4CHU A;  5FFX A;  1S7A A;  3HUG A;  4ETS A;  4U0V A;  1LDD A;  1OYW A;  2FNA A;  1BIA A;  1HXD A;  3DKW A;  1FSH A;  3J80 Z;  4AWX B;  2BE5 F;  2IRF G;  1LEA A;  5HLG A;  3IKT A;  3LST A;  1HW5 A;  1R23 A;  2EV0 A;  1FYL A;  5L3G A;  1XGM A;  2O61 A;  1I27 A;  3NRV A;  3R61 A;  2XGX A;  4OMY A;  2Y75 A;  1SFX A;  1FBQ A;  5LHH A;  1QQI A;  3V8J A;  1ZHF A;  3VOE A;  3I0T A;  1K79 A;  4NQW A;  5FB2 A;  2VBW A;  3HRM A;  2ZME A;  3L09 A;  1JXS A;  5L3C A;  4KYW A;  1IN7 A;  3KP6 A;  1RIO H;  2PFB A;  3CUO A;  4L18 B;  4M6X A;  4BXU A;  5HLH A;  2WV0 A;  2FML A;  2TDX A;  4IRI A;  2G9W A;  3MWM A;  4QWQ A;  3E97 A;  1JGS A;  3DXJ F;  3O2P E;  1J0R A;  3TOA A;  4ESB A;  1Z7U A;  4QLC U;  1YTY A;  4UNO A;  3CUQ A;  3RPQ A;  3SQN A;  4Y15 A;  2K02 A;  1WI9 A;  1W5S A;  3HTU A;  3BJA A;  5D5V B;  2VN2 A;  4RGU A;  1G3T A;  2E7W A;  1SAX A;  5EEH A;  4RGX A;  3K0L A;  4MQV A;  4G7Z F;  5JR3 A;  4N0B A;  3I59 A;  2D45 A;  1GXQ A;  2XAG A;  3QU3 A;  2VOD A;  3L7W A;  3M1E A;  4HV6 A;  3K1N A;  1RI7 A;  2EFO A;  4HX8 A;  2ZFW A;  3M9A A;  4EJW A;  2M8E A;  2OQR A;  1L3L A;  3M8E A;  3KP4 A; 
#chains in the Genus database with same CATH topology
 5ILS A;  3N4M A;  2V1U A;  5CVR A;  3PFY A;  2BXY A;  4DYC A;  2OZU A;  4PDK A;  4RA2 A;  3GW2 A;  5ILV A;  2QQ8 A;  4XLC A;  3T1B A;  4BGD A;  1ZN2 A;  4R8H A;  2R4G A;  3IL2 A;  4FIS A;  1ZQ3 P;  3AKZ A;  1W36 D;  4FQG A;  4EM2 A;  1K78 A;  4B4C A;  3W6J B;  4AID A;  3LAJ A;  2NNN A;  2UZK A;  3CC7 I;  4RM3 A;  2HFH A;  2DLL A;  2W57 A;  3GZ5 A;  5KVR A;  2R7R A;  3CTA A;  4Z6Y A;  2EZH A;  4LB6 B;  5GP9 A;  2V4J C;  1FBU A;  3EQL F;  1WJE A;  4M3E A;  1HOM A;  1R71 A;  4UVA A;  3BG3 A;  5D5X B;  4E7H A;  4RAY A;  4G8X A;  1QBJ A;  2B9S A;  2HYG D;  4KIS A;  1J09 A;  1LB2 A;  2X51 A;  1LJ9 A;  2X6W A;  1FY7 A;  2XVC A;  4GYG A;  4BJT A;  3MD2 A;  3KP2 A;  2WB1 A;  5ILU A;  1RKT A;  1YJN I;  2Z9O A;  1TT5 B;  4AIK A;  2CUJ A;  2O5R A;  2PEX A;  3RKQ A;  2K9L A;  2HQA A;  4BH9 A;  3JAM K;  2K4B A;  4TV7 A;  2H8R A;  1BI2 A;  2K7L A;  3OYB A;  3K4L A;  1XCB A;  2M1B A;  4LIT A;  3IRQ A;  4HDV A;  3OS0 A;  5IT3 A;  3HUG B;  2NVX J;  2JPC A;  1E3P A;  2K85 A;  3I9V 2;  1ZG3 A;  1MMA A;  2MH2 A;  2VOO A;  1LEB A;  5HOO A;  3BTJ A;  2VJ4 A;  3JR9 A;  1Z05 A;  2V6E A;  1TW3 A;  1XSV A;  2FQ4 A;  2DFF A;  4G9Y A;  1FOK A;  4MGR A;  2GLO A;  3K4C A;  2Y9Y A;  1BOB A;  1Y8R B;  1R1U A;  2MFZ A;  3MKW B;  3WGI A;  1CGP A;  5LRS A;  1R36 A;  1YX3 A;  1GXP A;  4ZC3 A;  4G6T B;  2EZI A;  3ULQ B;  1Y0N A;  3I58 A;  2JVH A;  2DA2 A;  3L2C A;  3CO7 C;  2A5W A;  2BW3 B;  2K5C A;  5L3D A;  1U9N A;  5EGO A;  1W7P A;  4MIM A;  4AYB N;  1J75 A;  3FXJ A;  3DV8 A;  5H6R A;  1POG A;  2CUZ A;  1V5E A;  1UAA A;  1KYW A;  2W84 A;  3IH2 A;  3A2K A;  4NQW B;  3HSR A;  3CCE I;  2HXO A;  2DFE A;  3BG7 A;  1A36 A;  1TNT A;  4A6D A;  3V7R A;  3OYF A;  3WTY C;  3VYT B;  4WCG A;  4U7B A;  2LBF B;  3WU0 A;  2EWN A;  3ABT A;  3X2Q H;  3BG5 A;  4C30 A;  4AC0 A;  2DI3 A;  2L4A A;  5ICF A;  3QAH A;  1DUX C;  1FOX A;  2MG4 A;  2W85 A;  1BBY A;  3A01 B;  1FJL A;  1V5G A;  3RSN A;  2R5Z A;  5DD8 A;  2O7O A;  1K61 A;  3NAR A;  4Y13 A;  5JVT A;  2O03 A;  3MEX A;  4YEJ A;  4ENJ A;  3IRR A;  1S7O A;  1YS7 A;  4ESF A;  1BW5 A;  2A6H F;  2VBZ A;  4BEH B;  2P6S A;  2CGP A;  3JCU C;  2ZJ2 A;  3OR2 C;  4EJT A;  2PN6 A;  3FK7 A;  3QPT A;  2DDA A;  3VEP A;  5LLQ A;  3OS2 A;  4KDP A;  5F0F A;  3TQN A;  3WG9 A;  3OYA A;  1A35 A;  3V42 A;  3PO3 J;  4RB2 C;  2QQB A;  4XLA A;  2Z3Y A;  2O0Y A;  3PM1 A;  4L9N A;  2VJJ A;  3RKW A;  3DBL B;  1PUE E;  1JGG A;  1XN7 A;  4OMZ A;  3K70 D;  1LVA A;  2YX7 A;  3JAM Z;  3HYI A;  2IT0 A;  5CQE A;  3F6V A;  1AA7 A;  4XKC A;  2PJR A;  1XGS A;  1Z91 A;  2KP6 A;  2XPW A;  4I09 A;  3P9I A;  4KT5 C;  1KQ9 A;  4L9J A;  2OV7 A;  3DWL E;  2OZ6 A;  2P8T A;  1HCR A;  4XN3 A;  1KYZ A;  1IUF A;  5LRR A;  3CQZ J;  2XPV A;  2B63 J;  1IXC A;  3H3V K;  1X1P A;  1QNT A;  1H9G A;  5AIQ A;  1IRZ A;  2PBI A;  2CV1 A;  2Y0S A;  3RCO A;  1GV5 A;  5FRM A;  2MSY A;  3JSO A;  2W25 A;  4F91 B;  2M34 A;  5J1Y A;  3ZQ7 A;  4E6K G;  1ZRE A;  1VQP I;  1P92 A;  3BR0 A;  3I59 B;  4M73 A;  1YOV B;  3F6O A;  3U21 A;  5GTH C;  1ODD A;  2DT5 A;  4WXH A;  3ZRG A;  1MNM C;  3S14 J;  3S16 J;  5CVI A;  1ZKG A;  2HYF A;  2QYO A;  9ANT A;  3ZQL A;  4N9H A;  1G3S A;  3GWZ A;  2F5F A;  3RKY A;  2ZJQ F;  5KAI C;  3GLL A;  4XKB A;  2DK5 A;  1MMG A;  1Z9C A;  4AUX A;  1VQ9 I;  1UHS A;  3T8R A;  3HZJ A;  1WKM A;  2CFO A;  3CD6 I;  4BY1 J;  2MH9 A;  3QOE A;  4LMY A;  3COA C;  5D4S A;  2MD0 A;  2HKX A;  2VXD A;  4LG0 A;  3HG9 A;  4NC6 A;  1T98 A;  2L5Q A;  3WE2 A;  5DEQ A;  3RQ4 A;  4UV8 A;  2JA6 J;  4CGZ A;  1FP1 D;  1IO2 A;  3ZQC A;  2BBY A;  1DPU A;  2IBD A;  4RS8 A;  2QF7 A;  1P7J A;  5DM7 F;  2ECC A;  4GYI A;  2W4S A;  4N4N B;  4UUS B;  1MJ9 A;  2L2O A;  2JPB A;  2BHY A;  2NS7 A;  3PNT A;  3S3M A;  3BT9 A;  1TBX A;  2KIU A;  3F0C A;  1K78 B;  1X2M A;  2H6C A;  1VF9 A;  4GRI A;  2E1O A;  1I3Q J;  1Z7L A;  1SMY F;  2ADU A;  3CDI A;  3LQQ A;  4LLN A;  4RDU A;  4QIW N;  3NWT A;  4EVI A;  3FWE A;  2HOS A;  1PYV A;  1PUF A;  4J00 A;  1HW2 A;  2ZME C;  3ECO A;  1ZGW A;  5FKO A;  2JT1 A;  1Z0X A;  1OIS A;  3I54 A;  3IP4 B;  1JI8 A;  1U5T B;  1FOY A;  1TTY A;  4JX4 A;  3ZMV A;  1X19 A;  2NNY A;  1RR7 A;  4U88 A;  4A3E J;  4M6Y A;  3S1Q J;  4A69 C;  4CXF A;  1MBG A;  3ZOB A;  3M7G A;  3W3C A;  2M45 A;  3JRF A;  2JA7 J;  2HGC A;  2LY2 A;  1HKT A;  3DPU A;  3OR1 C;  3CJN A;  2W48 A;  4MTD A;  4EMS A;  3M8F A;  2JA8 J;  4A3G J;  1T2K A;  1SAN A;  3KEY A;  3OIO A;  4KA4 A;  3CLQ A;  2E2J J;  5F27 A;  2L7K A;  2P6T A;  3HOY J;  1X3W B;  1RET A;  1T0F A;  4A0Z A;  1MSE C;  3CUQ C;  4I98 B;  4PGG A;  1D3Y A;  2X0L A;  2A6E F;  3IHU A;  2VKH A;  3BOQ A;  4NBQ A;  1Y39 A;  1ONV A;  3UR3 C;  3DP7 A;  2CJJ A;  4V19 K;  2VXZ A;  1FP2 A;  1MND A;  4LG3 A;  2CUE A;  3FXU A;  1TQI A;  1BR1 A;  3SDG A;  3PIP F;  1U3E M;  2LC2 A;  1SD5 A;  5FKM A;  2E1M C;  3PFI A;  1S6L A;  2KKO A;  2ZXJ A;  3C2B A;  3W6V A;  3WTS C;  2R7D A;  2XGE A;  2STT A;  4IHS A;  4KNY A;  3H92 A;  5HDN A;  1R5I D;  4B44 A;  3BDD A;  4ENK A;  1WJD A;  1WJA A;  3QU6 A;  3NQO A;  4UVC A;  1UFM A;  3S32 A;  1D5V A;  3R0J A;  1B72 A;  4AVP A;  1MDM B;  3I4P A;  2EFQ A;  1IUY A;  1SFU A;  1IRG A;  3FKI J;  1E0E A;  2KRC A;  1MH4 A;  1TZL A;  4R1H A;  5TGT A;  2HOE A;  5B1A H;  1IW7 F;  2X6Y A;  3MZY A;  2ZC2 A;  3E3V A;  3FXO A;  1B8I A;  1S7E A;  5IPA A;  4HF1 A;  3FXR A;  1K4T A;  4G7H F;  1DQU A;  2MC4 A;  4M72 A;  1XDU A;  2VPL A;  1CQT A;  2KJB A;  2COB A;  1XMK A;  2MC3 A;  2E35 A;  4QSH A;  1P9Q C;  5GPC A;  1FIP A;  3K4J A;  2DTZ A;  3KYC B;  4WWC A;  5J40 A;  2PJP A;  2VIX A;  3S15 J;  4BQO A;  3ABK H;  3KE2 A;  3MZ8 A;  3HB9 A;  1OYY A;  2H8W A;  2MBF A;  3K69 A;  4CYC A;  3CO6 C;  1FWZ A;  1DP3 A;  1OLT A;  2L7Z A;  3VWB A;  3ECH A;  1MMN A;  2BY3 A;  3V8K A;  2E5Z A;  4PSX A;  2DOA A;  2IGM A;  3KP5 A;  3J81 K;  1QPM A;  2FJ1 A;  3BC8 A;  2FNP A;  5F64 A;  3DLL F;  1MZB A;  1OCC H;  3LSG A;  2F4M B;  3HGG A;  4B47 A;  1ZRD A;  2B7E A;  4XLN F;  3SHF A;  4L5I A;  2HU9 A;  4HNU A;  1GVD A;  4HEA 2;  4PSW A;  2R7V A;  2V1X A;  3IKV A;  1MJA A;  3CJQ B;  2Y30 A;  2L9S A;  3G73 A;  2WA0 A;  3BR1 A;  1XS9 A;  2PJR B;  4BNC A;  2YPR A;  1R6R A;  3KLN A;  1REP C;  2K3P A;  3IH3 A;  5LEJ A;  3RZO J;  2HS5 A;  3VYU B;  1IN6 A;  1MNE A;  2PQ8 A;  1X1B A;  2HYJ A;  2G7U A;  3ABU A;  1UG0 A;  2X1D A;  5B66 C;  2EH3 A;  4XRS G;  4RB1 A;  3E6M A;  4NC8 A;  3L2W A;  3HHG A;  5J6X A;  1WCM J;  4BAC A;  3BPV A;  1PP7 U;  4FHT A;  3TP0 A;  1STZ A;  2VQL A;  4PJJ A;  4UXN A;  3L00 A;  1ZK8 A;  3BR6 A;  1TWC J;  3IV5 A;  4LB5 A;  1S3J A;  3LA3 A;  1WJF A;  4LFU A;  2E2I J;  1X1D A;  2JVG A;  4NUB A;  1ZG1 A;  2VOP A;  3CME I;  1AHD P;  3OYJ A;  2IAI A;  1U9O A;  1OCZ H;  1MBK A;  2JMW A;  5E1X A;  4A6E A;  4E7Z A;  3NAU A;  3PUB A;  3KET A;  2VON A;  3GTG J;  4I7H A;  5B5E C;  1NH3 A;  1F4K A;  1SVM A;  1Z6R A;  2LKP A;  3DKX A;  4A12 A;  3S93 A;  3F21 A;  2R7Q A;  4LG0 B;  3AL0 C;  5HVQ C;  3C1D A;  4MFD A;  2DFI A;  4BKX A;  5E17 F;  2FBK A;  3PQK A;  4UB8 C;  2A68 F;  4RBO A;  1X1A A;  3SZP A;  3P5J A;  4D5F A;  2RGV A;  1XG1 A;  4P9U A;  1W5T A;  1IN4 A;  3IWF A;  2LNB A;  3D5R C;  3LOC A;  1LNW A;  3FIW A;  4MLO A;  4DIQ A;  2HDC A;  4Q5S F;  4M6V A;  4ITV A;  1SC7 A;  1LFB A;  3IAM 2;  3I56 I;  2QA4 I;  1R58 A;  1XX5 A;  5F04 A;  2QCO A;  4S05 A;  4KFC A;  1QGP A;  3LA7 A;  2CSO A;  1YO5 C;  3TDU C;  3A4C A;  2H27 A;  2MGQ A;  3BRO A;  3BTI A;  4II2 A;  3WGG A;  2JSP A;  2VBY A;  2XAH A;  4B48 A;  3F8F A;  1BI3 A;  3W2W A;  4A3J J;  2UXX A;  4QPQ A;  4X0G A;  1HKS A;  4ESJ A;  3TDZ C;  1ZAR A;  3J81 Z;  5DM6 F;  4A3D J;  3SDB A;  2DTR A;  4FET A;  2OCC H;  3DBH B;  2D5V A;  3B6C A;  3GUD A;  2XAU A;  4ZH4 F;  1LFU P;  1YS6 A;  3S1M J;  2X1C A;  4XR6 A;  2LG4 A;  4B1R A;  1RC9 A;  2Q8K A;  1XD7 A;  1NTC A;  4CO8 A;  4BDY A;  1WSU A;  4GXO A;  1JKO C;  3J7A O;  2L0K A;  3LAP A;  1YQA A;  3IH4 A;  1EJ9 A;  2I5U A;  3E1S A;  3N05 A;  4OU0 A;  1EF4 A;  1U78 A;  2HWV A;  4HNT A;  1ZTR A;  4P9F A;  4UY8 I;  1Z67 A;  3ZQF A;  3QPL A;  3H9G A;  5E8I A;  4EJO A;  3TO7 A;  2XAF A;  4C3J J;  3M1C A;  4M74 A;  4RLF A;  4OWR B;  4DYQ A;  2D1H A;  4C2M J;  2DQL A;  1VQ6 I;  2FU4 A;  5AIP A;  2IW5 A;  2AO9 A;  1W7P D;  3WTW C;  4C2U A;  2STW A;  1F5T A;  3DU6 A;  3IWZ A;  1VQO I;  2WY7 Q;  2QZ8 A;  1D1A A;  1ZR4 A;  1U8R A;  4A3B J;  1F1Z A;  1D0X A;  3KZZ A;  3G4S I;  2NS0 A;  2HR3 A;  1XDS A;  2DW4 A;  2L9R A;  3T0Y A;  5FJ8 J;  2Z2S B;  3F8N A;  1MGT A;  3U1K A;  1ITY A;  4EJU A;  1B72 B;  5CKT A;  1XMA A;  3BLY A;  4FX0 A;  1JKQ C;  1W36 C;  3ZP5 A;  1TC3 C;  5EZH A;  1O7F A;  4XK4 A;  3S1R J;  4Y17 A;  3OL4 A;  3CCQ I;  4BE2 A;  2E19 A;  2BZT A;  2HTJ A;  2VQC A;  2QWW A;  1SMT A;  3ISP A;  5ED4 A;  3K1P A;  3JTH A;  1VQN I;  1G3W A;  2VC1 A;  4YG2 F;  1TQP A;  2P7C B;  4F52 A;  2YS9 A;  5EYR A;  1R9T J;  5FKL A;  2K27 A;  4ASN A;  3HXL A;  1YW8 A;  1XSD A;  3DEW A;  4M9Z A;  2V1D A;  2HOA A;  1BI1 A;  4IKF A;  1JE8 A;  5E79 C;  3BTC A;  5E3O A;  3LSR A;  4XRS A;  2F5E A;  1MKM A;  1O3S A;  1OCT C;  4BU2 A;  2BHZ A;  2A6T A;  3MAJ A;  3FXK A;  3CJT B;  2K9Q A;  2IS4 A;  4F93 B;  2O3F A;  3KX2 A;  3RIR A;  4M3G A;  1BL0 A;  1PP8 F;  4ANJ A;  2BVL A;  2V26 A;  2JWT A;  2RRE A;  3E7L A;  3L2V A;  1F9N A;  3JRH A;  3PNY A;  3P7N A;  3GFI A;  1EH7 A;  2R7Z J;  1D8K A;  5BPI A;  2XSJ C;  2IJL A;  3JW4 A;  2O8X A;  2P4W A;  3DU5 A;  4LK1 F;  2DQR A;  3DTE A;  2ZJR F;  1EV7 A;  2OQG A;  2Z33 A;  3WU2 C;  2F4O B;  4IF4 A;  2NVT J;  1J5Y A;  2QBY B;  2J5P A;  2DJI A;  4F7Z A;  3OYL A;  3S17 J;  3HHH A;  1N78 A;  2GWR A;  4A3L J;  2MLG A;  2QKL B;  1IN5 A;  3L2Q A;  3F22 A;  4IHY A;  2WV1 A;  1I1G A;  1LVK A;  2LYC A;  3H3Z A;  4RMN A;  3G1M A;  2ETH A;  2KMU A;  1VQL I;  4OIP F;  4IRH A;  2LLK A;  1ON1 A;  2D2W A;  2E5N A;  3P9K A;  4AIH A;  2A07 F;  2FUG 2;  1XB4 A;  1HF0 A;  3CDL A;  5EF6 A;  1UHM A;  1PDN C;  3CCU I;  1ZRF A;  4EGY A;  3ZMT A;  4FE7 A;  4JBA A;  4KIB A;  4P55 A;  4ZDP A;  2XDV A;  3PSF A;  3RI4 A;  5K5Q A;  3BQY A;  3TOB A;  4O3M A;  5ERI A;  3EDP A;  4BUP A;  4FAS D;  2WB1 N;  1T0F C;  3Q9S A;  2E1N A;  5GAG J;  5TRD A;  2ISZ A;  5M5Y J;  1YI2 I;  1X1C A;  1YE9 A;  3OYI A;  2HVS A;  2CRG A;  2VKD A;  2CW0 F;  3OWT A;  3Q0U A;  1U8B A;  3AG2 H;  3CCV I;  5D5W B;  1YFH A;  2NS8 A;  3E6B A;  1K6Y A;  4UHT A;  2RV8 A;  2KIF A;  1ETV A;  4W1U A;  3F72 A;  2FSW A;  2OD5 A;  3K6G A;  3KZI C;  4XLE A;  3F8M A;  2IA0 A;  1P4A A;  2QGU A;  5FKK A;  1QA6 A;  3IUO A;  1TQM A;  3SEZ A;  3KP3 A;  4BL0 B;  3NWS A;  5DCM A;  2BXZ A;  3R60 A;  3ERM A;  2CW7 A;  5D8K B;  3EYI A;  4B3X A;  2E2H J;  1HA8 A;  1J7K A;  2CMP A;  2L7F P;  5DCF A;  4I0A A;  2RVC A;  1LE8 A;  1IG7 A;  2EIJ H;  3OYK A;  4D5C A;  3TO9 A;  1O57 A;  1UST A;  3K70 C;  1P2F A;  1NG7 A;  1Z21 A;  3BG6 A;  4I76 A;  3FBI B;  2IA1 A;  3CZ6 A;  4IX7 A;  3GO5 A;  4O6J A;  4HW0 A;  2XRL A;  4XBF A;  2XF5 A;  2CS3 A;  1P4X A;  2YUS A;  2DK8 A;  3MMY B;  2DO7 A;  2GA1 A;  5K5O A;  4BBS J;  3R0A A;  3M07 A;  5C3E J;  2WAD A;  2XSD C;  4X1E A;  2LSO A;  3RZD J;  4CCL A;  1V4R A;  2P81 A;  2JRT A;  2ZME B;  5BQT A;  4PFP A;  4L9T A;  1IZ1 A;  3I4M J;  3EPZ A;  4ZYH A;  2DMN A;  4AYB A;  2QSH X;  2M0M A;  1T8I A;  3CDH A;  3LMM A;  2NVQ J;  5M3F J;  3HSF A;  3DBR B;  2HXI A;  4HV5 A;  5HDK A;  2OUM A;  1ZEL A;  1OJL A;  1I5Z A;  4FE4 A;  2HZT A;  3GYH X;  1LFP A;  3DCF A;  3GBG A;  4RGS A;  3J7A Y;  5LD2 C;  2Y9Z A;  1JT0 A;  2RC4 A;  1SFK A;  3CJR B;  4BXF A;  1X4O A;  1R4M B;  3ZQQ A;  4CCK A;  3QPH A;  1Z6T A;  3IAS 2;  4A93 J;  1TWH J;  3JSP A;  2DOE A;  2L3D A;  3QRF F;  2XV4 S;  4LLL A;  1BW6 A;  3CUQ B;  2XGD A;  4U7D A;  2BEO A;  2LTP A;  4YIF A;  3HKZ N;  2GQQ A;  3S2W A;  5GTI C;  2Z16 A;  1S8N A;  3E5U A;  2K86 A;  2UV1 A;  2GOX B;  4OOI A;  4F55 A;  3GXO A;  2F5V A;  3CCY A;  4Q4Z F;  2NYX A;  1WPK A;  3FKJ A;  3F8C A;  2E1M B;  4C9Y A;  4ZDL A;  1NK3 P;  1QVU A;  2QQ9 A;  4IPA A;  4RLQ A;  1JUM A;  3H9J A;  5FFZ A;  1QVT A;  5FO5 A;  3JRD A;  3GFJ A;  4XL9 A;  4MQ9 F;  5EEG A;  3DEE A;  3K7A J;  2ZNY A;  3CLO A;  3LSH A;  1I1S A;  4ZDO A;  1EH8 A;  1KA8 A;  2F5C A;  3Q0V A;  4Y3O A;  2VT2 A;  3S2D J;  1DU6 A;  5M5X J;  1JT6 A;  3MCZ A;  4I01 A;  2JQ7 A;  5J3L A;  3OS1 A;  4F92 B;  2FOW A;  3HOX J;  3ZGK A;  3AG1 H;  3MQ0 A;  2V1N A;  3QYF A;  3S3N A;  5F1J A;  5JI6 A;  2GXB A;  4A3M J;  1B6A A;  5FD6 A;  1Y1W J;  1E17 A;  5K1Y A;  1FYK A;  1ZLJ A;  3KIO A;  2LFB A;  4LJZ F;  5JFR A;  2BVM A;  4K2E A;  3ZMS A;  4Y4R A;  1G2H A;  4ZJZ A;  2GM4 A;  2FBH A;  2XB5 A;  3H9Q A;  4PFO A;  2EA4 A;  5HNH A;  2NVY J;  2PLY A;  1CF7 A;  1JKP C;  4ZZD A;  3K1M A;  3WHC A;  3HSE A;  1E2X A;  3TED A;  4D1Q A;  5IOZ A;  3SJM A;  3LA2 A;  5LBQ A;  5HLI A;  1B1B A;  1MMD A;  2Q2E A;  2K4J A;  2JRM A;  3CMM A;  4BDZ A;  1MBE A;  4MNU A;  4XLP F;  5M3M J;  4WX9 A;  1JTX A;  2EPF A;  1MBF A;  3SXY A;  1MD0 A;  3WTU C;  2MA3 A;  1R1T A;  3GLX A;  2KDZ A;  2EFN A;  3GCM A;  2XF7 A;  5AON A;  2A05 A;  4XKV A;  1FBS A;  1SD7 A;  3CMY A;  1BR4 A;  1WQ2 A;  2VJ5 A;  4JK1 X;  3JRG A;  1L0O C;  2ME0 A;  2NXN B;  1T95 A;  2EQR A;  2YX4 A;  5GAH J;  1ETO A;  3ASO H;  2AQE A;  5CLS A;  1XPX A;  3BR5 A;  3E5X A;  2XB0 X;  3VYR B;  3K4N A;  1W4M A;  3CMA I;  1E3O C;  5LGU A;  3B73 A;  5BMZ A;  1WRJ A;  2IPQ X;  3PUF A;  1JHF A;  1Y6I A;  1T56 A;  2KRH A;  2L9V A;  4BY7 J;  4E7S A;  1H88 C;  3BZ6 A;  2GAU A;  3KEO A;  3LNQ A;  3PJR A;  1ETQ A;  2ELJ A;  2MAB A;  3BR2 A;  1R49 A;  2FX0 A;  3OYC A;  3C18 A;  1ZG5 A;  3CP2 A;  1QPI A;  2E1C A;  3QWL A;  3KEQ A;  1WH5 A;  2VI6 A;  3RYR A;  2DYR H;  5HS9 A;  3CCL I;  3HGY A;  1R00 A;  3EUH A;  4IEJ A;  3BQZ A;  3E0J B;  1WHU A;  1J59 A;  3FXL A;  3I3L A;  1P7I A;  4DZJ A;  5LGN A;  1WZ2 A;  1MMS A;  2OF7 A;  1Y56 A;  5J8C A;  1USS A;  3B02 A;  2ZSH B;  2JZY A;  3BPX A;  1U6G A;  5LGT A;  5E3M A;  2W7N A;  1YJW I;  1QZY A;  5H20 A;  4AVZ A;  3AL0 B;  4A2U A;  2A69 F;  3GTL J;  4U0W A;  4AD9 A;  3GTO J;  2CQ7 A;  3KP4 A;  1XGO A;  5FRO A;  1APL C;  3GZ6 A;  3ABM H;  3KCC A;  4KIG A;  4EEF G;  4WK8 F;  1BC7 C;  2EB7 A;  3LSM A;  1WFX A;  3ZQH A;  2OA4 A;  2PMU A;  4BQQ A;  5D8L B;  2NRA C;  1XSX A;  3Q9V A;  3VYS B;  4G7O F;  1O3T A;  2OC6 A;  2VBX A;  2QVO A;  2DA5 A;  3CP8 A;  1G6N A;  1ZRC A;  4ZTJ A;  5EGO B;  1W7P B;  2WAF A;  1RKW A;  1QHG A;  2ESN A;  2V6C A;  1OCP A;  1ACI A;  4IVN A;  1V5F A;  1MJB A;  3WTV C;  3V8L A;  4NC7 A;  4L9V A;  4A3F J;  5KCM A;  2M7B A;  2WWY A;  2CW8 A;  2IA2 A;  2O6G E;  4M3F A;  2VQG A;  4V2G A;  1IC8 A;  2CV2 A;  1G3Y A;  1YIT I;  3BCA A;  4M9S A;  2XPU A;  1X4P A;  1GLN A;  1IXR C;  3TP3 A;  3HOT A;  2HVR A;  4CYD A;  5BOX A;  1ERD A;  4AM3 A;  1BR2 A;  3H36 A;  5FD5 A;  1O7L A;  3C3W A;  4CCJ A;  2R5Z B;  3W6K B;  1KU2 A;  3BWG A;  1EA3 A;  4J01 A;  1ZGA A;  1BI0 A;  2CFX A;  1BA5 A;  5C4X J;  1OFC X;  2L9N A;  3VSL A;  3A02 A;  3K4K A;  5LFA A;  4KT6 A;  2F5D A;  3HJE A;  2QM3 A;  4FCY A;  1AWC A;  1AU7 A;  5KK1 A;  4GDF A;  1FIA A;  2M8G X;  1A6Q A;  3BR3 A;  3AFH A;  4LIU A;  3LQR A;  3H5R A;  4HF2 A;  1G8X A;  2LDU A;  3QQA A;  2DMT A;  4OIO F;  4QPO A;  1B4A A;  3SFI A;  1AKH A;  2DPU A;  4XLH A;  2XRN A;  4HNV A;  3AG4 H;  2NOG A;  3RQI A;  2VLA A;  2CYY A;  2W24 A;  1ZGJ A;  1JHH A;  2VPR A;  4E7J A;  2FE3 A;  4WXC A;  2H1K A;  2Y2Z A;  4AIJ A;  4MEX F;  4IHT A;  4P5O A;  1IRX A;  3WTX C;  4UVB A;  3O6B B;  2KJC A;  3LSI A;  3C2G A;  2NVU B;  3HC7 A;  1HC8 A;  2R7F A;  1WJC A;  2DFH A;  2ZCW A;  3DF8 A;  2FA5 A;  4A0X A;  5D4R A;  1A31 A;  6PAX A;  2LR8 A;  1BIB A;  2K9S A;  3GEZ A;  5CQG A;  1K83 J;  1XMX A;  5DUI A;  2OBP A;  2RQP A;  3AG3 H;  3BP8 A;  4XSX F;  1MBH A;  3OIQ A;  2DU9 A;  4XIC A;  2QKM B;  2P0W A;  1HBX G;  3FHN A;  1QZZ A;  1UB9 A;  1R7J A;  2P5K A;  4XKW A;  2HKO A;  1MH3 A;  1I6X A;  4NNJ A;  3TKY A;  2HI3 A;  3FXQ A;  1R1V A;  2DT6 A;  4XOR A;  1VZ0 A;  2MLK A;  1XC5 A;  4HG2 A;  3I5U A;  2EIL H;  4L0Z B;  4YII A;  3S1N J;  3WU1 B;  5HOD A;  3EYY A;  4EGZ A;  2NAZ A;  2R7O A;  1O3R A;  2ZO4 A;  4HQE A;  4E7L A;  2QSF X;  4UV9 A;  2PMZ N;  5CVJ A;  1FC3 A;  4F3Q A;  1H8A C;  2EA2 A;  1DU0 A;  1KQ8 A;  3MVP A;  4IQJ A;  1HQC A;  1OR7 A;  4PJL A;  5ICE A;  3HPH A;  2M30 A;  1SD6 A;  4JP0 A;  4PUS A;  1R5G A;  2E36 A;  4IHW A;  2GZW A;  1HDD C;  1YYV A;  4BJ5 C;  2HOT A;  2FEZ A;  4Q48 A;  2CG4 A;  3TW6 A;  1X3Z B;  3ZQG A;  4M3D A;  1HLV A;  1TNS A;  3ROU A;  3JRC A;  2ZBK A;  1X58 A;  2OCE A;  3MKZ A;  2IGO A;  1IAW A;  3KPH A;  3W2A A;  3SZG A;  1PUF B;  3K2A A;  4YEL A;  2R7U A;  1LUJ B;  2XGC A;  5J4V A;  5KHD A;  3JTG A;  2I8D A;  2ELH A;  3ASN H;  4DBQ A;  5F0H A;  2AXL A;  4CIC A;  5KAF C;  5ICG A;  2GBY A;  1ON2 A;  3PIO F;  1U0J A;  4XRM A;  2ZSI B;  5IP6 A;  1C0W A;  2W00 A;  1ENH A;  1S9H A;  1F36 A;  1YJ9 I;  2O9L A;  1BOA A;  1HSJ A;  2N8G A;  2VKV A;  3ZPL A;  1ETX A;  1OQY A;  2KPM A;  1W0U A;  3O8G A;  2HPM A;  3WGH A;  2M4G A;  4IRG A;  3ZMU A;  2NOJ B;  1RNL A;  4PK4 A;  4RAZ A;  4D9J A;  3MKY B;  5DTD A;  1JUP A;  3L9F A;  2WAQ A;  4NDL A;  2FQ3 A;  2Q1Z B;  2CO5 A;  3K4M A;  2Z1D A;  4Q47 A;  3I71 A;  2VQH A;  1V54 H;  1S5L C;  5D5U B;  4U87 A;  3GTK J;  1HDP A;  4A5M A;  5IP7 J;  1W0T A;  3KYD B;  3OSG A;  2WY8 Q;  5K7H A;  2CQX A;  3CCM I;  2ZXW H;  4U0Y A;  4J19 A;  2ZNZ A;  2GIZ A;  2RAE A;  4FT8 A;  5H6Q A;  3V4G A;  3ERE D;  1LKX A;  3REO A;  3TW7 A;  3A0H C;  3KP7 A;  1WVR A;  4HYE A;  2ME6 A;  3A03 A;  5E3L A;  3A01 A;  2DA6 A;  2WTE A;  4H0E A;  3BZC A;  2CH0 A;  2A3S A;  1RUO A;  4DOZ A;  2F2E A;  4GO1 A;  3WE3 A;  4V2F A;  3OOP A;  4A5N A;  2VJI A;  1A04 A;  4HAM A;  4LGW A;  3SFZ A;  4L5E A;  3VOD A;  5IYB J;  2Q0O A;  2ELK A;  3WTT C;  2ACJ A;  4BXX J;  2VKE A;  4MHG A;  1UZC A;  5J8F A;  4FX4 A;  1ETW A;  4UUT A;  2IVM A;  2XAS A;  5IT9 K;  2Z99 A;  4LK0 F;  4I99 C;  5ICC A;  3CCR I;  1B9M A;  1R22 A;  2Y69 H;  2XAQ A;  3HOU J;  3VPR A;  5J47 A;  4ENN A;  2XUB A;  4OAY A;  3ZMZ A;  4G94 A;  1I39 A;  1KGS A;  5E1Z B;  2UWM A;  3FMR A;  2E7X A;  5L3E A;  2R93 J;  5L3B A;  1RPW A;  1FPQ A;  3M8J A;  4EAT A;  1B8I B;  4G6Q A;  4OAZ A;  2EZK A;  4O5V A;  2ZJP F;  1VQ5 I;  2PI0 A;  3R4K A;  1M1E B;  2FXA A;  5BPD A;  5F08 A;  2XC7 A;  4HOB A;  4JOM A;  3RDI A;  4PZJ A;  1QZE A;  1UMQ A;  3VSK A;  4B8X A;  1LQ1 A;  4E70 A;  5HNF A;  5JLX A;  3GTQ J;  2COM A;  4MFE A;  1VND A;  2I10 A;  2IEK A;  4LD5 A;  4CYC B;  1Z3Y A;  2A61 A;  1L3L A;  5HS7 A;  2X4H A;  4IOC F;  2LP0 A;  1TWF J;  4MEY F;  5EEA A;  4I2O A;  1ETY A;  1Y8Q B;  3K9T A;  1NK2 P;  1HW1 A;  4FTH A;  3H5A A;  1OPC A;  2R92 J;  2E34 A;  5CVU A;  1VTN C;  2BYV E;  4RGR A;  3HRU A;  2VB6 A;  2RQQ A;  2HQ5 A;  2WAE A;  3E6D A;  3F8B A;  3G2B A;  1PVE A;  2IXS A;  3FZV A;  1KQ0 A;  3FXM A;  1T6S A;  1TW2 A;  2KFD A;  3LFK A;  5C4J J;  1H9T A;  1AKH B;  1RR8 C;  2LK2 A;  4ZYA A;  5EG0 A;  1LPQ A;  3HOS A;  4XN0 A;  3TMO A;  4HRI A;  3O3K A;  4RAF A;  4DYR A;  3I55 I;  1TWA J;  3DTK A;  3PNV A;  4Y7N J;  1YRN A;  3Q3S A;  2OPT A;  2ZB9 A;  2LD5 A;  2Y48 A;  1FZP B;  4S0H B;  2HEO A;  3H5N A;  4PJM A;  3A0B C;  2VL8 A;  5FLX K;  4HBL A;  2R5Y A;  3LFU A;  4ZYD A;  4IZZ A;  5E3N A;  1N75 A;  3JRE A;  1BC8 C;  3BJO A;  5HLT A;  2KRF A;  4OIN F;  4BHP A;  3G3Z A;  3HTS B;  1D1C A;  3OOU A;  4XLF A;  1D0Z A;  2GIV A;  4W97 A;  3Q0W A;  5DD4 A;  4UUS A;  2ID6 A;  3GF2 A;  3H3U A;  3HL2 A;  3R6S A;  2X1E A;  2F48 A;  1MSF C;  3OL3 A;  3HPG A;  2VT3 A;  1VQK I;  3EUH C;  2EK5 A;  2M3A A;  3MN2 A;  2L54 A;  1KU9 A;  1BM9 A;  2OTJ I;  3L1P A;  3BY6 A;  3DKY A;  2RN7 A;  5IT9 Z;  2M9H A;  1TWG J;  3MFK A;  3F23 A;  3TGN A;  3FK6 A;  4DBR A;  4BAY A;  2DXI A;  1WWX A;  5DS9 A;  1RRJ A;  1QHH D;  1GDT A;  2AQF A;  3H0D A;  4ON0 A;  1YG2 A;  4HZF A;  2G7H A;  1U5T A;  3GTJ J;  5K5R A;  1GHC A;  3DTI A;  2ESH A;  3FF5 A;  1H0M A;  3M4O J;  4CCO A;  3H0G J;  2ISY A;  2IGK A;  2KL4 A;  3D0S A;  3LWF A;  2FF4 A;  1DDN A;  2QEX I;  3FBN B;  2CWE A;  2JSC A;  1QRY A;  4YFK F;  4EJV A;  5DDG A;  1HST A;  4N4O B;  1O4X A;  2H09 A;  3RPU A;  3G6E I;  1QU3 A;  3OYN A;  4GFB A;  3DFG A;  3ZR8 X;  4IJA A;  3J7Y J;  3FHZ A;  3QP6 A;  4PJ0 C;  4E7K A;  3JRB A;  1A6I A;  1IV8 A;  2EJR A;  4HA8 A;  4B3A A;  1ZLK A;  4P1W A;  3FDY A;  2XAJ A;  1SVL A;  2ID3 A;  2IP2 A;  2VE8 A;  2L01 A;  4KIF A;  2CQN A;  5GAE J;  2DOF A;  4IXA A;  2RNJ A;  2HQR A;  4XSZ F;  1DP7 P;  1I6H J;  2EIN H;  2F4I A;  1W1W E;  3DEU A;  4MTE A;  4CZZ A;  2ECB A;  1Q1V A;  4DQ2 A;  1RZ4 A;  3DPL C;  5LHG A;  2LF7 A;  4H4K C;  2GOM A;  3VB2 A;  2IS2 A;  4KMU X;  5FGM A;  4YFX F;  5FLX Z;  3GX4 X;  1MDM A;  2LMD A;  1BJZ A;  2KZG A;  2UXN A;  2FMY A;  4HF0 A;  2PMH A;  4L5J A;  3W2V A;  3CF2 A;  4RAG A;  1IRF A;  3JRI A;  4XMY A;  4Z2Y A;  4BQA A;  1YW7 A;  5BS6 A;  2J5O A;  4YFN F;  5E20 A;  5JHU A;  1S29 A;  3PO2 J;  5IYD J;  5F6F A;  2DA4 A;  4DZP A;  4L0Y B;  1B9N A;  4KUM A;  1DPR A;  4KJZ A;  5CYV A;  2M87 A;  2QUF A;  5FLV A;  3OYG A;  3U9G A;  1KZH A;  1VFC A;  2OAZ A;  1FOW A;  5FLM J;  3E6C C;  2Z5U A;  3CCS I;  4WXD A;  3F9K A;  4A0Y A;  2OU2 A;  3WHB A;  3S3O A;  1V3F A;  2DPD A;  4HX4 A;  3VFZ A;  4BS9 A;  5HDG A;  3DQV C;  1UG2 A;  2FD5 A;  5DV5 A;  3ZN0 A;  2LH9 A;  4G12 A;  4ZYE A;  4RB3 C;  3CCJ I;  2QSG X;  2L4M A;  4BHC A;  4JX5 A;  1GT0 C;  4CCN A;  2BY0 A;  2PG4 A;  1P4W A;  2E71 A;  3K4B A;  4JX6 A;  3OSF A;  2X6O A;  2EFW A;  2EIM H;  2QEN A;  2BV6 A;  3HKZ A;  2GXG A;  2XHK A;  2XRO A;  3I53 A;  4PJN A;  3M3Y J;  1J9I A;  1FMW A;  4B09 A;  2Y0S N;  4M3B A;  4ZYG A;  2LOO A;  1IGN A;  2LKX A;  4XON A;  5GAD J;  4E7I A;  1P6R A;  1Q1H A;  4IHX A;  3BJ6 A;  1JUS A;  4A3C J;  4G6D A;  3F3X A;  3SYT A;  1G4D A;  4EM0 B;  1I3A A;  1SVO A;  5CJ9 A;  3HRS A;  4S04 A;  3FM3 A;  2FBI A;  3N97 A;  2KQR A;  4I02 A;  4D7M A;  3UKG A;  1D8J A;  2R7W A;  2YU9 J;  3RTR A;  2AS5 F;  1SFE A;  1MIJ A;  1X3U A;  3HRT A;  3E5Q A;  1IF1 A;  3TBI A;  1OR7 C;  2JJ7 A;  2TRT A;  1AOY A;  3JRA A;  1SEU A;  5B1B H;  3ZMD A;  1EH6 A;  3TO6 A;  2CQK A;  2V79 A;  5FKN A;  2C6Y A;  4DJA A;  1LDK B;  2JA2 A;  2HQN A;  5D6E A;  5BNG A;  4UUV A;  1B59 A;  3CES A;  1ZAO A;  1DGW Y;  5EG0 B;  1JTY A;  1ORK A;  3EUA A;  2HTS A;  3ZN1 A;  4XNF A;  1NHA A;  2VE9 A;  5E1W A;  4II3 A;  2P7V B;  1YRN B;  2HDD A;  2P5L C;  2KIQ A;  2P5V A;  5TJJ A;  1QO0 D;  2K40 A;  2VAS A;  1ZH5 A;  1BN5 A;  1X2N A;  1GV2 A;  4EM1 A;  1WJ5 A;  3G71 I;  2R5Y B;  2KIM A;  2Y0M A;  2O8K A;  1D0Y A;  1S72 I;  4LLG F;  2DBB A;  2XF6 A;  1Z1D A;  2YSR A;  1T08 B;  4NHJ A;  3FM5 A;  4HST A;  1F43 A;  3ABL H;  3ML6 A;  1MBJ A;  2B0L A;  2TCT A;  2W1O A;  2BGC A;  3ELK A;  4XM3 A;  3U2R A;  4BHB A;  2H94 A;  2EFP A;  3A1Y A;  1GUU A;  2M5W A;  5K7Z A;  4OIR F;  3HEF A;  4P96 A;  4CCM A;  4HSR A;  1TT0 A;  3FMQ A;  4KIC A;  5H2F C;  2LF8 A;  1KU3 A;  2DDB A;  1ULY A;  4XRF A;  2IGN A;  2VUM J;  4Y33 A;  2HVQ A;  5JVG F;  4I0B A;  2D1V A;  3VDX A;  1FT9 A;  1LDJ A;  4UB6 C;  4GGG A;  1VQ8 I;  3C7J A;  3Q5F A;  1BJA A;  3OYD A;  3D1N I;  5EZG A;  1K6O A;  3QYB A;  1OCO H;  4BYY A;  1ZR2 A;  5A2Q K;  5CPR B;  2V9V A;  4C2T A;  2R7T A;  3HBL A;  1Y1V J;  4YRV A;  4WF2 A;  5E8G A;  3HM5 A;  1VQM I;  1RUN A;  5DCM B;  2CV0 A;  3LSP A;  4IHV A;  4XID A;  2RNG A;  1WGX A;  2R7S A;  4KN7 X;  4KMF A;  1KU7 A;  4QTR A;  3V7S A;  1OMI A;  2DYS H;  2GA2 A;  2JK3 A;  2YR2 A;  3G1L A;  3GVA A;  4I6Z A;  4LOC A;  2QLZ A;  5DUK A;  3OV8 A;  1O3Q A;  4CSW A;  2MD5 A;  1LE8 B;  2ZKZ A;  1UCR A;  5TIS C;  2KHM A;  1G59 A;  1UHW A;  1T38 A;  2DMQ A;  2LKS A;  2JTV A;  4KN4 X;  1T39 A;  1ETK A;  5F1R A;  4HDU A;  4ABZ A;  3ZXS A;  2KIS A;  5CVV A;  4JYK A;  1FSE A;  1WI3 A;  2EZL A;  3EET A;  5L3F A;  3GTP J;  1OKR A;  2DAO A;  1TLH B;  2EBI A;  3PSI A;  3TL4 X;  1IN8 A;  2YU3 A;  3CF5 F;  1K7A A;  2HDW A;  1SFO J;  2AHQ A;  3RKX A;  3V7C A;  3S2H J;  4HLX A;  1TL8 A;  3NEU A;  2WC2 A;  1Z3X A;  4CH7 A;  4BE0 A;  2FOK A;  1R5H A;  2LY1 A;  5IP9 J;  2R0Q C;  2XKO A;  3KZY A;  3P9C A;  3GFM A;  4M9X A;  3DLA A;  3OIP A;  2V7F A;  2FRH A;  2M0C A;  1JJ6 C;  5KNL A;  1EKE A;  1HKQ A;  4EV0 A;  1SAU A;  2V9P A;  4GCV A;  3HIF A;  5LHI A;  3QPS A;  1NG6 A;  4D0P A;  1FTT A;  3KFW X;  2JUC A;  3GFL A;  4PGH A;  4R79 A;  3PL8 A;  2XIG A;  3BCB A;  2H6B A;  3J80 K;  1YIO A;  5J4Y A;  1D1B A;  2G0E A;  4AU7 A;  2OJE D;  4HX7 A;  4PCQ A;  2OTL I;  3S8P A;  1UJ8 A;  4BE1 A;  3L2U A;  2HPI A;  1YX5 A;  1WJB A;  2JUG A;  4HQM A;  1YLF A;  2QQA A;  3QP5 A;  3WOD F;  4E4H A;  2DOD A;  5LEK A;  4RM2 A;  4XQF A;  2DA3 A;  2VC0 A;  3MZH A;  1Y0U A;  1GVJ A;  1MW7 A;  2F6C A;  1U2W A;  1OYI A;  1XTA A;  2MW8 A;  2HNH A;  4M71 A;  3T8T A;  3U1D A;  5A2Q Z;  2V9K A;  1VI0 A;  2EV6 A;  2EV5 A;  1J2X A;  3DPT A;  3BTL A;  1FYM A;  4RB0 A;  2AXT C;  1XGN A;  2IS1 A;  2DCE A;  3PQJ A;  3D5L A;  4HLY A;  4YIR X;  4EQQ A;  3B6A A;  3AAF A;  3K2Z A;  3RJP A;  1SD4 A;  4KIT B;  4DNC A;  3SZT A;  1TP4 A;  4B43 A;  4CDG A;  1N77 A;  2QBY A;  2RKH A;  3UNG C;  2M7A A;  3ONQ A;  5E18 F;  4N9I A;  3WTZ A;  1R4N B;  4NB5 A;  3HOZ J;  3H35 A;  4A3K J;  5F0C A;  5IY5 H;  5J1R A;  1U5T C;  1XCV A;  5HS8 A;  3FX3 A;  5DYM A;  3ZQI A;  1YW9 A;  4D7N A;  3IC7 A;  1FLI A;  1FNN A;  4ENM A;  4JQF A;  1IDY A;  3KLO A;  3QYE A;  1FX7 A;  1IDZ A;  5D6F A;  1CF7 B;  3RYP A;  2W82 A;  2K3F A;  2R3S A;  3GZN B;  1IXS B;  2L02 A;  2RDP A;  3I64 A;  2Q2E B;  3LSJ A;  3QOP A;  3CC2 I;  2XKP A;  2CQQ A;  3FMS A;  2X48 A;  3T5X A;  4OIQ F;  4MO7 A;  5EDN A;  2L7M P;  1ZYR F;  4CZC A;  4ZZL A;  2KLO A;  2BY1 A;  2KT0 A;  5IOY A;  2A5Y B;  4CHU A;  5FFX A;  1S7A A;  2M4K A;  5C44 J;  3HUG A;  3LL7 A;  4ETS A;  2CU7 A;  2UUZ A;  5EJC A;  4U0V A;  2DJN A;  2PMZ A;  1LDD A;  4XOP A;  3HOW J;  1OYW A;  2FNA A;  1BIA A;  1HXD A;  3DKW A;  1FSH A;  3D5S C;  2HZD A;  4XOT A;  3J80 Z;  1UEL B;  4AWX B;  2PX9 A;  4IL6 C;  2BE5 F;  2IRF G;  1LEA A;  3OY9 A;  3HDD A;  5HLG A;  3WG7 H;  1Z77 A;  4BBR J;  1K4S A;  3IKT A;  3LST A;  1HW5 A;  1R23 A;  2EV0 A;  1YHQ I;  2K9M A;  1FYL A;  5B3S H;  2DMP A;  5L3G A;  1XGM A;  2O61 A;  1I27 A;  4BQN A;  3NRV A;  2DA7 A;  3R61 A;  3KYL A;  2BW3 A;  2XGX A;  4OMY A;  2BY2 A;  2DT7 B;  2Y75 A;  2WAQ N;  1SFX A;  3H1C A;  1FBQ A;  3MKL A;  3RPU D;  1E3H A;  5LHH A;  1QQI A;  2DMU A;  3ESW B;  3V8J A;  3FIS A;  1ZHF A;  2EIK H;  2LRE A;  3GME A;  5JLW A;  3VOE A;  2ZXI A;  3I0T A;  1K79 A;  4NQW A;  4C3I J;  5FB2 A;  2VBW A;  3BG9 A;  3HRM A;  2ZME A;  3O8H A;  1JJ8 C;  2DA1 A;  3L09 A;  4IOA F;  4DGW B;  3ZCO A;  1JXS A;  5L3C A;  4KYW A;  1IN7 A;  3KP6 A;  2LVS A;  2LBF A;  1RIO H;  2PFB A;  3CUO A;  4L18 B;  4M6X A;  4BXU A;  5HLH A;  2GXA A;  1IJW C;  4IO9 F;  2WV0 A;  4LIV A;  2MYS A;  4IQ4 A;  2FML A;  2ZFU A;  4CUG A;  2TDX A;  2K9N A;  2LY9 A;  4IRI A;  2G9W A;  3K10 A;  3MWM A;  1V55 H;  5IYC J;  4QWQ A;  1N25 A;  3E97 A;  3L2R A;  4ZTF A;  1KON A;  1JGS A;  3DXJ F;  4BEH A;  3HOV J;  3G1O A;  3OYE A;  3O2P E;  1J0R A;  2WBM A;  1PJR A;  2X9D A;  2ICW G;  2ZXH A;  3TOA A;  4A3I J;  1VQ7 I;  4ESB A;  2IS6 A;  1Z7U A;  4QLC U;  3LSK A;  1FEX A;  1YTY A;  4UNO A;  3CUQ A;  1A5J A;  2JA5 J;  5JHF A;  2Y31 A;  3RPQ A;  1JKR C;  3SQN A;  4Y15 A;  2K02 A;  1WI9 A;  1W5S A;  1FMV A;  3C2H A;  3HTU A;  3BJA A;  3GTM J;  5D5V B;  2VN2 A;  4RGU A;  1G3T A;  2BOL A;  2E7W A;  1YIJ I;  1D5Y A;  2X6X A;  4Y52 J;  1SAX A;  5EEH A;  3QOD A;  5FRN A;  4RGX A;  2R7X A;  3K0L A;  3SEQ A;  5M5W J;  3CC4 I;  3EUK L;  4C3H J;  1WH7 A;  2KZV A;  4MQV A;  4G7Z F;  2CUF A;  5JR3 A;  4N0B A;  1VQ4 I;  2E60 A;  2H1L A;  5GPA A;  1T33 A;  3I59 A;  1OCR H;  1RES A;  3J7Z I;  4DW6 A;  1GXQ A;  2D45 A;  2XAG A;  3OMY A;  3OYM A;  5K7F A;  3QU3 A;  2VOD A;  3L7W A;  3BZK A;  2KDO A;  1IV6 A;  3M1E A;  1FTZ A;  4HV6 A;  1DGR M;  4HPQ A;  2DN0 A;  2LRD A;  3OYH A;  3K1N A;  2JN6 A;  1RI7 A;  2EFO A;  4CA0 A;  2M2E A;  4HX8 A;  5J1U A;  3I4N J;  1H89 C;  2ZFW A;  1I50 J;  3M9A A;  4EJW A;  2M8E A;  2OQR A;  2X85 A;  4BJ6 C;  4X6A J;  3M8E A;  1W5C C; 
#chains in the Genus database with same CATH homology
 5ILS A;  3N4M A;  2V1U A;  5CVR A;  2OZU A;  4PDK A;  3GW2 A;  5ILV A;  3T1B A;  1ZN2 A;  4R8H A;  3IL2 A;  4EM2 A;  1K78 A;  3W6J B;  3LAJ A;  2NNN A;  2UZK A;  2HFH A;  2DLL A;  2W57 A;  3GZ5 A;  5KVR A;  3CTA A;  4LB6 B;  1FBU A;  3EQL F;  4UVA A;  5D5X B;  4RAY A;  4G8X A;  1QBJ A;  2HYG D;  1LB2 A;  1LJ9 A;  1FY7 A;  2XVC A;  4GYG A;  3KP2 A;  5ILU A;  2Z9O A;  4AIK A;  2PEX A;  4BH9 A;  3JAM K;  2K4B A;  4TV7 A;  1BI2 A;  2K7L A;  1XCB A;  2M1B A;  3IRQ A;  4HDV A;  5IT3 A;  2JPC A;  1ZG3 A;  2MH2 A;  2VOO A;  1LEB A;  5HOO A;  1Z05 A;  1TW3 A;  1XSV A;  4G9Y A;  1FOK A;  4MGR A;  1R1U A;  3WGI A;  1CGP A;  5LRS A;  1R36 A;  1GXP A;  3ULQ B;  3I58 A;  3CO7 C;  3L2C A;  5L3D A;  1W7P A;  1J75 A;  3DV8 A;  5H6R A;  1KYW A;  2W84 A;  3HSR A;  1TNT A;  4A6D A;  3V7R A;  3WTY C;  4WCG A;  4U7B A;  3WU0 A;  2EWN A;  3ABT A;  2DI3 A;  2L4A A;  5ICF A;  3QAH A;  1DUX C;  2W85 A;  1BBY A;  5DD8 A;  4Y13 A;  5JVT A;  2O03 A;  3MEX A;  4ENJ A;  3IRR A;  1S7O A;  1YS7 A;  4ESF A;  2A6H F;  2VBZ A;  2P6S A;  2CGP A;  4EJT A;  2ZJ2 A;  2PN6 A;  3VEP A;  3QPT A;  5LLQ A;  4KDP A;  3TQN A;  3WG9 A;  4RB2 C;  2QQB A;  2Z3Y A;  2O0Y A;  4L9N A;  3RKW A;  1PUE E;  1XN7 A;  4OMZ A;  1LVA A;  2YX7 A;  3JAM Z;  3HYI A;  2IT0 A;  3F6V A;  1XGS A;  1Z91 A;  4I09 A;  3P9I A;  4KT5 C;  1KQ9 A;  4L9J A;  2OZ6 A;  2P8T A;  1KYZ A;  5LRR A;  1IXC A;  1QNT A;  1H9G A;  5AIQ A;  2PBI A;  3JSO A;  2W25 A;  3ZQ7 A;  1ZRE A;  1P92 A;  3I59 B;  4M73 A;  3F6O A;  1ODD A;  2DT5 A;  4WXH A;  5CVI A;  2HYF A;  2QYO A;  4N9H A;  1G3S A;  3GWZ A;  2F5F A;  3RKY A;  2DK5 A;  1Z9C A;  3T8R A;  1WKM A;  2MH9 A;  4LMY A;  3COA C;  5D4S A;  2HKX A;  4LG0 A;  1T98 A;  3WE2 A;  5DEQ A;  4UV8 A;  4CGZ A;  1FP1 D;  2BBY A;  1DPU A;  4RS8 A;  4GYI A;  1MJ9 A;  2JPB A;  1TBX A;  2KIU A;  1K78 B;  2H6C A;  2ADU A;  1SMY F;  3LQQ A;  4LLN A;  4EVI A;  3FWE A;  1HW2 A;  3ECO A;  2JT1 A;  3I54 A;  1U5T B;  1TTY A;  3ZMV A;  2NNY A;  4U88 A;  4M6Y A;  4CXF A;  3M7G A;  2M45 A;  2HGC A;  1HKT A;  3CJN A;  4MTD A;  4EMS A;  3M8F A;  1T2K A;  4KA4 A;  2P6T A;  1T0F A;  4A0Z A;  3CUQ C;  4I98 B;  4PGG A;  1D3Y A;  2X0L A;  2A6E F;  3IHU A;  3BOQ A;  1ONV A;  3DP7 A;  2VXZ A;  1FP2 A;  3FXU A;  1TQI A;  1U3E M;  1SD5 A;  3PFI A;  1S6L A;  2KKO A;  2ZXJ A;  3WTS C;  2R7D A;  2STT A;  4IHS A;  4KNY A;  3H92 A;  5HDN A;  3BDD A;  4ENK A;  3QU6 A;  3NQO A;  4UVC A;  1UFM A;  1D5V A;  3R0J A;  4AVP A;  1MDM B;  3I4P A;  2EFQ A;  1IUY A;  1SFU A;  1IRG A;  4R1H A;  2HOE A;  1IW7 F;  3MZY A;  3E3V A;  4HF1 A;  3FXR A;  4G7H F;  4M72 A;  1XDU A;  2KJB A;  2MC3 A;  1XMK A;  4WWC A;  2PJP A;  3KE2 A;  1OYY A;  3K69 A;  2MBF A;  3CO6 C;  1FWZ A;  3ECH A;  3V8K A;  3KP5 A;  3J81 K;  1QPM A;  2FNP A;  5F64 A;  1MZB A;  1ZRD A;  4XLN F;  3SHF A;  4L5I A;  2V1X A;  3IKV A;  1MJA A;  3G73 A;  4BNC A;  2YPR A;  3KLN A;  1REP C;  5LEJ A;  2HS5 A;  1IN6 A;  2PQ8 A;  2G7U A;  3ABU A;  4RB1 A;  3E6M A;  3HHG A;  5J6X A;  3BPV A;  1PP7 U;  4FHT A;  1STZ A;  4UXN A;  3L00 A;  4LB5 A;  1S3J A;  3LA3 A;  4LFU A;  1ZG1 A;  2VOP A;  5E1X A;  4A6E A;  3KET A;  2VON A;  4I7H A;  1F4K A;  1Z6R A;  2LKP A;  4A12 A;  3F21 A;  4LG0 B;  5HVQ C;  3C1D A;  2DFI A;  5E17 F;  2FBK A;  3PQK A;  2A68 F;  3SZP A;  2RGV A;  4P9U A;  1W5T A;  1IN4 A;  3IWF A;  2LNB A;  2HDC A;  1LNW A;  4Q5S F;  1R58 A;  4S05 A;  4KFC A;  1QGP A;  3LA7 A;  2CSO A;  1YO5 C;  3TDU C;  2H27 A;  3BRO A;  3WGG A;  2VBY A;  2XAH A;  3F8F A;  1BI3 A;  2UXX A;  1HKS A;  4ESJ A;  3TDZ C;  1ZAR A;  3J81 Z;  2DTR A;  3GUD A;  4ZH4 F;  1YS6 A;  2Q8K A;  1XD7 A;  4CO8 A;  1WSU A;  4GXO A;  3J7A O;  3LAP A;  1YQA A;  4OU0 A;  1U78 A;  2HWV A;  4P9F A;  5E8I A;  4EJO A;  3TO7 A;  2XAF A;  4M74 A;  2D1H A;  2DQL A;  2FU4 A;  5AIP A;  2IW5 A;  1W7P D;  3WTW C;  2STW A;  1F5T A;  3IWZ A;  2QZ8 A;  1U8R A;  1F1Z A;  3KZZ A;  2NS0 A;  2HR3 A;  1XDS A;  2DW4 A;  3T0Y A;  3F8N A;  1MGT A;  4EJU A;  1XMA A;  4FX0 A;  3ZP5 A;  1O7F A;  4Y17 A;  2HTJ A;  2QWW A;  1SMT A;  3ISP A;  5ED4 A;  3K1P A;  3JTH A;  1G3W A;  2VC1 A;  4YG2 F;  1TQP A;  2P7C B;  2K27 A;  4ASN A;  1YW8 A;  1XSD A;  4M9Z A;  2V1D A;  1BI1 A;  1JE8 A;  2F5E A;  1MKM A;  1O3S A;  3MAJ A;  2O3F A;  3RIR A;  1PP8 F;  1F9N A;  3P7N A;  3GFI A;  1EH7 A;  1D8K A;  5BPI A;  3JW4 A;  2IJL A;  2O8X A;  2P4W A;  4LK1 F;  2DQR A;  1EV7 A;  2OQG A;  2Z33 A;  4IF4 A;  1J5Y A;  2QBY B;  2J5P A;  4F7Z A;  3HHH A;  2GWR A;  2MLG A;  1IN5 A;  3F22 A;  1I1G A;  3H3Z A;  2ETH A;  4OIP F;  4IRH A;  1ON1 A;  2D2W A;  3P9K A;  4AIH A;  2A07 F;  1XB4 A;  1UHM A;  1PDN C;  1ZRF A;  4EGY A;  3ZMT A;  4JBA A;  4KIB A;  4P55 A;  3RI4 A;  5K5Q A;  3TOB A;  4O3M A;  5ERI A;  3EDP A;  3Q9S A;  2E1N A;  5TRD A;  2ISZ A;  2CW0 F;  5D5W B;  1YFH A;  3E6B A;  4UHT A;  2RV8 A;  2KIF A;  3F72 A;  2FSW A;  2OD5 A;  3F8M A;  2IA0 A;  1P4A A;  1TQM A;  3KP3 A;  5DCM A;  3R60 A;  5D8K B;  3EYI A;  1J7K A;  5DCF A;  4I0A A;  2RVC A;  3TO9 A;  1O57 A;  1UST A;  1P2F A;  2IA1 A;  3GO5 A;  4O6J A;  4HW0 A;  4XBF A;  1P4X A;  2DK8 A;  2DO7 A;  2GA1 A;  5K5O A;  3R0A A;  2LSO A;  1V4R A;  2JRT A;  2ZME B;  5BQT A;  4L9T A;  1IZ1 A;  4ZYH A;  3CDH A;  3HSF A;  4HV5 A;  5HDK A;  1I5Z A;  2HZT A;  3GYH X;  4RGS A;  2RC4 A;  3QPH A;  1Z6T A;  3JSP A;  2L3D A;  3QRF F;  2XV4 S;  4LLL A;  3CUQ B;  4U7D A;  2BEO A;  4YIF A;  2GQQ A;  3S2W A;  1S8N A;  3E5U A;  2K86 A;  4OOI A;  3GXO A;  4Q4Z F;  2NYX A;  3F8C A;  2QQ9 A;  4IPA A;  5FFZ A;  5FO5 A;  3GFJ A;  4MQ9 F;  5EEG A;  2ZNY A;  3CLO A;  1I1S A;  1EH8 A;  1KA8 A;  2F5C A;  2VT2 A;  4I01 A;  3MCZ A;  3MQ0 A;  5JI6 A;  2GXB A;  1B6A A;  5FD6 A;  1E17 A;  5K1Y A;  1FYK A;  1ZLJ A;  4LJZ F;  5JFR A;  4K2E A;  3ZMS A;  2FBH A;  2EA4 A;  2PLY A;  1CF7 A;  4ZZD A;  3K1M A;  3HSE A;  1E2X A;  3LA2 A;  5LBQ A;  5HLI A;  1B1B A;  2Q2E A;  2K4J A;  4MNU A;  4XLP F;  4WX9 A;  3SXY A;  1MD0 A;  3WTU C;  2MA3 A;  1R1T A;  3GLX A;  2EFN A;  5AON A;  1FBS A;  1SD7 A;  1WQ2 A;  4JK1 X;  1L0O C;  2YX4 A;  5CLS A;  3E5X A;  1W4M A;  5LGU A;  3B73 A;  5BMZ A;  1WRJ A;  2IPQ X;  1JHF A;  3BZ6 A;  2GAU A;  3KEO A;  3C18 A;  1ZG5 A;  2E1C A;  3KEQ A;  3RYR A;  5HS9 A;  1R00 A;  3EUH A;  1J59 A;  5LGN A;  5J8C A;  1USS A;  3B02 A;  2JZY A;  5LGT A;  1U6G A;  3BPX A;  1QZY A;  5H20 A;  4A2U A;  2A69 F;  4U0W A;  4AD9 A;  1XGO A;  3GZ6 A;  3KCC A;  4KIG A;  4WK8 F;  1BC7 C;  2EB7 A;  2OA4 A;  2PMU A;  5D8L B;  2NRA C;  1XSX A;  3Q9V A;  4G7O F;  1O3T A;  2VBX A;  2QVO A;  1G6N A;  1ZRC A;  1W7P B;  2ESN A;  2V6C A;  4IVN A;  1MJB A;  3WTV C;  3V8L A;  4L9V A;  2WWY A;  2IA2 A;  2O6G E;  1G3Y A;  4M9S A;  1IXR C;  3HOT A;  4CYD A;  5BOX A;  5FD5 A;  1O7L A;  3C3W A;  3W6K B;  1KU2 A;  3BWG A;  1ZGA A;  1BI0 A;  2CFX A;  2F5D A;  2QM3 A;  1AWC A;  5KK1 A;  3LQR A;  4HF2 A;  2LDU A;  4OIO F;  1B4A A;  2DPU A;  2XRN A;  2CYY A;  2W24 A;  1ZGJ A;  1JHH A;  2FE3 A;  4WXC A;  4AIJ A;  4MEX F;  4IHT A;  4P5O A;  3WTX C;  4UVB A;  3O6B B;  2KJC A;  2R7F A;  3DF8 A;  2ZCW A;  2FA5 A;  4A0X A;  5D4R A;  6PAX A;  1BIB A;  3GEZ A;  5DUI A;  2OBP A;  2RQP A;  3BP8 A;  4XSX F;  2DU9 A;  1HBX G;  1QZZ A;  1UB9 A;  1R7J A;  2P5K A;  2HKO A;  1I6X A;  3TKY A;  3FXQ A;  1R1V A;  2MLK A;  3I5U A;  4L0Z B;  4YII A;  3WU1 B;  3EYY A;  4EGZ A;  2NAZ A;  1O3R A;  2ZO4 A;  4HQE A;  4UV9 A;  5CVJ A;  1FC3 A;  2EA2 A;  1KQ8 A;  1HQC A;  1OR7 A;  5ICE A;  2M30 A;  1SD6 A;  1R5G A;  2GZW A;  1YYV A;  2FEZ A;  4Q48 A;  2CG4 A;  1TNS A;  3ROU A;  2ZBK A;  1IAW A;  3JTG A;  2ELH A;  2AXL A;  4CIC A;  5ICG A;  1ON2 A;  1C0W A;  1BOA A;  1HSJ A;  3ZPL A;  3WGH A;  4IRG A;  3ZMU A;  1RNL A;  4RAZ A;  3L9F A;  2FQ3 A;  2CO5 A;  4Q47 A;  3I71 A;  5D5U B;  4A5M A;  4U0Y A;  2ZNZ A;  3ERE D;  4FT8 A;  5H6Q A;  3V4G A;  3REO A;  3KP7 A;  4HYE A;  2WTE A;  4H0E A;  2A3S A;  1RUO A;  2F2E A;  4GO1 A;  3WE3 A;  3OOP A;  4A5N A;  1A04 A;  3VOD A;  4HAM A;  4LGW A;  3SFZ A;  2Q0O A;  3WTT C;  2ACJ A;  4FX4 A;  4MHG A;  5J8F A;  2IVM A;  2XAS A;  5IT9 K;  2Z99 A;  4LK0 F;  5ICC A;  1B9M A;  1R22 A;  2XAQ A;  4ENN A;  2XUB A;  3ZMZ A;  4G94 A;  1KGS A;  5E1Z B;  2UWM A;  3FMR A;  2E7X A;  5L3E A;  5L3B A;  1FPQ A;  4G6Q A;  4O5V A;  2PI0 A;  3R4K A;  2FXA A;  5BPD A;  4HOB A;  3RDI A;  4PZJ A;  4B8X A;  1LQ1 A;  4E70 A;  2COM A;  4LD5 A;  2A61 A;  5HS7 A;  2X4H A;  4MEY F;  4I2O A;  3K9T A;  1HW1 A;  1OPC A;  5CVU A;  1VTN C;  2BYV E;  4RGR A;  3HRU A;  3E6D A;  3F8B A;  3FZV A;  1KQ0 A;  1T6S A;  1TW2 A;  3LFK A;  1H9T A;  3HOS A;  3O3K A;  2Y48 A;  1FZP B;  2HEO A;  5FLX K;  4HBL A;  4ZYD A;  1BC8 C;  3BJO A;  2KRF A;  4OIN F;  4BHP A;  3G3Z A;  3HTS B;  2GIV A;  5DD4 A;  3H3U A;  3GF2 A;  3R6S A;  2VT3 A;  2EK5 A;  2L54 A;  1KU9 A;  1BM9 A;  3BY6 A;  2RN7 A;  5IT9 Z;  3F23 A;  3MFK A;  3TGN A;  4BAY A;  1WWX A;  4ON0 A;  1YG2 A;  4HZF A;  2G7H A;  1U5T A;  1GHC A;  5K5R A;  2ESH A;  3FF5 A;  1H0M A;  2ISY A;  3LWF A;  3D0S A;  2FF4 A;  1DDN A;  2CWE A;  2JSC A;  4YFK F;  4EJV A;  5DDG A;  1HST A;  2H09 A;  3RPU A;  3DFG A;  3FHZ A;  4IJA A;  3QP6 A;  2EJR A;  4HA8 A;  1ZLK A;  2XAJ A;  2IP2 A;  2VE8 A;  2L01 A;  4KIF A;  4IXA A;  2RNJ A;  2HQR A;  4XSZ F;  1DP7 P;  3DEU A;  4CZZ A;  4MTE A;  4DQ2 A;  1RZ4 A;  3DPL C;  5LHG A;  2LF7 A;  3VB2 A;  4KMU X;  5FGM A;  4YFX F;  5FLX Z;  3GX4 X;  1MDM A;  2UXN A;  2FMY A;  4HF0 A;  2PMH A;  4L5J A;  1IRF A;  4Z2Y A;  4BQA A;  1YW7 A;  5BS6 A;  2J5O A;  4YFN F;  5E20 A;  5JHU A;  1S29 A;  5F6F A;  4L0Y B;  1B9N A;  4KUM A;  1DPR A;  5CYV A;  2M87 A;  2QUF A;  3U9G A;  2OAZ A;  3E6C C;  2Z5U A;  4WXD A;  4A0Y A;  2OU2 A;  1V3F A;  2DPD A;  4HX4 A;  3VFZ A;  5HDG A;  3DQV C;  5DV5 A;  3ZN0 A;  4ZYE A;  4RB3 C;  2L4M A;  4BHC A;  2PG4 A;  1P4W A;  2EFW A;  2QEN A;  2BV6 A;  2GXG A;  2XHK A;  2XRO A;  3I53 A;  1J9I A;  4B09 A;  4ZYG A;  1P6R A;  1Q1H A;  3BJ6 A;  4G6D A;  3F3X A;  1G4D A;  4EM0 B;  5CJ9 A;  3HRS A;  4S04 A;  3FM3 A;  2FBI A;  3N97 A;  4I02 A;  1D8J A;  3RTR A;  2AS5 F;  1SFE A;  1X3U A;  3HRT A;  3E5Q A;  1IF1 A;  1AOY A;  3ZMD A;  1EH6 A;  3TO6 A;  2CQK A;  2V79 A;  2C6Y A;  1LDK B;  2HQN A;  5D6E A;  4UUV A;  1B59 A;  1ZAO A;  2HTS A;  3ZN1 A;  1NHA A;  2VE9 A;  5E1W A;  2P7V B;  2P5L C;  2P5V A;  5TJJ A;  1QO0 D;  1ZH5 A;  1BN5 A;  4EM1 A;  2KIM A;  2Y0M A;  4LLG F;  2DBB A;  1Z1D A;  2YSR A;  4NHJ A;  3FM5 A;  3ML6 A;  2B0L A;  2BGC A;  3ELK A;  3U2R A;  4BHB A;  2H94 A;  2EFP A;  2M5W A;  4OIR F;  4P96 A;  3FMQ A;  4KIC A;  2LF8 A;  1KU3 A;  1ULY A;  4XRF A;  4I0B A;  2D1V A;  1FT9 A;  1LDJ A;  4GGG A;  3C7J A;  3Q5F A;  1BJA A;  1K6O A;  4BYY A;  5A2Q K;  2V9V A;  4WF2 A;  5E8G A;  1RUN A;  5DCM B;  4KN7 X;  4KMF A;  1KU7 A;  3V7S A;  1OMI A;  2GA2 A;  2YR2 A;  3GVA A;  2QLZ A;  5DUK A;  3OV8 A;  1O3Q A;  2MD5 A;  2ZKZ A;  1UCR A;  1UHW A;  1T38 A;  2JTV A;  4KN4 X;  1T39 A;  5F1R A;  4HDU A;  5CVV A;  1FSE A;  3EET A;  5L3F A;  1OKR A;  2DAO A;  1TLH B;  1IN8 A;  2YU3 A;  1K7A A;  3RKX A;  3V7C A;  4HLX A;  3NEU A;  2WC2 A;  2FOK A;  1R5H A;  2XKO A;  3KZY A;  3P9C A;  3GFM A;  4M9X A;  2FRH A;  1HKQ A;  4EV0 A;  4GCV A;  3HIF A;  5LHI A;  4D0P A;  3KFW X;  3GFL A;  4PGH A;  4R79 A;  2XIG A;  2H6B A;  3J80 K;  1YIO A;  4HX7 A;  4PCQ A;  4HQM A;  1YLF A;  2QQA A;  3QP5 A;  3WOD F;  5LEK A;  2VC0 A;  3MZH A;  1Y0U A;  1GVJ A;  1U2W A;  1OYI A;  4M71 A;  3T8T A;  3U1D A;  5A2Q Z;  2EV6 A;  2EV5 A;  1J2X A;  3DPT A;  1FYM A;  4RB0 A;  1XGN A;  3PQJ A;  3D5L A;  4HLY A;  4EQQ A;  3AAF A;  3K2Z A;  3RJP A;  1SD4 A;  4DNC A;  3SZT A;  4CDG A;  2QBY A;  2RKH A;  5E18 F;  4N9I A;  3WTZ A;  4NB5 A;  1U5T C;  1XCV A;  5HS8 A;  3FX3 A;  5DYM A;  1YW9 A;  3IC7 A;  1FLI A;  1FNN A;  4ENM A;  4JQF A;  3KLO A;  1FX7 A;  5D6F A;  1CF7 B;  3RYP A;  2R3S A;  1IXS B;  2L02 A;  2RDP A;  3I64 A;  3QOP A;  2XKP A;  3FMS A;  4OIQ F;  3T5X A;  1ZYR F;  4ZZL A;  2A5Y B;  4CHU A;  5FFX A;  1S7A A;  3HUG A;  4ETS A;  4U0V A;  1LDD A;  1OYW A;  2FNA A;  1BIA A;  1HXD A;  3DKW A;  1FSH A;  3J80 Z;  4AWX B;  2BE5 F;  2IRF G;  1LEA A;  5HLG A;  3IKT A;  3LST A;  1HW5 A;  1R23 A;  2EV0 A;  1FYL A;  5L3G A;  1XGM A;  2O61 A;  1I27 A;  3NRV A;  3R61 A;  2XGX A;  4OMY A;  2Y75 A;  1SFX A;  1FBQ A;  5LHH A;  1QQI A;  3V8J A;  1ZHF A;  3VOE A;  3I0T A;  1K79 A;  4NQW A;  5FB2 A;  2VBW A;  3HRM A;  2ZME A;  3L09 A;  1JXS A;  5L3C A;  4KYW A;  1IN7 A;  3KP6 A;  1RIO H;  2PFB A;  3CUO A;  4L18 B;  4M6X A;  4BXU A;  5HLH A;  2WV0 A;  2FML A;  2TDX A;  4IRI A;  2G9W A;  3MWM A;  4QWQ A;  3E97 A;  1JGS A;  3DXJ F;  3O2P E;  1J0R A;  3TOA A;  4ESB A;  1Z7U A;  4QLC U;  1YTY A;  4UNO A;  3CUQ A;  3RPQ A;  3SQN A;  4Y15 A;  2K02 A;  1WI9 A;  1W5S A;  3HTU A;  3BJA A;  5D5V B;  2VN2 A;  4RGU A;  1G3T A;  2E7W A;  1SAX A;  5EEH A;  4RGX A;  3K0L A;  4MQV A;  4G7Z F;  5JR3 A;  4N0B A;  3I59 A;  2D45 A;  1GXQ A;  2XAG A;  3QU3 A;  2VOD A;  3L7W A;  3M1E A;  4HV6 A;  3K1N A;  1RI7 A;  2EFO A;  4HX8 A;  2ZFW A;  3M9A A;  4EJW A;  2M8E A;  2OQR A;  1L3L A;  3M8E A;  3KP4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...