4I9IA

Crystal structure of tankyrase 1 with compound 4
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
212
structure length
212
Chain Sequence
QGTILLDLAPEDKEYQSVEEEMQSTIREHRDGGNAGGIFNRYNVIRIQKVVNKKLRERFCHRQKEVSEENHNHHNERMLFHGSPFINAIIHKGFDERHAYIGGMFGAGIYFAENSSKSNQYVYGIGGGTGCPTHKDRSCYICHRQMLFCRVTLGKSFLQFSTMKMAHAPPGHHSVIGRPSVNGLAYAEYVIYRGEQAYPEYLITYQIMKPEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Discovery of a class of novel tankyrase inhibitors that bind to both the nicotinamide pocket and the induced pocket.
pubmed doi rcsb
molecule keywords Tankyrase-1
molecule tags Transferase/transferase inhibitor
source organism Homo sapiens
total genus 60
structure length 212
sequence length 212
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2012-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00644 PARP Poly(ADP-ribose) polymerase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.228.10 Alpha Beta Alpha-Beta Complex Phosphoenolpyruvate Carboxykinase; domain 3 Phosphoenolpyruvate Carboxykinase; domain 3 4i9iA00
4HYFA 4GV4A 3C4HA 5LXPA 4L6SA 2PAXA 4PNMA 4UVOA 5C5PA 4HKIA 4PNQA 4L7UA 4AVUA 4BUYA 3HKVA 3UDDA 4UVWA 4UVUA 4KZLA 4PMLA 4BUWA 4PAXA 4PNLA 3KCZA 4L2GA 4GV7A 4L7RA 4K4FA 4N3RA 4J21A 4PNSA 4TJYA 4UVVA 5ECEA 3KR7A 4ZZXA 5AL1A 4LI6A 4BJCA 3CE0A 5ETYA 4UFYA 3L3MA 4TJWA 4UW1A 4W5SA 4L7OA 3KJDA 4PY4A 4L32A 4BU6A 4L2KA 3GJWA 4RV6A 4UVNA 4KRSA 4HHYA 4J1ZA 4ZZYA 4X52A 5LYHA 2RD6A 4L7NA 3SE2A 4AVWA 4L0SA 3SMIA 4UXBA 4BJBA 4L7PA 4GV2A 4BUUA 3UH2A 4HHZA 4UVLA 4L0BA 4TVJA 4KZUA 4PJVA 3U9HA 4UI3A 4HLKA 4MSGA 5AL3A 4UI5A 4IUEA 4UVPA 5FPGA 4OQAC 4TK5A 3C49A 4UFUA 4BU5A 4HMHA 4UI6A 4F1LA 5AKUA 4KZQA 4F1QA 4LI7A 4L33A 4TKGA 4BU8A 4UVTA 4J3MA 3GN7A 4L31A 4UVZA 4F0EA 4UI4A 4L10A 2PQFA 4TOSA 3UH4A 4BUIA 4L0VA 3L3LA 3BLJA 4W6EA 4BU9A 4BU7A 4BJ9A 5AL4A 2RF5A 4PNRA 4HLGA 5DCZA 4UVYA 4J3LA 5C5QA 5ADQA 4L0TA 3UA9A 4UI8A 5AEHA 4LI8A 5AL2A 3P0QA 4BUDA 3P0PA 3FHBA 3MHJA 4L70A 4TJUA 2PAWA 4BU3A 1UK1A 4BUFA 4DVIA 4U6AA 3W51A 3P0NA 4BS4A 1PAXA 4BUVA 4UNDA 4UX4A 4L09A 4MT9A 4BUTA 4PJTA 4N4TA 4XHUA 3SMJA 4BFPA 4HKKA 4J22A 3MHKA 4DQYC 4OQBC 4BUEA 5LX6A 2RCWA 4HLFA 4I9IA 1GS0A 4UI7A 4TKIA 4TK0A 4UHGA 4BUAA 4R6EA 4N4VA 4W5IA 3GOYA 2X5YA 5ADTA 3GEYA 3PAXA 4HKNA 4L6ZA 3KR8A 5AKWA 1UK0A 5C5RA 4PNNA 5FPFA 1EFYA 4M7BA 4BUXA 3U9YA 4TKFA 4UVSA 4UUHA 4K4EA 1WOKA 4GV0A 4HLHA 1A26A 4TORA 4R5WA 4MSKA 4UVXA 4HLMA 5ADSA 4OA7A 4L7LA 4L0IA 4L2FA 4L34A 5ADRA 5EBTA 4BUSA 4OPXC 5A00A 4ZZZA 4HL5A 4PNTA 5AL5A
chains in the Genus database with same CATH superfamily
4HYFA 4GV4A 2RK7A 4GMUA 3C4HA 5LXPA 4L6SA 2PAXA 1KHEA 4PNMA 4R43A 4UVOA 1OS1A 1YGGA 2FAFA 4YW9A 4HKIA 4PNQA 5C5PA 4L7UA 4GNQA 4AVUA 4BUYA 5FH5A 3DT4A 3HKVA 3UDDA 4UVWA 4UVUA 4KZLA 4PMLA 4BUWA 5FPFA 2RKEA 4PAXA 5FH4A 4PNLA 3KCZA 4L2GA 4GV7A 4L7RA 4K4FA 4N3RA 4J21A 4PNSA 4TJYA 4UVVA 5ECEA 3KR7A 4WIUA 5AL1A 4YWDA 4LI6A 5I67A 4BJCA 3CE0A 5ETYA 4UFYA 3L3MA 4TJWA 4WPVA 4UW1A 2QZYA 4W5SA 2PXZX 4L7OA 3KJDA 4PY4A 4WOUA 4WPTA 4L32A 4GMWA 4BU6A 4L2KA 2GMVA 3GJWA 4GMMA 4RV6A 4UVNA 4KRSA 3DTBA 4HHYA 4YW8A 4J1ZA 4ZZYA 4X52A 5LYHA 1K3CA 2OLQA 2RD6A 4L7NA 3SE2A 4AVWA 4L0SA 3SMIA 4UXBA 2ZCIA 2QF1A 4L7PA 4BJBA 4GV2A 4BUUA 3UH2A 1KHFA 4HHZA 4GMZA 4GNLA 1AYLA 4L0BA 4UVLA 4TVJA 4KZUA 4HL5A 4PJVA 4YWBA 3U9HA 4UI3A 4HLKA 4MSGA 5AL3A 4UI5A 3DT7A 1II2A 4IUEA 4UVPA 5FPGA 4OQAC 4TK5A 3C49A 4UFUA 4BU5A 4HMHA 4UI6A 4F1LA 5AKUA 2RKAA 4KZQA 4OX2A 4LI7A 4F1QA 1AQ2A 4L33A 4TKGA 4BU8A 1J3BA 4UVTA 3MOEA 4J3MA 1XKVA 3GN7A 4L31A 4UVZA 4F0EA 4UI4A 2OLRA 4L10A 2PQFA 4TOSA 3UH4A 4BUIA 4L0VA 3L3LA 3BLJA 4W6EA 4BU9A 4BU7A 4BJ9A 5AL4A 2RF5A 4PNRA 4HLGA 5DCZA 4UVYA 4GNOA 4J3LA 5FH0A 5C5QA 4L0TA 4PNTA 4UI8A 1KHGA 4LI8A 5AL2A 5AEHA 3UA9A 5ADQA 3P0QA 2PY7X 2QEYA 3P0PA 4BUDA 1YTMA 3FHBA 3MHJA 4L70A 2PAWA 4TJUA 4BU3A 1NHXA 1UK1A 4BUFA 4DVIA 4U6AA 3MOHA 3W51A 3P0NA 4BS4A 1PAXA 4BUVA 4UNDA 4UX4A 4L09A 4MT9A 4BUTA 4PJTA 4WL8A 4N4TA 4XHUA 3SMJA 4BFPA 4HKKA 3DT2A 4J22A 3MHKA 4DQYC 4OQBC 4BUEA 5LX6A 2RCWA 4HLFA 4I9IA 1GS0A 4UI7A 4TKIA 2PC9A 4GNMA 4TK0A 4UHGA 4BUAA 5FH2A 2RKDA 4N4VA 4R6EA 3MOFA 3GOYA 4W5IA 5ADTA 3GEYA 3PAXA 4HKNA 4L6ZA 3KR8A 5AKWA 1UK0A 5C5RA 2QF2A 4PNNA 4WPUA 5FH1A 5FH3A 1EFYA 4M7BA 4BUXA 3U9YA 4TKFA 4UVSA 4GNPA 4ZZXA 1M51A 4K4EA 1WOKA 4UUHA 4GV0A 1YLHA 4HLHA 4RCGA 1A26A 4TORA 4R5WA 4MSKA 4UVXA 4HLMA 5ADSA 4WIEA 2FAHA 1OENA 4OA7A 4L7LA 4L0IA 4L2FA 4L34A 5ADRA 1YVYA 5EBTA 4BUSA 1K3DA 4OPXC 5A00A 4ZZZA 1KHBA 2QEWA 2X5YA 2RK8A 5AL5A
chains in the Genus database with same CATH topology
4HYFA 4GV4A 2RK7A 4GMUA 3C4HA 5LXPA 4L6SA 2PAXA 1KHEA 4PNMA 4R43A 4UVOA 1OS1A 1YGGA 2FAFA 4YW9A 4HKIA 4PNQA 5C5PA 4L7UA 4GNQA 4AVUA 4BUYA 5FH5A 3DT4A 3HKVA 3UDDA 4UVWA 4UVUA 4KZLA 4PMLA 4BUWA 5FPFA 2RKEA 4PAXA 5FH4A 4PNLA 3KCZA 4L2GA 4GV7A 4L7RA 4K4FA 4N3RA 4J21A 4PNSA 4TJYA 4UVVA 5ECEA 3KR7A 4WIUA 5AL1A 4YWDA 4LI6A 5I67A 4BJCA 3CE0A 5ETYA 4UFYA 3L3MA 4TJWA 4WPVA 4UW1A 2QZYA 4W5SA 2PXZX 4L7OA 3KJDA 4PY4A 4WOUA 4WPTA 4L32A 4GMWA 4BU6A 4L2KA 2GMVA 3GJWA 4GMMA 4RV6A 4UVNA 4KRSA 3DTBA 4HHYA 4YW8A 4J1ZA 4ZZYA 4X52A 5LYHA 1K3CA 2OLQA 2RD6A 4L7NA 3SE2A 4AVWA 4L0SA 3SMIA 4UXBA 2ZCIA 2QF1A 4L7PA 4BJBA 4GV2A 4BUUA 3UH2A 1KHFA 4HHZA 4GMZA 4GNLA 1AYLA 4L0BA 4UVLA 4TVJA 4KZUA 4HL5A 4PJVA 4YWBA 3U9HA 4UI3A 4HLKA 4MSGA 5AL3A 4UI5A 3DT7A 1II2A 4IUEA 4UVPA 5FPGA 4OQAC 4TK5A 3C49A 4UFUA 4BU5A 4HMHA 4UI6A 4F1LA 5AKUA 2RKAA 4KZQA 4OX2A 4LI7A 4F1QA 1AQ2A 4L33A 4TKGA 4BU8A 1J3BA 4UVTA 3MOEA 4J3MA 1XKVA 3GN7A 4L31A 4UVZA 4F0EA 4UI4A 2OLRA 4L10A 2PQFA 4TOSA 3UH4A 4BUIA 4L0VA 3L3LA 3BLJA 4W6EA 4BU9A 4BU7A 4BJ9A 5AL4A 2RF5A 4PNRA 4HLGA 5DCZA 4UVYA 4GNOA 4J3LA 5FH0A 5C5QA 4L0TA 4PNTA 4UI8A 1KHGA 4LI8A 5AL2A 5AEHA 3UA9A 5ADQA 3P0QA 2PY7X 2QEYA 3P0PA 4BUDA 1YTMA 3FHBA 3MHJA 4L70A 2PAWA 4TJUA 4BU3A 1NHXA 1UK1A 4BUFA 4DVIA 4U6AA 3MOHA 3W51A 3P0NA 4BS4A 1PAXA 4BUVA 4UNDA 4UX4A 4L09A 4MT9A 4BUTA 4PJTA 4WL8A 4N4TA 4XHUA 3SMJA 4BFPA 4HKKA 3DT2A 4J22A 3MHKA 4DQYC 4OQBC 4BUEA 5LX6A 2RCWA 4HLFA 4I9IA 1GS0A 4UI7A 4TKIA 2PC9A 4GNMA 4TK0A 4UHGA 4BUAA 5FH2A 2RKDA 4N4VA 4R6EA 3MOFA 3GOYA 4W5IA 5ADTA 3GEYA 3PAXA 4HKNA 4L6ZA 3KR8A 5AKWA 1UK0A 5C5RA 2QF2A 4PNNA 4WPUA 5FH1A 5FH3A 1EFYA 4M7BA 4BUXA 3U9YA 4TKFA 4UVSA 4GNPA 4ZZXA 1M51A 4K4EA 1WOKA 4UUHA 4GV0A 1YLHA 4HLHA 4RCGA 1A26A 4TORA 4R5WA 4MSKA 4UVXA 4HLMA 5ADSA 4WIEA 2FAHA 1OENA 4OA7A 4L7LA 4L0IA 4L2FA 4L34A 5ADRA 1YVYA 5EBTA 4BUSA 1K3DA 4OPXC 5A00A 4ZZZA 1KHBA 2QEWA 2X5YA 2RK8A 5AL5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HYF A;  4GV4 A;  3C4H A;  5LXP A;  4L6S A;  2PAX A;  4PNM A;  4UVO A;  5C5P A;  4HKI A;  4PNQ A;  4L7U A;  4AVU A;  4BUY A;  3HKV A;  3UDD A;  4UVW A;  4UVU A;  4KZL A;  4PML A;  4BUW A;  4PAX A;  4PNL A;  3KCZ A;  4L2G A;  4GV7 A;  4L7R A;  4K4F A;  4N3R A;  4J21 A;  4PNS A;  4TJY A;  4UVV A;  5ECE A;  3KR7 A;  4ZZX A;  5AL1 A;  4LI6 A;  4BJC A;  3CE0 A;  5ETY A;  4UFY A;  3L3M A;  4TJW A;  4UW1 A;  4W5S A;  4L7O A;  3KJD A;  4PY4 A;  4L32 A;  4BU6 A;  4L2K A;  3GJW A;  4RV6 A;  4UVN A;  4KRS A;  4HHY A;  4J1Z A;  4ZZY A;  4X52 A;  5LYH A;  2RD6 A;  4L7N A;  3SE2 A;  4AVW A;  4L0S A;  3SMI A;  4UXB A;  4BJB A;  4L7P A;  4GV2 A;  4BUU A;  3UH2 A;  4HHZ A;  4UVL A;  4L0B A;  4TVJ A;  4KZU A;  4PJV A;  3U9H A;  4UI3 A;  4HLK A;  4MSG A;  5AL3 A;  4UI5 A;  4IUE A;  4UVP A;  5FPG A;  4OQA C;  4TK5 A;  3C49 A;  4UFU A;  4BU5 A;  4HMH A;  4UI6 A;  4F1L A;  5AKU A;  4KZQ A;  4F1Q A;  4LI7 A;  4L33 A;  4TKG A;  4BU8 A;  4UVT A;  4J3M A;  3GN7 A;  4L31 A;  4UVZ A;  4F0E A;  4UI4 A;  4L10 A;  2PQF A;  4TOS A;  3UH4 A;  4BUI A;  4L0V A;  3L3L A;  3BLJ A;  4W6E A;  4BU9 A;  4BU7 A;  4BJ9 A;  5AL4 A;  2RF5 A;  4PNR A;  4HLG A;  5DCZ A;  4UVY A;  4J3L A;  5C5Q A;  5ADQ A;  4L0T A;  3UA9 A;  4UI8 A;  5AEH A;  4LI8 A;  5AL2 A;  3P0Q A;  4BUD A;  3P0P A;  3FHB A;  3MHJ A;  4L70 A;  4TJU A;  2PAW A;  4BU3 A;  1UK1 A;  4BUF A;  4DVI A;  4U6A A;  3W51 A;  3P0N A;  4BS4 A;  1PAX A;  4BUV A;  4UND A;  4UX4 A;  4L09 A;  4MT9 A;  4BUT A;  4PJT A;  4N4T A;  4XHU A;  3SMJ A;  4BFP A;  4HKK A;  4J22 A;  3MHK A;  4DQY C;  4OQB C;  4BUE A;  5LX6 A;  2RCW A;  4HLF A;  4I9I A;  1GS0 A;  4UI7 A;  4TKI A;  4TK0 A;  4UHG A;  4BUA A;  4R6E A;  4N4V A;  4W5I A;  3GOY A;  2X5Y A;  5ADT A;  3GEY A;  3PAX A;  4HKN A;  4L6Z A;  3KR8 A;  5AKW A;  1UK0 A;  5C5R A;  4PNN A;  5FPF A;  1EFY A;  4M7B A;  4BUX A;  3U9Y A;  4TKF A;  4UVS A;  4UUH A;  4K4E A;  1WOK A;  4GV0 A;  4HLH A;  1A26 A;  4TOR A;  4R5W A;  4MSK A;  4UVX A;  4HLM A;  5ADS A;  4OA7 A;  4L7L A;  4L0I A;  4L2F A;  4L34 A;  5ADR A;  5EBT A;  4BUS A;  4OPX C;  5A00 A;  4ZZZ A;  4HL5 A;  4PNT A;  5AL5 A; 
#chains in the Genus database with same CATH topology
 4HYF A;  4GV4 A;  2RK7 A;  4GMU A;  3C4H A;  5LXP A;  4L6S A;  2PAX A;  1KHE A;  4PNM A;  4R43 A;  4UVO A;  1OS1 A;  1YGG A;  2FAF A;  4YW9 A;  4HKI A;  4PNQ A;  5C5P A;  4L7U A;  4GNQ A;  4AVU A;  4BUY A;  5FH5 A;  3DT4 A;  3HKV A;  3UDD A;  4UVW A;  4UVU A;  4KZL A;  4PML A;  4BUW A;  5FPF A;  2RKE A;  4PAX A;  5FH4 A;  4PNL A;  3KCZ A;  4L2G A;  4GV7 A;  4L7R A;  4K4F A;  4N3R A;  4J21 A;  4PNS A;  4TJY A;  4UVV A;  5ECE A;  3KR7 A;  4WIU A;  5AL1 A;  4YWD A;  4LI6 A;  5I67 A;  4BJC A;  3CE0 A;  5ETY A;  4UFY A;  3L3M A;  4TJW A;  4WPV A;  4UW1 A;  2QZY A;  4W5S A;  2PXZ X;  4L7O A;  3KJD A;  4PY4 A;  4WOU A;  4WPT A;  4L32 A;  4GMW A;  4BU6 A;  4L2K A;  2GMV A;  3GJW A;  4GMM A;  4RV6 A;  4UVN A;  4KRS A;  3DTB A;  4HHY A;  4YW8 A;  4J1Z A;  4ZZY A;  4X52 A;  5LYH A;  1K3C A;  2OLQ A;  2RD6 A;  4L7N A;  3SE2 A;  4AVW A;  4L0S A;  3SMI A;  4UXB A;  2ZCI A;  2QF1 A;  4L7P A;  4BJB A;  4GV2 A;  4BUU A;  3UH2 A;  1KHF A;  4HHZ A;  4GMZ A;  4GNL A;  1AYL A;  4L0B A;  4UVL A;  4TVJ A;  4KZU A;  4HL5 A;  4PJV A;  4YWB A;  3U9H A;  4UI3 A;  4HLK A;  4MSG A;  5AL3 A;  4UI5 A;  3DT7 A;  1II2 A;  4IUE A;  4UVP A;  5FPG A;  4OQA C;  4TK5 A;  3C49 A;  4UFU A;  4BU5 A;  4HMH A;  4UI6 A;  4F1L A;  5AKU A;  2RKA A;  4KZQ A;  4OX2 A;  4LI7 A;  4F1Q A;  1AQ2 A;  4L33 A;  4TKG A;  4BU8 A;  1J3B A;  4UVT A;  3MOE A;  4J3M A;  1XKV A;  3GN7 A;  4L31 A;  4UVZ A;  4F0E A;  4UI4 A;  2OLR A;  4L10 A;  2PQF A;  4TOS A;  3UH4 A;  4BUI A;  4L0V A;  3L3L A;  3BLJ A;  4W6E A;  4BU9 A;  4BU7 A;  4BJ9 A;  5AL4 A;  2RF5 A;  4PNR A;  4HLG A;  5DCZ A;  4UVY A;  4GNO A;  4J3L A;  5FH0 A;  5C5Q A;  4L0T A;  4PNT A;  4UI8 A;  1KHG A;  4LI8 A;  5AL2 A;  5AEH A;  3UA9 A;  5ADQ A;  3P0Q A;  2PY7 X;  2QEY A;  3P0P A;  4BUD A;  1YTM A;  3FHB A;  3MHJ A;  4L70 A;  2PAW A;  4TJU A;  4BU3 A;  1NHX A;  1UK1 A;  4BUF A;  4DVI A;  4U6A A;  3MOH A;  3W51 A;  3P0N A;  4BS4 A;  1PAX A;  4BUV A;  4UND A;  4UX4 A;  4L09 A;  4MT9 A;  4BUT A;  4PJT A;  4WL8 A;  4N4T A;  4XHU A;  3SMJ A;  4BFP A;  4HKK A;  3DT2 A;  4J22 A;  3MHK A;  4DQY C;  4OQB C;  4BUE A;  5LX6 A;  2RCW A;  4HLF A;  4I9I A;  1GS0 A;  4UI7 A;  4TKI A;  2PC9 A;  4GNM A;  4TK0 A;  4UHG A;  4BUA A;  5FH2 A;  2RKD A;  4N4V A;  4R6E A;  3MOF A;  3GOY A;  4W5I A;  5ADT A;  3GEY A;  3PAX A;  4HKN A;  4L6Z A;  3KR8 A;  5AKW A;  1UK0 A;  5C5R A;  2QF2 A;  4PNN A;  4WPU A;  5FH1 A;  5FH3 A;  1EFY A;  4M7B A;  4BUX A;  3U9Y A;  4TKF A;  4UVS A;  4GNP A;  4ZZX A;  1M51 A;  4K4E A;  1WOK A;  4UUH A;  4GV0 A;  1YLH A;  4HLH A;  4RCG A;  1A26 A;  4TOR A;  4R5W A;  4MSK A;  4UVX A;  4HLM A;  5ADS A;  4WIE A;  2FAH A;  1OEN A;  4OA7 A;  4L7L A;  4L0I A;  4L2F A;  4L34 A;  5ADR A;  1YVY A;  5EBT A;  4BUS A;  1K3D A;  4OPX C;  5A00 A;  4ZZZ A;  1KHB A;  2QEW A;  2X5Y A;  2RK8 A;  5AL5 A; 
#chains in the Genus database with same CATH homology
 4HYF A;  4GV4 A;  2RK7 A;  4GMU A;  3C4H A;  5LXP A;  4L6S A;  2PAX A;  1KHE A;  4PNM A;  4R43 A;  4UVO A;  1OS1 A;  1YGG A;  2FAF A;  4YW9 A;  4HKI A;  4PNQ A;  5C5P A;  4L7U A;  4GNQ A;  4AVU A;  4BUY A;  5FH5 A;  3DT4 A;  3HKV A;  3UDD A;  4UVW A;  4UVU A;  4KZL A;  4PML A;  4BUW A;  5FPF A;  2RKE A;  4PAX A;  5FH4 A;  4PNL A;  3KCZ A;  4L2G A;  4GV7 A;  4L7R A;  4K4F A;  4N3R A;  4J21 A;  4PNS A;  4TJY A;  4UVV A;  5ECE A;  3KR7 A;  4WIU A;  5AL1 A;  4YWD A;  4LI6 A;  5I67 A;  4BJC A;  3CE0 A;  5ETY A;  4UFY A;  3L3M A;  4TJW A;  4WPV A;  4UW1 A;  2QZY A;  4W5S A;  2PXZ X;  4L7O A;  3KJD A;  4PY4 A;  4WOU A;  4WPT A;  4L32 A;  4GMW A;  4BU6 A;  4L2K A;  2GMV A;  3GJW A;  4GMM A;  4RV6 A;  4UVN A;  4KRS A;  3DTB A;  4HHY A;  4YW8 A;  4J1Z A;  4ZZY A;  4X52 A;  5LYH A;  1K3C A;  2OLQ A;  2RD6 A;  4L7N A;  3SE2 A;  4AVW A;  4L0S A;  3SMI A;  4UXB A;  2ZCI A;  2QF1 A;  4L7P A;  4BJB A;  4GV2 A;  4BUU A;  3UH2 A;  1KHF A;  4HHZ A;  4GMZ A;  4GNL A;  1AYL A;  4L0B A;  4UVL A;  4TVJ A;  4KZU A;  4HL5 A;  4PJV A;  4YWB A;  3U9H A;  4UI3 A;  4HLK A;  4MSG A;  5AL3 A;  4UI5 A;  3DT7 A;  1II2 A;  4IUE A;  4UVP A;  5FPG A;  4OQA C;  4TK5 A;  3C49 A;  4UFU A;  4BU5 A;  4HMH A;  4UI6 A;  4F1L A;  5AKU A;  2RKA A;  4KZQ A;  4OX2 A;  4LI7 A;  4F1Q A;  1AQ2 A;  4L33 A;  4TKG A;  4BU8 A;  1J3B A;  4UVT A;  3MOE A;  4J3M A;  1XKV A;  3GN7 A;  4L31 A;  4UVZ A;  4F0E A;  4UI4 A;  2OLR A;  4L10 A;  2PQF A;  4TOS A;  3UH4 A;  4BUI A;  4L0V A;  3L3L A;  3BLJ A;  4W6E A;  4BU9 A;  4BU7 A;  4BJ9 A;  5AL4 A;  2RF5 A;  4PNR A;  4HLG A;  5DCZ A;  4UVY A;  4GNO A;  4J3L A;  5FH0 A;  5C5Q A;  4L0T A;  4PNT A;  4UI8 A;  1KHG A;  4LI8 A;  5AL2 A;  5AEH A;  3UA9 A;  5ADQ A;  3P0Q A;  2PY7 X;  2QEY A;  3P0P A;  4BUD A;  1YTM A;  3FHB A;  3MHJ A;  4L70 A;  2PAW A;  4TJU A;  4BU3 A;  1NHX A;  1UK1 A;  4BUF A;  4DVI A;  4U6A A;  3MOH A;  3W51 A;  3P0N A;  4BS4 A;  1PAX A;  4BUV A;  4UND A;  4UX4 A;  4L09 A;  4MT9 A;  4BUT A;  4PJT A;  4WL8 A;  4N4T A;  4XHU A;  3SMJ A;  4BFP A;  4HKK A;  3DT2 A;  4J22 A;  3MHK A;  4DQY C;  4OQB C;  4BUE A;  5LX6 A;  2RCW A;  4HLF A;  4I9I A;  1GS0 A;  4UI7 A;  4TKI A;  2PC9 A;  4GNM A;  4TK0 A;  4UHG A;  4BUA A;  5FH2 A;  2RKD A;  4N4V A;  4R6E A;  3MOF A;  3GOY A;  4W5I A;  5ADT A;  3GEY A;  3PAX A;  4HKN A;  4L6Z A;  3KR8 A;  5AKW A;  1UK0 A;  5C5R A;  2QF2 A;  4PNN A;  4WPU A;  5FH1 A;  5FH3 A;  1EFY A;  4M7B A;  4BUX A;  3U9Y A;  4TKF A;  4UVS A;  4GNP A;  4ZZX A;  1M51 A;  4K4E A;  1WOK A;  4UUH A;  4GV0 A;  1YLH A;  4HLH A;  4RCG A;  1A26 A;  4TOR A;  4R5W A;  4MSK A;  4UVX A;  4HLM A;  5ADS A;  4WIE A;  2FAH A;  1OEN A;  4OA7 A;  4L7L A;  4L0I A;  4L2F A;  4L34 A;  5ADR A;  1YVY A;  5EBT A;  4BUS A;  1K3D A;  4OPX C;  5A00 A;  4ZZZ A;  1KHB A;  2QEW A;  2X5Y A;  2RK8 A;  5AL5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...