4I9RA

Crystal structure of the r111k:r132l:y134f:t54v:r59w:a32w mutant of the cellular retinoic acid binding protein type ii in complex with all-trans retinal at 2.6 angstrom resolution
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
137
structure length
137
Chain Sequence
b'PNFSGNWKIIRSENFEELLKVLGVNVMLRKIWVAAASKPAVEIKQEGDTFYIKVSTTVWTTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTKELTNDGELILTMTADDVVCTLVFVRE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cellular retinoic acid-binding protein 2
publication title Rational Design of a Colorimetric pH Sensor from a Soluble Retinoic Acid Chaperone.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 31
structure length 137
sequence length 137
ec nomenclature
pdb deposition date 2012-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 4i9rA00
2A2UA 2JU7A 2AKQA 2AMMX 1ICNA 1DZPA 5H9AA 4HPDA 3CBCA 5D47A 2QO4A 3C78X 2DM5A 3FA9A 2A3FX 3CWKA 2FWVA 3GAQA 4PSQA 1BJ7A 3ZUOA 3F8AA 5IO7A 4NLJA 2RCQA 3G7XA 5B29A 1U17A 4IB7A 1D2UA 1LNMA 5H9LA 1DZMA 5HZQA 2QO6A 3FR2A 1ZNDA 1YIVA 5B27A 1P6PA 4YKOA 4MVLA 4XMHA 2AH7X 1YP7A 1E5PA 1QY0A 4ZGUA 4ZHDA 5LJEA 4TLJA 3O2YA 2WEXA 3NX2A 1ZNGA 3NP1A 4XMDA 1Z24A 2ALLX 1O1VA 2R74A 3MBTA 4YMYA 1ADLA 2NNDA 5LJBA 1UREA 1DZKA 5H9KA 1GGLA 1GM6A 4ORUA 3DTQA 4I9SA 5EEEA 2L68A 4IBAA 3FENA 1OBUA 4EFGA 4TKHA 4ALBA 3EBWA 3K3LA 2JU3A 5F7GA 4EXZA 4DQ4A 4OS3A 4YDAA 1OPAA 1PM1X 2ASNX 5LJGA 1VYFA 3FW4A 4AYHA 3EM0A 3TGAA 1ZNEA 4GE1A 4AZPA 3BRNA 2QO5A 5HCEC 5LJHA 4CK4A 3STNA 1BSQA 1I06A 1OBPA 4YBPA 4QZTA 2RD7C 2OVDA 3WJGA 1KXOA 3DSZA 4R0BA 5LKFA 3BU9A 3FLLA 3B2JA 3B2KA 3ZUIA 4YCEA 1T0VA 4D6AA 2Q2MA 2AT0X 2MJIA 2WQ9A 2HLVA 1SXYA 2OVEA 3WJFA 3HK1A 4BQUA 4ZHGA 2KTDA 3AKNA 2R56A 4EDEA 3BDRA 1BBPA 1JYJA 1DFVA 1IFBA 4ZFXA 2CM9A 2QM9A 4BOEA 2NNEA 2X45A 5BVSA 4ES7A 5IO5A 1EUOA 4AW8A 5HZ8A 4ZJ0A 4HPCA 3B2LA 4TNNA 4QGWA 4ALOA 4ORXA 3TGBA 2HNXA 5HZ9A 1EXSA 4QGXA 3EMMA 4YGZA 1X71A 3FA7A 4YFRA 3BLGA 1FDQA 1X8UA 3FW5A 1E06A 3VG6A 1A2DA 5KICA 4YGGA 4YBUA 2BLGA 3D97A 4ORSA 3FR4A 3U9PC 1A57A 3BY0A 2FT9A 2AL0X 5LJCA 3WJBA 1YWDA 1GKAA 1JJXA 1KT7A 4AZRA 1KGLA 3O19A 3NQ3A 1E02A 1YP6A 1X8NA 4MVKA 3IFBA 4RUUA 3EYCA 3FA8A 4UU2A 1IW2A 1KOIA 3STKA 2LB6A 5EDCA 4QGVA 3APVA 1ALBA 2A0AA 3P6EA 2HYSA 3HWDA 2AT8X 1MVGA 5L8OA 3BS2A 4Y0QA 1LF7A 4NP1A 1X8QA 1B56A 1UZ2X 4IMOA 1BSOA 1LPJA 3FIQA 2OVAA 5BVTA 3B2IA 3CQRA 2IFBA 4ARHA 3KFFA 3STMX 1A18A 3I0AA 3C77X 2A2GA 4TKJA 1A3YA 3KFGA 3NADA 1HN2A 3PP6A 3FEKA 1DV9A 3JSQA 2Q4NA 1OEKA 1S2PA 1G7NA 1HBQA 4D6BA 4ZHFA 2OFMX 2WEWA 2CBSA 5DG4A 1HMSA 4BVMA 4ZHCA 2OZQA 5H8TA 1EPBA 4TKBA 1QG5A 2WWPA 4HPBA 1BWYA 4GNYA 5F1EA 4N7DA 4YGHA 1QABE 1ML7A 1AB0A 5IO6A 2W2BA 1IKJA 1BRQA 4XMEA 4I3BA 3FELA 1SY1A 5EPQA 2F73A 3FA6A 3APWA 2L5PA 2L67A 3TZSA 2FR3A 5L8IA 4Y0PA 3RZYA 4YH0A 5HZ5A 3TF6A 2RA6A 2L9CA 1NP1A 3KZAA 3HWEA 1FELA 5FAZA 5HBSA 1I4UA 4GETA 4AZQA 1QWDA 2MO5A 4OS8A 5CE4A 5DPQA 3NX1A 4NYQA 1HMTA 5LJDA 3PEDA 4I9RA 2CM4A 4NNSA 3S26A 2EU7X 1RLBE 2N93A 4I3DA 1OEJA 3WJCA 3B2HA 1JV4A 4LZUA 5K06A 1BM5A 2GC9A 1TOWA 1LIEA 2W2AA 2PY1A 4ZR2A 2E4JA 3NQ9A 3EBKA 1ACDA 1LIBA 4XMCA 4ORYA 3CR6A 1IKEA 1CRBA 4ZH9A 3C76X 5HCDC 4TJZA 1YWBA 2LBAA 1HQPA 4OS0A 3IA8A 4AZMA 3KQ0A 1IIUA 5HA1A 1HBPA 1AELA 3WXQA 4EEJA 1SY2A 4MVIA 1EQDA 3APXA 1YWAA 1X8OA 1FE3A 1DC9A 3OJYC 2ACOA 1YWCA 5L8NA 1XCAA 2RCTA 1KQWA 4GH7A 1LIDA 3UEXA 1IFCA 3P6HA 3T1DA 5HZ6A 1VYGA 2ANSA 1KT6A 4QZUA 3FEPA 1GT4A 1X8PA 1QY2A 1EALA 3UEVA 2NNQA 1KZWA 4K19A 2FS6A 1GT3A 4M6SA 4QYPA 4QAEA 4NLIA 3KFIA 1CBRA 4YFQA 3UEUA 1GX8A 1JJJA 1BSYA 4LKTA 1OPBA 4ORWA 5C0NA 3NR3A 4GKCA 2G78A 1LICA 4A1HA 1MX7A 5F6ZA 1E00A 1ZNKA 1KT3A 1GT1A 1G85A 1GX9A 1GT5A 3O22A 3PECA 2LBVA 4IB8A 5EDBA 3FR5A 4WFUA 1SXUA 5KIDA 2JU8A 1NP4A 2LFOA 1G5WA 1JYDA 5JR8A 1DF3A 4A8ZA 4DQ3A 4OMXA 3HWFA 3UEWA 1SXWA 3BU1A 1HMRA 2LKKA 5HA0A 1LFOA 2FLJA 1EIIA 2WUTA 1BRPA 3BSZE 3WBGA 1CBIA 1SXXA 3TGCA 1S44A 3ELXA 1KZXA 1X89A 1GKAB 1ERBA 5F6BA 4IMNA 4IB6A 4IAXA 1B0OA 1LIFA 2Q2PA 5KHPA 1OEEA 4Y0SA 5EEDA 1JBHA 5LKEA 2R73A 5EZ2A 4YFPA 2JOZA 1KQXA 4LZVA 4NNTA 1FTPA 3F9DA 4AZOA 3PH5A 2ACPX 4LKPA 3VG5A 4UU3A 1NGLA 1I04A 5FENA 1MDCA 2WR6A 1CJ5A 4A1YA 3FMZA 1O8VA 1QQSA 3D95A 4RUNA 1OBQA 2CZUA 4AZNA 3RSWA 4O9SA 1PBOA 1EPAA 2POAA 1H91A 2FS7A 3VG4A 5H9NA 1B8EA 1SY3A 3NPOA 1PEEA 1AQBA 1ICMA 2FR2A 1T68X 3CQNA 3JS1A 3ZQ3A 4XMFA 1VPRA 4N7CA 2K23A 4A60A 5HCCC 5FFHA 1ZNLA 3U03A 3P6DA 3VG3A 2O62A 2WQAE 3BX7A 3CMPA 4YKMA 1LKEA 2CBRA 2GTFX 3ELZA 5AQ6A 2FTBA 1MX8A 3SAOA 3AKMA 4M7MA 2P8GA 2MM3A 2JN3A 1EW3A 4GRJA 2KT4B 1N0SA 3L4RA 3MVFA 3U0DA 5HTEA 4XMGA 2FRSA 5D4AA 2X46A 3VG7A 3I17A 2A13A 5HWZA 1FEMA 1FENA 1B4MA 3WJEA 5D8JA 1TW4A 3PPTA 2OFRX 4ZHHA 1SY0A 4TQ2A 3BX8A 2CZTA 1MUPA 1O1UA 1S7DA 3Q6LA 1SA8A 4KIIA 1R0UA 4QYNA 4Y0RA 5F58A 1XKIA 3P6FA 3P6CA 1TOUA 2G7BA 4YCHA 1T8VA 3CBSA 4GNWA 5D48A 1I05A 3D96A 3VG2A 2G79A 3WJDA 1EIOA 5LJKA 3KFHA 2AT6X 1U18A 1PMPA 1YUPA 2XSTA 1QY1A 2RQ0A 1BEBA 2NP1A 1L6MA 4WBKA 2QOSC 4NYRA 1CBQA 1AVGI 1ERXA 4ZH6A 4ZCBA 1JZUA 4WFVA 1CBSA 1ZNHA 4HPAA 1TXLA 1KT5A 5D45A 2HZRA 3WVMA 1RBPA 1U0XA 2XKLA 2Q9SA 3HWGA 4HFOA 2AT3X 2AT5X 4IB9A 2Q39A 2YG2A 1G74A 2K62A 1D3SA 1DZJA 1GXAA 4ORRA 2HZQA 4IAWA 4OMWA 2HMBA 3APUA 2GJ5A 3QKGA 4ODDA 5BVQA 2W2FA 3PH6A 4YDBA 5HAEA 1QFTA 2WSJA 1BLRA 1ZRYA 1KT4A 1QFVA 1TVQA 3P6GA 4I3CA 5HTDA
chains in the Genus database with same CATH superfamily
2A2UA 2JU7A 2RTJA 4GGTA 2AKQA 2AMMX 1ICNA 1DZPA 5H9AA 1VWEB 4HPDA 3VE2A 2QOMA 4FBOA 3CBCA 4MEEA 1HXLA 5D47A 3S60A 2QO4A 2IZLB 3C78X 3P24A 2DM5A 3FA9A 2A3FX 2UYWA 2RTKA 4O4OA 4BCSA 2OFAA 2FWVA 3CWKA 3GAQA 1BJ7A 1NBXA 4PSQA 3ZUOA 3F8AA 5IO7A 4NLJA 2RCQA 2RTCB 3G7XA 3VE1A 5IRAA 3PQSA 5B29A 1U17A 2BS6A 3RDOA 4IB7A 1D2UA 1LNMA 5H9LA 3CKGA 1DZMA 5HZQA 2QO6A 3FR2A 3S5XA 1ZNDA 4CDDA 4CPHA 1KL4A 1SWBA 1YIVA 5B27A 1P6PA 4YKOA 4MVLA 4XMHA 2AH7X 1YP7A 1E5PA 1QY0A 4ZGUA 4ZHDA 5CYBA 4BX7B 5LJEA 4TLJA 4L3RA 3O2YA 2WEXA 3NX2A 1ZNGA 3NP1A 4XMDA 1Z24A 2ALLX 1O1VA 2R74A 3MBTA 3ZW1A 1ADLA 2NNDA 1NQMA 3MM0A 4YMYA 1UREA 5LJBA 1DZKA 5H9KA 1GGLA 1GM6A 4ORUA 1SWDA 2C1SA 3DTQA 4I9SA 5EEEA 2L68A 1Y0GA 4IBAA 5IO6A 2GTLN 3FENA 1OBUA 4EFGA 2YMSA 4TKHA 4ALBA 2ZAIA 3EBWA 3K3LA 2JU3A 5F7GA 4EXZA 4DQ4A 3X00A 4OS3A 2F09A 5IRUA 4YDAA 1OPAA 1PM1X 1VWQB 4BGFA 2ASNX 5LJGA 3RDSA 1VYFA 3FW4A 1JJUA 3EM0A 4JNJA 4AYHA 4CPEA 1SWSA 3TGAA 3ZW0B 1ZNEA 3ZZVA 4BX6B 1VWOB 4GE1A 1LDQA 4AZPA 3BRNA 3ZW1B 2QO5A 5HCEC 4KT5A 5LJHA 2IZFB 4CK4A 3STNA 3FIDA 1BSQA 3WYQA 1I06A 1OBPA 4YBPA 3VHIA 2FGSA 2M4LA 2OY8A 2RTDB 4O4SA 2F01A 4QZTA 2RD7C 2OVDA 2GTLM 1VWAB 1SLEB 3WJGA 1SREA 1SWLA 3ZI8A 1KXOA 1W5RA 3E3CA 3DSZA 4R0BA 5LKFA 3BU9A 3FLLA 3B2JA 3B2KA 3ZUIA 2RTNB 4YCEA 2OYBO 1T0VA 4D6AA 1LCVA 1SLGB 2AT0X 2Q2MA 2MJIA 3AEHA 4KH8A 2RTMA 2WQ9A 2HKDA 1VWMB 2HLVA 1SXYA 2OVEA 3WJFA 3HK1A 4O4UA 4BQUA 2RTOB 1SWPA 2KTDA 4ZHGA 3AKNA 2R56A 4EDEA 3BDRA 1BBPA 1JYJA 4FGIB 1DFVA 1IFBA 4CPFA 4ZFXA 2CM9A 2OL7A 2QM9A 4Y59A 4BOEA 2NNEA 2X45A 5BVSA 5FQ6E 4ES7A 3SLJA 5IO5A 1SWUA 2AF5A 1EUOA 4I60A 4GGZA 4AW8A 5HZ8A 4ZJ0A 4HPCA 2VFCA 3B2LA 4TNNA 4QGWA 4ALOA 4U8UN 5AEOA 4ORXA 5IXGA 3ZW2A 2HNXA 5HZ9A 3TGBA 1EXSA 4ZGFA 4QGXA 3EMMA 4YGZA 1X71A 3FA7A 4YFRA 3BLGA 3HOLA 1FDQA 1SMPI 1X8UA 3FW5A 1FJ1E 4OELA 1E06A 3VG6A 1A2DA 5KICA 4YGGA 4YBUA 2BLGA 2OY7A 1SLFB 2KTSA 3D97A 4ORSA 3D9WA 3FR4A 4GU8A 3U9PC 1AVDA 1A57A 2X4MA 3BY0A 2FT9A 2AL0X 4JHQA 1STSB 4BBOA 5LJCA 3WJBA 1VWGB 1YWDA 1GKAA 1JJXA 1KT7A 4AZRA 1KGLA 3O19A 3NQ3A 1SRHA 2IZHB 4U8UM 1E02A 1YP6A 1X8NA 4MVKA 3WOVA 3WZNA 1SWCA 3IFBA 3QQ2A 4RUUA 2IZJA 1Y52X 2BHVA 3EYCA 3FA8A 4UU2A 1IW2A 1KOIA 4GK9A 3STKA 2IZKA 2LB6A 1I78A 5EDCA 3F6ZB 4QGVA 2RTRB 3APVA 2I5VO 1VWJB 1ALBA 2A0AA 2X55A 3P6EA 1VWHB 2HYSA 4O3YA 3HWDA 2AT8X 1STPA 1SWAA 1MVGA 2OL6O 1SWHA 5L8OA 3BS2A 4Y0QA 3OD9A 1LF7A 4NP1A 1X8QA 1B56A 1UZ2X 4IMOA 2Y3EA 1BSOA 1LPJA 3FIQA 2OVAA 2RTPB 1VWNB 2BC3A 3VGWA 4Z6JA 5BVTA 3B2IA 4GDAA 3CQRA 1SWQA 2IFBA 5B5FA 4ARHA 3KFFA 3STMX 2C4IA 3RDMA 1A18A 3I0AA 2RTEB 3C77X 2A2GA 4TKJA 1A3YA 1LUQA 3KFGA 3FDCA 3NADA 1HN2A 2FHNX 3PP6A 4JGLA 1SWNA 3FEKA 3RDUA 3RWXA 4FBRA 4CV7A 1DV9A 3JSQA 1N43A 1OEKA 2Q4NA 3T2WA 2FKJA 1S2PA 1G7NA 1HBQA 2X56A 4D6BA 4ZHFA 2OFMX 2RTFB 2CBSA 2WEWA 5DG4A 1HMSA 4QRLA 4BVMA 4ZHCA 1RSTB 4COTA 2OZQA 5H8TA 3HOEA 5K67A 1EPBA 3WYPA 4TKBA 1W4TA 1QG5A 5FQ8E 4EKVA 3RKGA 2WWPA 3SZIA 4HPBA 1BWYA 5HZ5A 4GNYA 5F1EA 4Y5DA 4N7DA 1Y53X 4YGHA 4BX5B 1QABE 1ML7A 3N91A 3FYFA 3LHNA 1AB0A 3Q34A 2W2BA 1IKJA 1BRQA 4QNIA 4XMEA 4KC7A 5B5GA 5JD2A 4I3BA 5L3YA 3FELA 1Y9LA 1SY1A 5EPQA 2MWHA 2DJGA 1LELA 2F73A 3FA6A 3APWA 2L5PA 2L67A 4I6SA 2FR3A 4GGRA 3TZSA 1HXZA 1PTSA 4Y0PA 5L8IA 2KW1A 4YH0A 4NV7A 3RZYA 3V8UA 3EW1A 2RA6A 2L9CA 3TF6A 1NP1A 3KZAA 3HWEA 1FELA 5FAZA 5HBSA 1I4UA 4GETA 1LDOA 1QWDA 2MO5A 5K68A 3T6LA 4AZQA 4OS8A 3SLTA 4KC8A 5CE4A 4WHIA 1SWOA 4MVEA 5DPQA 3NX1A 4NYQA 4U3QA 1HMTA 5LJDA 3PEDA 4I9RA 2CM4A 4NNSA 1SWEA 5AJCA 3S26A 2EU7X 1RLBE 2IZDB 2N93A 1OEJA 4I3DA 3WJCA 2RTBB 3B2HA 1JV4A 4LZUA 5K06A 3WZQA 1BM5A 2GC9A 3MX7A 3WZPA 1TOWA 1LIEA 3RDXA 2W2AA 2PY1A 4ZR2A 2E4JA 3NQ9A 3D4RA 1SRIA 2BT9A 1WUBA 3EBKA 1ACDA 1LIBA 4XMCA 4Z2PA 1SWKA 3CR6A 4ORYA 4CPHB 3NQKA 1IKEA 3HPEA 1CRBA 4ZH9A 3C76X 1EI5A 4TJZA 5HCDC 1YWBA 2LBAA 1HQPA 4OS0A 5B11O 2RTHB 1RXHA 3IA8A 4AZMA 3KQ0A 1IIUA 1E2TA 1MEPA 5HA1A 1VWKB 4GZVA 1HBPA 1VWFB 1AELA 3WXQA 4EEJA 1SY2A 2RTLA 3RE5A 2IZCB 4MVIA 2X8SA 3WZOA 1EQDA 3APXA 2A5BA 3T2XA 1YWAA 3MG5A 1W6FA 1X8OA 2GTLO 3NBXX 4Z2OA 1FE3A 1DC9A 4JO6A 2GH7A 3OJYC 3VPJE 2ACOA 1N9YA 1YWCA 3RY2A 5L8NA 1XCAA 2RCTA 4OKAA 1KQWA 4GH7A 1LIDA 1RSUB 2X32A 1IFCA 3UEXA 3CKFA 1LCZA 2OVSA 3P6HA 2A8GA 4HWMA 3T1DA 5HZ6A 1VYGA 2ANSA 2VDFA 1KT6A 5IRWA 3OE3A 4QZUA 2DJFA 3FEPA 4GDZA 2FHLA 1GT4A 1SLDB 1X8PA 1DF8A 4Z28A 1VWRB 4O3ZA 1QY2A 1EALA 2OY5O 3UEVA 2NNQA 4GD9A 1KZWA 3RDQA 4K19A 5B10O 1IJ8A 3VU1A 1RXKA 4FQBB 2FS6A 4CPIA 1GT3A 4M6SA 3ZWEA 4QYPA 3AUMO 2FKGA 2QCBA 2RN4A 4QAEA 4NLIA 3KFIA 1CBRA 4YFQA 3UEUA 1GX8A 1JJJA 1BSYA 2Y3FA 4LKTA 1OPBA 4ORWA 5C0NA 4Z2VA 2IZBA 3NR3A 4GKCA 2G78A 2OY1O 2RTIB 1LICA 4B55A 2ZSCA 1NDJA 4A1HA 1MX7A 5F6ZA 1E00A 1ZNKA 4O49A 5CSEA 1JMXA 2WPUA 1KT3A 1GT1A 2RTGB 1VWLB 2OF8A 1G85A 1GX9A 1GT5A 3O22A 3PECA 1SRFA 2LBVA 4IB8A 2RTQB 5EDBA 1N4JA 2X8TA 3OBLA 2X8FA 3FR5A 4WFUA 1SXUA 5KIDA 2JU8A 4BX7A 1NP4A 2LFOA 3H3IA 1G5WA 5AJBA 2A5CA 2IZEB 4U8UO 1JYDA 5JR8A 2IZGB 3PDFA 4I95A 4A8ZA 4OMXA 4DQ3A 1DF3A 3HWFA 3UEWA 1SXWA 3BU1A 1HMRA 3JQOA 2LKKA 5HA0A 1LFOA 1SRJA 5HTDA 2FLJA 1EIIA 2WUTA 1BRPA 3SZJA 3BSZE 4ID2A 3WBGA 1CBIA 1SXXA 2OL8O 3S5VA 3TGCA 1WBIA 3EC5A 1S44A 3ELXA 1KZXA 1X89A 4C5PA 1GKAB 1ERBA 5F6BA 4IMNA 4IB6A 4IAXA 1B0OA 1VWIB 2CAMA 2PI3O 1LIFA 2LA7A 1AVEA 2Q2PA 1N7YA 5KHPA 1OEEA 4Y0SA 5EEDA 1JBHA 4CDFA 3ZW0A 5LKEA 2OFBA 2R73A 4YFPA 5EZ2A 4BX6A 2I5ZO 2RTAA 4U46A 2JOZA 1KQXA 2QMIA 1KL5A 2MF6A 5B3MO 4LZVA 1JMZA 1FTPA 4NNTA 2ZAGA 3F9DA 4INNA 1I9HA 4AZOA 2C1QA 3PH5A 1Y55X 2ACPX 4LKPA 3VG5A 4UU3A 1UYOX 1NGLA 3T6FA 1I04A 5FENA 1MDCA 2WR6A 4CSBA 1CJ5A 4A1YA 4GJVA 2G5LA 3FMZA 1O8VA 1QQSA 3D95A 2Z4IA 4O4XA 4RUNA 1OBQA 4EQAC 4QQ1A 2Z4HA 2CZUA 2OF9A 4AZNA 3RSWA 1K3BA 4O9SA 1PBOA 1EPAA 2POAA 1H91A 4O3WA 3EW2A 2FS7A 3VHHA 3VG4A 5H9NA 1B8EA 1SY3A 2G8CO 2JW1A 1AQBA 1ICMA 3NPOA 2FR2A 1T68X 4LQZA 1PEEA 4CDEA 3CQNA 3JS1A 3ZQ3A 4U9CA 1SWTA 4XMFA 1VPRA 4N7CA 2K23A 4A60A 5HCCC 5FFHA 1OSPO 1ZNLA 3U03A 3P6DA 4NW4A 4L1NA 3VG3A 1GX3A 2O62A 4CDCA 2WQAE 1VWCB 3BX7A 3CMPA 4YKMA 1LKEA 2CBRA 2JMBA 5CHKA 1NQNA 2GTFX 3ELZA 4PJ2A 5AQ6A 4YVBA 2FTBA 3LTWA 1MX8A 1N9MA 3SAOA 4BJ8A 3AKMA 4M7MA 4Z27A 4FBVA 2P8GA 2MM3A 2JN3A 1EW3A 1LCWA 1VWBB 2KT4B 1N0SA 1MK5A 2BSZA 3L4RA 3P02A 4GRJA 3MVFA 3SZHA 3U0DA 5HTEA 4XMGA 2FRSA 5D4AA 2X46A 1RXJA 3I17A 3VG7A 1SRGA 2A13A 5HWZA 1FEMA 1FENA 1B4MA 3WJEA 5D8JA 3RBYA 1TW4A 3PPTA 2OFRX 3RY1A 4ZHHA 1KFFA 1SY0A 1VYOA 3KVNA 4TQ2A 3BX8A 1MM9A 2CZTA 1Y9TA 1VWDB 1MUPA 1NC9A 1O1UA 1S7DA 3Q6LA 1JIWI 1SA8A 4ML7B 4DNEA 4KIIA 1RAVA 1JQPA 1R0UA 2KD2A 4QYNA 4Y0RA 5F58A 3LV4A 1XKIA 3P6FA 3P6CA 1TOUA 2G7BA 4YCHA 1T8VA 3CBSA 4GNWA 5D48A 1I05A 2X34A 2Y32A 3D96A 2G79A 3VG2A 3WJDA 5BYPA 1EIOA 5LJKA 1STRB 3KFHA 2JGSA 2IZIA 4GUZA 2AT6X 1UYNX 1U18A 1PMPA 1YUPA 2XSTA 1SWJA 4ON1A 3VHMA 4GJSA 2IZAA 3GE2A 1QY1A 1K24A 1VWPB 2VFBA 2RQ0A 1BEBA 4MIRA 2NP1A 1L6MA 4WBKA 2BS5A 5B2AO 1HY2A 2QOSC 4NYRA 1SWGA 4NV8A 2UZ2A 5F2BA 1CBQA 1AVGI 4OEMA 1ERXA 4ZH6A 4KCAA 3SOTA 4ZCBA 1JZUA 4WFVA 1CBSA 1ZNHA 4HPAA 1TXLA 1KT5A 5D45A 4O3XB 2HZRA 2AVIA 1SWRA 3WVMA 1RBPA 1U0XA 4IABA 2XKLA 5FQ7E 2Q9SA 3RE6A 3UAQA 4IRWA 3HWGA 4HFOA 4MISA 2AT3X 2AT5X 1KL3A 2MHDA 4IB9A 3PQUA 2Q39A 3PK2A 2YG2A 1G74A 2K62A 1D3SA 1DZJA 1GXAA 4ORRA 3SLOA 1SWFA 2HZQA 4IAWA 4OMWA 2HMBA 4BX5A 3APUA 2GJ5A 3QKGA 4ODDA 5BVQA 4DCBA 1PBYA 2W2FA 3PH6A 4YDBA 5HAEA 1QFTA 3HTYA 2WSJA 1BLRA 1ZRYA 1KT4A 1MOYA 1QFVA 1TVQA 3P6GA 4I3CA 1HQQA
chains in the Genus database with same CATH topology
2A2UA 2JU7A 2AKQA 2AMMX 1ICNA 1DZPA 5H9AA 4HPDA 3VE2A 4FBOA 3CBCA 5D47A 3S60A 2QO4A 3C78X 3P24A 2DM5A 3FA9A 2A3FX 4O4OA 3CWKA 2FWVA 3GAQA 4PSQA 1BJ7A 3ZUOA 3F8AA 5IO7A 4NLJA 2RCQA 3G7XA 3VE1A 3PQSA 5B29A 1U17A 2BS6A 4IB7A 1D2UA 1LNMA 5H9LA 1DZMA 5HZQA 2QO6A 3FR2A 3S5XA 1ZNDA 1YIVA 5B27A 1P6PA 4YKOA 4MVLA 4XMHA 2AH7X 1YP7A 1E5PA 1QY0A 4ZGUA 4ZHDA 5CYBA 5LJEA 4TLJA 4L3RA 3O2YA 2WEXA 3NX2A 1ZNGA 3NP1A 4XMDA 1Z24A 2ALLX 1O1VA 2R74A 3MBTA 3ZW1A 1ADLA 2NNDA 4YMYA 5LJBA 1UREA 1DZKA 5H9KA 1GGLA 1GM6A 4ORUA 3DTQA 4I9SA 5EEEA 2L68A 4IBAA 2GTLN 3FENA 1OBUA 4EFGA 2YMSA 4TKHA 4ALBA 2ZAIA 3EBWA 3K3LA 2JU3A 5F7GA 4EXZA 4DQ4A 4OS3A 2F09A 4YDAA 1OPAA 1PM1X 2ASNX 5LJGA 1VYFA 3FW4A 4AYHA 3EM0A 3TGAA 3ZW0B 1ZNEA 3ZZVA 4GE1A 4AZPA 3BRNA 2QO5A 5HCEC 4KT5A 5LJHA 4CK4A 3STNA 1BSQA 1I06A 1OBPA 4YBPA 2M4LA 4O4SA 4QZTA 2RD7C 2OVDA 2GTLM 3WJGA 3ZI8A 1KXOA 3E3CA 3DSZA 4R0BA 5LKFA 3BU9A 3FLLA 3B2JA 3B2KA 3ZUIA 4YCEA 1T0VA 4D6AA 2Q2MA 2AT0X 2MJIA 4KH8A 2WQ9A 2HLVA 1SXYA 2OVEA 3WJFA 3HK1A 4O4UA 4BQUA 4ZHGA 2KTDA 3AKNA 2R56A 4EDEA 3BDRA 1BBPA 1JYJA 4FGIB 1DFVA 1IFBA 4ZFXA 2CM9A 2QM9A 4BOEA 2NNEA 2X45A 5BVSA 5FQ6E 4ES7A 5IO5A 1EUOA 4AW8A 5HZ8A 4ZJ0A 4HPCA 3B2LA 4TNNA 4QGWA 4ALOA 4U8UN 5AEOA 4ORXA 3TGBA 3ZW2A 2HNXA 5HZ9A 1EXSA 4ZGFA 4QGXA 3EMMA 4YGZA 1X71A 3FA7A 4YFRA 3BLGA 3HOLA 1FDQA 1SMPI 1X8UA 3FW5A 1E06A 3VG6A 1A2DA 5KICA 4YGGA 4YBUA 2BLGA 2KTSA 3D97A 4ORSA 3FR4A 4GU8A 3U9PC 1A57A 3BY0A 2FT9A 2AL0X 5LJCA 3WJBA 1YWDA 1GKAA 1JJXA 1KT7A 4AZRA 1KGLA 3O19A 3NQ3A 4U8UM 1E02A 1YP6A 1X8NA 4MVKA 3WOVA 3IFBA 4RUUA 3EYCA 3FA8A 2BHVA 4UU2A 1IW2A 1KOIA 4GK9A 3STKA 2LB6A 5EDCA 3F6ZB 4QGVA 3APVA 1ALBA 2A0AA 3P6EA 4O3YA 2HYSA 3HWDA 2AT8X 1MVGA 5L8OA 3BS2A 4Y0QA 3OD9A 1LF7A 4NP1A 1X8QA 1B56A 1UZ2X 4IMOA 1BSOA 1LPJA 3FIQA 2OVAA 5BVTA 3B2IA 3CQRA 2IFBA 4ARHA 3KFFA 3STMX 1A18A 3I0AA 3C77X 2A2GA 4TKJA 1A3YA 3KFGA 3NADA 4JGLA 1HN2A 3PP6A 4CV7A 3FEKA 3RWXA 4FBRA 1DV9A 3JSQA 2Q4NA 1OEKA 1S2PA 1G7NA 1HBQA 4D6BA 4ZHFA 2OFMX 2WEWA 2CBSA 5DG4A 1HMSA 4QRLA 4BVMA 4ZHCA 4COTA 2OZQA 5H8TA 3HOEA 1EPBA 4TKBA 1QG5A 5FQ8E 3RKGA 2WWPA 4HPBA 1BWYA 4GNYA 5F1EA 4N7DA 4YGHA 1QABE 1ML7A 3N91A 3FYFA 3LHNA 1AB0A 4QNIA 2W2BA 1IKJA 1BRQA 4XMEA 5IO6A 4KC7A 4I3BA 3FELA 1Y9LA 1SY1A 5EPQA 2MWHA 2F73A 3FA6A 3APWA 2L5PA 2L67A 4I6SA 2FR3A 3TZSA 5L8IA 4Y0PA 3RZYA 3V8UA 2KW1A 4YH0A 5HZ5A 3TF6A 2RA6A 2L9CA 1NP1A 3KZAA 3HWEA 1FELA 5FAZA 5HBSA 1I4UA 4GETA 4AZQA 1QWDA 2MO5A 4OS8A 4KC8A 5CE4A 4WHIA 5DPQA 4MVEA 3NX1A 4NYQA 4U3QA 1HMTA 5LJDA 3PEDA 4I9RA 2CM4A 4NNSA 5AJCA 3S26A 2EU7X 1RLBE 2N93A 4I3DA 1OEJA 3WJCA 3B2HA 1JV4A 4LZUA 5K06A 1BM5A 2GC9A 3MX7A 1TOWA 1LIEA 2W2AA 2PY1A 4ZR2A 2E4JA 3NQ9A 3D4RA 2BT9A 3EBKA 1ACDA 1LIBA 4XMCA 4ORYA 3CR6A 3NQKA 1IKEA 1CRBA 4ZH9A 3C76X 1EI5A 4TJZA 5HCDC 1YWBA 2LBAA 1HQPA 4OS0A 3IA8A 4AZMA 3KQ0A 1IIUA 5HA1A 4GZVA 1HBPA 1AELA 3WXQA 4EEJA 1SY2A 4MVIA 2X8SA 1EQDA 3APXA 1YWAA 1X8OA 2GTLO 3NBXX 1FE3A 1DC9A 3OJYC 3VPJE 2ACOA 1YWCA 5L8NA 1XCAA 2RCTA 1KQWA 4GH7A 1LIDA 3UEXA 1IFCA 2OVSA 3P6HA 3T1DA 4HWMA 5HZ6A 1VYGA 2ANSA 1KT6A 3OE3A 4QZUA 3FEPA 4GDZA 1GT4A 1X8PA 4O3ZA 1QY2A 1EALA 3UEVA 2NNQA 1KZWA 4K19A 3VU1A 4FQBB 2FS6A 1GT3A 4M6SA 3ZWEA 4QYPA 2RN4A 4QAEA 4NLIA 3KFIA 1CBRA 4YFQA 3UEUA 1GX8A 1JJJA 1BSYA 4LKTA 1OPBA 4ORWA 5C0NA 3NR3A 4GKCA 2G78A 1LICA 4A1HA 1MX7A 5F6ZA 1E00A 1ZNKA 4O49A 1KT3A 1GT1A 1G85A 1GX9A 1GT5A 3O22A 3PECA 2LBVA 4IB8A 5EDBA 2X8TA 3OBLA 2X8FA 3FR5A 4WFUA 1SXUA 5KIDA 2JU8A 1NP4A 2LFOA 3H3IA 1G5WA 5AJBA 4U8UO 1JYDA 5JR8A 1DF3A 4I95A 4A8ZA 4OMXA 4DQ3A 3HWFA 3UEWA 1SXWA 3BU1A 1HMRA 3JQOA 2LKKA 5HA0A 1LFOA 2FLJA 1EIIA 2WUTA 1BRPA 3BSZE 4ID2A 3WBGA 1CBIA 1SXXA 3S5VA 3TGCA 1S44A 3ELXA 1KZXA 1X89A 1GKAB 1ERBA 5F6BA 4IMNA 4IB6A 4IAXA 1B0OA 1LIFA 2LA7A 2Q2PA 5KHPA 1OEEA 4Y0SA 5EEDA 1JBHA 3ZW0A 5LKEA 2R73A 5EZ2A 4YFPA 2JOZA 1KQXA 2QMIA 4LZVA 4NNTA 1FTPA 2ZAGA 3F9DA 4INNA 4AZOA 3PH5A 2ACPX 4LKPA 3VG5A 4UU3A 1NGLA 1I04A 5FENA 1MDCA 2WR6A 4CSBA 1CJ5A 4A1YA 3FMZA 1O8VA 1QQSA 3D95A 2Z4IA 4O4XA 4RUNA 1OBQA 4EQAC 4QQ1A 2Z4HA 2CZUA 4AZNA 3RSWA 4O9SA 1PBOA 1EPAA 2POAA 1H91A 4O3WA 2FS7A 3VG4A 5H9NA 1B8EA 1SY3A 3NPOA 2JW1A 1AQBA 1ICMA 1PEEA 2FR2A 1T68X 4LQZA 3CQNA 3JS1A 3ZQ3A 4U9CA 4XMFA 1VPRA 4N7CA 2K23A 4A60A 5HCCC 5FFHA 1ZNLA 3U03A 3P6DA 4NW4A 4L1NA 3VG3A 2O62A 2WQAE 3BX7A 3CMPA 4YKMA 1LKEA 2CBRA 2JMBA 4PJ2A 2GTFX 3ELZA 5AQ6A 2FTBA 1MX8A 3SAOA 3AKMA 4M7MA 4FBVA 2P8GA 2MM3A 2JN3A 1EW3A 4GRJA 3ZW1B 2KT4B 1N0SA 3L4RA 3P02A 3MVFA 3U0DA 5HTEA 4XMGA 2FRSA 5D4AA 2X46A 3VG7A 3I17A 2A13A 5HWZA 1FEMA 1FENA 1B4MA 3WJEA 5D8JA 3RBYA 1TW4A 3PPTA 2OFRX 4ZHHA 1SY0A 4TQ2A 3BX8A 2CZTA 1Y9TA 1MUPA 1O1UA 1S7DA 3Q6LA 1JIWI 1SA8A 4ML7B 4KIIA 2KD2A 1R0UA 4QYNA 4Y0RA 5F58A 3LV4A 1XKIA 3P6FA 3P6CA 1TOUA 2G7BA 4YCHA 1T8VA 3CBSA 4GNWA 5D48A 1I05A 3D96A 3VG2A 2G79A 3WJDA 5BYPA 1EIOA 5LJKA 3KFHA 2AT6X 1U18A 1PMPA 1YUPA 2XSTA 4ON1A 3GE2A 1QY1A 2RQ0A 1BEBA 4MIRA 2NP1A 1L6MA 4WBKA 2BS5A 2QOSC 4NYRA 1CBQA 1AVGI 1ERXA 4ZH6A 4KCAA 3SOTA 4ZCBA 1JZUA 4WFVA 1CBSA 1ZNHA 4HPAA 1TXLA 1KT5A 5D45A 4O3XB 2HZRA 3WVMA 1RBPA 1U0XA 4IABA 2XKLA 5FQ7E 2Q9SA 3UAQA 3HWGA 4HFOA 4MISA 2AT3X 2AT5X 4IB9A 2MHDA 3PQUA 2Q39A 2YG2A 1G74A 2K62A 1D3SA 1DZJA 1GXAA 4ORRA 2HZQA 4IAWA 4OMWA 2HMBA 3APUA 2GJ5A 3QKGA 4ODDA 5BVQA 2W2FA 3PH6A 4YDBA 5HAEA 1QFTA 3HTYA 2WSJA 1BLRA 1ZRYA 1KT4A 1QFVA 1TVQA 3P6GA 4I3CA 5HTDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A2U A;  2JU7 A;  2AKQ A;  2AMM X;  1ICN A;  1DZP A;  5H9A A;  4HPD A;  3CBC A;  5D47 A;  2QO4 A;  3C78 X;  2DM5 A;  3FA9 A;  2A3F X;  3CWK A;  2FWV A;  3GAQ A;  4PSQ A;  1BJ7 A;  3ZUO A;  3F8A A;  5IO7 A;  4NLJ A;  2RCQ A;  3G7X A;  5B29 A;  1U17 A;  4IB7 A;  1D2U A;  1LNM A;  5H9L A;  1DZM A;  5HZQ A;  2QO6 A;  3FR2 A;  1ZND A;  1YIV A;  5B27 A;  1P6P A;  4YKO A;  4MVL A;  4XMH A;  2AH7 X;  1YP7 A;  1E5P A;  1QY0 A;  4ZGU A;  4ZHD A;  5LJE A;  4TLJ A;  3O2Y A;  2WEX A;  3NX2 A;  1ZNG A;  3NP1 A;  4XMD A;  1Z24 A;  2ALL X;  1O1V A;  2R74 A;  3MBT A;  4YMY A;  1ADL A;  2NND A;  5LJB A;  1URE A;  1DZK A;  5H9K A;  1GGL A;  1GM6 A;  4ORU A;  3DTQ A;  4I9S A;  5EEE A;  2L68 A;  4IBA A;  3FEN A;  1OBU A;  4EFG A;  4TKH A;  4ALB A;  3EBW A;  3K3L A;  2JU3 A;  5F7G A;  4EXZ A;  4DQ4 A;  4OS3 A;  4YDA A;  1OPA A;  1PM1 X;  2ASN X;  5LJG A;  1VYF A;  3FW4 A;  4AYH A;  3EM0 A;  3TGA A;  1ZNE A;  4GE1 A;  4AZP A;  3BRN A;  2QO5 A;  5HCE C;  5LJH A;  4CK4 A;  3STN A;  1BSQ A;  1I06 A;  1OBP A;  4YBP A;  4QZT A;  2RD7 C;  2OVD A;  3WJG A;  1KXO A;  3DSZ A;  4R0B A;  5LKF A;  3BU9 A;  3FLL A;  3B2J A;  3B2K A;  3ZUI A;  4YCE A;  1T0V A;  4D6A A;  2Q2M A;  2AT0 X;  2MJI A;  2WQ9 A;  2HLV A;  1SXY A;  2OVE A;  3WJF A;  3HK1 A;  4BQU A;  4ZHG A;  2KTD A;  3AKN A;  2R56 A;  4EDE A;  3BDR A;  1BBP A;  1JYJ A;  1DFV A;  1IFB A;  4ZFX A;  2CM9 A;  2QM9 A;  4BOE A;  2NNE A;  2X45 A;  5BVS A;  4ES7 A;  5IO5 A;  1EUO A;  4AW8 A;  5HZ8 A;  4ZJ0 A;  4HPC A;  3B2L A;  4TNN A;  4QGW A;  4ALO A;  4ORX A;  3TGB A;  2HNX A;  5HZ9 A;  1EXS A;  4QGX A;  3EMM A;  4YGZ A;  1X71 A;  3FA7 A;  4YFR A;  3BLG A;  1FDQ A;  1X8U A;  3FW5 A;  1E06 A;  3VG6 A;  1A2D A;  5KIC A;  4YGG A;  4YBU A;  2BLG A;  3D97 A;  4ORS A;  3FR4 A;  3U9P C;  1A57 A;  3BY0 A;  2FT9 A;  2AL0 X;  5LJC A;  3WJB A;  1YWD A;  1GKA A;  1JJX A;  1KT7 A;  4AZR A;  1KGL A;  3O19 A;  3NQ3 A;  1E02 A;  1YP6 A;  1X8N A;  4MVK A;  3IFB A;  4RUU A;  3EYC A;  3FA8 A;  4UU2 A;  1IW2 A;  1KOI A;  3STK A;  2LB6 A;  5EDC A;  4QGV A;  3APV A;  1ALB A;  2A0A A;  3P6E A;  2HYS A;  3HWD A;  2AT8 X;  1MVG A;  5L8O A;  3BS2 A;  4Y0Q A;  1LF7 A;  4NP1 A;  1X8Q A;  1B56 A;  1UZ2 X;  4IMO A;  1BSO A;  1LPJ A;  3FIQ A;  2OVA A;  5BVT A;  3B2I A;  3CQR A;  2IFB A;  4ARH A;  3KFF A;  3STM X;  1A18 A;  3I0A A;  3C77 X;  2A2G A;  4TKJ A;  1A3Y A;  3KFG A;  3NAD A;  1HN2 A;  3PP6 A;  3FEK A;  1DV9 A;  3JSQ A;  2Q4N A;  1OEK A;  1S2P A;  1G7N A;  1HBQ A;  4D6B A;  4ZHF A;  2OFM X;  2WEW A;  2CBS A;  5DG4 A;  1HMS A;  4BVM A;  4ZHC A;  2OZQ A;  5H8T A;  1EPB A;  4TKB A;  1QG5 A;  2WWP A;  4HPB A;  1BWY A;  4GNY A;  5F1E A;  4N7D A;  4YGH A;  1QAB E;  1ML7 A;  1AB0 A;  5IO6 A;  2W2B A;  1IKJ A;  1BRQ A;  4XME A;  4I3B A;  3FEL A;  1SY1 A;  5EPQ A;  2F73 A;  3FA6 A;  3APW A;  2L5P A;  2L67 A;  3TZS A;  2FR3 A;  5L8I A;  4Y0P A;  3RZY A;  4YH0 A;  5HZ5 A;  3TF6 A;  2RA6 A;  2L9C A;  1NP1 A;  3KZA A;  3HWE A;  1FEL A;  5FAZ A;  5HBS A;  1I4U A;  4GET A;  4AZQ A;  1QWD A;  2MO5 A;  4OS8 A;  5CE4 A;  5DPQ A;  3NX1 A;  4NYQ A;  1HMT A;  5LJD A;  3PED A;  4I9R A;  2CM4 A;  4NNS A;  3S26 A;  2EU7 X;  1RLB E;  2N93 A;  4I3D A;  1OEJ A;  3WJC A;  3B2H A;  1JV4 A;  4LZU A;  5K06 A;  1BM5 A;  2GC9 A;  1TOW A;  1LIE A;  2W2A A;  2PY1 A;  4ZR2 A;  2E4J A;  3NQ9 A;  3EBK A;  1ACD A;  1LIB A;  4XMC A;  4ORY A;  3CR6 A;  1IKE A;  1CRB A;  4ZH9 A;  3C76 X;  5HCD C;  4TJZ A;  1YWB A;  2LBA A;  1HQP A;  4OS0 A;  3IA8 A;  4AZM A;  3KQ0 A;  1IIU A;  5HA1 A;  1HBP A;  1AEL A;  3WXQ A;  4EEJ A;  1SY2 A;  4MVI A;  1EQD A;  3APX A;  1YWA A;  1X8O A;  1FE3 A;  1DC9 A;  3OJY C;  2ACO A;  1YWC A;  5L8N A;  1XCA A;  2RCT A;  1KQW A;  4GH7 A;  1LID A;  3UEX A;  1IFC A;  3P6H A;  3T1D A;  5HZ6 A;  1VYG A;  2ANS A;  1KT6 A;  4QZU A;  3FEP A;  1GT4 A;  1X8P A;  1QY2 A;  1EAL A;  3UEV A;  2NNQ A;  1KZW A;  4K19 A;  2FS6 A;  1GT3 A;  4M6S A;  4QYP A;  4QAE A;  4NLI A;  3KFI A;  1CBR A;  4YFQ A;  3UEU A;  1GX8 A;  1JJJ A;  1BSY A;  4LKT A;  1OPB A;  4ORW A;  5C0N A;  3NR3 A;  4GKC A;  2G78 A;  1LIC A;  4A1H A;  1MX7 A;  5F6Z A;  1E00 A;  1ZNK A;  1KT3 A;  1GT1 A;  1G85 A;  1GX9 A;  1GT5 A;  3O22 A;  3PEC A;  2LBV A;  4IB8 A;  5EDB A;  3FR5 A;  4WFU A;  1SXU A;  5KID A;  2JU8 A;  1NP4 A;  2LFO A;  1G5W A;  1JYD A;  5JR8 A;  1DF3 A;  4A8Z A;  4DQ3 A;  4OMX A;  3HWF A;  3UEW A;  1SXW A;  3BU1 A;  1HMR A;  2LKK A;  5HA0 A;  1LFO A;  2FLJ A;  1EII A;  2WUT A;  1BRP A;  3BSZ E;  3WBG A;  1CBI A;  1SXX A;  3TGC A;  1S44 A;  3ELX A;  1KZX A;  1X89 A;  1GKA B;  1ERB A;  5F6B A;  4IMN A;  4IB6 A;  4IAX A;  1B0O A;  1LIF A;  2Q2P A;  5KHP A;  1OEE A;  4Y0S A;  5EED A;  1JBH A;  5LKE A;  2R73 A;  5EZ2 A;  4YFP A;  2JOZ A;  1KQX A;  4LZV A;  4NNT A;  1FTP A;  3F9D A;  4AZO A;  3PH5 A;  2ACP X;  4LKP A;  3VG5 A;  4UU3 A;  1NGL A;  1I04 A;  5FEN A;  1MDC A;  2WR6 A;  1CJ5 A;  4A1Y A;  3FMZ A;  1O8V A;  1QQS A;  3D95 A;  4RUN A;  1OBQ A;  2CZU A;  4AZN A;  3RSW A;  4O9S A;  1PBO A;  1EPA A;  2POA A;  1H91 A;  2FS7 A;  3VG4 A;  5H9N A;  1B8E A;  1SY3 A;  3NPO A;  1PEE A;  1AQB A;  1ICM A;  2FR2 A;  1T68 X;  3CQN A;  3JS1 A;  3ZQ3 A;  4XMF A;  1VPR A;  4N7C A;  2K23 A;  4A60 A;  5HCC C;  5FFH A;  1ZNL A;  3U03 A;  3P6D A;  3VG3 A;  2O62 A;  2WQA E;  3BX7 A;  3CMP A;  4YKM A;  1LKE A;  2CBR A;  2GTF X;  3ELZ A;  5AQ6 A;  2FTB A;  1MX8 A;  3SAO A;  3AKM A;  4M7M A;  2P8G A;  2MM3 A;  2JN3 A;  1EW3 A;  4GRJ A;  2KT4 B;  1N0S A;  3L4R A;  3MVF A;  3U0D A;  5HTE A;  4XMG A;  2FRS A;  5D4A A;  2X46 A;  3VG7 A;  3I17 A;  2A13 A;  5HWZ A;  1FEM A;  1FEN A;  1B4M A;  3WJE A;  5D8J A;  1TW4 A;  3PPT A;  2OFR X;  4ZHH A;  1SY0 A;  4TQ2 A;  3BX8 A;  2CZT A;  1MUP A;  1O1U A;  1S7D A;  3Q6L A;  1SA8 A;  4KII A;  1R0U A;  4QYN A;  4Y0R A;  5F58 A;  1XKI A;  3P6F A;  3P6C A;  1TOU A;  2G7B A;  4YCH A;  1T8V A;  3CBS A;  4GNW A;  5D48 A;  1I05 A;  3D96 A;  3VG2 A;  2G79 A;  3WJD A;  1EIO A;  5LJK A;  3KFH A;  2AT6 X;  1U18 A;  1PMP A;  1YUP A;  2XST A;  1QY1 A;  2RQ0 A;  1BEB A;  2NP1 A;  1L6M A;  4WBK A;  2QOS C;  4NYR A;  1CBQ A;  1AVG I;  1ERX A;  4ZH6 A;  4ZCB A;  1JZU A;  4WFV A;  1CBS A;  1ZNH A;  4HPA A;  1TXL A;  1KT5 A;  5D45 A;  2HZR A;  3WVM A;  1RBP A;  1U0X A;  2XKL A;  2Q9S A;  3HWG A;  4HFO A;  2AT3 X;  2AT5 X;  4IB9 A;  2Q39 A;  2YG2 A;  1G74 A;  2K62 A;  1D3S A;  1DZJ A;  1GXA A;  4ORR A;  2HZQ A;  4IAW A;  4OMW A;  2HMB A;  3APU A;  2GJ5 A;  3QKG A;  4ODD A;  5BVQ A;  2W2F A;  3PH6 A;  4YDB A;  5HAE A;  1QFT A;  2WSJ A;  1BLR A;  1ZRY A;  1KT4 A;  1QFV A;  1TVQ A;  3P6G A;  4I3C A;  5HTD A; 
#chains in the Genus database with same CATH topology
 2A2U A;  2JU7 A;  2RTJ A;  4GGT A;  2AKQ A;  2AMM X;  1ICN A;  1DZP A;  5H9A A;  1VWE B;  4HPD A;  3VE2 A;  2QOM A;  4FBO A;  3CBC A;  4MEE A;  1HXL A;  5D47 A;  3S60 A;  2QO4 A;  2IZL B;  3C78 X;  3P24 A;  2DM5 A;  3FA9 A;  2A3F X;  2UYW A;  2RTK A;  4O4O A;  4BCS A;  2OFA A;  2FWV A;  3CWK A;  3GAQ A;  1BJ7 A;  1NBX A;  4PSQ A;  3ZUO A;  3F8A A;  5IO7 A;  4NLJ A;  2RCQ A;  2RTC B;  3G7X A;  3VE1 A;  5IRA A;  3PQS A;  5B29 A;  1U17 A;  2BS6 A;  3RDO A;  4IB7 A;  1D2U A;  1LNM A;  5H9L A;  3CKG A;  1DZM A;  5HZQ A;  2QO6 A;  3FR2 A;  3S5X A;  1ZND A;  4CDD A;  4CPH A;  1KL4 A;  1SWB A;  1YIV A;  5B27 A;  1P6P A;  4YKO A;  4MVL A;  4XMH A;  2AH7 X;  1YP7 A;  1E5P A;  1QY0 A;  4ZGU A;  4ZHD A;  5CYB A;  4BX7 B;  5LJE A;  4TLJ A;  4L3R A;  3O2Y A;  2WEX A;  3NX2 A;  1ZNG A;  3NP1 A;  4XMD A;  1Z24 A;  2ALL X;  1O1V A;  2R74 A;  3MBT A;  3ZW1 A;  1ADL A;  2NND A;  1NQM A;  3MM0 A;  4YMY A;  1URE A;  5LJB A;  1DZK A;  5H9K A;  1GGL A;  1GM6 A;  4ORU A;  1SWD A;  2C1S A;  3DTQ A;  4I9S A;  5EEE A;  2L68 A;  1Y0G A;  4IBA A;  5IO6 A;  2GTL N;  3FEN A;  1OBU A;  4EFG A;  2YMS A;  4TKH A;  4ALB A;  2ZAI A;  3EBW A;  3K3L A;  2JU3 A;  5F7G A;  4EXZ A;  4DQ4 A;  3X00 A;  4OS3 A;  2F09 A;  5IRU A;  4YDA A;  1OPA A;  1PM1 X;  1VWQ B;  4BGF A;  2ASN X;  5LJG A;  3RDS A;  1VYF A;  3FW4 A;  1JJU A;  3EM0 A;  4JNJ A;  4AYH A;  4CPE A;  1SWS A;  3TGA A;  3ZW0 B;  1ZNE A;  3ZZV A;  4BX6 B;  1VWO B;  4GE1 A;  1LDQ A;  4AZP A;  3BRN A;  3ZW1 B;  2QO5 A;  5HCE C;  4KT5 A;  5LJH A;  2IZF B;  4CK4 A;  3STN A;  3FID A;  1BSQ A;  3WYQ A;  1I06 A;  1OBP A;  4YBP A;  3VHI A;  2FGS A;  2M4L A;  2OY8 A;  2RTD B;  4O4S A;  2F01 A;  4QZT A;  2RD7 C;  2OVD A;  2GTL M;  1VWA B;  1SLE B;  3WJG A;  1SRE A;  1SWL A;  3ZI8 A;  1KXO A;  1W5R A;  3E3C A;  3DSZ A;  4R0B A;  5LKF A;  3BU9 A;  3FLL A;  3B2J A;  3B2K A;  3ZUI A;  2RTN B;  4YCE A;  2OYB O;  1T0V A;  4D6A A;  1LCV A;  1SLG B;  2AT0 X;  2Q2M A;  2MJI A;  3AEH A;  4KH8 A;  2RTM A;  2WQ9 A;  2HKD A;  1VWM B;  2HLV A;  1SXY A;  2OVE A;  3WJF A;  3HK1 A;  4O4U A;  4BQU A;  2RTO B;  1SWP A;  2KTD A;  4ZHG A;  3AKN A;  2R56 A;  4EDE A;  3BDR A;  1BBP A;  1JYJ A;  4FGI B;  1DFV A;  1IFB A;  4CPF A;  4ZFX A;  2CM9 A;  2OL7 A;  2QM9 A;  4Y59 A;  4BOE A;  2NNE A;  2X45 A;  5BVS A;  5FQ6 E;  4ES7 A;  3SLJ A;  5IO5 A;  1SWU A;  2AF5 A;  1EUO A;  4I60 A;  4GGZ A;  4AW8 A;  5HZ8 A;  4ZJ0 A;  4HPC A;  2VFC A;  3B2L A;  4TNN A;  4QGW A;  4ALO A;  4U8U N;  5AEO A;  4ORX A;  5IXG A;  3ZW2 A;  2HNX A;  5HZ9 A;  3TGB A;  1EXS A;  4ZGF A;  4QGX A;  3EMM A;  4YGZ A;  1X71 A;  3FA7 A;  4YFR A;  3BLG A;  3HOL A;  1FDQ A;  1SMP I;  1X8U A;  3FW5 A;  1FJ1 E;  4OEL A;  1E06 A;  3VG6 A;  1A2D A;  5KIC A;  4YGG A;  4YBU A;  2BLG A;  2OY7 A;  1SLF B;  2KTS A;  3D97 A;  4ORS A;  3D9W A;  3FR4 A;  4GU8 A;  3U9P C;  1AVD A;  1A57 A;  2X4M A;  3BY0 A;  2FT9 A;  2AL0 X;  4JHQ A;  1STS B;  4BBO A;  5LJC A;  3WJB A;  1VWG B;  1YWD A;  1GKA A;  1JJX A;  1KT7 A;  4AZR A;  1KGL A;  3O19 A;  3NQ3 A;  1SRH A;  2IZH B;  4U8U M;  1E02 A;  1YP6 A;  1X8N A;  4MVK A;  3WOV A;  3WZN A;  1SWC A;  3IFB A;  3QQ2 A;  4RUU A;  2IZJ A;  1Y52 X;  2BHV A;  3EYC A;  3FA8 A;  4UU2 A;  1IW2 A;  1KOI A;  4GK9 A;  3STK A;  2IZK A;  2LB6 A;  1I78 A;  5EDC A;  3F6Z B;  4QGV A;  2RTR B;  3APV A;  2I5V O;  1VWJ B;  1ALB A;  2A0A A;  2X55 A;  3P6E A;  1VWH B;  2HYS A;  4O3Y A;  3HWD A;  2AT8 X;  1STP A;  1SWA A;  1MVG A;  2OL6 O;  1SWH A;  5L8O A;  3BS2 A;  4Y0Q A;  3OD9 A;  1LF7 A;  4NP1 A;  1X8Q A;  1B56 A;  1UZ2 X;  4IMO A;  2Y3E A;  1BSO A;  1LPJ A;  3FIQ A;  2OVA A;  2RTP B;  1VWN B;  2BC3 A;  3VGW A;  4Z6J A;  5BVT A;  3B2I A;  4GDA A;  3CQR A;  1SWQ A;  2IFB A;  5B5F A;  4ARH A;  3KFF A;  3STM X;  2C4I A;  3RDM A;  1A18 A;  3I0A A;  2RTE B;  3C77 X;  2A2G A;  4TKJ A;  1A3Y A;  1LUQ A;  3KFG A;  3FDC A;  3NAD A;  1HN2 A;  2FHN X;  3PP6 A;  4JGL A;  1SWN A;  3FEK A;  3RDU A;  3RWX A;  4FBR A;  4CV7 A;  1DV9 A;  3JSQ A;  1N43 A;  1OEK A;  2Q4N A;  3T2W A;  2FKJ A;  1S2P A;  1G7N A;  1HBQ A;  2X56 A;  4D6B A;  4ZHF A;  2OFM X;  2RTF B;  2CBS A;  2WEW A;  5DG4 A;  1HMS A;  4QRL A;  4BVM A;  4ZHC A;  1RST B;  4COT A;  2OZQ A;  5H8T A;  3HOE A;  5K67 A;  1EPB A;  3WYP A;  4TKB A;  1W4T A;  1QG5 A;  5FQ8 E;  4EKV A;  3RKG A;  2WWP A;  3SZI A;  4HPB A;  1BWY A;  5HZ5 A;  4GNY A;  5F1E A;  4Y5D A;  4N7D A;  1Y53 X;  4YGH A;  4BX5 B;  1QAB E;  1ML7 A;  3N91 A;  3FYF A;  3LHN A;  1AB0 A;  3Q34 A;  2W2B A;  1IKJ A;  1BRQ A;  4QNI A;  4XME A;  4KC7 A;  5B5G A;  5JD2 A;  4I3B A;  5L3Y A;  3FEL A;  1Y9L A;  1SY1 A;  5EPQ A;  2MWH A;  2DJG A;  1LEL A;  2F73 A;  3FA6 A;  3APW A;  2L5P A;  2L67 A;  4I6S A;  2FR3 A;  4GGR A;  3TZS A;  1HXZ A;  1PTS A;  4Y0P A;  5L8I A;  2KW1 A;  4YH0 A;  4NV7 A;  3RZY A;  3V8U A;  3EW1 A;  2RA6 A;  2L9C A;  3TF6 A;  1NP1 A;  3KZA A;  3HWE A;  1FEL A;  5FAZ A;  5HBS A;  1I4U A;  4GET A;  1LDO A;  1QWD A;  2MO5 A;  5K68 A;  3T6L A;  4AZQ A;  4OS8 A;  3SLT A;  4KC8 A;  5CE4 A;  4WHI A;  1SWO A;  4MVE A;  5DPQ A;  3NX1 A;  4NYQ A;  4U3Q A;  1HMT A;  5LJD A;  3PED A;  4I9R A;  2CM4 A;  4NNS A;  1SWE A;  5AJC A;  3S26 A;  2EU7 X;  1RLB E;  2IZD B;  2N93 A;  1OEJ A;  4I3D A;  3WJC A;  2RTB B;  3B2H A;  1JV4 A;  4LZU A;  5K06 A;  3WZQ A;  1BM5 A;  2GC9 A;  3MX7 A;  3WZP A;  1TOW A;  1LIE A;  3RDX A;  2W2A A;  2PY1 A;  4ZR2 A;  2E4J A;  3NQ9 A;  3D4R A;  1SRI A;  2BT9 A;  1WUB A;  3EBK A;  1ACD A;  1LIB A;  4XMC A;  4Z2P A;  1SWK A;  3CR6 A;  4ORY A;  4CPH B;  3NQK A;  1IKE A;  3HPE A;  1CRB A;  4ZH9 A;  3C76 X;  1EI5 A;  4TJZ A;  5HCD C;  1YWB A;  2LBA A;  1HQP A;  4OS0 A;  5B11 O;  2RTH B;  1RXH A;  3IA8 A;  4AZM A;  3KQ0 A;  1IIU A;  1E2T A;  1MEP A;  5HA1 A;  1VWK B;  4GZV A;  1HBP A;  1VWF B;  1AEL A;  3WXQ A;  4EEJ A;  1SY2 A;  2RTL A;  3RE5 A;  2IZC B;  4MVI A;  2X8S A;  3WZO A;  1EQD A;  3APX A;  2A5B A;  3T2X A;  1YWA A;  3MG5 A;  1W6F A;  1X8O A;  2GTL O;  3NBX X;  4Z2O A;  1FE3 A;  1DC9 A;  4JO6 A;  2GH7 A;  3OJY C;  3VPJ E;  2ACO A;  1N9Y A;  1YWC A;  3RY2 A;  5L8N A;  1XCA A;  2RCT A;  4OKA A;  1KQW A;  4GH7 A;  1LID A;  1RSU B;  2X32 A;  1IFC A;  3UEX A;  3CKF A;  1LCZ A;  2OVS A;  3P6H A;  2A8G A;  4HWM A;  3T1D A;  5HZ6 A;  1VYG A;  2ANS A;  2VDF A;  1KT6 A;  5IRW A;  3OE3 A;  4QZU A;  2DJF A;  3FEP A;  4GDZ A;  2FHL A;  1GT4 A;  1SLD B;  1X8P A;  1DF8 A;  4Z28 A;  1VWR B;  4O3Z A;  1QY2 A;  1EAL A;  2OY5 O;  3UEV A;  2NNQ A;  4GD9 A;  1KZW A;  3RDQ A;  4K19 A;  5B10 O;  1IJ8 A;  3VU1 A;  1RXK A;  4FQB B;  2FS6 A;  4CPI A;  1GT3 A;  4M6S A;  3ZWE A;  4QYP A;  3AUM O;  2FKG A;  2QCB A;  2RN4 A;  4QAE A;  4NLI A;  3KFI A;  1CBR A;  4YFQ A;  3UEU A;  1GX8 A;  1JJJ A;  1BSY A;  2Y3F A;  4LKT A;  1OPB A;  4ORW A;  5C0N A;  4Z2V A;  2IZB A;  3NR3 A;  4GKC A;  2G78 A;  2OY1 O;  2RTI B;  1LIC A;  4B55 A;  2ZSC A;  1NDJ A;  4A1H A;  1MX7 A;  5F6Z A;  1E00 A;  1ZNK A;  4O49 A;  5CSE A;  1JMX A;  2WPU A;  1KT3 A;  1GT1 A;  2RTG B;  1VWL B;  2OF8 A;  1G85 A;  1GX9 A;  1GT5 A;  3O22 A;  3PEC A;  1SRF A;  2LBV A;  4IB8 A;  2RTQ B;  5EDB A;  1N4J A;  2X8T A;  3OBL A;  2X8F A;  3FR5 A;  4WFU A;  1SXU A;  5KID A;  2JU8 A;  4BX7 A;  1NP4 A;  2LFO A;  3H3I A;  1G5W A;  5AJB A;  2A5C A;  2IZE B;  4U8U O;  1JYD A;  5JR8 A;  2IZG B;  3PDF A;  4I95 A;  4A8Z A;  4OMX A;  4DQ3 A;  1DF3 A;  3HWF A;  3UEW A;  1SXW A;  3BU1 A;  1HMR A;  3JQO A;  2LKK A;  5HA0 A;  1LFO A;  1SRJ A;  5HTD A;  2FLJ A;  1EII A;  2WUT A;  1BRP A;  3SZJ A;  3BSZ E;  4ID2 A;  3WBG A;  1CBI A;  1SXX A;  2OL8 O;  3S5V A;  3TGC A;  1WBI A;  3EC5 A;  1S44 A;  3ELX A;  1KZX A;  1X89 A;  4C5P A;  1GKA B;  1ERB A;  5F6B A;  4IMN A;  4IB6 A;  4IAX A;  1B0O A;  1VWI B;  2CAM A;  2PI3 O;  1LIF A;  2LA7 A;  1AVE A;  2Q2P A;  1N7Y A;  5KHP A;  1OEE A;  4Y0S A;  5EED A;  1JBH A;  4CDF A;  3ZW0 A;  5LKE A;  2OFB A;  2R73 A;  4YFP A;  5EZ2 A;  4BX6 A;  2I5Z O;  2RTA A;  4U46 A;  2JOZ A;  1KQX A;  2QMI A;  1KL5 A;  2MF6 A;  5B3M O;  4LZV A;  1JMZ A;  1FTP A;  4NNT A;  2ZAG A;  3F9D A;  4INN A;  1I9H A;  4AZO A;  2C1Q A;  3PH5 A;  1Y55 X;  2ACP X;  4LKP A;  3VG5 A;  4UU3 A;  1UYO X;  1NGL A;  3T6F A;  1I04 A;  5FEN A;  1MDC A;  2WR6 A;  4CSB A;  1CJ5 A;  4A1Y A;  4GJV A;  2G5L A;  3FMZ A;  1O8V A;  1QQS A;  3D95 A;  2Z4I A;  4O4X A;  4RUN A;  1OBQ A;  4EQA C;  4QQ1 A;  2Z4H A;  2CZU A;  2OF9 A;  4AZN A;  3RSW A;  1K3B A;  4O9S A;  1PBO A;  1EPA A;  2POA A;  1H91 A;  4O3W A;  3EW2 A;  2FS7 A;  3VHH A;  3VG4 A;  5H9N A;  1B8E A;  1SY3 A;  2G8C O;  2JW1 A;  1AQB A;  1ICM A;  3NPO A;  2FR2 A;  1T68 X;  4LQZ A;  1PEE A;  4CDE A;  3CQN A;  3JS1 A;  3ZQ3 A;  4U9C A;  1SWT A;  4XMF A;  1VPR A;  4N7C A;  2K23 A;  4A60 A;  5HCC C;  5FFH A;  1OSP O;  1ZNL A;  3U03 A;  3P6D A;  4NW4 A;  4L1N A;  3VG3 A;  1GX3 A;  2O62 A;  4CDC A;  2WQA E;  1VWC B;  3BX7 A;  3CMP A;  4YKM A;  1LKE A;  2CBR A;  2JMB A;  5CHK A;  1NQN A;  2GTF X;  3ELZ A;  4PJ2 A;  5AQ6 A;  4YVB A;  2FTB A;  3LTW A;  1MX8 A;  1N9M A;  3SAO A;  4BJ8 A;  3AKM A;  4M7M A;  4Z27 A;  4FBV A;  2P8G A;  2MM3 A;  2JN3 A;  1EW3 A;  1LCW A;  1VWB B;  2KT4 B;  1N0S A;  1MK5 A;  2BSZ A;  3L4R A;  3P02 A;  4GRJ A;  3MVF A;  3SZH A;  3U0D A;  5HTE A;  4XMG A;  2FRS A;  5D4A A;  2X46 A;  1RXJ A;  3I17 A;  3VG7 A;  1SRG A;  2A13 A;  5HWZ A;  1FEM A;  1FEN A;  1B4M A;  3WJE A;  5D8J A;  3RBY A;  1TW4 A;  3PPT A;  2OFR X;  3RY1 A;  4ZHH A;  1KFF A;  1SY0 A;  1VYO A;  3KVN A;  4TQ2 A;  3BX8 A;  1MM9 A;  2CZT A;  1Y9T A;  1VWD B;  1MUP A;  1NC9 A;  1O1U A;  1S7D A;  3Q6L A;  1JIW I;  1SA8 A;  4ML7 B;  4DNE A;  4KII A;  1RAV A;  1JQP A;  1R0U A;  2KD2 A;  4QYN A;  4Y0R A;  5F58 A;  3LV4 A;  1XKI A;  3P6F A;  3P6C A;  1TOU A;  2G7B A;  4YCH A;  1T8V A;  3CBS A;  4GNW A;  5D48 A;  1I05 A;  2X34 A;  2Y32 A;  3D96 A;  2G79 A;  3VG2 A;  3WJD A;  5BYP A;  1EIO A;  5LJK A;  1STR B;  3KFH A;  2JGS A;  2IZI A;  4GUZ A;  2AT6 X;  1UYN X;  1U18 A;  1PMP A;  1YUP A;  2XST A;  1SWJ A;  4ON1 A;  3VHM A;  4GJS A;  2IZA A;  3GE2 A;  1QY1 A;  1K24 A;  1VWP B;  2VFB A;  2RQ0 A;  1BEB A;  4MIR A;  2NP1 A;  1L6M A;  4WBK A;  2BS5 A;  5B2A O;  1HY2 A;  2QOS C;  4NYR A;  1SWG A;  4NV8 A;  2UZ2 A;  5F2B A;  1CBQ A;  1AVG I;  4OEM A;  1ERX A;  4ZH6 A;  4KCA A;  3SOT A;  4ZCB A;  1JZU A;  4WFV A;  1CBS A;  1ZNH A;  4HPA A;  1TXL A;  1KT5 A;  5D45 A;  4O3X B;  2HZR A;  2AVI A;  1SWR A;  3WVM A;  1RBP A;  1U0X A;  4IAB A;  2XKL A;  5FQ7 E;  2Q9S A;  3RE6 A;  3UAQ A;  4IRW A;  3HWG A;  4HFO A;  4MIS A;  2AT3 X;  2AT5 X;  1KL3 A;  2MHD A;  4IB9 A;  3PQU A;  2Q39 A;  3PK2 A;  2YG2 A;  1G74 A;  2K62 A;  1D3S A;  1DZJ A;  1GXA A;  4ORR A;  3SLO A;  1SWF A;  2HZQ A;  4IAW A;  4OMW A;  2HMB A;  4BX5 A;  3APU A;  2GJ5 A;  3QKG A;  4ODD A;  5BVQ A;  4DCB A;  1PBY A;  2W2F A;  3PH6 A;  4YDB A;  5HAE A;  1QFT A;  3HTY A;  2WSJ A;  1BLR A;  1ZRY A;  1KT4 A;  1MOY A;  1QFV A;  1TVQ A;  3P6G A;  4I3C A;  1HQQ A; 
#chains in the Genus database with same CATH homology
 2A2U A;  2JU7 A;  2AKQ A;  2AMM X;  1ICN A;  1DZP A;  5H9A A;  4HPD A;  3VE2 A;  4FBO A;  3CBC A;  5D47 A;  3S60 A;  2QO4 A;  3C78 X;  3P24 A;  2DM5 A;  3FA9 A;  2A3F X;  4O4O A;  3CWK A;  2FWV A;  3GAQ A;  4PSQ A;  1BJ7 A;  3ZUO A;  3F8A A;  5IO7 A;  4NLJ A;  2RCQ A;  3G7X A;  3VE1 A;  3PQS A;  5B29 A;  1U17 A;  2BS6 A;  4IB7 A;  1D2U A;  1LNM A;  5H9L A;  1DZM A;  5HZQ A;  2QO6 A;  3FR2 A;  3S5X A;  1ZND A;  1YIV A;  5B27 A;  1P6P A;  4YKO A;  4MVL A;  4XMH A;  2AH7 X;  1YP7 A;  1E5P A;  1QY0 A;  4ZGU A;  4ZHD A;  5CYB A;  5LJE A;  4TLJ A;  4L3R A;  3O2Y A;  2WEX A;  3NX2 A;  1ZNG A;  3NP1 A;  4XMD A;  1Z24 A;  2ALL X;  1O1V A;  2R74 A;  3MBT A;  3ZW1 A;  1ADL A;  2NND A;  4YMY A;  5LJB A;  1URE A;  1DZK A;  5H9K A;  1GGL A;  1GM6 A;  4ORU A;  3DTQ A;  4I9S A;  5EEE A;  2L68 A;  4IBA A;  2GTL N;  3FEN A;  1OBU A;  4EFG A;  2YMS A;  4TKH A;  4ALB A;  2ZAI A;  3EBW A;  3K3L A;  2JU3 A;  5F7G A;  4EXZ A;  4DQ4 A;  4OS3 A;  2F09 A;  4YDA A;  1OPA A;  1PM1 X;  2ASN X;  5LJG A;  1VYF A;  3FW4 A;  4AYH A;  3EM0 A;  3TGA A;  3ZW0 B;  1ZNE A;  3ZZV A;  4GE1 A;  4AZP A;  3BRN A;  2QO5 A;  5HCE C;  4KT5 A;  5LJH A;  4CK4 A;  3STN A;  1BSQ A;  1I06 A;  1OBP A;  4YBP A;  2M4L A;  4O4S A;  4QZT A;  2RD7 C;  2OVD A;  2GTL M;  3WJG A;  3ZI8 A;  1KXO A;  3E3C A;  3DSZ A;  4R0B A;  5LKF A;  3BU9 A;  3FLL A;  3B2J A;  3B2K A;  3ZUI A;  4YCE A;  1T0V A;  4D6A A;  2Q2M A;  2AT0 X;  2MJI A;  4KH8 A;  2WQ9 A;  2HLV A;  1SXY A;  2OVE A;  3WJF A;  3HK1 A;  4O4U A;  4BQU A;  4ZHG A;  2KTD A;  3AKN A;  2R56 A;  4EDE A;  3BDR A;  1BBP A;  1JYJ A;  4FGI B;  1DFV A;  1IFB A;  4ZFX A;  2CM9 A;  2QM9 A;  4BOE A;  2NNE A;  2X45 A;  5BVS A;  5FQ6 E;  4ES7 A;  5IO5 A;  1EUO A;  4AW8 A;  5HZ8 A;  4ZJ0 A;  4HPC A;  3B2L A;  4TNN A;  4QGW A;  4ALO A;  4U8U N;  5AEO A;  4ORX A;  3TGB A;  3ZW2 A;  2HNX A;  5HZ9 A;  1EXS A;  4ZGF A;  4QGX A;  3EMM A;  4YGZ A;  1X71 A;  3FA7 A;  4YFR A;  3BLG A;  3HOL A;  1FDQ A;  1SMP I;  1X8U A;  3FW5 A;  1E06 A;  3VG6 A;  1A2D A;  5KIC A;  4YGG A;  4YBU A;  2BLG A;  2KTS A;  3D97 A;  4ORS A;  3FR4 A;  4GU8 A;  3U9P C;  1A57 A;  3BY0 A;  2FT9 A;  2AL0 X;  5LJC A;  3WJB A;  1YWD A;  1GKA A;  1JJX A;  1KT7 A;  4AZR A;  1KGL A;  3O19 A;  3NQ3 A;  4U8U M;  1E02 A;  1YP6 A;  1X8N A;  4MVK A;  3WOV A;  3IFB A;  4RUU A;  3EYC A;  3FA8 A;  2BHV A;  4UU2 A;  1IW2 A;  1KOI A;  4GK9 A;  3STK A;  2LB6 A;  5EDC A;  3F6Z B;  4QGV A;  3APV A;  1ALB A;  2A0A A;  3P6E A;  4O3Y A;  2HYS A;  3HWD A;  2AT8 X;  1MVG A;  5L8O A;  3BS2 A;  4Y0Q A;  3OD9 A;  1LF7 A;  4NP1 A;  1X8Q A;  1B56 A;  1UZ2 X;  4IMO A;  1BSO A;  1LPJ A;  3FIQ A;  2OVA A;  5BVT A;  3B2I A;  3CQR A;  2IFB A;  4ARH A;  3KFF A;  3STM X;  1A18 A;  3I0A A;  3C77 X;  2A2G A;  4TKJ A;  1A3Y A;  3KFG A;  3NAD A;  4JGL A;  1HN2 A;  3PP6 A;  4CV7 A;  3FEK A;  3RWX A;  4FBR A;  1DV9 A;  3JSQ A;  2Q4N A;  1OEK A;  1S2P A;  1G7N A;  1HBQ A;  4D6B A;  4ZHF A;  2OFM X;  2WEW A;  2CBS A;  5DG4 A;  1HMS A;  4QRL A;  4BVM A;  4ZHC A;  4COT A;  2OZQ A;  5H8T A;  3HOE A;  1EPB A;  4TKB A;  1QG5 A;  5FQ8 E;  3RKG A;  2WWP A;  4HPB A;  1BWY A;  4GNY A;  5F1E A;  4N7D A;  4YGH A;  1QAB E;  1ML7 A;  3N91 A;  3FYF A;  3LHN A;  1AB0 A;  4QNI A;  2W2B A;  1IKJ A;  1BRQ A;  4XME A;  5IO6 A;  4KC7 A;  4I3B A;  3FEL A;  1Y9L A;  1SY1 A;  5EPQ A;  2MWH A;  2F73 A;  3FA6 A;  3APW A;  2L5P A;  2L67 A;  4I6S A;  2FR3 A;  3TZS A;  5L8I A;  4Y0P A;  3RZY A;  3V8U A;  2KW1 A;  4YH0 A;  5HZ5 A;  3TF6 A;  2RA6 A;  2L9C A;  1NP1 A;  3KZA A;  3HWE A;  1FEL A;  5FAZ A;  5HBS A;  1I4U A;  4GET A;  4AZQ A;  1QWD A;  2MO5 A;  4OS8 A;  4KC8 A;  5CE4 A;  4WHI A;  5DPQ A;  4MVE A;  3NX1 A;  4NYQ A;  4U3Q A;  1HMT A;  5LJD A;  3PED A;  4I9R A;  2CM4 A;  4NNS A;  5AJC A;  3S26 A;  2EU7 X;  1RLB E;  2N93 A;  4I3D A;  1OEJ A;  3WJC A;  3B2H A;  1JV4 A;  4LZU A;  5K06 A;  1BM5 A;  2GC9 A;  3MX7 A;  1TOW A;  1LIE A;  2W2A A;  2PY1 A;  4ZR2 A;  2E4J A;  3NQ9 A;  3D4R A;  2BT9 A;  3EBK A;  1ACD A;  1LIB A;  4XMC A;  4ORY A;  3CR6 A;  3NQK A;  1IKE A;  1CRB A;  4ZH9 A;  3C76 X;  1EI5 A;  4TJZ A;  5HCD C;  1YWB A;  2LBA A;  1HQP A;  4OS0 A;  3IA8 A;  4AZM A;  3KQ0 A;  1IIU A;  5HA1 A;  4GZV A;  1HBP A;  1AEL A;  3WXQ A;  4EEJ A;  1SY2 A;  4MVI A;  2X8S A;  1EQD A;  3APX A;  1YWA A;  1X8O A;  2GTL O;  3NBX X;  1FE3 A;  1DC9 A;  3OJY C;  3VPJ E;  2ACO A;  1YWC A;  5L8N A;  1XCA A;  2RCT A;  1KQW A;  4GH7 A;  1LID A;  3UEX A;  1IFC A;  2OVS A;  3P6H A;  3T1D A;  4HWM A;  5HZ6 A;  1VYG A;  2ANS A;  1KT6 A;  3OE3 A;  4QZU A;  3FEP A;  4GDZ A;  1GT4 A;  1X8P A;  4O3Z A;  1QY2 A;  1EAL A;  3UEV A;  2NNQ A;  1KZW A;  4K19 A;  3VU1 A;  4FQB B;  2FS6 A;  1GT3 A;  4M6S A;  3ZWE A;  4QYP A;  2RN4 A;  4QAE A;  4NLI A;  3KFI A;  1CBR A;  4YFQ A;  3UEU A;  1GX8 A;  1JJJ A;  1BSY A;  4LKT A;  1OPB A;  4ORW A;  5C0N A;  3NR3 A;  4GKC A;  2G78 A;  1LIC A;  4A1H A;  1MX7 A;  5F6Z A;  1E00 A;  1ZNK A;  4O49 A;  1KT3 A;  1GT1 A;  1G85 A;  1GX9 A;  1GT5 A;  3O22 A;  3PEC A;  2LBV A;  4IB8 A;  5EDB A;  2X8T A;  3OBL A;  2X8F A;  3FR5 A;  4WFU A;  1SXU A;  5KID A;  2JU8 A;  1NP4 A;  2LFO A;  3H3I A;  1G5W A;  5AJB A;  4U8U O;  1JYD A;  5JR8 A;  1DF3 A;  4I95 A;  4A8Z A;  4OMX A;  4DQ3 A;  3HWF A;  3UEW A;  1SXW A;  3BU1 A;  1HMR A;  3JQO A;  2LKK A;  5HA0 A;  1LFO A;  2FLJ A;  1EII A;  2WUT A;  1BRP A;  3BSZ E;  4ID2 A;  3WBG A;  1CBI A;  1SXX A;  3S5V A;  3TGC A;  1S44 A;  3ELX A;  1KZX A;  1X89 A;  1GKA B;  1ERB A;  5F6B A;  4IMN A;  4IB6 A;  4IAX A;  1B0O A;  1LIF A;  2LA7 A;  2Q2P A;  5KHP A;  1OEE A;  4Y0S A;  5EED A;  1JBH A;  3ZW0 A;  5LKE A;  2R73 A;  5EZ2 A;  4YFP A;  2JOZ A;  1KQX A;  2QMI A;  4LZV A;  4NNT A;  1FTP A;  2ZAG A;  3F9D A;  4INN A;  4AZO A;  3PH5 A;  2ACP X;  4LKP A;  3VG5 A;  4UU3 A;  1NGL A;  1I04 A;  5FEN A;  1MDC A;  2WR6 A;  4CSB A;  1CJ5 A;  4A1Y A;  3FMZ A;  1O8V A;  1QQS A;  3D95 A;  2Z4I A;  4O4X A;  4RUN A;  1OBQ A;  4EQA C;  4QQ1 A;  2Z4H A;  2CZU A;  4AZN A;  3RSW A;  4O9S A;  1PBO A;  1EPA A;  2POA A;  1H91 A;  4O3W A;  2FS7 A;  3VG4 A;  5H9N A;  1B8E A;  1SY3 A;  3NPO A;  2JW1 A;  1AQB A;  1ICM A;  1PEE A;  2FR2 A;  1T68 X;  4LQZ A;  3CQN A;  3JS1 A;  3ZQ3 A;  4U9C A;  4XMF A;  1VPR A;  4N7C A;  2K23 A;  4A60 A;  5HCC C;  5FFH A;  1ZNL A;  3U03 A;  3P6D A;  4NW4 A;  4L1N A;  3VG3 A;  2O62 A;  2WQA E;  3BX7 A;  3CMP A;  4YKM A;  1LKE A;  2CBR A;  2JMB A;  4PJ2 A;  2GTF X;  3ELZ A;  5AQ6 A;  2FTB A;  1MX8 A;  3SAO A;  3AKM A;  4M7M A;  4FBV A;  2P8G A;  2MM3 A;  2JN3 A;  1EW3 A;  4GRJ A;  3ZW1 B;  2KT4 B;  1N0S A;  3L4R A;  3P02 A;  3MVF A;  3U0D A;  5HTE A;  4XMG A;  2FRS A;  5D4A A;  2X46 A;  3VG7 A;  3I17 A;  2A13 A;  5HWZ A;  1FEM A;  1FEN A;  1B4M A;  3WJE A;  5D8J A;  3RBY A;  1TW4 A;  3PPT A;  2OFR X;  4ZHH A;  1SY0 A;  4TQ2 A;  3BX8 A;  2CZT A;  1Y9T A;  1MUP A;  1O1U A;  1S7D A;  3Q6L A;  1JIW I;  1SA8 A;  4ML7 B;  4KII A;  2KD2 A;  1R0U A;  4QYN A;  4Y0R A;  5F58 A;  3LV4 A;  1XKI A;  3P6F A;  3P6C A;  1TOU A;  2G7B A;  4YCH A;  1T8V A;  3CBS A;  4GNW A;  5D48 A;  1I05 A;  3D96 A;  3VG2 A;  2G79 A;  3WJD A;  5BYP A;  1EIO A;  5LJK A;  3KFH A;  2AT6 X;  1U18 A;  1PMP A;  1YUP A;  2XST A;  4ON1 A;  3GE2 A;  1QY1 A;  2RQ0 A;  1BEB A;  4MIR A;  2NP1 A;  1L6M A;  4WBK A;  2BS5 A;  2QOS C;  4NYR A;  1CBQ A;  1AVG I;  1ERX A;  4ZH6 A;  4KCA A;  3SOT A;  4ZCB A;  1JZU A;  4WFV A;  1CBS A;  1ZNH A;  4HPA A;  1TXL A;  1KT5 A;  5D45 A;  4O3X B;  2HZR A;  3WVM A;  1RBP A;  1U0X A;  4IAB A;  2XKL A;  5FQ7 E;  2Q9S A;  3UAQ A;  3HWG A;  4HFO A;  4MIS A;  2AT3 X;  2AT5 X;  4IB9 A;  2MHD A;  3PQU A;  2Q39 A;  2YG2 A;  1G74 A;  2K62 A;  1D3S A;  1DZJ A;  1GXA A;  4ORR A;  2HZQ A;  4IAW A;  4OMW A;  2HMB A;  3APU A;  2GJ5 A;  3QKG A;  4ODD A;  5BVQ A;  2W2F A;  3PH6 A;  4YDB A;  5HAE A;  1QFT A;  3HTY A;  2WSJ A;  1BLR A;  1ZRY A;  1KT4 A;  1QFV A;  1TVQ A;  3P6G A;  4I3C A;  5HTD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...