4I9SA

Crystal structure of the r111k:r132l:y134f:t54v:r59w mutant of the cellular retinoic acid binding protein type ii in complex with all-trans retinal at 2.58 angstrom resolution
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
137
structure length
137
Chain Sequence
PNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKVSTTVWTTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTKELTNDGELILTMTADDVVCTLVFVRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cellular retinoic acid-binding protein 2
publication title Rational Design of a Colorimetric pH Sensor from a Soluble Retinoic Acid Chaperone.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 32
structure length 137
sequence length 137
ec nomenclature
pdb deposition date 2012-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 4i9sA00
3P6DA 5IO6A 4AW8A 2WR6A 1D2UA 1EXSA 1G85A 3APVA 3CBSA 3FELA 2WWPA 2POAA 4ES7A 1ZNEA 3NR3A 1KT6A 3UEVA 4ZHDA 4ZJ0A 4M7MA 4NP1A 1ZNGA 1MVGA 4EXZA 2NNEA 1X8NA 4ORWA 4BVMA 1TOUA 1DZMA 4ALBA 2FR2A 1EUOA 4AZQA 1JJJA 2Q9SA 5C0NA 2FWVA 3FEKA 1DFVA 1I05A 3ZUOA 1QFVA 2LBAA 4R0BA 1FTPA 4YBPA 1I04A 1N0SA 4D6AA 4XMDA 3I17A 1RLBE 1YWCA 2L9CA 4ORYA 3F8AA 1XKIA 2Q2PA 3C77X 4IBAA 1DF3A 5L8IA 3NX1A 2PY1A 3BSZE 2Q2MA 5EZ2A 3B2HA 1LKEA 5HCEC 3TF6A 3KFIA 4EDEA 1MX7A 1X8UA 4XMFA 1BSYA 1SY1A 1X8OA 3BU1A 3FENA 1S2PA 4YH0A 2AT0X 3CWKA 4YFPA 3FIQA 4QYPA 2FT9A 2WSJA 3PECA 1O1VA 5H9LA 1KT7A 4QGXA 1O1UA 4ARHA 2BLGA 5H8TA 5HAEA 3P6CA 2O62A 4IMNA 2G78A 1CRBA 4I3DA 1B8EA 4IB7A 5LJCA 1PM1X 2QO6A 4ZHCA 4EEJA 2WUTA 5BVTA 1A57A 3F9DA 3L4RA 5K06A 3CQNA 2NNDA 2NP1A 3NQ3A 4IAWA 2IFBA 2CBRA 3DTQA 3NP1A 5DG4A 5EDCA 1TW4A 2HZQA 3KFFA 3C76X 1BWYA 2QM9A 1IKJA 1JYJA 1ICNA 2CM4A 1UZ2X 1JBHA 3U03A 1ERBA 1SY2A 4Y0QA 2WQ9A 4ZR2A 3OJYC 5LJKA 4GH7A 2QO5A 3WBGA 5B29A 4OS3A 3BU9A 3U9PC 4WFUA 4BOEA 4HPAA 1AVGI 1TOWA 1YWDA 1B0OA 3RZYA 1I4UA 2R56A 4AZPA 3TZSA 4I9RA 1SA8A 1NGLA 1YP6A 4YBUA 3GAQA 3Q6LA 1FEMA 1RBPA 1HMSA 3B2KA 4QGVA 3TGBA 1LPJA 1GKAB 2W2BA 3MBTA 3TGCA 3G7XA 4XMEA 3WJFA 3FLLA 3D96A 3BX8A 5EEEA 1VPRA 1ZNKA 1ZRYA 4MVLA 4WFVA 4YGZA 3WJCA 1DZPA 3BY0A 1VYFA 4DQ4A 1ML7A 4ORSA 2W2AA 5DPQA 4ZHFA 1HMTA 1T68X 2AT8X 1KZWA 1T0VA 5HWZA 3IFBA 1DV9A 1IIUA 1HQPA 1OBUA 4NNTA 4TKBA 2LFOA 5IO7A 5F6ZA 1QABE 3FMZA 1KQXA 3ZQ3A 3ELZA 2HZRA 3APUA 1X89A 3KZAA 3B2LA 5HZ6A 1LNMA 4GETA 4IB8A 2MM3A 4HPBA 1LICA 5LJGA 1FE3A 2E4JA 1ACDA 4ZH6A 1AQBA 5IO5A 1BRQA 2AT6X 1DC9A 3P6EA 5HZ8A 3EBWA 2CZUA 2P8GA 1GT4A 2CBSA 2OFRX 2KT4B 3VG4A 2A0AA 1E5PA 2JU8A 1KQWA 5AQ6A 2XSTA 1E06A 1MDCA 1E00A 3WJDA 1XCAA 3UEWA 2WQAE 1JYDA 1S44A 2GJ5A 4YGHA 3T1DA 1IW2A 2OFMX 5EPQA 4O9SA 1JZUA 1LF7A 4ZHGA 1L6MA 2R73A 4TJZA 1ZNHA 3ZUIA 1EPBA 4D6BA 2AMMX 1SXYA 1TXLA 2MO5A 3C78X 1CBSA 3B2IA 1BJ7A 3AKMA 4RUNA 4IB9A 1GM6A 5LJEA 4YFRA 1P6PA 1LIEA 1BSQA 2DM5A 4AZOA 3FR2A 4XMCA 3AKNA 5HA0A 4AZRA 4XMHA 1X71A 2HLVA 4YKOA 4YKMA 4CK4A 4TLJA 4I3BA 1QY2A 2R74A 5EDBA 1PBOA 2ACPX 4ORUA 4YGGA 4BQUA 3B2JA 5D45A 3P6HA 4A60A 1FENA 2K23A 2LB6A 1KT5A 3STNA 1IKEA 2YG2A 3PH6A 2X46A 1BLRA 4QYNA 2JU7A 4HPCA 2Q4NA 1HN2A 3FA9A 4PSQA 2JOZA 4A1HA 3CR6A 1QWDA 5L8NA 2HYSA 3VG7A 3EMMA 1KT4A 1HBQA 5JR8A 2ACOA 5F1EA 1BRPA 5HTDA 1GT3A 1A3YA 2MJIA 2FR3A 1LFOA 3BLGA 4OS0A 3U0DA 4QZTA 5L8OA 3BRNA 5FENA 1ICMA 1DZKA 5CE4A 5F6BA 4TNNA 3HK1A 1HMRA 3O2YA 3PH5A 1OEEA 3WVMA 4TKHA 1SXWA 1SY0A 2AH7X 4XMGA 4YMYA 4N7CA 2LBVA 2AT3X 3HWFA 5LKEA 3KQ0A 1CBIA 1YWAA 1GKAA 1FDQA 1EIIA 5FFHA 1SXUA 3P6FA 3SAOA 1D3SA 4GE1A 5F7GA 3IA8A 4ZCBA 4YCHA 2RD7C 4Y0RA 2RCTA 1VYGA 5H9AA 3FW5A 1PEEA 1CJ5A 3NPOA 2JU3A 4QAEA 4GNWA 4ZFXA 3PEDA 5H9NA 1ADLA 3FR5A 4AZNA 1B56A 4A8ZA 2K62A 3VG3A 5KIDA 1GT1A 1AB0A 4YFQA 1KXOA 2FRSA 1MX8A 2QOSC 2FS6A 1T8VA 1IFBA 5H9KA 2A2UA 2RCQA 3HWEA 4RUUA 2RA6A 1X8PA 3K3LA 1FELA 3NADA 4ORRA 5D4AA 1O8VA 3BDRA 2HMBA 3CQRA 1YP7A 3FA7A 1NP4A 3NX2A 2WEXA 4HPDA 1GX9A 3STMX 2FTBA 1BEBA 1S7DA 5B27A 4NLIA 2OZQA 2ASNX 1YUPA 1GGLA 1G74A 1PMPA 5HZ5A 3UEXA 4WBKA 1BM5A 1I06A 4LKPA 2AT5X 4I9SA 2ANSA 1Z24A 2A13A 2X45A 1MUPA 1OPBA 1H91A 1HBPA 3KFHA 2LKKA 3NQ9A 1LIDA 3JS1A 3APXA 5HCCC 1KGLA 1QY1A 1KT3A 1BSOA 2FLJA 2NNQA 3EBKA 5LJDA 1OEKA 3UEUA 3WJBA 3PP6A 5KICA 2Q39A 2QO4A 1LIBA 3RSWA 4LZUA 1QY0A 3O22A 3STKA 1IFCA 4IAXA 2L5PA 3FEPA 5D47A 2OVDA 4K19A 1GX8A 4A1YA 3APWA 3QKGA 4IB6A 4OMXA 4ZGUA 2AL0X 1E02A 1QG5A 1U18A 2GC9A 2CZTA 5HCDC 4ALOA 1R0UA 4AYHA 2G7BA 2WEWA 4LKTA 1GT5A 4QZUA 3FW4A 4Y0SA 1X8QA 3JSQA 2KTDA 2HNXA 1AELA 1OEJA 4ZHHA 2F73A 3D95A 1JV4A 4YDBA 2A3FX 3I0AA 2A2GA 2L68A 2JN3A 3HWGA 4UU2A 4GKCA 3WJEA 3S26A 1CBQA 1ALBA 4EFGA 4MVKA 5HZ9A 1TVQA 4NLJA 2EU7X 3EM0A 1ZNLA 4UU3A 2G79A 3FR4A 3O19A 1EQDA 1OBPA 4M6SA 4YDAA 1EIOA 4AZMA 2AKQA 4ORXA 5BVSA 5HTEA 3FA8A 3DSZA 1CBRA 5KHPA 1OBQA 1YWBA 4YCEA 5LJBA 4I3CA 3BX7A 4GNYA 5HA1A 3CMPA 5HZQA 2GTFX 4NNSA 4NYRA 2N93A 3ELXA 3KFGA 3WXQA 4ZH9A 1U17A 1B4MA 3TGAA 5FAZA 1UREA 4OMWA 1JJXA 3PPTA 4OS8A 3P6GA 3EYCA 4ODDA 5BVQA 1NP1A 4TQ2A 3VG2A 4IMOA 4Y0PA 3D97A 4GRJA 1EPAA 4KIIA 4HFOA 1EW3A 2ALLX 1OPAA 1YIVA 2OVEA 3FA6A 4QGWA 2XKLA 5F58A 3CBCA 1ZNDA 5D8JA 2L67A 1G7NA 1A2DA 5LKFA 5HBSA 5EEDA 4TKJA 3VG5A 1EALA 2W2FA 1LIFA 1G5WA 3BS2A 3VG6A 1A18A 4N7DA 1QQSA 1ERXA 5D48A 1QFTA 4MVIA 1BBPA 3HWDA 1SY3A 1SXXA 2OVAA 3MVFA 4DQ3A 2CM9A 2FS7A 1U0XA 2RQ0A 1KZXA 4LZVA 4NYQA 5LJHA 1GXAA 1KOIA 1DZJA 3WJGA
chains in the Genus database with same CATH superfamily
3P6DA 5IO6A 4AW8A 2WR6A 1D2UA 1EXSA 1JMXA 1G85A 3APVA 3CBSA 3FELA 3PDFA 3ZW1A 2WWPA 2POAA 1Y0GA 1ZNEA 2BHVA 3NR3A 1KT6A 1VWRB 4ES7A 3UEVA 2UYWA 4ZHDA 4M7MA 4ZJ0A 4NP1A 1ZNGA 1MVGA 1SLDB 4EXZA 1LELA 3VU1A 2NNEA 1X8NA 1N43A 4ORWA 4BVMA 1TOUA 1VWMB 1DZMA 1MM9A 4O3WA 2Y32A 4ALBA 2FR2A 1STSB 1EUOA 4Z28A 4AZQA 2QCBA 1JJJA 2Q9SA 5C0NA 1RSUB 4MIRA 2FWVA 3HOLA 3FEKA 3HPEA 1DFVA 1I05A 3ZUOA 1QFVA 4JO6A 3SLJA 4O49A 2LBAA 4R0BA 1FTPA 1SREA 4YBPA 1N4JA 1I04A 1N0SA 4D6AA 4XMDA 1NQMA 5K68A 3T6FA 4U3QA 3P24A 2RTGB 1MOYA 2IZDB 3I17A 1RLBE 1YWCA 2L9CA 2CAMA 2C1QA 4ORYA 3F8AA 1XKIA 2Q2PA 3C77X 4IBAA 4FBRA 1DF3A 2M4LA 5L8IA 2OF9A 3NX1A 2IZJA 1VWNB 2PY1A 1N7YA 2Q2MA 1SWDA 3BSZE 3B2HA 2VFCA 5EZ2A 1LDOA 1LKEA 3PQSA 5HCEC 3TF6A 3KFIA 4EDEA 1MX7A 1X8UA 4XMFA 1BSYA 1SY1A 1X8OA 3BU1A 2GTLN 3FENA 1S2PA 4YH0A 2AT0X 3CWKA 4YFPA 3FIQA 3PK2A 2LA7A 4CDFA 4QYPA 2FT9A 2WSJA 3PECA 1O1VA 5H9LA 4U46A 4COTA 1KT7A 4QGXA 1O1UA 2G5LA 2BLGA 3N91A 5H8TA 3KVNA 3ZW0B 4ARHA 4EKVA 4GJSA 5HAEA 3P6CA 1VWLB 2O62A 2RTCB 4IMNA 3S5VA 2DJGA 5FQ8E 2G78A 1CRBA 4I3DA 1B8EA 2Z4IA 4IB7A 4Y59A 5LJCA 1PM1X 2BC3A 1VWKB 2QO6A 4EQAC 4ZHCA 4EEJA 3PQUA 2WUTA 4BX5A 5BVTA 1JJUA 1LCZA 2A5BA 1A57A 2AF5A 3F9DA 3L4RA 5K06A 1AVEA 2X32A 3AUMO 3CKFA 3CQNA 4GD9A 2NNDA 3S5XA 5FQ6E 2NP1A 3NQ3A 1SWUA 4DNEA 2DJFA 4IAWA 1SWKA 2IFBA 2KD2A 2RN4A 2CBRA 3DTQA 3NP1A 5DG4A 5EDCA 1TW4A 2HZQA 3EW1A 3C76X 3KFFA 1SRFA 3NBXX 1BWYA 2QM9A 2RTFB 1IKJA 1JYJA 1ICNA 1SWAA 2CM4A 2C4IA 1UZ2X 2ZSCA 4OEMA 3U03A 1JBHA 1ERBA 1SY2A 4FGIB 2GH7A 2WQ9A 2MWHA 4Y0QA 4ZR2A 3OJYC 4ID2A 4Z2OA 4GH7A 2QO5A 3WBGA 5LJKA 5B29A 5IRWA 4OS3A 3BU9A 4QQ1A 4WFUA 3U9PC 4BOEA 3OE3A 4HPAA 1AVGI 1TOWA 1YWDA 3RDXA 4CDDA 2I5ZO 1VWAB 4O4UA 3RY1A 1B0OA 1VWDB 4I6SA 3RZYA 4GU8A 1I4UA 2R56A 4YVBA 1SLEB 2YMSA 4AZPA 3TZSA 4I9RA 2Y3EA 1SA8A 3MX7A 1NGLA 1YP6A 2IZKA 4YBUA 1SMPI 3GAQA 3Q6LA 1FEMA 1Y9TA 1RBPA 2RTAA 1HMSA 3S60A 4BX7A 3B2KA 4QGVA 3TGBA 4ZGFA 1LPJA 1GKAB 2W2BA 3MBTA 3TGCA 1SWJA 2A5CA 3G7XA 4XMEA 3WJFA 3T2WA 3VE1A 3FLLA 3SOTA 4KH8A 3D96A 3BX8A 5EEEA 1VPRA 1ZNKA 1ZRYA 2X56A 4MVLA 4WFVA 4YGZA 3WJCA 1DZPA 2RTOB 1VYFA 3BY0A 3WZNA 3VHHA 4DQ4A 1ML7A 3SZJA 4ORSA 2W2AA 3ZW2A 1RAVA 3RBYA 2RTHB 3OBLA 5DPQA 4BX6B 4O3ZA 4ZHFA 1SWFA 2OY1O 1HQQA 1HMTA 1VWGB 4GJVA 1T68X 2AT8X 1KZWA 1VWCB 2G8CO 1T0VA 5HWZA 2RTKA 3IFBA 1DV9A 1IIUA 1HQPA 1OBUA 4NNTA 1N9YA 4MISA 4TKBA 2LFOA 1LCVA 4Z2PA 5IO7A 2JW1A 2OYBO 5F6ZA 1QABE 3FMZA 1KQXA 2Z4HA 4GGTA 3ELZA 3ZQ3A 2HZRA 4O4SA 3APUA 1X89A 3KZAA 3B2LA 5HZ6A 1LNMA 4GETA 4IB8A 2MM3A 1SRGA 4HPBA 1LICA 5LJGA 1FE3A 3QQ2A 2E4JA 1ACDA 4ZH6A 1AQBA 5IO5A 1BRQA 2AT6X 1DC9A 1K3BA 2QOMA 3P6EA 3EBWA 2CZUA 2P8GA 1GT4A 2CBSA 2UZ2A 5HZ8A 1SWPA 4KT5A 4L3RA 2OFRX 2KT4B 2ZAIA 3SZIA 2A0AA 3VG4A 1E5PA 3FYFA 4GZVA 2JU8A 1KQWA 5AQ6A 2XSTA 3SLTA 1E06A 1SWCA 1MDCA 5L3YA 1E00A 3WJDA 1XCAA 3UEWA 5BYPA 2WQAE 1JYDA 1S44A 2GJ5A 4YGHA 1VWJB 3T1DA 3RDMA 1IW2A 1I9HA 2OFMX 5EPQA 4O9SA 4CPHA 1NC9A 1DF8A 1JZUA 1LF7A 4ZHGA 1LDQA 4JNJA 1L6MA 4QNIA 2R73A 1HY2A 1NBXA 4TJZA 5AJBA 1RSTB 1ZNHA 5JD2A 3ZUIA 1EPBA 4D6BA 2AMMX 2IZIA 1SXYA 1TXLA 4FQBB 3WYPA 2MO5A 3C78X 2IZGB 1CBSA 1VWPB 1BJ7A 3B2IA 1Y55X 3AKMA 4RUNA 2X4MA 3ZW0A 2C1SA 1GM6A 4IB9A 5LJEA 4YFRA 1P6PA 2RTRB 2BS5A 2IZLB 1LIEA 1BSQA 2DM5A 4AZOA 3FR2A 3NQKA 4XMCA 3AKNA 5HA0A 4AZRA 1W4TA 1X71A 1KL5A 2HLVA 4U9CA 4HWMA 4XMHA 4YKMA 4YKOA 4TLJA 3VGWA 3X00A 4I3BA 4CK4A 1JIWI 4Z27A 2OY8A 1QY2A 2R74A 1PTSA 5CYBA 1PBOA 2ACPX 5EDBA 4ORUA 2JMBA 4YGGA 4BQUA 3B2JA 5D45A 1RXKA 3VE2A 3P6HA 4A60A 1FENA 2K23A 2LB6A 5CHKA 1KT5A 4NW4A 1KL4A 3RE6A 3STNA 1IKEA 2YG2A 3PH6A 2X46A 1BLRA 4QYNA 3D4RA 2JU7A 4HPCA 1EI5A 3UAQA 1NQNA 2Q4NA 1HN2A 3FA9A 4PSQA 2JOZA 4C5PA 4A1HA 5B3MO 3CR6A 1QWDA 3ZI8A 2HYSA 3VG7A 5L8NA 3EMMA 1KT4A 2VDFA 1HBQA 5JR8A 2ACOA 4Z6JA 1SWGA 5F1EA 1BRPA 5HTDA 1GT3A 4FBVA 2BT9A 1A3YA 2MJIA 1SWTA 2FR3A 1LFOA 3BLGA 4OS0A 3U0DA 4QZTA 5L8OA 3BRNA 5FENA 1ICMA 4GGZA 1VWQB 3LTWA 1DZKA 5CE4A 4MVEA 5F6BA 4TNNA 1E2TA 2X55A 3HK1A 1HMRA 3EC5A 3O2YA 2A8GA 1OEEA 3PH5A 4BX5B 3HOEA 3WVMA 1Y53X 4TKHA 1SXWA 1SWHA 1SY0A 2AH7X 4BJ8A 1KFFA 4GGRA 2ZAGA 4N7CA 4XMGA 2AT3X 3HWFA 2LBVA 4YMYA 5LKEA 3KQ0A 4I95A 3ZWEA 1CBIA 1STPA 3VG5A 3MM0A 1YWAA 1WBIA 1GKAA 1FDQA 2F09A 5B5FA 1EIIA 5FFHA 1SXUA 3P6FA 3SAOA 3LV4A 4CSBA 1D3SA 2IZEB 5AJCA 3RDQA 4GE1A 4GDAA 5F7GA 3IA8A 5IRAA 1GX3A 2Y3FA 4GK9A 4IRWA 5CSEA 2F01A 4ZCBA 4YCHA 2RD7C 4Y0RA 1VYOA 4B55A 1VWBB 1W6FA 2RCTA 1VYGA 5H9AA 3FW5A 1PEEA 1CJ5A 3NPOA 3RDOA 2JU3A 4QAEA 4GNWA 2IZFB 1FJ1E 3PEDA 1VWIB 1ADLA 5H9NA 4ZFXA 2FKGA 1SWEA 3FR5A 4AZNA 4Z2VA 1B56A 4A8ZA 2FGSA 2K62A 4JGLA 3VG3A 3WYQA 2OL6O 3D9WA 1NDJA 5KIDA 1GT1A 1VWOB 2RTPB 2QMIA 1AB0A 3WOVA 4YFQA 1SWSA 1KXOA 2FRSA 1MX8A 2QOSC 2FS6A 1T8VA 3RE5A 1IFBA 2IZBA 2OVSA 4O4OA 1LCWA 5H9KA 2A2UA 2RCQA 3HWEA 4RUUA 2RA6A 1X8PA 3K3LA 2IZAA 1FELA 2FKJA 3LHNA 2AVIA 3NADA 4ORRA 5D4AA 1MEPA 1O8VA 3AEHA 3BDRA 2HMBA 2OY7A 5B2AO 3CQRA 1HXZA 1YP7A 3FA7A 1NP4A 3NX2A 2WEXA 4HPDA 1GX9A 2RTBB 4Y5DA 1SWQA 3STMX 2FTBA 1BEBA 1S7DA 2X8FA 4U8UM 5B27A 4NLIA 4NV7A 1VWFB 2OZQA 2ASNX 4CDCA 1YUPA 1GGLA 2GTLM 1KL3A 1G74A 1PMPA 3SLOA 3UEXA 4WBKA 5HZ5A 1BM5A 1I06A 3RKGA 3JQOA 3ZW1B 4LKPA 2AT5X 4I9SA 4O3XB 2ANSA 5B10O 1HXLA 1SWLA 3FIDA 1Z24A 2A13A 2X45A 1MUPA 1OPBA 1VWEB 1H91A 1SWOA 2OF8A 2RTIB 1HBPA 3KFHA 2LKKA 3NQ9A 1Y52X 1K24A 1LIDA 1Y9LA 3JS1A 3Q34A 3APXA 1MK5A 3T2XA 5HCCC 1QY1A 4KCAA 1KGLA 5B11O 2OL7A 1KT3A 1BSOA 2FLJA 2NNQA 3EBKA 5LJDA 3E3CA 1OEKA 3UEUA 1SWNA 3PP6A 4PJ2A 3WJBA 2MF6A 2X34A 5KICA 2Q39A 2QO4A 4L1NA 5IXGA 1LIBA 3RSWA 4LZUA 2RTEB 1QY0A 3O22A 3STKA 2IZCB 1IFCA 4IAXA 2BSZA 2L5PA 3FEPA 4MEEA 5D47A 2OVDA 4K19A 1GX8A 4A1YA 3APWA 4BGFA 4GDZA 3QKGA 4IB6A 4OMXA 4KC8A 2FHNX 5FQ7E 4ZGUA 2AL0X 1E02A 4U8UN 4CV7A 1QG5A 1U18A 2IZHB 4O4XA 3T6LA 2HKDA 5K67A 1UYNX 2CZTA 2GC9A 4CPHB 4CPEA 5HCDC 4ALOA 2RTNB 1R0UA 4CPIA 4OELA 4AYHA 3RWXA 2G7BA 2WEWA 4LKTA 1GT5A 4KC7A 4QZUA 3FW4A 4Y0SA 3WZPA 1X8QA 3ZZVA 3FDCA 3JSQA 4FBOA 5AEOA 2WPUA 2KTDA 3RDUA 2HNXA 2MHDA 1AELA 4QRLA 1OEJA 4ZHHA 2F73A 3D95A 1WUBA 3OD9A 1JV4A 2RTMA 4YDBA 2A3FX 3I0AA 2A2GA 2L68A 2JN3A 3HWGA 3V8UA 2RTDB 4UU2A 4GKCA 3WJEA 4U8UO 3S26A 3WZQA 1RXJA 1CBQA 3RY2A 1ALBA 4EFGA 2GTLO 4MVKA 5HZ9A 2RTLA 1TVQA 3F6ZB 4NLJA 4DCBA 2EU7X 3EM0A 1ZNLA 4UU3A 2G79A 3FR4A 2I5VO 4JHQA 4CPFA 3O19A 1EQDA 1JMZA 1OBPA 1W5RA 4M6SA 1SLGB 2KTSA 2KW1A 2RTJA 4YDAA 1EIOA 4AZMA 2AKQA 3VHIA 4LQZA 4ORXA 5BVSA 2OFBA 5HTEA 3FA8A 1I78A 3DSZA 1CBRA 4NV8A 4CDEA 5KHPA 2JGSA 1OBQA 1YWBA 4YCEA 5LJBA 1JQPA 5F2BA 1UYOX 4I3CA 3BX7A 4GNYA 5HA1A 1RXHA 3CMPA 1IJ8A 5HZQA 1SRIA 2GTFX 4NNSA 4NYRA 3HTYA 2N93A 3ELXA 3KFGA 3WXQA 5B5GA 1PBYA 1U17A 4ZH9A 1B4MA 2OY5O 1VWHB 3TGAA 1SWRA 4GUZA 5FAZA 1UREA 4OMWA 1JJXA 4INNA 4BX6A 3PPTA 1LUQA 1SLFB 2X8TA 3P02A 4BBOA 4OS8A 3P6GA 3EYCA 4ODDA 1SRJA 2OL8O 5BVQA 1SWBA 4OKAA 1NP1A 4ML7B 3WZOA 3SZHA 1STRB 3VG2A 3VHMA 4TQ2A 4IMOA 4Y0PA 3D97A 4GRJA 1EPAA 4KIIA 2BS6A 1EW3A 2OFAA 4HFOA 2ALLX 1OPAA 4BCSA 1YIVA 2OVEA 3H3IA 3FA6A 2RTQB 2XKLA 4QGWA 5F58A 3CBCA 1ZNDA 4BX7B 4I60A 5D8JA 2L67A 1G7NA 1A2DA 2VFBA 4O3YA 5EEDA 4IABA 4TKJA 5HBSA 5LKFA 3RDSA 2W2FA 1AVDA 1LIFA 1EALA 1G5WA 3BS2A 3VG6A 3VPJE 1A18A 5IRUA 4N7DA 1QQSA 1ERXA 4ON1A 1OSPO 5D48A 2PI3O 1QFTA 3EW2A 4MVIA 1BBPA 3HWDA 3MG5A 2FHLA 3CKGA 1SY3A 4WHIA 1N9MA 1SXXA 2OVAA 3MVFA 3GE2A 2CM9A 2FS7A 4DQ3A 1U0XA 2RQ0A 1SRHA 2X8SA 1KZXA 4LZVA 4NYQA 5LJHA 1GXAA 1KOIA 1DZJA 3WJGA
chains in the Genus database with same CATH topology
3P6DA 5IO6A 4AW8A 2WR6A 1D2UA 1EXSA 1G85A 3APVA 3CBSA 3FELA 3ZW1A 2WWPA 2POAA 2BHVA 1ZNEA 3NR3A 4ES7A 1KT6A 3UEVA 4ZHDA 4ZJ0A 4M7MA 4NP1A 1ZNGA 1MVGA 4EXZA 3VU1A 2NNEA 1X8NA 4ORWA 4BVMA 1TOUA 1DZMA 4O3WA 4ALBA 2FR2A 1EUOA 4AZQA 1JJJA 2Q9SA 5C0NA 4MIRA 2FWVA 3HOLA 3FEKA 1DFVA 1I05A 3ZUOA 1QFVA 4O49A 2LBAA 4R0BA 1FTPA 4YBPA 1I04A 1N0SA 4D6AA 4XMDA 4U3QA 3P24A 3I17A 1RLBE 1YWCA 2L9CA 4ORYA 3F8AA 1XKIA 2Q2PA 3C77X 4IBAA 4FBRA 1DF3A 2M4LA 5L8IA 3NX1A 2PY1A 3BSZE 2Q2MA 5EZ2A 3B2HA 1LKEA 3PQSA 5HCEC 3TF6A 3KFIA 4EDEA 1MX7A 1X8UA 4XMFA 1BSYA 1SY1A 1X8OA 3BU1A 2GTLN 3FENA 1S2PA 4YH0A 2AT0X 3CWKA 4YFPA 3FIQA 2LA7A 4QYPA 2FT9A 2WSJA 3PECA 1O1VA 5H9LA 4COTA 1KT7A 4QGXA 1O1UA 3N91A 2BLGA 5H8TA 3ZW0B 4ARHA 5HAEA 3P6CA 2O62A 4IMNA 3S5VA 5FQ8E 2G78A 1CRBA 4I3DA 1B8EA 2Z4IA 4IB7A 5LJCA 1PM1X 2QO6A 4EQAC 4ZHCA 4EEJA 3PQUA 2WUTA 5BVTA 1A57A 3F9DA 3L4RA 5K06A 3CQNA 2NNDA 3S5XA 5FQ6E 2NP1A 3NQ3A 4IAWA 2IFBA 2KD2A 2RN4A 2CBRA 3DTQA 3NP1A 5DG4A 5EDCA 1TW4A 2HZQA 3KFFA 3C76X 3NBXX 1BWYA 2QM9A 1IKJA 1JYJA 1ICNA 2CM4A 1UZ2X 1JBHA 3U03A 1ERBA 1SY2A 4FGIB 4Y0QA 2WQ9A 2MWHA 4ZR2A 3OJYC 4ID2A 5LJKA 4GH7A 2QO5A 3WBGA 5B29A 4OS3A 3BU9A 4QQ1A 4WFUA 3U9PC 4BOEA 3OE3A 4HPAA 1AVGI 1TOWA 1YWDA 4O4UA 1B0OA 4I6SA 3RZYA 4GU8A 1I4UA 2R56A 4AZPA 2YMSA 3TZSA 4I9RA 1SA8A 3MX7A 1NGLA 1YP6A 4YBUA 1SMPI 3GAQA 3Q6LA 1FEMA 1Y9TA 1RBPA 1HMSA 3S60A 3B2KA 4QGVA 3TGBA 4ZGFA 1LPJA 1GKAB 2W2BA 3MBTA 3TGCA 3G7XA 4XMEA 3WJFA 3VE1A 3FLLA 3SOTA 4KH8A 3D96A 3BX8A 5EEEA 1VPRA 1ZNKA 1ZRYA 4MVLA 4WFVA 4YGZA 3WJCA 4CSBA 1DZPA 3BY0A 1VYFA 4DQ4A 1ML7A 4ORSA 2W2AA 3ZW2A 3RBYA 3OBLA 5DPQA 4ZHFA 4O3ZA 1HMTA 1T68X 2AT8X 1KZWA 1T0VA 5HWZA 3IFBA 1DV9A 1IIUA 1HQPA 1OBUA 4NNTA 4MISA 4TKBA 2LFOA 5IO7A 2JW1A 5F6ZA 1QABE 3FMZA 1KQXA 2Z4HA 3ZQ3A 3ELZA 2HZRA 4O4SA 3APUA 1X89A 3KZAA 3B2LA 5HZ6A 1LNMA 4GETA 4IB8A 2MM3A 4HPBA 1LICA 5LJGA 1FE3A 2E4JA 1ACDA 4ZH6A 1AQBA 5IO5A 1BRQA 2AT6X 1DC9A 3P6EA 5HZ8A 3EBWA 2CZUA 2P8GA 1GT4A 2CBSA 4KT5A 4L3RA 2OFRX 2KT4B 2ZAIA 3VG4A 2A0AA 1E5PA 3FYFA 4GZVA 2JU8A 1KQWA 5AQ6A 2XSTA 1E06A 1MDCA 1E00A 3WJDA 1XCAA 3UEWA 5BYPA 2WQAE 1JYDA 1S44A 2GJ5A 4YGHA 3T1DA 1IW2A 2OFMX 5EPQA 4O9SA 1JZUA 1LF7A 4ZHGA 1L6MA 4QNIA 2R73A 4TJZA 5AJBA 1ZNHA 3ZUIA 1EPBA 4D6BA 2AMMX 1SXYA 1TXLA 4FQBB 2MO5A 3C78X 1CBSA 3B2IA 1BJ7A 3AKMA 4RUNA 3ZW0A 4IB9A 1GM6A 5LJEA 4YFRA 1P6PA 2BS5A 1LIEA 1BSQA 2DM5A 4AZOA 3FR2A 3NQKA 4XMCA 3AKNA 5HA0A 4AZRA 4XMHA 1X71A 2HLVA 4U9CA 4YKOA 4HWMA 4YKMA 4CK4A 4TLJA 4I3BA 1JIWI 1QY2A 2R74A 5CYBA 5EDBA 1PBOA 2ACPX 4ORUA 2JMBA 4YGGA 4BQUA 3B2JA 5D45A 3VE2A 3P6HA 4A60A 1FENA 2K23A 2LB6A 1KT5A 4NW4A 3STNA 1IKEA 2YG2A 3PH6A 2X46A 1BLRA 4QYNA 3D4RA 2JU7A 4HPCA 1EI5A 3UAQA 2Q4NA 1HN2A 3FA9A 4PSQA 2JOZA 4A1HA 3CR6A 1QWDA 3ZI8A 2HYSA 3VG7A 5L8NA 3EMMA 1KT4A 1HBQA 5JR8A 2ACOA 5F1EA 1BRPA 5HTDA 1GT3A 4FBVA 2BT9A 1A3YA 2MJIA 2FR3A 1LFOA 3BLGA 4OS0A 3U0DA 4QZTA 5L8OA 3BRNA 5FENA 1ICMA 1DZKA 5CE4A 4MVEA 5F6BA 4TNNA 3HK1A 1HMRA 3O2YA 3PH5A 1OEEA 3HOEA 3WVMA 4TKHA 1SXWA 1SY0A 2AH7X 4XMGA 4YMYA 2ZAGA 4N7CA 2LBVA 2AT3X 3HWFA 5LKEA 3KQ0A 4I95A 3ZWEA 1CBIA 1YWAA 1GKAA 1FDQA 2F09A 1EIIA 5FFHA 1SXUA 3P6FA 3SAOA 3LV4A 1D3SA 5AJCA 4GE1A 5F7GA 3IA8A 4GK9A 4ZCBA 4YCHA 2RD7C 4Y0RA 2RCTA 1VYGA 5H9AA 3FW5A 1PEEA 1CJ5A 3NPOA 2JU3A 4QAEA 4GNWA 4ZFXA 3PEDA 5H9NA 1ADLA 3FR5A 4AZNA 1B56A 4A8ZA 4JGLA 2K62A 3VG3A 5KIDA 1GT1A 2QMIA 1AB0A 3WOVA 4YFQA 1KXOA 2FRSA 1MX8A 2QOSC 2FS6A 1T8VA 1IFBA 2OVSA 4O4OA 5H9KA 2A2UA 2RCQA 3HWEA 4RUUA 2RA6A 1X8PA 3K3LA 1FELA 3LHNA 3NADA 4ORRA 5D4AA 1O8VA 3BDRA 2HMBA 3CQRA 1YP7A 3FA7A 1NP4A 3NX2A 2WEXA 4HPDA 1GX9A 3STMX 2FTBA 1BEBA 1S7DA 2X8FA 4U8UM 5B27A 4NLIA 2OZQA 2ASNX 1YUPA 1GGLA 2GTLM 1G74A 1PMPA 5HZ5A 3UEXA 4WBKA 1BM5A 1I06A 3RKGA 3JQOA 3ZW1B 4LKPA 2AT5X 4I9SA 4O3XB 2ANSA 1Z24A 2A13A 2X45A 1MUPA 1OPBA 1H91A 1HBPA 3KFHA 2LKKA 3NQ9A 1LIDA 1Y9LA 3JS1A 3APXA 5HCCC 1KGLA 1QY1A 4KCAA 2NNQA 1BSOA 1KT3A 2FLJA 3EBKA 5LJDA 3E3CA 1OEKA 3UEUA 3WJBA 3PP6A 4PJ2A 5KICA 2Q39A 2QO4A 4L1NA 1LIBA 3RSWA 4LZUA 1QY0A 3O22A 3STKA 1IFCA 4IAXA 2L5PA 3FEPA 5D47A 2OVDA 4K19A 1GX8A 4A1YA 3APWA 4GDZA 3QKGA 4IB6A 4OMXA 4KC8A 5FQ7E 4ZGUA 2AL0X 1E02A 4U8UN 4CV7A 1QG5A 1U18A 4O4XA 2GC9A 2CZTA 5HCDC 4ALOA 1R0UA 4AYHA 3RWXA 2G7BA 2WEWA 4LKTA 1GT5A 4KC7A 4QZUA 3FW4A 4Y0SA 1X8QA 3ZZVA 3JSQA 4FBOA 5AEOA 2KTDA 2HNXA 2MHDA 1AELA 4QRLA 1OEJA 4ZHHA 2F73A 3D95A 3OD9A 1JV4A 4YDBA 2A3FX 3I0AA 2A2GA 2L68A 2JN3A 3HWGA 3V8UA 4UU2A 4GKCA 3WJEA 4U8UO 3S26A 1CBQA 1ALBA 4EFGA 2GTLO 4MVKA 5HZ9A 1TVQA 3F6ZB 4NLJA 2EU7X 3EM0A 1ZNLA 4UU3A 2G79A 3FR4A 3O19A 1EQDA 1OBPA 4M6SA 4YDAA 2KTSA 2KW1A 1EIOA 4AZMA 2AKQA 4LQZA 4ORXA 5BVSA 5HTEA 3FA8A 3DSZA 1CBRA 5KHPA 1OBQA 1YWBA 4YCEA 5LJBA 4I3CA 3BX7A 4GNYA 5HA1A 3CMPA 5HZQA 2GTFX 4NNSA 4NYRA 3HTYA 2N93A 3ELXA 3KFGA 3WXQA 4ZH9A 1U17A 1B4MA 3TGAA 5FAZA 1UREA 4OMWA 1JJXA 4INNA 3PPTA 2X8TA 3P02A 4OS8A 3P6GA 3EYCA 4ODDA 5BVQA 1NP1A 4ML7B 4TQ2A 3VG2A 4IMOA 4Y0PA 3D97A 4GRJA 1EPAA 4KIIA 2BS6A 1EW3A 4HFOA 2ALLX 1OPAA 1YIVA 2OVEA 3H3IA 3FA6A 4QGWA 2XKLA 5F58A 3CBCA 1ZNDA 5D8JA 2L67A 1G7NA 1A2DA 4O3YA 5HBSA 5EEDA 4IABA 4TKJA 5LKFA 3VG5A 1EALA 2W2FA 1LIFA 1G5WA 3BS2A 3VG6A 3VPJE 1A18A 4N7DA 1QQSA 1ERXA 4ON1A 5D48A 1QFTA 4MVIA 1BBPA 3HWDA 1SY3A 4WHIA 1SXXA 2OVAA 3MVFA 3GE2A 2CM9A 2FS7A 4DQ3A 1U0XA 2RQ0A 2X8SA 1KZXA 4LZVA 4NYQA 5LJHA 1GXAA 1KOIA 1DZJA 3WJGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P6D A;  5IO6 A;  4AW8 A;  2WR6 A;  1D2U A;  1EXS A;  1G85 A;  3APV A;  3CBS A;  3FEL A;  2WWP A;  2POA A;  4ES7 A;  1ZNE A;  3NR3 A;  1KT6 A;  3UEV A;  4ZHD A;  4ZJ0 A;  4M7M A;  4NP1 A;  1ZNG A;  1MVG A;  4EXZ A;  2NNE A;  1X8N A;  4ORW A;  4BVM A;  1TOU A;  1DZM A;  4ALB A;  2FR2 A;  1EUO A;  4AZQ A;  1JJJ A;  2Q9S A;  5C0N A;  2FWV A;  3FEK A;  1DFV A;  1I05 A;  3ZUO A;  1QFV A;  2LBA A;  4R0B A;  1FTP A;  4YBP A;  1I04 A;  1N0S A;  4D6A A;  4XMD A;  3I17 A;  1RLB E;  1YWC A;  2L9C A;  4ORY A;  3F8A A;  1XKI A;  2Q2P A;  3C77 X;  4IBA A;  1DF3 A;  5L8I A;  3NX1 A;  2PY1 A;  3BSZ E;  2Q2M A;  5EZ2 A;  3B2H A;  1LKE A;  5HCE C;  3TF6 A;  3KFI A;  4EDE A;  1MX7 A;  1X8U A;  4XMF A;  1BSY A;  1SY1 A;  1X8O A;  3BU1 A;  3FEN A;  1S2P A;  4YH0 A;  2AT0 X;  3CWK A;  4YFP A;  3FIQ A;  4QYP A;  2FT9 A;  2WSJ A;  3PEC A;  1O1V A;  5H9L A;  1KT7 A;  4QGX A;  1O1U A;  4ARH A;  2BLG A;  5H8T A;  5HAE A;  3P6C A;  2O62 A;  4IMN A;  2G78 A;  1CRB A;  4I3D A;  1B8E A;  4IB7 A;  5LJC A;  1PM1 X;  2QO6 A;  4ZHC A;  4EEJ A;  2WUT A;  5BVT A;  1A57 A;  3F9D A;  3L4R A;  5K06 A;  3CQN A;  2NND A;  2NP1 A;  3NQ3 A;  4IAW A;  2IFB A;  2CBR A;  3DTQ A;  3NP1 A;  5DG4 A;  5EDC A;  1TW4 A;  2HZQ A;  3KFF A;  3C76 X;  1BWY A;  2QM9 A;  1IKJ A;  1JYJ A;  1ICN A;  2CM4 A;  1UZ2 X;  1JBH A;  3U03 A;  1ERB A;  1SY2 A;  4Y0Q A;  2WQ9 A;  4ZR2 A;  3OJY C;  5LJK A;  4GH7 A;  2QO5 A;  3WBG A;  5B29 A;  4OS3 A;  3BU9 A;  3U9P C;  4WFU A;  4BOE A;  4HPA A;  1AVG I;  1TOW A;  1YWD A;  1B0O A;  3RZY A;  1I4U A;  2R56 A;  4AZP A;  3TZS A;  4I9R A;  1SA8 A;  1NGL A;  1YP6 A;  4YBU A;  3GAQ A;  3Q6L A;  1FEM A;  1RBP A;  1HMS A;  3B2K A;  4QGV A;  3TGB A;  1LPJ A;  1GKA B;  2W2B A;  3MBT A;  3TGC A;  3G7X A;  4XME A;  3WJF A;  3FLL A;  3D96 A;  3BX8 A;  5EEE A;  1VPR A;  1ZNK A;  1ZRY A;  4MVL A;  4WFV A;  4YGZ A;  3WJC A;  1DZP A;  3BY0 A;  1VYF A;  4DQ4 A;  1ML7 A;  4ORS A;  2W2A A;  5DPQ A;  4ZHF A;  1HMT A;  1T68 X;  2AT8 X;  1KZW A;  1T0V A;  5HWZ A;  3IFB A;  1DV9 A;  1IIU A;  1HQP A;  1OBU A;  4NNT A;  4TKB A;  2LFO A;  5IO7 A;  5F6Z A;  1QAB E;  3FMZ A;  1KQX A;  3ZQ3 A;  3ELZ A;  2HZR A;  3APU A;  1X89 A;  3KZA A;  3B2L A;  5HZ6 A;  1LNM A;  4GET A;  4IB8 A;  2MM3 A;  4HPB A;  1LIC A;  5LJG A;  1FE3 A;  2E4J A;  1ACD A;  4ZH6 A;  1AQB A;  5IO5 A;  1BRQ A;  2AT6 X;  1DC9 A;  3P6E A;  5HZ8 A;  3EBW A;  2CZU A;  2P8G A;  1GT4 A;  2CBS A;  2OFR X;  2KT4 B;  3VG4 A;  2A0A A;  1E5P A;  2JU8 A;  1KQW A;  5AQ6 A;  2XST A;  1E06 A;  1MDC A;  1E00 A;  3WJD A;  1XCA A;  3UEW A;  2WQA E;  1JYD A;  1S44 A;  2GJ5 A;  4YGH A;  3T1D A;  1IW2 A;  2OFM X;  5EPQ A;  4O9S A;  1JZU A;  1LF7 A;  4ZHG A;  1L6M A;  2R73 A;  4TJZ A;  1ZNH A;  3ZUI A;  1EPB A;  4D6B A;  2AMM X;  1SXY A;  1TXL A;  2MO5 A;  3C78 X;  1CBS A;  3B2I A;  1BJ7 A;  3AKM A;  4RUN A;  4IB9 A;  1GM6 A;  5LJE A;  4YFR A;  1P6P A;  1LIE A;  1BSQ A;  2DM5 A;  4AZO A;  3FR2 A;  4XMC A;  3AKN A;  5HA0 A;  4AZR A;  4XMH A;  1X71 A;  2HLV A;  4YKO A;  4YKM A;  4CK4 A;  4TLJ A;  4I3B A;  1QY2 A;  2R74 A;  5EDB A;  1PBO A;  2ACP X;  4ORU A;  4YGG A;  4BQU A;  3B2J A;  5D45 A;  3P6H A;  4A60 A;  1FEN A;  2K23 A;  2LB6 A;  1KT5 A;  3STN A;  1IKE A;  2YG2 A;  3PH6 A;  2X46 A;  1BLR A;  4QYN A;  2JU7 A;  4HPC A;  2Q4N A;  1HN2 A;  3FA9 A;  4PSQ A;  2JOZ A;  4A1H A;  3CR6 A;  1QWD A;  5L8N A;  2HYS A;  3VG7 A;  3EMM A;  1KT4 A;  1HBQ A;  5JR8 A;  2ACO A;  5F1E A;  1BRP A;  5HTD A;  1GT3 A;  1A3Y A;  2MJI A;  2FR3 A;  1LFO A;  3BLG A;  4OS0 A;  3U0D A;  4QZT A;  5L8O A;  3BRN A;  5FEN A;  1ICM A;  1DZK A;  5CE4 A;  5F6B A;  4TNN A;  3HK1 A;  1HMR A;  3O2Y A;  3PH5 A;  1OEE A;  3WVM A;  4TKH A;  1SXW A;  1SY0 A;  2AH7 X;  4XMG A;  4YMY A;  4N7C A;  2LBV A;  2AT3 X;  3HWF A;  5LKE A;  3KQ0 A;  1CBI A;  1YWA A;  1GKA A;  1FDQ A;  1EII A;  5FFH A;  1SXU A;  3P6F A;  3SAO A;  1D3S A;  4GE1 A;  5F7G A;  3IA8 A;  4ZCB A;  4YCH A;  2RD7 C;  4Y0R A;  2RCT A;  1VYG A;  5H9A A;  3FW5 A;  1PEE A;  1CJ5 A;  3NPO A;  2JU3 A;  4QAE A;  4GNW A;  4ZFX A;  3PED A;  5H9N A;  1ADL A;  3FR5 A;  4AZN A;  1B56 A;  4A8Z A;  2K62 A;  3VG3 A;  5KID A;  1GT1 A;  1AB0 A;  4YFQ A;  1KXO A;  2FRS A;  1MX8 A;  2QOS C;  2FS6 A;  1T8V A;  1IFB A;  5H9K A;  2A2U A;  2RCQ A;  3HWE A;  4RUU A;  2RA6 A;  1X8P A;  3K3L A;  1FEL A;  3NAD A;  4ORR A;  5D4A A;  1O8V A;  3BDR A;  2HMB A;  3CQR A;  1YP7 A;  3FA7 A;  1NP4 A;  3NX2 A;  2WEX A;  4HPD A;  1GX9 A;  3STM X;  2FTB A;  1BEB A;  1S7D A;  5B27 A;  4NLI A;  2OZQ A;  2ASN X;  1YUP A;  1GGL A;  1G74 A;  1PMP A;  5HZ5 A;  3UEX A;  4WBK A;  1BM5 A;  1I06 A;  4LKP A;  2AT5 X;  4I9S A;  2ANS A;  1Z24 A;  2A13 A;  2X45 A;  1MUP A;  1OPB A;  1H91 A;  1HBP A;  3KFH A;  2LKK A;  3NQ9 A;  1LID A;  3JS1 A;  3APX A;  5HCC C;  1KGL A;  1QY1 A;  1KT3 A;  1BSO A;  2FLJ A;  2NNQ A;  3EBK A;  5LJD A;  1OEK A;  3UEU A;  3WJB A;  3PP6 A;  5KIC A;  2Q39 A;  2QO4 A;  1LIB A;  3RSW A;  4LZU A;  1QY0 A;  3O22 A;  3STK A;  1IFC A;  4IAX A;  2L5P A;  3FEP A;  5D47 A;  2OVD A;  4K19 A;  1GX8 A;  4A1Y A;  3APW A;  3QKG A;  4IB6 A;  4OMX A;  4ZGU A;  2AL0 X;  1E02 A;  1QG5 A;  1U18 A;  2GC9 A;  2CZT A;  5HCD C;  4ALO A;  1R0U A;  4AYH A;  2G7B A;  2WEW A;  4LKT A;  1GT5 A;  4QZU A;  3FW4 A;  4Y0S A;  1X8Q A;  3JSQ A;  2KTD A;  2HNX A;  1AEL A;  1OEJ A;  4ZHH A;  2F73 A;  3D95 A;  1JV4 A;  4YDB A;  2A3F X;  3I0A A;  2A2G A;  2L68 A;  2JN3 A;  3HWG A;  4UU2 A;  4GKC A;  3WJE A;  3S26 A;  1CBQ A;  1ALB A;  4EFG A;  4MVK A;  5HZ9 A;  1TVQ A;  4NLJ A;  2EU7 X;  3EM0 A;  1ZNL A;  4UU3 A;  2G79 A;  3FR4 A;  3O19 A;  1EQD A;  1OBP A;  4M6S A;  4YDA A;  1EIO A;  4AZM A;  2AKQ A;  4ORX A;  5BVS A;  5HTE A;  3FA8 A;  3DSZ A;  1CBR A;  5KHP A;  1OBQ A;  1YWB A;  4YCE A;  5LJB A;  4I3C A;  3BX7 A;  4GNY A;  5HA1 A;  3CMP A;  5HZQ A;  2GTF X;  4NNS A;  4NYR A;  2N93 A;  3ELX A;  3KFG A;  3WXQ A;  4ZH9 A;  1U17 A;  1B4M A;  3TGA A;  5FAZ A;  1URE A;  4OMW A;  1JJX A;  3PPT A;  4OS8 A;  3P6G A;  3EYC A;  4ODD A;  5BVQ A;  1NP1 A;  4TQ2 A;  3VG2 A;  4IMO A;  4Y0P A;  3D97 A;  4GRJ A;  1EPA A;  4KII A;  4HFO A;  1EW3 A;  2ALL X;  1OPA A;  1YIV A;  2OVE A;  3FA6 A;  4QGW A;  2XKL A;  5F58 A;  3CBC A;  1ZND A;  5D8J A;  2L67 A;  1G7N A;  1A2D A;  5LKF A;  5HBS A;  5EED A;  4TKJ A;  3VG5 A;  1EAL A;  2W2F A;  1LIF A;  1G5W A;  3BS2 A;  3VG6 A;  1A18 A;  4N7D A;  1QQS A;  1ERX A;  5D48 A;  1QFT A;  4MVI A;  1BBP A;  3HWD A;  1SY3 A;  1SXX A;  2OVA A;  3MVF A;  4DQ3 A;  2CM9 A;  2FS7 A;  1U0X A;  2RQ0 A;  1KZX A;  4LZV A;  4NYQ A;  5LJH A;  1GXA A;  1KOI A;  1DZJ A;  3WJG A; 
#chains in the Genus database with same CATH topology
 3P6D A;  5IO6 A;  4AW8 A;  2WR6 A;  1D2U A;  1EXS A;  1JMX A;  1G85 A;  3APV A;  3CBS A;  3FEL A;  3PDF A;  3ZW1 A;  2WWP A;  2POA A;  1Y0G A;  1ZNE A;  2BHV A;  3NR3 A;  1KT6 A;  1VWR B;  4ES7 A;  3UEV A;  2UYW A;  4ZHD A;  4M7M A;  4ZJ0 A;  4NP1 A;  1ZNG A;  1MVG A;  1SLD B;  4EXZ A;  1LEL A;  3VU1 A;  2NNE A;  1X8N A;  1N43 A;  4ORW A;  4BVM A;  1TOU A;  1VWM B;  1DZM A;  1MM9 A;  4O3W A;  2Y32 A;  4ALB A;  2FR2 A;  1STS B;  1EUO A;  4Z28 A;  4AZQ A;  2QCB A;  1JJJ A;  2Q9S A;  5C0N A;  1RSU B;  4MIR A;  2FWV A;  3HOL A;  3FEK A;  3HPE A;  1DFV A;  1I05 A;  3ZUO A;  1QFV A;  4JO6 A;  3SLJ A;  4O49 A;  2LBA A;  4R0B A;  1FTP A;  1SRE A;  4YBP A;  1N4J A;  1I04 A;  1N0S A;  4D6A A;  4XMD A;  1NQM A;  5K68 A;  3T6F A;  4U3Q A;  3P24 A;  2RTG B;  1MOY A;  2IZD B;  3I17 A;  1RLB E;  1YWC A;  2L9C A;  2CAM A;  2C1Q A;  4ORY A;  3F8A A;  1XKI A;  2Q2P A;  3C77 X;  4IBA A;  4FBR A;  1DF3 A;  2M4L A;  5L8I A;  2OF9 A;  3NX1 A;  2IZJ A;  1VWN B;  2PY1 A;  1N7Y A;  2Q2M A;  1SWD A;  3BSZ E;  3B2H A;  2VFC A;  5EZ2 A;  1LDO A;  1LKE A;  3PQS A;  5HCE C;  3TF6 A;  3KFI A;  4EDE A;  1MX7 A;  1X8U A;  4XMF A;  1BSY A;  1SY1 A;  1X8O A;  3BU1 A;  2GTL N;  3FEN A;  1S2P A;  4YH0 A;  2AT0 X;  3CWK A;  4YFP A;  3FIQ A;  3PK2 A;  2LA7 A;  4CDF A;  4QYP A;  2FT9 A;  2WSJ A;  3PEC A;  1O1V A;  5H9L A;  4U46 A;  4COT A;  1KT7 A;  4QGX A;  1O1U A;  2G5L A;  2BLG A;  3N91 A;  5H8T A;  3KVN A;  3ZW0 B;  4ARH A;  4EKV A;  4GJS A;  5HAE A;  3P6C A;  1VWL B;  2O62 A;  2RTC B;  4IMN A;  3S5V A;  2DJG A;  5FQ8 E;  2G78 A;  1CRB A;  4I3D A;  1B8E A;  2Z4I A;  4IB7 A;  4Y59 A;  5LJC A;  1PM1 X;  2BC3 A;  1VWK B;  2QO6 A;  4EQA C;  4ZHC A;  4EEJ A;  3PQU A;  2WUT A;  4BX5 A;  5BVT A;  1JJU A;  1LCZ A;  2A5B A;  1A57 A;  2AF5 A;  3F9D A;  3L4R A;  5K06 A;  1AVE A;  2X32 A;  3AUM O;  3CKF A;  3CQN A;  4GD9 A;  2NND A;  3S5X A;  5FQ6 E;  2NP1 A;  3NQ3 A;  1SWU A;  4DNE A;  2DJF A;  4IAW A;  1SWK A;  2IFB A;  2KD2 A;  2RN4 A;  2CBR A;  3DTQ A;  3NP1 A;  5DG4 A;  5EDC A;  1TW4 A;  2HZQ A;  3EW1 A;  3C76 X;  3KFF A;  1SRF A;  3NBX X;  1BWY A;  2QM9 A;  2RTF B;  1IKJ A;  1JYJ A;  1ICN A;  1SWA A;  2CM4 A;  2C4I A;  1UZ2 X;  2ZSC A;  4OEM A;  3U03 A;  1JBH A;  1ERB A;  1SY2 A;  4FGI B;  2GH7 A;  2WQ9 A;  2MWH A;  4Y0Q A;  4ZR2 A;  3OJY C;  4ID2 A;  4Z2O A;  4GH7 A;  2QO5 A;  3WBG A;  5LJK A;  5B29 A;  5IRW A;  4OS3 A;  3BU9 A;  4QQ1 A;  4WFU A;  3U9P C;  4BOE A;  3OE3 A;  4HPA A;  1AVG I;  1TOW A;  1YWD A;  3RDX A;  4CDD A;  2I5Z O;  1VWA B;  4O4U A;  3RY1 A;  1B0O A;  1VWD B;  4I6S A;  3RZY A;  4GU8 A;  1I4U A;  2R56 A;  4YVB A;  1SLE B;  2YMS A;  4AZP A;  3TZS A;  4I9R A;  2Y3E A;  1SA8 A;  3MX7 A;  1NGL A;  1YP6 A;  2IZK A;  4YBU A;  1SMP I;  3GAQ A;  3Q6L A;  1FEM A;  1Y9T A;  1RBP A;  2RTA A;  1HMS A;  3S60 A;  4BX7 A;  3B2K A;  4QGV A;  3TGB A;  4ZGF A;  1LPJ A;  1GKA B;  2W2B A;  3MBT A;  3TGC A;  1SWJ A;  2A5C A;  3G7X A;  4XME A;  3WJF A;  3T2W A;  3VE1 A;  3FLL A;  3SOT A;  4KH8 A;  3D96 A;  3BX8 A;  5EEE A;  1VPR A;  1ZNK A;  1ZRY A;  2X56 A;  4MVL A;  4WFV A;  4YGZ A;  3WJC A;  1DZP A;  2RTO B;  1VYF A;  3BY0 A;  3WZN A;  3VHH A;  4DQ4 A;  1ML7 A;  3SZJ A;  4ORS A;  2W2A A;  3ZW2 A;  1RAV A;  3RBY A;  2RTH B;  3OBL A;  5DPQ A;  4BX6 B;  4O3Z A;  4ZHF A;  1SWF A;  2OY1 O;  1HQQ A;  1HMT A;  1VWG B;  4GJV A;  1T68 X;  2AT8 X;  1KZW A;  1VWC B;  2G8C O;  1T0V A;  5HWZ A;  2RTK A;  3IFB A;  1DV9 A;  1IIU A;  1HQP A;  1OBU A;  4NNT A;  1N9Y A;  4MIS A;  4TKB A;  2LFO A;  1LCV A;  4Z2P A;  5IO7 A;  2JW1 A;  2OYB O;  5F6Z A;  1QAB E;  3FMZ A;  1KQX A;  2Z4H A;  4GGT A;  3ELZ A;  3ZQ3 A;  2HZR A;  4O4S A;  3APU A;  1X89 A;  3KZA A;  3B2L A;  5HZ6 A;  1LNM A;  4GET A;  4IB8 A;  2MM3 A;  1SRG A;  4HPB A;  1LIC A;  5LJG A;  1FE3 A;  3QQ2 A;  2E4J A;  1ACD A;  4ZH6 A;  1AQB A;  5IO5 A;  1BRQ A;  2AT6 X;  1DC9 A;  1K3B A;  2QOM A;  3P6E A;  3EBW A;  2CZU A;  2P8G A;  1GT4 A;  2CBS A;  2UZ2 A;  5HZ8 A;  1SWP A;  4KT5 A;  4L3R A;  2OFR X;  2KT4 B;  2ZAI A;  3SZI A;  2A0A A;  3VG4 A;  1E5P A;  3FYF A;  4GZV A;  2JU8 A;  1KQW A;  5AQ6 A;  2XST A;  3SLT A;  1E06 A;  1SWC A;  1MDC A;  5L3Y A;  1E00 A;  3WJD A;  1XCA A;  3UEW A;  5BYP A;  2WQA E;  1JYD A;  1S44 A;  2GJ5 A;  4YGH A;  1VWJ B;  3T1D A;  3RDM A;  1IW2 A;  1I9H A;  2OFM X;  5EPQ A;  4O9S A;  4CPH A;  1NC9 A;  1DF8 A;  1JZU A;  1LF7 A;  4ZHG A;  1LDQ A;  4JNJ A;  1L6M A;  4QNI A;  2R73 A;  1HY2 A;  1NBX A;  4TJZ A;  5AJB A;  1RST B;  1ZNH A;  5JD2 A;  3ZUI A;  1EPB A;  4D6B A;  2AMM X;  2IZI A;  1SXY A;  1TXL A;  4FQB B;  3WYP A;  2MO5 A;  3C78 X;  2IZG B;  1CBS A;  1VWP B;  1BJ7 A;  3B2I A;  1Y55 X;  3AKM A;  4RUN A;  2X4M A;  3ZW0 A;  2C1S A;  1GM6 A;  4IB9 A;  5LJE A;  4YFR A;  1P6P A;  2RTR B;  2BS5 A;  2IZL B;  1LIE A;  1BSQ A;  2DM5 A;  4AZO A;  3FR2 A;  3NQK A;  4XMC A;  3AKN A;  5HA0 A;  4AZR A;  1W4T A;  1X71 A;  1KL5 A;  2HLV A;  4U9C A;  4HWM A;  4XMH A;  4YKM A;  4YKO A;  4TLJ A;  3VGW A;  3X00 A;  4I3B A;  4CK4 A;  1JIW I;  4Z27 A;  2OY8 A;  1QY2 A;  2R74 A;  1PTS A;  5CYB A;  1PBO A;  2ACP X;  5EDB A;  4ORU A;  2JMB A;  4YGG A;  4BQU A;  3B2J A;  5D45 A;  1RXK A;  3VE2 A;  3P6H A;  4A60 A;  1FEN A;  2K23 A;  2LB6 A;  5CHK A;  1KT5 A;  4NW4 A;  1KL4 A;  3RE6 A;  3STN A;  1IKE A;  2YG2 A;  3PH6 A;  2X46 A;  1BLR A;  4QYN A;  3D4R A;  2JU7 A;  4HPC A;  1EI5 A;  3UAQ A;  1NQN A;  2Q4N A;  1HN2 A;  3FA9 A;  4PSQ A;  2JOZ A;  4C5P A;  4A1H A;  5B3M O;  3CR6 A;  1QWD A;  3ZI8 A;  2HYS A;  3VG7 A;  5L8N A;  3EMM A;  1KT4 A;  2VDF A;  1HBQ A;  5JR8 A;  2ACO A;  4Z6J A;  1SWG A;  5F1E A;  1BRP A;  5HTD A;  1GT3 A;  4FBV A;  2BT9 A;  1A3Y A;  2MJI A;  1SWT A;  2FR3 A;  1LFO A;  3BLG A;  4OS0 A;  3U0D A;  4QZT A;  5L8O A;  3BRN A;  5FEN A;  1ICM A;  4GGZ A;  1VWQ B;  3LTW A;  1DZK A;  5CE4 A;  4MVE A;  5F6B A;  4TNN A;  1E2T A;  2X55 A;  3HK1 A;  1HMR A;  3EC5 A;  3O2Y A;  2A8G A;  1OEE A;  3PH5 A;  4BX5 B;  3HOE A;  3WVM A;  1Y53 X;  4TKH A;  1SXW A;  1SWH A;  1SY0 A;  2AH7 X;  4BJ8 A;  1KFF A;  4GGR A;  2ZAG A;  4N7C A;  4XMG A;  2AT3 X;  3HWF A;  2LBV A;  4YMY A;  5LKE A;  3KQ0 A;  4I95 A;  3ZWE A;  1CBI A;  1STP A;  3VG5 A;  3MM0 A;  1YWA A;  1WBI A;  1GKA A;  1FDQ A;  2F09 A;  5B5F A;  1EII A;  5FFH A;  1SXU A;  3P6F A;  3SAO A;  3LV4 A;  4CSB A;  1D3S A;  2IZE B;  5AJC A;  3RDQ A;  4GE1 A;  4GDA A;  5F7G A;  3IA8 A;  5IRA A;  1GX3 A;  2Y3F A;  4GK9 A;  4IRW A;  5CSE A;  2F01 A;  4ZCB A;  4YCH A;  2RD7 C;  4Y0R A;  1VYO A;  4B55 A;  1VWB B;  1W6F A;  2RCT A;  1VYG A;  5H9A A;  3FW5 A;  1PEE A;  1CJ5 A;  3NPO A;  3RDO A;  2JU3 A;  4QAE A;  4GNW A;  2IZF B;  1FJ1 E;  3PED A;  1VWI B;  1ADL A;  5H9N A;  4ZFX A;  2FKG A;  1SWE A;  3FR5 A;  4AZN A;  4Z2V A;  1B56 A;  4A8Z A;  2FGS A;  2K62 A;  4JGL A;  3VG3 A;  3WYQ A;  2OL6 O;  3D9W A;  1NDJ A;  5KID A;  1GT1 A;  1VWO B;  2RTP B;  2QMI A;  1AB0 A;  3WOV A;  4YFQ A;  1SWS A;  1KXO A;  2FRS A;  1MX8 A;  2QOS C;  2FS6 A;  1T8V A;  3RE5 A;  1IFB A;  2IZB A;  2OVS A;  4O4O A;  1LCW A;  5H9K A;  2A2U A;  2RCQ A;  3HWE A;  4RUU A;  2RA6 A;  1X8P A;  3K3L A;  2IZA A;  1FEL A;  2FKJ A;  3LHN A;  2AVI A;  3NAD A;  4ORR A;  5D4A A;  1MEP A;  1O8V A;  3AEH A;  3BDR A;  2HMB A;  2OY7 A;  5B2A O;  3CQR A;  1HXZ A;  1YP7 A;  3FA7 A;  1NP4 A;  3NX2 A;  2WEX A;  4HPD A;  1GX9 A;  2RTB B;  4Y5D A;  1SWQ A;  3STM X;  2FTB A;  1BEB A;  1S7D A;  2X8F A;  4U8U M;  5B27 A;  4NLI A;  4NV7 A;  1VWF B;  2OZQ A;  2ASN X;  4CDC A;  1YUP A;  1GGL A;  2GTL M;  1KL3 A;  1G74 A;  1PMP A;  3SLO A;  3UEX A;  4WBK A;  5HZ5 A;  1BM5 A;  1I06 A;  3RKG A;  3JQO A;  3ZW1 B;  4LKP A;  2AT5 X;  4I9S A;  4O3X B;  2ANS A;  5B10 O;  1HXL A;  1SWL A;  3FID A;  1Z24 A;  2A13 A;  2X45 A;  1MUP A;  1OPB A;  1VWE B;  1H91 A;  1SWO A;  2OF8 A;  2RTI B;  1HBP A;  3KFH A;  2LKK A;  3NQ9 A;  1Y52 X;  1K24 A;  1LID A;  1Y9L A;  3JS1 A;  3Q34 A;  3APX A;  1MK5 A;  3T2X A;  5HCC C;  1QY1 A;  4KCA A;  1KGL A;  5B11 O;  2OL7 A;  1KT3 A;  1BSO A;  2FLJ A;  2NNQ A;  3EBK A;  5LJD A;  3E3C A;  1OEK A;  3UEU A;  1SWN A;  3PP6 A;  4PJ2 A;  3WJB A;  2MF6 A;  2X34 A;  5KIC A;  2Q39 A;  2QO4 A;  4L1N A;  5IXG A;  1LIB A;  3RSW A;  4LZU A;  2RTE B;  1QY0 A;  3O22 A;  3STK A;  2IZC B;  1IFC A;  4IAX A;  2BSZ A;  2L5P A;  3FEP A;  4MEE A;  5D47 A;  2OVD A;  4K19 A;  1GX8 A;  4A1Y A;  3APW A;  4BGF A;  4GDZ A;  3QKG A;  4IB6 A;  4OMX A;  4KC8 A;  2FHN X;  5FQ7 E;  4ZGU A;  2AL0 X;  1E02 A;  4U8U N;  4CV7 A;  1QG5 A;  1U18 A;  2IZH B;  4O4X A;  3T6L A;  2HKD A;  5K67 A;  1UYN X;  2CZT A;  2GC9 A;  4CPH B;  4CPE A;  5HCD C;  4ALO A;  2RTN B;  1R0U A;  4CPI A;  4OEL A;  4AYH A;  3RWX A;  2G7B A;  2WEW A;  4LKT A;  1GT5 A;  4KC7 A;  4QZU A;  3FW4 A;  4Y0S A;  3WZP A;  1X8Q A;  3ZZV A;  3FDC A;  3JSQ A;  4FBO A;  5AEO A;  2WPU A;  2KTD A;  3RDU A;  2HNX A;  2MHD A;  1AEL A;  4QRL A;  1OEJ A;  4ZHH A;  2F73 A;  3D95 A;  1WUB A;  3OD9 A;  1JV4 A;  2RTM A;  4YDB A;  2A3F X;  3I0A A;  2A2G A;  2L68 A;  2JN3 A;  3HWG A;  3V8U A;  2RTD B;  4UU2 A;  4GKC A;  3WJE A;  4U8U O;  3S26 A;  3WZQ A;  1RXJ A;  1CBQ A;  3RY2 A;  1ALB A;  4EFG A;  2GTL O;  4MVK A;  5HZ9 A;  2RTL A;  1TVQ A;  3F6Z B;  4NLJ A;  4DCB A;  2EU7 X;  3EM0 A;  1ZNL A;  4UU3 A;  2G79 A;  3FR4 A;  2I5V O;  4JHQ A;  4CPF A;  3O19 A;  1EQD A;  1JMZ A;  1OBP A;  1W5R A;  4M6S A;  1SLG B;  2KTS A;  2KW1 A;  2RTJ A;  4YDA A;  1EIO A;  4AZM A;  2AKQ A;  3VHI A;  4LQZ A;  4ORX A;  5BVS A;  2OFB A;  5HTE A;  3FA8 A;  1I78 A;  3DSZ A;  1CBR A;  4NV8 A;  4CDE A;  5KHP A;  2JGS A;  1OBQ A;  1YWB A;  4YCE A;  5LJB A;  1JQP A;  5F2B A;  1UYO X;  4I3C A;  3BX7 A;  4GNY A;  5HA1 A;  1RXH A;  3CMP A;  1IJ8 A;  5HZQ A;  1SRI A;  2GTF X;  4NNS A;  4NYR A;  3HTY A;  2N93 A;  3ELX A;  3KFG A;  3WXQ A;  5B5G A;  1PBY A;  1U17 A;  4ZH9 A;  1B4M A;  2OY5 O;  1VWH B;  3TGA A;  1SWR A;  4GUZ A;  5FAZ A;  1URE A;  4OMW A;  1JJX A;  4INN A;  4BX6 A;  3PPT A;  1LUQ A;  1SLF B;  2X8T A;  3P02 A;  4BBO A;  4OS8 A;  3P6G A;  3EYC A;  4ODD A;  1SRJ A;  2OL8 O;  5BVQ A;  1SWB A;  4OKA A;  1NP1 A;  4ML7 B;  3WZO A;  3SZH A;  1STR B;  3VG2 A;  3VHM A;  4TQ2 A;  4IMO A;  4Y0P A;  3D97 A;  4GRJ A;  1EPA A;  4KII A;  2BS6 A;  1EW3 A;  2OFA A;  4HFO A;  2ALL X;  1OPA A;  4BCS A;  1YIV A;  2OVE A;  3H3I A;  3FA6 A;  2RTQ B;  2XKL A;  4QGW A;  5F58 A;  3CBC A;  1ZND A;  4BX7 B;  4I60 A;  5D8J A;  2L67 A;  1G7N A;  1A2D A;  2VFB A;  4O3Y A;  5EED A;  4IAB A;  4TKJ A;  5HBS A;  5LKF A;  3RDS A;  2W2F A;  1AVD A;  1LIF A;  1EAL A;  1G5W A;  3BS2 A;  3VG6 A;  3VPJ E;  1A18 A;  5IRU A;  4N7D A;  1QQS A;  1ERX A;  4ON1 A;  1OSP O;  5D48 A;  2PI3 O;  1QFT A;  3EW2 A;  4MVI A;  1BBP A;  3HWD A;  3MG5 A;  2FHL A;  3CKG A;  1SY3 A;  4WHI A;  1N9M A;  1SXX A;  2OVA A;  3MVF A;  3GE2 A;  2CM9 A;  2FS7 A;  4DQ3 A;  1U0X A;  2RQ0 A;  1SRH A;  2X8S A;  1KZX A;  4LZV A;  4NYQ A;  5LJH A;  1GXA A;  1KOI A;  1DZJ A;  3WJG A; 
#chains in the Genus database with same CATH homology
 3P6D A;  5IO6 A;  4AW8 A;  2WR6 A;  1D2U A;  1EXS A;  1G85 A;  3APV A;  3CBS A;  3FEL A;  3ZW1 A;  2WWP A;  2POA A;  2BHV A;  1ZNE A;  3NR3 A;  4ES7 A;  1KT6 A;  3UEV A;  4ZHD A;  4ZJ0 A;  4M7M A;  4NP1 A;  1ZNG A;  1MVG A;  4EXZ A;  3VU1 A;  2NNE A;  1X8N A;  4ORW A;  4BVM A;  1TOU A;  1DZM A;  4O3W A;  4ALB A;  2FR2 A;  1EUO A;  4AZQ A;  1JJJ A;  2Q9S A;  5C0N A;  4MIR A;  2FWV A;  3HOL A;  3FEK A;  1DFV A;  1I05 A;  3ZUO A;  1QFV A;  4O49 A;  2LBA A;  4R0B A;  1FTP A;  4YBP A;  1I04 A;  1N0S A;  4D6A A;  4XMD A;  4U3Q A;  3P24 A;  3I17 A;  1RLB E;  1YWC A;  2L9C A;  4ORY A;  3F8A A;  1XKI A;  2Q2P A;  3C77 X;  4IBA A;  4FBR A;  1DF3 A;  2M4L A;  5L8I A;  3NX1 A;  2PY1 A;  3BSZ E;  2Q2M A;  5EZ2 A;  3B2H A;  1LKE A;  3PQS A;  5HCE C;  3TF6 A;  3KFI A;  4EDE A;  1MX7 A;  1X8U A;  4XMF A;  1BSY A;  1SY1 A;  1X8O A;  3BU1 A;  2GTL N;  3FEN A;  1S2P A;  4YH0 A;  2AT0 X;  3CWK A;  4YFP A;  3FIQ A;  2LA7 A;  4QYP A;  2FT9 A;  2WSJ A;  3PEC A;  1O1V A;  5H9L A;  4COT A;  1KT7 A;  4QGX A;  1O1U A;  3N91 A;  2BLG A;  5H8T A;  3ZW0 B;  4ARH A;  5HAE A;  3P6C A;  2O62 A;  4IMN A;  3S5V A;  5FQ8 E;  2G78 A;  1CRB A;  4I3D A;  1B8E A;  2Z4I A;  4IB7 A;  5LJC A;  1PM1 X;  2QO6 A;  4EQA C;  4ZHC A;  4EEJ A;  3PQU A;  2WUT A;  5BVT A;  1A57 A;  3F9D A;  3L4R A;  5K06 A;  3CQN A;  2NND A;  3S5X A;  5FQ6 E;  2NP1 A;  3NQ3 A;  4IAW A;  2IFB A;  2KD2 A;  2RN4 A;  2CBR A;  3DTQ A;  3NP1 A;  5DG4 A;  5EDC A;  1TW4 A;  2HZQ A;  3KFF A;  3C76 X;  3NBX X;  1BWY A;  2QM9 A;  1IKJ A;  1JYJ A;  1ICN A;  2CM4 A;  1UZ2 X;  1JBH A;  3U03 A;  1ERB A;  1SY2 A;  4FGI B;  4Y0Q A;  2WQ9 A;  2MWH A;  4ZR2 A;  3OJY C;  4ID2 A;  5LJK A;  4GH7 A;  2QO5 A;  3WBG A;  5B29 A;  4OS3 A;  3BU9 A;  4QQ1 A;  4WFU A;  3U9P C;  4BOE A;  3OE3 A;  4HPA A;  1AVG I;  1TOW A;  1YWD A;  4O4U A;  1B0O A;  4I6S A;  3RZY A;  4GU8 A;  1I4U A;  2R56 A;  4AZP A;  2YMS A;  3TZS A;  4I9R A;  1SA8 A;  3MX7 A;  1NGL A;  1YP6 A;  4YBU A;  1SMP I;  3GAQ A;  3Q6L A;  1FEM A;  1Y9T A;  1RBP A;  1HMS A;  3S60 A;  3B2K A;  4QGV A;  3TGB A;  4ZGF A;  1LPJ A;  1GKA B;  2W2B A;  3MBT A;  3TGC A;  3G7X A;  4XME A;  3WJF A;  3VE1 A;  3FLL A;  3SOT A;  4KH8 A;  3D96 A;  3BX8 A;  5EEE A;  1VPR A;  1ZNK A;  1ZRY A;  4MVL A;  4WFV A;  4YGZ A;  3WJC A;  4CSB A;  1DZP A;  3BY0 A;  1VYF A;  4DQ4 A;  1ML7 A;  4ORS A;  2W2A A;  3ZW2 A;  3RBY A;  3OBL A;  5DPQ A;  4ZHF A;  4O3Z A;  1HMT A;  1T68 X;  2AT8 X;  1KZW A;  1T0V A;  5HWZ A;  3IFB A;  1DV9 A;  1IIU A;  1HQP A;  1OBU A;  4NNT A;  4MIS A;  4TKB A;  2LFO A;  5IO7 A;  2JW1 A;  5F6Z A;  1QAB E;  3FMZ A;  1KQX A;  2Z4H A;  3ZQ3 A;  3ELZ A;  2HZR A;  4O4S A;  3APU A;  1X89 A;  3KZA A;  3B2L A;  5HZ6 A;  1LNM A;  4GET A;  4IB8 A;  2MM3 A;  4HPB A;  1LIC A;  5LJG A;  1FE3 A;  2E4J A;  1ACD A;  4ZH6 A;  1AQB A;  5IO5 A;  1BRQ A;  2AT6 X;  1DC9 A;  3P6E A;  5HZ8 A;  3EBW A;  2CZU A;  2P8G A;  1GT4 A;  2CBS A;  4KT5 A;  4L3R A;  2OFR X;  2KT4 B;  2ZAI A;  3VG4 A;  2A0A A;  1E5P A;  3FYF A;  4GZV A;  2JU8 A;  1KQW A;  5AQ6 A;  2XST A;  1E06 A;  1MDC A;  1E00 A;  3WJD A;  1XCA A;  3UEW A;  5BYP A;  2WQA E;  1JYD A;  1S44 A;  2GJ5 A;  4YGH A;  3T1D A;  1IW2 A;  2OFM X;  5EPQ A;  4O9S A;  1JZU A;  1LF7 A;  4ZHG A;  1L6M A;  4QNI A;  2R73 A;  4TJZ A;  5AJB A;  1ZNH A;  3ZUI A;  1EPB A;  4D6B A;  2AMM X;  1SXY A;  1TXL A;  4FQB B;  2MO5 A;  3C78 X;  1CBS A;  3B2I A;  1BJ7 A;  3AKM A;  4RUN A;  3ZW0 A;  4IB9 A;  1GM6 A;  5LJE A;  4YFR A;  1P6P A;  2BS5 A;  1LIE A;  1BSQ A;  2DM5 A;  4AZO A;  3FR2 A;  3NQK A;  4XMC A;  3AKN A;  5HA0 A;  4AZR A;  4XMH A;  1X71 A;  2HLV A;  4U9C A;  4YKO A;  4HWM A;  4YKM A;  4CK4 A;  4TLJ A;  4I3B A;  1JIW I;  1QY2 A;  2R74 A;  5CYB A;  5EDB A;  1PBO A;  2ACP X;  4ORU A;  2JMB A;  4YGG A;  4BQU A;  3B2J A;  5D45 A;  3VE2 A;  3P6H A;  4A60 A;  1FEN A;  2K23 A;  2LB6 A;  1KT5 A;  4NW4 A;  3STN A;  1IKE A;  2YG2 A;  3PH6 A;  2X46 A;  1BLR A;  4QYN A;  3D4R A;  2JU7 A;  4HPC A;  1EI5 A;  3UAQ A;  2Q4N A;  1HN2 A;  3FA9 A;  4PSQ A;  2JOZ A;  4A1H A;  3CR6 A;  1QWD A;  3ZI8 A;  2HYS A;  3VG7 A;  5L8N A;  3EMM A;  1KT4 A;  1HBQ A;  5JR8 A;  2ACO A;  5F1E A;  1BRP A;  5HTD A;  1GT3 A;  4FBV A;  2BT9 A;  1A3Y A;  2MJI A;  2FR3 A;  1LFO A;  3BLG A;  4OS0 A;  3U0D A;  4QZT A;  5L8O A;  3BRN A;  5FEN A;  1ICM A;  1DZK A;  5CE4 A;  4MVE A;  5F6B A;  4TNN A;  3HK1 A;  1HMR A;  3O2Y A;  3PH5 A;  1OEE A;  3HOE A;  3WVM A;  4TKH A;  1SXW A;  1SY0 A;  2AH7 X;  4XMG A;  4YMY A;  2ZAG A;  4N7C A;  2LBV A;  2AT3 X;  3HWF A;  5LKE A;  3KQ0 A;  4I95 A;  3ZWE A;  1CBI A;  1YWA A;  1GKA A;  1FDQ A;  2F09 A;  1EII A;  5FFH A;  1SXU A;  3P6F A;  3SAO A;  3LV4 A;  1D3S A;  5AJC A;  4GE1 A;  5F7G A;  3IA8 A;  4GK9 A;  4ZCB A;  4YCH A;  2RD7 C;  4Y0R A;  2RCT A;  1VYG A;  5H9A A;  3FW5 A;  1PEE A;  1CJ5 A;  3NPO A;  2JU3 A;  4QAE A;  4GNW A;  4ZFX A;  3PED A;  5H9N A;  1ADL A;  3FR5 A;  4AZN A;  1B56 A;  4A8Z A;  4JGL A;  2K62 A;  3VG3 A;  5KID A;  1GT1 A;  2QMI A;  1AB0 A;  3WOV A;  4YFQ A;  1KXO A;  2FRS A;  1MX8 A;  2QOS C;  2FS6 A;  1T8V A;  1IFB A;  2OVS A;  4O4O A;  5H9K A;  2A2U A;  2RCQ A;  3HWE A;  4RUU A;  2RA6 A;  1X8P A;  3K3L A;  1FEL A;  3LHN A;  3NAD A;  4ORR A;  5D4A A;  1O8V A;  3BDR A;  2HMB A;  3CQR A;  1YP7 A;  3FA7 A;  1NP4 A;  3NX2 A;  2WEX A;  4HPD A;  1GX9 A;  3STM X;  2FTB A;  1BEB A;  1S7D A;  2X8F A;  4U8U M;  5B27 A;  4NLI A;  2OZQ A;  2ASN X;  1YUP A;  1GGL A;  2GTL M;  1G74 A;  1PMP A;  5HZ5 A;  3UEX A;  4WBK A;  1BM5 A;  1I06 A;  3RKG A;  3JQO A;  3ZW1 B;  4LKP A;  2AT5 X;  4I9S A;  4O3X B;  2ANS A;  1Z24 A;  2A13 A;  2X45 A;  1MUP A;  1OPB A;  1H91 A;  1HBP A;  3KFH A;  2LKK A;  3NQ9 A;  1LID A;  1Y9L A;  3JS1 A;  3APX A;  5HCC C;  1KGL A;  1QY1 A;  4KCA A;  2NNQ A;  1BSO A;  1KT3 A;  2FLJ A;  3EBK A;  5LJD A;  3E3C A;  1OEK A;  3UEU A;  3WJB A;  3PP6 A;  4PJ2 A;  5KIC A;  2Q39 A;  2QO4 A;  4L1N A;  1LIB A;  3RSW A;  4LZU A;  1QY0 A;  3O22 A;  3STK A;  1IFC A;  4IAX A;  2L5P A;  3FEP A;  5D47 A;  2OVD A;  4K19 A;  1GX8 A;  4A1Y A;  3APW A;  4GDZ A;  3QKG A;  4IB6 A;  4OMX A;  4KC8 A;  5FQ7 E;  4ZGU A;  2AL0 X;  1E02 A;  4U8U N;  4CV7 A;  1QG5 A;  1U18 A;  4O4X A;  2GC9 A;  2CZT A;  5HCD C;  4ALO A;  1R0U A;  4AYH A;  3RWX A;  2G7B A;  2WEW A;  4LKT A;  1GT5 A;  4KC7 A;  4QZU A;  3FW4 A;  4Y0S A;  1X8Q A;  3ZZV A;  3JSQ A;  4FBO A;  5AEO A;  2KTD A;  2HNX A;  2MHD A;  1AEL A;  4QRL A;  1OEJ A;  4ZHH A;  2F73 A;  3D95 A;  3OD9 A;  1JV4 A;  4YDB A;  2A3F X;  3I0A A;  2A2G A;  2L68 A;  2JN3 A;  3HWG A;  3V8U A;  4UU2 A;  4GKC A;  3WJE A;  4U8U O;  3S26 A;  1CBQ A;  1ALB A;  4EFG A;  2GTL O;  4MVK A;  5HZ9 A;  1TVQ A;  3F6Z B;  4NLJ A;  2EU7 X;  3EM0 A;  1ZNL A;  4UU3 A;  2G79 A;  3FR4 A;  3O19 A;  1EQD A;  1OBP A;  4M6S A;  4YDA A;  2KTS A;  2KW1 A;  1EIO A;  4AZM A;  2AKQ A;  4LQZ A;  4ORX A;  5BVS A;  5HTE A;  3FA8 A;  3DSZ A;  1CBR A;  5KHP A;  1OBQ A;  1YWB A;  4YCE A;  5LJB A;  4I3C A;  3BX7 A;  4GNY A;  5HA1 A;  3CMP A;  5HZQ A;  2GTF X;  4NNS A;  4NYR A;  3HTY A;  2N93 A;  3ELX A;  3KFG A;  3WXQ A;  4ZH9 A;  1U17 A;  1B4M A;  3TGA A;  5FAZ A;  1URE A;  4OMW A;  1JJX A;  4INN A;  3PPT A;  2X8T A;  3P02 A;  4OS8 A;  3P6G A;  3EYC A;  4ODD A;  5BVQ A;  1NP1 A;  4ML7 B;  4TQ2 A;  3VG2 A;  4IMO A;  4Y0P A;  3D97 A;  4GRJ A;  1EPA A;  4KII A;  2BS6 A;  1EW3 A;  4HFO A;  2ALL X;  1OPA A;  1YIV A;  2OVE A;  3H3I A;  3FA6 A;  4QGW A;  2XKL A;  5F58 A;  3CBC A;  1ZND A;  5D8J A;  2L67 A;  1G7N A;  1A2D A;  4O3Y A;  5HBS A;  5EED A;  4IAB A;  4TKJ A;  5LKF A;  3VG5 A;  1EAL A;  2W2F A;  1LIF A;  1G5W A;  3BS2 A;  3VG6 A;  3VPJ E;  1A18 A;  4N7D A;  1QQS A;  1ERX A;  4ON1 A;  5D48 A;  1QFT A;  4MVI A;  1BBP A;  3HWD A;  1SY3 A;  4WHI A;  1SXX A;  2OVA A;  3MVF A;  3GE2 A;  2CM9 A;  2FS7 A;  4DQ3 A;  1U0X A;  2RQ0 A;  2X8S A;  1KZX A;  4LZV A;  4NYQ A;  5LJH A;  1GXA A;  1KOI A;  1DZJ A;  3WJG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...