4I9SA

Crystal structure of the r111k:r132l:y134f:t54v:r59w mutant of the cellular retinoic acid binding protein type ii in complex with all-trans retinal at 2.58 angstrom resolution
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
137
structure length
137
Chain Sequence
b'PNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKVSTTVWTTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTKELTNDGELILTMTADDVVCTLVFVRE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cellular retinoic acid-binding protein 2
publication title Rational Design of a Colorimetric pH Sensor from a Soluble Retinoic Acid Chaperone.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 32
structure length 137
sequence length 137
ec nomenclature
pdb deposition date 2012-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 4i9sA00
1OPBA 3FEPA 4XMFA 3CWKA 4OS3A 1DC9A 4OS0A 2OVEA 1YP6A 3CBSA 4LKPA 4ORSA 1OPAA 3G7XA 4QGWA 1ZNLA 1SXXA 3VG7A 1LIDA 3FLLA 3FEKA 2HNXA 2ACPX 3FA8A 1DFVA 1YIVA 2HZRA 1O8VA 4YMYA 3NP1A 1ERXA 4N7DA 2L67A 5FAZA 5L8NA 2FLJA 3NPOA 4I3CA 4ORYA 2MJIA 3FR2A 5D45A 2FWVA 2AT6X 3FA9A 4ORXA 2KT4B 5DPQA 1B0OA 1LKEA 2QOSC 5LKEA 3BU1A 1HBPA 4LZUA 3BRNA 4IAXA 5L8OA 4AZOA 2FR3A 5KHPA 5BVQA 4ZHCA 1TOWA 2WR6A 1BBPA 3RZYA 1O1UA 5HWZA 3U03A 5HA0A 1GX8A 5HBSA 2OVAA 3C78X 3EYCA 1S7DA 2A3FX 5C0NA 1X8NA 5BVTA 2G78A 2X45A 3APXA 2GTFX 1GT1A 1ICNA 4YCHA 1GT5A 1FENA 3D96A 3UEVA 5EPQA 1I4UA 2AT5X 1A57A 1CRBA 3WVMA 1NGLA 3TZSA 3ELXA 1YWDA 4A60A 2JN3A 1MUPA 1TW4A 1T8VA 2ANSA 4YKMA 2WQAE 4GE1A 1KQWA 4YKOA 5D47A 2AH7X 4MVKA 4TKJA 1BRQA 3CQNA 1EW3A 5FFHA 1CBIA 3P6EA 3P6GA 3FA7A 2WEXA 5H9KA 2WUTA 3FMZA 3BS2A 1EQDA 3FR4A 3WJGA 1CBSA 1HMTA 3FIQA 1GT3A 5IO7A 1KQXA 3EBKA 2RCQA 3AKNA 3BSZE 2K62A 1X8PA 1B4MA 2L5PA 5F6ZA 2W2AA 4PSQA 2Q2MA 2L68A 2O62A 3O2YA 1VYFA 4ZHHA 3VG3A 4AYHA 3U0DA 5HCCC 1OEJA 3B2KA 1KT6A 3O22A 2L9CA 4ZCBA 4Y0SA 4ZR2A 1KOIA 3NR3A 4YDBA 5JR8A 4D6AA 2R74A 1U18A 3CBCA 3P6HA 3T1DA 4QGXA 2AT3X 1RLBE 2LBVA 1QQSA 2A13A 5HTDA 4DQ4A 1SXUA 3NADA 4AZRA 3QKGA 4NYQA 2CM4A 3IFBA 4KIIA 1IKEA 2W2BA 3CQRA 1G7NA 1JV4A 2WWPA 4TQ2A 3ELZA 4WFVA 3B2JA 1AB0A 1SXYA 2RCTA 1IIUA 4YGZA 5LJDA 2FS7A 5F6BA 1KZXA 4WFUA 4NNSA 1LPJA 2OFRX 2ACOA 1FDQA 2FTBA 4ZH9A 5LJGA 1I06A 4YBPA 2AMMX 3K3LA 5EDCA 1ZNEA 1ZNDA 3BDRA 3KFHA 3PPTA 4LZVA 5HZ5A 5D8JA 1FELA 1QFTA 1BEBA 4MVIA 1YWBA 1VYGA 1X8OA 1BSYA 1GKAB 2NP1A 1S2PA 1JJXA 3WBGA 2FT9A 4XMEA 3RSWA 4NLJA 3B2IA 2R56A 3WJDA 2AT8X 1XCAA 2WEWA 1D3SA 2A2GA 4YBUA 5FENA 1AQBA 1G85A 2OZQA 1TOUA 3PEDA 3PH6A 1MX8A 4EDEA 3FR5A 4YGHA 3I17A 4ZFXA 1GGLA 1GKAA 2X46A 1HMRA 2AKQA 1QWDA 3TGBA 2LFOA 3DTQA 3TGCA 1SA8A 5AQ6A 2AL0X 1IFBA 5LKFA 4AZMA 3FW5A 1MX7A 2Q4NA 1SY3A 3VG4A 1DZPA 5H9LA 1ZNGA 3VG5A 5EZ2A 4HFOA 1TXLA 1ZNHA 1KT7A 1AVGI 1OBPA 5IO6A 3FELA 4ORWA 3U9PC 3KZAA 3ZUIA 1U17A 3I0AA 3D95A 3STNA 3TGAA 2Q39A 1QY2A 2LKKA 4QAEA 4MVLA 2BLGA 1LICA 1R0UA 3ZQ3A 5HZ9A 1L6MA 1HMSA 4BVMA 1ALBA 1FE3A 1O1VA 3WXQA 1OBQA 1GXAA 2LBAA 2IFBA 3UEWA 1D2UA 2JOZA 1TVQA 2YG2A 2POAA 3KQ0A 4QZUA 1CBQA 4UU2A 1UZ2X 5H9NA 4YFRA 4IMNA 4IAWA 2RD7C 4EEJA 1BM5A 4I3BA 2LB6A 4Y0PA 3FA6A 4NLIA 4NNTA 4AZNA 5DG4A 4EXZA 1EIIA 3BX8A 3STMX 3ZUOA 3UEUA 4IB7A 1IKJA 2Q9SA 3DSZA 1EPBA 4RUNA 5EDBA 3HWDA 2DM5A 4IB6A 1QG5A 4TNNA 2MO5A 2HYSA 5L8IA 1P6PA 4YGGA 4A8ZA 4ZJ0A 3BLGA 4O9SA 4IB9A 3HWEA 3P6DA 1X8QA 4EFGA 2XKLA 2MM3A 1BWYA 3F8AA 1HBQA 5K06A 1T68X 4GKCA 4Y0QA 1U0XA 2W2FA 3KFFA 2OVDA 1ICMA 5BVSA 4IB8A 4R0BA 4TKBA 4OS8A 4UU3A 3VG2A 1IFCA 3B2HA 1LIEA 4TJZA 3F9DA 5B27A 4M6SA 5HCDC 3Q6LA 1EXSA 3EBWA 1BLRA 1YP7A 4IMOA 3NQ9A 3O19A 1ERBA 3C76X 1SY1A 5B29A 2GC9A 4GRJA 4YCEA 3VG6A 1EIOA 5F1EA 2QM9A 1ZNKA 3WJEA 4HPAA 1PM1X 2ASNX 1PBOA 1Z24A 4ZH6A 2WQ9A 1DZJA 1G5WA 1A3YA 1DZMA 1H91A 1SY0A 1JJJA 2CZTA 2AT0X 2HLVA 4XMCA 4AZPA 1I04A 1RBPA 2XSTA 1KT3A 1JBHA 1OEEA 3IA8A 4I9RA 1EUOA 1ML7A 2WSJA 4ORUA 1QABE 1SXWA 4HPDA 4ORRA 5D4AA 5EEEA 2CBRA 4ES7A 4YH0A 3P6FA 5LJHA 1AELA 3KFGA 4BQUA 4GNYA 1A18A 2G79A 2PY1A 1GM6A 3GAQA 5KICA 1JZUA 1YUPA 2N93A 4HPBA 5LJKA 1E02A 1SY2A 2QO5A 1CBRA 1DZKA 4I3DA 4BOEA 4GETA 4ARHA 5HTEA 3WJBA 1E00A 5HA1A 2FS6A 1GT4A 4RUUA 1JYDA 1LF7A 5HAEA 1IW2A 4YFPA 5D48A 1DF3A 1OBUA 1X71A 3D97A 4ZGUA 2Q2PA 4A1HA 5HCEC 2FRSA 1I05A 2F73A 2JU3A 3UEXA 1DV9A 4D6BA 3B2LA 1CJ5A 1EALA 3APVA 1E5PA 3S26A 2HZQA 1FEMA 3KFIA 1HQPA 1MDCA 3EM0A 3PH5A 3HWGA 1QY1A 1E06A 4QZTA 1XKIA 3C77X 1EPAA 1KGLA 3EMMA 3FW4A 1FTPA 1BSQA 2K23A 5HZ6A 2G7BA 3NX1A 2P8GA 2A0AA 4LKTA 5CE4A 1BRPA 4N7CA 3STKA 2RQ0A 2RA6A 3JS1A 4DQ3A 4ZHDA 2GJ5A 1YWCA 2JU8A 1KT4A 4YDAA 2CZUA 4Y0RA 4A1YA 4GH7A 1T0VA 1KT5A 5LJEA 5H9AA 3AKMA 3CMPA 4CK4A 3MBTA 3BX7A 1PMPA 1QY0A 5IO5A 2CBSA 1A2DA 2R73A 4XMGA 2A2UA 3JSQA 1S44A 2OFMX 3HWFA 1JYJA 5HZ8A 2JU7A 1YWAA 3P6CA 3TF6A 1LIFA 3PECA 4XMHA 1B56A 3WJFA 2NNEA 1N0SA 1MVGA 3APWA 2QO6A 1QFVA 4QYPA 5KIDA 4NP1A 5H8TA 1PEEA 4HPCA 2E4JA 4ZHFA 1BSOA 1HN2A 5LJBA 5F58A 3MVFA 4OMWA 3NX2A 4ALOA 5EEDA 1LNMA 1BJ7A 4WBKA 1NP4A 2FR2A 1OEKA 1X89A 3APUA 4ODDA 4AW8A 1LIBA 1LFOA 5F7GA 4QYNA 4ALBA 3NQ3A 4NYRA 3CR6A 3L4RA 4AZQA 4ZHGA 2KTDA 4M7MA 4K19A 3WJCA 2ALLX 2CM9A 2NNQA 3PP6A 1KXOA 4TKHA 3FENA 3SAOA 4I9SA 4IBAA 5HZQA 1GX9A 1X8UA 3HK1A 1G74A 4YFQA 1ACDA 3BY0A 4XMDA 3BU9A 4GNWA 2QO4A 4TLJA 1B8EA 1VPRA 4QGVA 4OMXA 2NNDA 3OJYC 2EU7X 1KZWA 1ADLA 5LJCA 2HMBA 1NP1A 1ZRYA 1UREA
chains in the Genus database with same CATH superfamily
1OPBA 4OEMA 2GTLN 3FEPA 2C1SA 4XMFA 3ZWEA 3CWKA 4OS3A 3RWXA 1DC9A 1NQMA 4OS0A 1Y9TA 4O4OA 2VFBA 2OVEA 1YP6A 2VFCA 3VU1A 3CBSA 1LCWA 3WZOA 4LKPA 3WZNA 4ORSA 1OPAA 3QQ2A 3G7XA 2RTBB 2JW1A 1ZNLA 4QGWA 5B11O 1SXXA 3HOEA 4ON1A 3VG7A 3RDQA 1LIDA 1JIWI 4BX6B 3FLLA 3FEKA 3P24A 4FBOA 2HNXA 2ACPX 3FA8A 1VWQB 1RSUB 4JGLA 1DFVA 1YIVA 2HZRA 2YMSA 1O8VA 2FGSA 4CDEA 4YMYA 2X4MA 3NP1A 1ERXA 4N7DA 2L67A 5FAZA 5L8NA 2FLJA 4O4XA 3NPOA 4PJ2A 4CV7A 4I3CA 4ORYA 2MJIA 3FR2A 5D45A 2FWVA 5K68A 4BX6A 2AT6X 3FA9A 4ORXA 2KT4B 5DPQA 1B0OA 1LKEA 2QOSC 4L3RA 3UAQA 3BU1A 1HBPA 4LZUA 3BRNA 3EW1A 4IAXA 5K67A 4CDCA 5L8OA 4O4SA 4AZOA 2FR3A 1VWBB 5BVQA 5KHPA 2BSZA 4ZHCA 1TOWA 2WR6A 4OKAA 1BBPA 3SZHA 1VWEB 3RZYA 1O1UA 5HWZA 3U03A 5HA0A 4MISA 4KT5A 1GX8A 5HBSA 3T2XA 4GJVA 2AF5A 2FKGA 2OVAA 4GDAA 3C78X 3EYCA 1S7DA 2X32A 2A3FX 2RTMA 2FHNX 5C0NA 4HWMA 1X8NA 5BVTA 2G78A 2X45A 3APXA 2GTFX 1GT1A 1ICNA 5BYPA 4YCHA 5FQ8E 5CSEA 1SWRA 1GT5A 1FENA 3D96A 3UEVA 3VE2A 5EPQA 1MM9A 1I4UA 2AT5X 1A57A 1VWFB 1CRBA 2RTLA 2RTQB 3WVMA 3VPJE 1N9YA 1NGLA 3ELXA 1YWDA 4A60A 3TZSA 2JN3A 1MUPA 4CDDA 1TW4A 1T8VA 2ANSA 4YKMA 2WQAE 4BJ8A 4GE1A 1KQWA 1K3BA 4YKOA 5D47A 4MVKA 4TKJA 3MM0A 2AH7X 2OFAA 1BRQA 3CQNA 1SWBA 1EW3A 2IZCB 5FFHA 1CBIA 3P6EA 2A5CA 4GGZA 3P6GA 3VHIA 2IZIA 3FA7A 2WEXA 1VWPB 3VHMA 5H9KA 2AVIA 2WUTA 2F01A 3FMZA 3BS2A 1EQDA 3FR4A 3PQUA 3WJGA 1CBSA 1HMTA 1SREA 1GT3A 2IZDB 3FIQA 4CPIA 5IO7A 3N91A 1KQXA 3EBKA 2RCQA 3AKNA 1KFFA 3BSZE 2K62A 3OBLA 1X8PA 3SOTA 1B4MA 2IZEB 2L5PA 5F6ZA 2W2AA 1VYOA 4Y59A 2MF6A 4PSQA 2Q2MA 2L68A 2O62A 1SRFA 3O2YA 1VYFA 4I95A 3VG3A 1JMZA 4AYHA 4BBOA 4ZHHA 3U0DA 5HCCC 1OEJA 1SWDA 2GTLM 1KT6A 3B2KA 2OYBO 2OY7A 4QNIA 4BCSA 3X00A 3O22A 2L9CA 2MWHA 4Y0SA 2BHVA 4ZCBA 4BGFA 4ZR2A 1KOIA 3NBXX 4NW4A 4Z28A 1RXJA 1SRGA 1SWHA 3NR3A 4YDBA 4D6AA 5JR8A 1SLEB 1U18A 1RXHA 2R74A 3CBCA 3P6HA 5B2AO 3T1DA 1N7YA 2F09A 2AT3X 1RLBE 2QOMA 1QQSA 2A13A 4QGXA 2LBVA 5HTDA 4DQ4A 2MHDA 4MEEA 3S5XA 1SXUA 3NADA 2JGSA 2IZBA 4AZRA 3QKGA 4NYQA 3HPEA 2BT9A 2CM4A 3IFBA 4EKVA 4GD9A 4KIIA 1N4JA 2HKDA 2JMBA 1IKEA 2W2BA 3CQRA 1G7NA 1JV4A 2WWPA 4TQ2A 3EW2A 2Z4IA 3ELZA 4WFVA 3B2JA 1AB0A 1SXYA 2RCTA 1IIUA 1IJ8A 3OE3A 2FS7A 4YGZA 5LJDA 1Y55X 3SLJA 5F6BA 1W5RA 3AEHA 1KZXA 4U46A 4WFUA 4NNSA 1LPJA 2ACOA 1Y0GA 1FDQA 2FTBA 2OFRX 4U8UN 1I06A 4ZH9A 5LJGA 2AMMX 3K3LA 5EDCA 1VWOB 1ZNEA 1ZNDA 2I5ZO 3BDRA 3KFHA 3PPTA 4LZVA 3SLTA 3ZI8A 2A5BA 5D8JA 5B5FA 1FELA 2KW1A 1SWQA 1QFTA 1BEBA 4MVIA 1YWBA 1VYGA 1X8OA 1BSYA 1GKAB 2OY8A 5IRAA 2NP1A 1S2PA 1JJXA 2Y3EA 1LCZA 2OY1O 3WBGA 2FT9A 3KVNA 4XMEA 1HQQA 4NLJA 3RSWA 3B2IA 2OF9A 2R56A 2AT8X 3WJDA 1XCAA 2WEWA 1D3SA 2A2GA 1HY2A 2PI3O 2X8SA 4YBUA 5FQ7E 3S5VA 5FENA 1AQBA 1G85A 2UYWA 1SRHA 3HOLA 2OZQA 1NC9A 1TOUA 4GUZA 3SZJA 4INNA 3PEDA 3PH6A 1VWAB 2C4IA 3NQKA 1MX8A 4EDEA 3FR5A 4YGHA 3I17A 4ZFXA 1GGLA 1GKAA 4IABA 2X46A 2OF8A 1HMRA 2AKQA 1QWDA 3TGBA 2LFOA 3DTQA 3RDMA 3ZZVA 3TGCA 1SA8A 1SWUA 2AL0X 4JHQA 1IFBA 5AQ6A 5IRUA 3Q34A 3FW5A 5LKFA 4AZMA 1MX7A 2Q4NA 1MEPA 1SY3A 3FIDA 3VG4A 4NV7A 1DZPA 5H9LA 4L1NA 1ZNGA 3RDOA 3VG5A 1NDJA 1VWMB 1I9HA 2BS5A 5EZ2A 4HFOA 1TXLA 1ZNHA 4FBRA 1KT7A 1AVGI 1OBPA 5IO6A 1SLFB 3FELA 3CKGA 4ORWA 3U9PC 1NQNA 3KZAA 1SWCA 1VWHB 3P02A 5AJCA 1U17A 3I0AA 3D95A 3STNA 3TGAA 3ZUIA 2Q39A 3JQOA 5CHKA 1QY2A 2LKKA 4I6SA 1W6FA 4QAEA 4MVLA 2BLGA 1LICA 1R0UA 1SRJA 3ZQ3A 5HZ9A 2RTPB 1L6MA 1HMSA 2GTLO 4BVMA 1ALBA 1FE3A 1O1VA 1SMPI 3WXQA 1OBQA 1SRIA 1GXAA 2A8GA 2IFBA 2IZJA 1D2UA 2LBAA 2JOZA 2RN4A 3UEWA 1TVQA 2YG2A 2RTAA 2I5VO 2POAA 3KQ0A 4QZUA 1CBQA 4UU2A 4GZVA 1UZ2X 5H9NA 4YFRA 1N43A 1STRB 4IMNA 2IZHB 3WOVA 1DF8A 3LV4A 1N9MA 4IAWA 2RD7C 4EEJA 1BM5A 4I3BA 2LB6A 4Y0PA 3FA6A 5JD2A 2DJGA 2Y3FA 2OFBA 4KCAA 2QMIA 4NLIA 4NNTA 4AZNA 5DG4A 2RTGB 2FHLA 4EXZA 1EIIA 3BX8A 3STMX 1LDQA 3ZUOA 3UEUA 4IB7A 1IKJA 2QCBA 2Q9SA 3DSZA 1EPBA 1LELA 4RUNA 4CPHB 4COTA 1W4TA 3T2WA 5EDBA 3HWDA 1LCVA 2DM5A 4IB6A 1QG5A 3RDXA 2WPUA 3T6FA 4TNNA 2MO5A 2HYSA 4QRLA 3VHHA 5L8IA 2X8TA 1KL4A 1P6PA 4YGGA 4A8ZA 1VWKB 3BLGA 4O9SA 2GH7A 4IB9A 4Z2VA 4ZJ0A 3HWEA 3P6DA 1VWRB 1X8QA 4EFGA 2IZKA 2XKLA 3MG5A 2MM3A 4EQAC 1BWYA 3F8AA 1HBQA 4CPHA 5IXGA 5K06A 1T68X 4GKCA 4Y0QA 1U0XA 2W2FA 3KFFA 2OVDA 2X55A 1ICMA 4U8UM 1JMXA 5BVSA 4IB8A 4KC8A 4GGTA 4R0BA 4OS8A 4TKBA 4O4UA 4UU3A 3LHNA 3VG2A 3SZIA 1IFCA 3B2HA 1LIEA 3RKGA 4GJSA 3H3IA 4YBPA 1KL5A 4TJZA 3F9DA 5B27A 4M6SA 5HCDC 3Q6LA 4FBVA 3D9WA 4MVEA 3RDUA 1EXSA 3EBWA 1BLRA 1YP7A 4IMOA 3NQ9A 3O19A 1ERBA 3C76X 1SY1A 2OL7A 4I60A 5B29A 2GC9A 4Z2OA 4GRJA 1E2TA 4YCEA 3SLOA 3VG6A 1EIOA 1RSTB 5F1EA 2QM9A 1ZNKA 3WJEA 1EI5A 1PM1X 2ASNX 4HPAA 4O3XB 1PBOA 1Z24A 1RXKA 4ZH6A 2WQ9A 1NBXA 1DZJA 1G5WA 1A3YA 1DZMA 1Y52X 1H91A 1SY0A 2RTJA 4O3YA 2CZTA 2AT0X 1JJJA 2HLVA 4XMCA 4AZPA 2Y32A 1I04A 3VE1A 2CAMA 4BX7B 1RBPA 2XSTA 1KT3A 3OD9A 1JBHA 1OEEA 3IA8A 4I9RA 1EUOA 2C1QA 2G5LA 5LKEA 1ML7A 3AUMO 2WSJA 3HTYA 4ORUA 1QABE 1SXWA 4HPDA 1SWTA 4ORRA 5D4AA 4Z6JA 2KD2A 5EEEA 2CBRA 4Z27A 4ES7A 2UZ2A 4YH0A 3P6FA 5LJHA 2LA7A 1RAVA 4GDZA 1SWNA 3PK2A 3KFGA 4BQUA 4BX7A 4CDFA 4GNYA 1AELA 1A18A 2G79A 2PY1A 2RTFB 1GM6A 3GAQA 5KICA 1JZUA 3LTWA 1YUPA 2KTSA 2N93A 1K24A 4HPBA 5AJBA 1E02A 4ALOA 4Z2PA 1SY2A 2QO5A 1CBRA 2DJFA 5LJKA 5B5GA 2M4LA 1DZKA 4I3DA 4BOEA 1SWAA 4GETA 1SWJA 1JQPA 4Y5DA 3FYFA 2ZSCA 5HTEA 4ARHA 3WJBA 2RTRB 1E00A 3ZW1B 1STSB 5HA1A 2FS6A 1GT4A 5F2BA 4RUUA 1JYDA 1LF7A 5HAEA 1IW2A 1VWNB 1VWIB 3MX7A 4YFPA 5D48A 2IZLB 1DF3A 1JJUA 1OBUA 1HXLA 1X71A 3D97A 4ZGUA 1SLGB 2Q2PA 2OL8O 4A1HA 5HCEC 2FRSA 2RTNB 1I05A 2F73A 2JU3A 4JO6A 3UEXA 3PQSA 1DV9A 1Y53X 4D6BA 1VWJB 4ID2A 3ZW1A 5AEOA 2IZAA 2OL6O 3B2LA 1CJ5A 1SWLA 4U8UO 1EALA 4O3WA 3APVA 1WBIA 3RY2A 1E5PA 3S26A 2HZQA 1FEMA 2Z4HA 2BS6A 3KFIA 1HQPA 1SWGA 1MDCA 4KH8A 4OELA 1WUBA 3EM0A 1HXZA 1PTSA 3PH5A 3HWGA 5B10O 1QY1A 1E06A 1VWGB 3F6ZB 4QZTA 1FJ1E 1SWEA 1XKIA 3C77X 4O3ZA 1I78A 1EPAA 1KGLA 3GE2A 1UYOX 3EMMA 4GK9A 3FW4A 1FTPA 3T6LA 1BSQA 2K23A 1SWFA 2RTHB 2G7BA 5HZ5A 3RDSA 5HZ6A 3NX1A 2OVSA 2P8GA 5FQ6E 2A0AA 4LKTA 5CE4A 1BRPA 4N7CA 3STKA 4FGIB 2RQ0A 5IRWA 2RA6A 3JS1A 4DQ3A 4CPFA 4ZHDA 2GJ5A 3E3CA 3PDFA 4LQZA 1YWCA 4IRWA 4CPEA 4ZGFA 2JU8A 5L3YA 2ZAIA 1KT4A 4U3QA 4YDAA 2CZUA 4Y0RA 4WHIA 4A1YA 3V8UA 4MIRA 4GH7A 1T0VA 2VDFA 1KT5A 1VWLB 4DCBA 5LJEA 5H9AA 3AKMA 1MOYA 3CMPA 1OSPO 2OY5O 4CK4A 4YVBA 4NV8A 2IZGB 3MBTA 1GX3A 3BX7A 1PMPA 1QY0A 5IO5A 2CBSA 3S60A 1A2DA 2R73A 4XMGA 2A2UA 3JSQA 3WZQA 3VGWA 1S44A 2OFMX 4DNEA 3HWFA 1JYJA 4KC7A 4CSBA 5HZ8A 2JU7A 1YWAA 2RTEB 3CKFA 3P6CA 3TF6A 1LIFA 2IZFB 3FDCA 3PECA 3RBYA 4XMHA 1B56A 3WJFA 1VWCB 2NNEA 1N0SA 1MVGA 3APWA 2QO6A 4ML7B 1QFVA 1UYNX 3D4RA 4QYPA 5KIDA 4NP1A 5H8TA 1PEEA 4HPCA 2E4JA 4QQ1A 4ZHFA 1BSOA 1HN2A 1SLDB 5CYBA 5LJBA 1PBYA 1SWKA 3MVFA 4OMWA 5F58A 3NX2A 4U9CA 5EEDA 2ZAGA 2RTKA 1LNMA 3ZW0B 1SWOA 2RTIB 3RE5A 1BJ7A 4WBKA 1NP4A 2FR2A 1MK5A 1OEKA 1Y9LA 4FQBB 1STPA 1SWPA 1X89A 2RTCB 2X34A 3APUA 4ODDA 4AW8A 4B55A 1LIBA 1AVEA 1LFOA 5F7GA 3EC5A 2RTDB 3NQ3A 4JNJA 4NYRA 4QYNA 3CR6A 3RY1A 4ALBA 3L4RA 2RTOB 3WZPA 4AZQA 2X56A 2KTDA 4C5PA 4M7MA 2X8FA 4K19A 4ZHGA 3ZW0A 3WJCA 2FKJA 2ALLX 1LDOA 2CM9A 2NNQA 1KXOA 3PP6A 4GU8A 4BX5B 4TKHA 3FENA 3SAOA 4I9SA 3WYQA 1LUQA 4IBAA 5HZQA 1GX9A 1X8UA 3HK1A 4O49A 1G74A 4GGRA 4YFQA 1ACDA 3BY0A 4XMDA 3BU9A 4GNWA 2QO4A 4TLJA 1B8EA 2BC3A 3WYPA 1VPRA 4QGVA 4OMXA 5B3MO 2NNDA 3OJYC 4BX5A 2EU7X 1SWSA 1KZWA 1ADLA 1AVDA 3ZW2A 5LJCA 3RE6A 2HMBA 1NP1A 1VWDB 1ZRYA 1UREA 1KL3A 2G8CO
chains in the Genus database with same CATH topology
1OPBA 2GTLN 3FEPA 4XMFA 3ZWEA 3CWKA 4OS3A 3RWXA 1DC9A 4OS0A 1Y9TA 4O4OA 2OVEA 1YP6A 3VU1A 3CBSA 4LKPA 4ORSA 1OPAA 3G7XA 4QGWA 2JW1A 1ZNLA 1SXXA 3HOEA 4ON1A 3VG7A 1LIDA 1JIWI 3FLLA 3FEKA 3P24A 4FBOA 2HNXA 2ACPX 3FA8A 4JGLA 1DFVA 1YIVA 2HZRA 2YMSA 1O8VA 4YMYA 3NP1A 1ERXA 4N7DA 2L67A 5FAZA 5L8NA 2FLJA 4O4XA 3NPOA 4PJ2A 4CV7A 4I3CA 4ORYA 2MJIA 3FR2A 5D45A 2FWVA 2AT6X 3FA9A 4ORXA 2KT4B 5DPQA 1B0OA 1LKEA 2QOSC 4L3RA 3UAQA 3BU1A 1HBPA 4LZUA 3BRNA 4IAXA 5L8OA 4O4SA 4AZOA 2FR3A 5KHPA 5BVQA 4ZHCA 1TOWA 2WR6A 1BBPA 3RZYA 1O1UA 5HWZA 3U03A 5HA0A 4MISA 4KT5A 1GX8A 5HBSA 2OVAA 3C78X 3EYCA 1S7DA 2A3FX 5C0NA 4HWMA 1X8NA 5BVTA 2G78A 2X45A 3APXA 2GTFX 1GT1A 1ICNA 5BYPA 4YCHA 5FQ8E 1GT5A 1FENA 3D96A 3UEVA 3VE2A 5EPQA 1I4UA 2AT5X 1A57A 1CRBA 3WVMA 3VPJE 1NGLA 3TZSA 3ELXA 1YWDA 4A60A 2JN3A 1MUPA 1TW4A 1T8VA 2ANSA 4YKMA 2WQAE 4GE1A 1KQWA 4YKOA 5D47A 2AH7X 4MVKA 4TKJA 1BRQA 3CQNA 1EW3A 5FFHA 1CBIA 3P6EA 3P6GA 3FA7A 2WEXA 5H9KA 2WUTA 3FMZA 3BS2A 1EQDA 3FR4A 3PQUA 3WJGA 1CBSA 1HMTA 3FIQA 1GT3A 5IO7A 3N91A 1KQXA 3EBKA 2RCQA 3AKNA 3BSZE 2K62A 3OBLA 1X8PA 3SOTA 1B4MA 2L5PA 5F6ZA 2W2AA 4PSQA 2Q2MA 2L68A 2O62A 3O2YA 4I95A 1VYFA 4ZHHA 3VG3A 4AYHA 3U0DA 5HCCC 1OEJA 2GTLM 3B2KA 1KT6A 4QNIA 3O22A 2L9CA 2MWHA 4Y0SA 2BHVA 4ZCBA 4ZR2A 1KOIA 3NBXX 4NW4A 3NR3A 4YDBA 5JR8A 4D6AA 2R74A 1U18A 3CBCA 3P6HA 3T1DA 4QGXA 2F09A 2AT3X 1RLBE 2LBVA 1QQSA 2A13A 5HTDA 4DQ4A 2MHDA 3S5XA 1SXUA 3NADA 4AZRA 3QKGA 4NYQA 2BT9A 2CM4A 3IFBA 4KIIA 2JMBA 1IKEA 2W2BA 3CQRA 1G7NA 1JV4A 2WWPA 4TQ2A 2Z4IA 3ELZA 4WFVA 3B2JA 1AB0A 1SXYA 2RCTA 1IIUA 3OE3A 4YGZA 2FS7A 5LJDA 5F6BA 1KZXA 4WFUA 4NNSA 1LPJA 2OFRX 2ACOA 1FDQA 2FTBA 4U8UN 4ZH9A 1I06A 5LJGA 4YBPA 2AMMX 3K3LA 5EDCA 1ZNEA 1ZNDA 3BDRA 3KFHA 3PPTA 4LZVA 3ZI8A 5HZ5A 5D8JA 1FELA 2KW1A 1QFTA 1BEBA 4MVIA 1YWBA 1VYGA 1X8OA 1BSYA 1GKAB 2NP1A 1S2PA 1JJXA 3WBGA 2FT9A 4XMEA 3RSWA 4NLJA 3B2IA 2R56A 3WJDA 2AT8X 1XCAA 2WEWA 1D3SA 2A2GA 2X8SA 4YBUA 5FQ7E 5FENA 3S5VA 1AQBA 1G85A 3HOLA 2OZQA 1TOUA 4INNA 3PEDA 3PH6A 3NQKA 1MX8A 4EDEA 3FR5A 4YGHA 3I17A 4ZFXA 1GGLA 1GKAA 4IABA 2X46A 1HMRA 2AKQA 1QWDA 3TGBA 2LFOA 3DTQA 3ZZVA 3TGCA 1SA8A 5AQ6A 2AL0X 1IFBA 5LKFA 4AZMA 3FW5A 1MX7A 2Q4NA 1SY3A 3VG4A 1DZPA 5H9LA 4L1NA 1ZNGA 3VG5A 2BS5A 5EZ2A 4HFOA 1TXLA 1ZNHA 4FBRA 1KT7A 1AVGI 1OBPA 5IO6A 3FELA 4ORWA 3U9PC 3KZAA 3P02A 5AJCA 1U17A 3I0AA 3D95A 3STNA 3TGAA 3ZUIA 2Q39A 3JQOA 1QY2A 2LKKA 4I6SA 4QAEA 4MVLA 2BLGA 1LICA 1R0UA 3ZQ3A 5HZ9A 1L6MA 1HMSA 2GTLO 4BVMA 1ALBA 1FE3A 1O1VA 1SMPI 3WXQA 1OBQA 1GXAA 2LBAA 2IFBA 3UEWA 1D2UA 2JOZA 2RN4A 1TVQA 2YG2A 2POAA 3KQ0A 4QZUA 1CBQA 4UU2A 4GZVA 1UZ2X 5H9NA 4YFRA 4IMNA 3WOVA 3LV4A 4IAWA 2RD7C 4EEJA 1BM5A 4I3BA 2LB6A 4Y0PA 3FA6A 4NLIA 4KCAA 2QMIA 4NNTA 4AZNA 5DG4A 4EXZA 1EIIA 3BX8A 3STMX 3ZUOA 3UEUA 4IB7A 1IKJA 4COTA 2Q9SA 3DSZA 1EPBA 4RUNA 5EDBA 3HWDA 2DM5A 4IB6A 1QG5A 4TNNA 2MO5A 2HYSA 4QRLA 5L8IA 2X8TA 1P6PA 4YGGA 4A8ZA 4ZJ0A 3BLGA 4O9SA 4IB9A 3HWEA 3P6DA 1X8QA 4EFGA 2XKLA 4EQAC 2MM3A 1BWYA 3F8AA 1HBQA 5K06A 1T68X 4GKCA 4Y0QA 1U0XA 2W2FA 3KFFA 2OVDA 1ICMA 4U8UM 5BVSA 4IB8A 4KC8A 4R0BA 4TKBA 4OS8A 4O4UA 4UU3A 3LHNA 3VG2A 1IFCA 3B2HA 1LIEA 3RKGA 3H3IA 4TJZA 3F9DA 5B27A 4M6SA 5HCDC 3Q6LA 4FBVA 4MVEA 1EXSA 3EBWA 1BLRA 1YP7A 4IMOA 3NQ9A 3O19A 1ERBA 3C76X 1SY1A 5B29A 2GC9A 4GRJA 4YCEA 3VG6A 1EIOA 5F1EA 2QM9A 1ZNKA 3WJEA 1EI5A 1PM1X 2ASNX 4HPAA 4O3XB 1PBOA 1Z24A 4ZH6A 2WQ9A 1DZJA 1G5WA 1A3YA 1DZMA 1H91A 1SY0A 1JJJA 4O3YA 2CZTA 2AT0X 2HLVA 4XMCA 4AZPA 1I04A 3VE1A 1RBPA 2XSTA 1KT3A 3OD9A 1JBHA 1OEEA 3IA8A 4I9RA 1EUOA 5LKEA 1ML7A 2WSJA 3HTYA 4ORUA 1QABE 1SXWA 4HPDA 4ORRA 5D4AA 2KD2A 5EEEA 2CBRA 4ES7A 4YH0A 3P6FA 5LJHA 2LA7A 4GDZA 1AELA 3KFGA 4BQUA 4GNYA 1A18A 2G79A 2PY1A 1GM6A 3GAQA 5KICA 1JZUA 1YUPA 2KTSA 2N93A 4HPBA 5LJKA 5AJBA 1E02A 1SY2A 2QO5A 1CBRA 2M4LA 1DZKA 4I3DA 4BOEA 4GETA 3FYFA 4ARHA 5HTEA 3WJBA 1E00A 3ZW1B 5HA1A 2FS6A 1GT4A 4RUUA 1JYDA 1LF7A 5HAEA 1IW2A 4YFPA 3MX7A 5D48A 1DF3A 1OBUA 1X71A 3D97A 4ZGUA 2Q2PA 4A1HA 5HCEC 2FRSA 1I05A 2F73A 2JU3A 3UEXA 1DV9A 3PQSA 4D6BA 4ID2A 3ZW1A 5AEOA 3B2LA 1CJ5A 4U8UO 1EALA 4O3WA 3APVA 1E5PA 3S26A 2HZQA 1FEMA 2Z4HA 2BS6A 3KFIA 1HQPA 1MDCA 4KH8A 3EM0A 3PH5A 3HWGA 1QY1A 1E06A 4QZTA 3F6ZB 4O3ZA 1XKIA 3C77X 1EPAA 1KGLA 3GE2A 3EMMA 4GK9A 3FW4A 1FTPA 1BSQA 2K23A 5HZ6A 2G7BA 3NX1A 2OVSA 2P8GA 5FQ6E 2A0AA 4LKTA 5CE4A 1BRPA 4N7CA 3STKA 4FGIB 2RQ0A 2RA6A 3JS1A 4DQ3A 4ZHDA 2GJ5A 3E3CA 4LQZA 1YWCA 4ZGFA 2JU8A 2ZAIA 1KT4A 4U3QA 4YDAA 2CZUA 4Y0RA 4WHIA 4A1YA 3V8UA 4MIRA 4GH7A 1T0VA 1KT5A 5LJEA 5H9AA 3AKMA 3CMPA 4CK4A 3MBTA 3BX7A 1PMPA 1QY0A 5IO5A 2CBSA 3S60A 1A2DA 2R73A 4XMGA 2A2UA 3JSQA 1S44A 2OFMX 3HWFA 1JYJA 4KC7A 4CSBA 5HZ8A 2JU7A 1YWAA 3P6CA 3TF6A 1LIFA 3PECA 3RBYA 4XMHA 1B56A 3WJFA 2NNEA 1N0SA 1MVGA 3APWA 2QO6A 4ML7B 1QFVA 3D4RA 4QYPA 5KIDA 4NP1A 5H8TA 1PEEA 4HPCA 2E4JA 4QQ1A 4ZHFA 1BSOA 1HN2A 5CYBA 5LJBA 5F58A 3MVFA 4OMWA 3NX2A 4U9CA 5EEDA 2ZAGA 3ZW0B 1LNMA 4ALOA 1BJ7A 4WBKA 1NP4A 2FR2A 1OEKA 4FQBB 1Y9LA 1X89A 3APUA 4ODDA 4AW8A 1LIBA 1LFOA 5F7GA 4QYNA 4ALBA 3NQ3A 4NYRA 3CR6A 3L4RA 4AZQA 4ZHGA 2KTDA 4M7MA 2X8FA 4K19A 3ZW0A 3WJCA 2ALLX 2CM9A 2NNQA 3PP6A 1KXOA 4GU8A 4TKHA 3FENA 3SAOA 4I9SA 4IBAA 5HZQA 1GX9A 1X8UA 3HK1A 4O49A 1G74A 4YFQA 1ACDA 3BY0A 4XMDA 3BU9A 4GNWA 2QO4A 4TLJA 1B8EA 1VPRA 4QGVA 4OMXA 2NNDA 3OJYC 2EU7X 1KZWA 1ADLA 3ZW2A 5LJCA 2HMBA 1NP1A 1ZRYA 1UREA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OPB A;  3FEP A;  4XMF A;  3CWK A;  4OS3 A;  1DC9 A;  4OS0 A;  2OVE A;  1YP6 A;  3CBS A;  4LKP A;  4ORS A;  1OPA A;  3G7X A;  4QGW A;  1ZNL A;  1SXX A;  3VG7 A;  1LID A;  3FLL A;  3FEK A;  2HNX A;  2ACP X;  3FA8 A;  1DFV A;  1YIV A;  2HZR A;  1O8V A;  4YMY A;  3NP1 A;  1ERX A;  4N7D A;  2L67 A;  5FAZ A;  5L8N A;  2FLJ A;  3NPO A;  4I3C A;  4ORY A;  2MJI A;  3FR2 A;  5D45 A;  2FWV A;  2AT6 X;  3FA9 A;  4ORX A;  2KT4 B;  5DPQ A;  1B0O A;  1LKE A;  2QOS C;  5LKE A;  3BU1 A;  1HBP A;  4LZU A;  3BRN A;  4IAX A;  5L8O A;  4AZO A;  2FR3 A;  5KHP A;  5BVQ A;  4ZHC A;  1TOW A;  2WR6 A;  1BBP A;  3RZY A;  1O1U A;  5HWZ A;  3U03 A;  5HA0 A;  1GX8 A;  5HBS A;  2OVA A;  3C78 X;  3EYC A;  1S7D A;  2A3F X;  5C0N A;  1X8N A;  5BVT A;  2G78 A;  2X45 A;  3APX A;  2GTF X;  1GT1 A;  1ICN A;  4YCH A;  1GT5 A;  1FEN A;  3D96 A;  3UEV A;  5EPQ A;  1I4U A;  2AT5 X;  1A57 A;  1CRB A;  3WVM A;  1NGL A;  3TZS A;  3ELX A;  1YWD A;  4A60 A;  2JN3 A;  1MUP A;  1TW4 A;  1T8V A;  2ANS A;  4YKM A;  2WQA E;  4GE1 A;  1KQW A;  4YKO A;  5D47 A;  2AH7 X;  4MVK A;  4TKJ A;  1BRQ A;  3CQN A;  1EW3 A;  5FFH A;  1CBI A;  3P6E A;  3P6G A;  3FA7 A;  2WEX A;  5H9K A;  2WUT A;  3FMZ A;  3BS2 A;  1EQD A;  3FR4 A;  3WJG A;  1CBS A;  1HMT A;  3FIQ A;  1GT3 A;  5IO7 A;  1KQX A;  3EBK A;  2RCQ A;  3AKN A;  3BSZ E;  2K62 A;  1X8P A;  1B4M A;  2L5P A;  5F6Z A;  2W2A A;  4PSQ A;  2Q2M A;  2L68 A;  2O62 A;  3O2Y A;  1VYF A;  4ZHH A;  3VG3 A;  4AYH A;  3U0D A;  5HCC C;  1OEJ A;  3B2K A;  1KT6 A;  3O22 A;  2L9C A;  4ZCB A;  4Y0S A;  4ZR2 A;  1KOI A;  3NR3 A;  4YDB A;  5JR8 A;  4D6A A;  2R74 A;  1U18 A;  3CBC A;  3P6H A;  3T1D A;  4QGX A;  2AT3 X;  1RLB E;  2LBV A;  1QQS A;  2A13 A;  5HTD A;  4DQ4 A;  1SXU A;  3NAD A;  4AZR A;  3QKG A;  4NYQ A;  2CM4 A;  3IFB A;  4KII A;  1IKE A;  2W2B A;  3CQR A;  1G7N A;  1JV4 A;  2WWP A;  4TQ2 A;  3ELZ A;  4WFV A;  3B2J A;  1AB0 A;  1SXY A;  2RCT A;  1IIU A;  4YGZ A;  5LJD A;  2FS7 A;  5F6B A;  1KZX A;  4WFU A;  4NNS A;  1LPJ A;  2OFR X;  2ACO A;  1FDQ A;  2FTB A;  4ZH9 A;  5LJG A;  1I06 A;  4YBP A;  2AMM X;  3K3L A;  5EDC A;  1ZNE A;  1ZND A;  3BDR A;  3KFH A;  3PPT A;  4LZV A;  5HZ5 A;  5D8J A;  1FEL A;  1QFT A;  1BEB A;  4MVI A;  1YWB A;  1VYG A;  1X8O A;  1BSY A;  1GKA B;  2NP1 A;  1S2P A;  1JJX A;  3WBG A;  2FT9 A;  4XME A;  3RSW A;  4NLJ A;  3B2I A;  2R56 A;  3WJD A;  2AT8 X;  1XCA A;  2WEW A;  1D3S A;  2A2G A;  4YBU A;  5FEN A;  1AQB A;  1G85 A;  2OZQ A;  1TOU A;  3PED A;  3PH6 A;  1MX8 A;  4EDE A;  3FR5 A;  4YGH A;  3I17 A;  4ZFX A;  1GGL A;  1GKA A;  2X46 A;  1HMR A;  2AKQ A;  1QWD A;  3TGB A;  2LFO A;  3DTQ A;  3TGC A;  1SA8 A;  5AQ6 A;  2AL0 X;  1IFB A;  5LKF A;  4AZM A;  3FW5 A;  1MX7 A;  2Q4N A;  1SY3 A;  3VG4 A;  1DZP A;  5H9L A;  1ZNG A;  3VG5 A;  5EZ2 A;  4HFO A;  1TXL A;  1ZNH A;  1KT7 A;  1AVG I;  1OBP A;  5IO6 A;  3FEL A;  4ORW A;  3U9P C;  3KZA A;  3ZUI A;  1U17 A;  3I0A A;  3D95 A;  3STN A;  3TGA A;  2Q39 A;  1QY2 A;  2LKK A;  4QAE A;  4MVL A;  2BLG A;  1LIC A;  1R0U A;  3ZQ3 A;  5HZ9 A;  1L6M A;  1HMS A;  4BVM A;  1ALB A;  1FE3 A;  1O1V A;  3WXQ A;  1OBQ A;  1GXA A;  2LBA A;  2IFB A;  3UEW A;  1D2U A;  2JOZ A;  1TVQ A;  2YG2 A;  2POA A;  3KQ0 A;  4QZU A;  1CBQ A;  4UU2 A;  1UZ2 X;  5H9N A;  4YFR A;  4IMN A;  4IAW A;  2RD7 C;  4EEJ A;  1BM5 A;  4I3B A;  2LB6 A;  4Y0P A;  3FA6 A;  4NLI A;  4NNT A;  4AZN A;  5DG4 A;  4EXZ A;  1EII A;  3BX8 A;  3STM X;  3ZUO A;  3UEU A;  4IB7 A;  1IKJ A;  2Q9S A;  3DSZ A;  1EPB A;  4RUN A;  5EDB A;  3HWD A;  2DM5 A;  4IB6 A;  1QG5 A;  4TNN A;  2MO5 A;  2HYS A;  5L8I A;  1P6P A;  4YGG A;  4A8Z A;  4ZJ0 A;  3BLG A;  4O9S A;  4IB9 A;  3HWE A;  3P6D A;  1X8Q A;  4EFG A;  2XKL A;  2MM3 A;  1BWY A;  3F8A A;  1HBQ A;  5K06 A;  1T68 X;  4GKC A;  4Y0Q A;  1U0X A;  2W2F A;  3KFF A;  2OVD A;  1ICM A;  5BVS A;  4IB8 A;  4R0B A;  4TKB A;  4OS8 A;  4UU3 A;  3VG2 A;  1IFC A;  3B2H A;  1LIE A;  4TJZ A;  3F9D A;  5B27 A;  4M6S A;  5HCD C;  3Q6L A;  1EXS A;  3EBW A;  1BLR A;  1YP7 A;  4IMO A;  3NQ9 A;  3O19 A;  1ERB A;  3C76 X;  1SY1 A;  5B29 A;  2GC9 A;  4GRJ A;  4YCE A;  3VG6 A;  1EIO A;  5F1E A;  2QM9 A;  1ZNK A;  3WJE A;  4HPA A;  1PM1 X;  2ASN X;  1PBO A;  1Z24 A;  4ZH6 A;  2WQ9 A;  1DZJ A;  1G5W A;  1A3Y A;  1DZM A;  1H91 A;  1SY0 A;  1JJJ A;  2CZT A;  2AT0 X;  2HLV A;  4XMC A;  4AZP A;  1I04 A;  1RBP A;  2XST A;  1KT3 A;  1JBH A;  1OEE A;  3IA8 A;  4I9R A;  1EUO A;  1ML7 A;  2WSJ A;  4ORU A;  1QAB E;  1SXW A;  4HPD A;  4ORR A;  5D4A A;  5EEE A;  2CBR A;  4ES7 A;  4YH0 A;  3P6F A;  5LJH A;  1AEL A;  3KFG A;  4BQU A;  4GNY A;  1A18 A;  2G79 A;  2PY1 A;  1GM6 A;  3GAQ A;  5KIC A;  1JZU A;  1YUP A;  2N93 A;  4HPB A;  5LJK A;  1E02 A;  1SY2 A;  2QO5 A;  1CBR A;  1DZK A;  4I3D A;  4BOE A;  4GET A;  4ARH A;  5HTE A;  3WJB A;  1E00 A;  5HA1 A;  2FS6 A;  1GT4 A;  4RUU A;  1JYD A;  1LF7 A;  5HAE A;  1IW2 A;  4YFP A;  5D48 A;  1DF3 A;  1OBU A;  1X71 A;  3D97 A;  4ZGU A;  2Q2P A;  4A1H A;  5HCE C;  2FRS A;  1I05 A;  2F73 A;  2JU3 A;  3UEX A;  1DV9 A;  4D6B A;  3B2L A;  1CJ5 A;  1EAL A;  3APV A;  1E5P A;  3S26 A;  2HZQ A;  1FEM A;  3KFI A;  1HQP A;  1MDC A;  3EM0 A;  3PH5 A;  3HWG A;  1QY1 A;  1E06 A;  4QZT A;  1XKI A;  3C77 X;  1EPA A;  1KGL A;  3EMM A;  3FW4 A;  1FTP A;  1BSQ A;  2K23 A;  5HZ6 A;  2G7B A;  3NX1 A;  2P8G A;  2A0A A;  4LKT A;  5CE4 A;  1BRP A;  4N7C A;  3STK A;  2RQ0 A;  2RA6 A;  3JS1 A;  4DQ3 A;  4ZHD A;  2GJ5 A;  1YWC A;  2JU8 A;  1KT4 A;  4YDA A;  2CZU A;  4Y0R A;  4A1Y A;  4GH7 A;  1T0V A;  1KT5 A;  5LJE A;  5H9A A;  3AKM A;  3CMP A;  4CK4 A;  3MBT A;  3BX7 A;  1PMP A;  1QY0 A;  5IO5 A;  2CBS A;  1A2D A;  2R73 A;  4XMG A;  2A2U A;  3JSQ A;  1S44 A;  2OFM X;  3HWF A;  1JYJ A;  5HZ8 A;  2JU7 A;  1YWA A;  3P6C A;  3TF6 A;  1LIF A;  3PEC A;  4XMH A;  1B56 A;  3WJF A;  2NNE A;  1N0S A;  1MVG A;  3APW A;  2QO6 A;  1QFV A;  4QYP A;  5KID A;  4NP1 A;  5H8T A;  1PEE A;  4HPC A;  2E4J A;  4ZHF A;  1BSO A;  1HN2 A;  5LJB A;  5F58 A;  3MVF A;  4OMW A;  3NX2 A;  4ALO A;  5EED A;  1LNM A;  1BJ7 A;  4WBK A;  1NP4 A;  2FR2 A;  1OEK A;  1X89 A;  3APU A;  4ODD A;  4AW8 A;  1LIB A;  1LFO A;  5F7G A;  4QYN A;  4ALB A;  3NQ3 A;  4NYR A;  3CR6 A;  3L4R A;  4AZQ A;  4ZHG A;  2KTD A;  4M7M A;  4K19 A;  3WJC A;  2ALL X;  2CM9 A;  2NNQ A;  3PP6 A;  1KXO A;  4TKH A;  3FEN A;  3SAO A;  4I9S A;  4IBA A;  5HZQ A;  1GX9 A;  1X8U A;  3HK1 A;  1G74 A;  4YFQ A;  1ACD A;  3BY0 A;  4XMD A;  3BU9 A;  4GNW A;  2QO4 A;  4TLJ A;  1B8E A;  1VPR A;  4QGV A;  4OMX A;  2NND A;  3OJY C;  2EU7 X;  1KZW A;  1ADL A;  5LJC A;  2HMB A;  1NP1 A;  1ZRY A;  1URE A; 
#chains in the Genus database with same CATH topology
 1OPB A;  4OEM A;  2GTL N;  3FEP A;  2C1S A;  4XMF A;  3ZWE A;  3CWK A;  4OS3 A;  3RWX A;  1DC9 A;  1NQM A;  4OS0 A;  1Y9T A;  4O4O A;  2VFB A;  2OVE A;  1YP6 A;  2VFC A;  3VU1 A;  3CBS A;  1LCW A;  3WZO A;  4LKP A;  3WZN A;  4ORS A;  1OPA A;  3QQ2 A;  3G7X A;  2RTB B;  2JW1 A;  1ZNL A;  4QGW A;  5B11 O;  1SXX A;  3HOE A;  4ON1 A;  3VG7 A;  3RDQ A;  1LID A;  1JIW I;  4BX6 B;  3FLL A;  3FEK A;  3P24 A;  4FBO A;  2HNX A;  2ACP X;  3FA8 A;  1VWQ B;  1RSU B;  4JGL A;  1DFV A;  1YIV A;  2HZR A;  2YMS A;  1O8V A;  2FGS A;  4CDE A;  4YMY A;  2X4M A;  3NP1 A;  1ERX A;  4N7D A;  2L67 A;  5FAZ A;  5L8N A;  2FLJ A;  4O4X A;  3NPO A;  4PJ2 A;  4CV7 A;  4I3C A;  4ORY A;  2MJI A;  3FR2 A;  5D45 A;  2FWV A;  5K68 A;  4BX6 A;  2AT6 X;  3FA9 A;  4ORX A;  2KT4 B;  5DPQ A;  1B0O A;  1LKE A;  2QOS C;  4L3R A;  3UAQ A;  3BU1 A;  1HBP A;  4LZU A;  3BRN A;  3EW1 A;  4IAX A;  5K67 A;  4CDC A;  5L8O A;  4O4S A;  4AZO A;  2FR3 A;  1VWB B;  5BVQ A;  5KHP A;  2BSZ A;  4ZHC A;  1TOW A;  2WR6 A;  4OKA A;  1BBP A;  3SZH A;  1VWE B;  3RZY A;  1O1U A;  5HWZ A;  3U03 A;  5HA0 A;  4MIS A;  4KT5 A;  1GX8 A;  5HBS A;  3T2X A;  4GJV A;  2AF5 A;  2FKG A;  2OVA A;  4GDA A;  3C78 X;  3EYC A;  1S7D A;  2X32 A;  2A3F X;  2RTM A;  2FHN X;  5C0N A;  4HWM A;  1X8N A;  5BVT A;  2G78 A;  2X45 A;  3APX A;  2GTF X;  1GT1 A;  1ICN A;  5BYP A;  4YCH A;  5FQ8 E;  5CSE A;  1SWR A;  1GT5 A;  1FEN A;  3D96 A;  3UEV A;  3VE2 A;  5EPQ A;  1MM9 A;  1I4U A;  2AT5 X;  1A57 A;  1VWF B;  1CRB A;  2RTL A;  2RTQ B;  3WVM A;  3VPJ E;  1N9Y A;  1NGL A;  3ELX A;  1YWD A;  4A60 A;  3TZS A;  2JN3 A;  1MUP A;  4CDD A;  1TW4 A;  1T8V A;  2ANS A;  4YKM A;  2WQA E;  4BJ8 A;  4GE1 A;  1KQW A;  1K3B A;  4YKO A;  5D47 A;  4MVK A;  4TKJ A;  3MM0 A;  2AH7 X;  2OFA A;  1BRQ A;  3CQN A;  1SWB A;  1EW3 A;  2IZC B;  5FFH A;  1CBI A;  3P6E A;  2A5C A;  4GGZ A;  3P6G A;  3VHI A;  2IZI A;  3FA7 A;  2WEX A;  1VWP B;  3VHM A;  5H9K A;  2AVI A;  2WUT A;  2F01 A;  3FMZ A;  3BS2 A;  1EQD A;  3FR4 A;  3PQU A;  3WJG A;  1CBS A;  1HMT A;  1SRE A;  1GT3 A;  2IZD B;  3FIQ A;  4CPI A;  5IO7 A;  3N91 A;  1KQX A;  3EBK A;  2RCQ A;  3AKN A;  1KFF A;  3BSZ E;  2K62 A;  3OBL A;  1X8P A;  3SOT A;  1B4M A;  2IZE B;  2L5P A;  5F6Z A;  2W2A A;  1VYO A;  4Y59 A;  2MF6 A;  4PSQ A;  2Q2M A;  2L68 A;  2O62 A;  1SRF A;  3O2Y A;  1VYF A;  4I95 A;  3VG3 A;  1JMZ A;  4AYH A;  4BBO A;  4ZHH A;  3U0D A;  5HCC C;  1OEJ A;  1SWD A;  2GTL M;  1KT6 A;  3B2K A;  2OYB O;  2OY7 A;  4QNI A;  4BCS A;  3X00 A;  3O22 A;  2L9C A;  2MWH A;  4Y0S A;  2BHV A;  4ZCB A;  4BGF A;  4ZR2 A;  1KOI A;  3NBX X;  4NW4 A;  4Z28 A;  1RXJ A;  1SRG A;  1SWH A;  3NR3 A;  4YDB A;  4D6A A;  5JR8 A;  1SLE B;  1U18 A;  1RXH A;  2R74 A;  3CBC A;  3P6H A;  5B2A O;  3T1D A;  1N7Y A;  2F09 A;  2AT3 X;  1RLB E;  2QOM A;  1QQS A;  2A13 A;  4QGX A;  2LBV A;  5HTD A;  4DQ4 A;  2MHD A;  4MEE A;  3S5X A;  1SXU A;  3NAD A;  2JGS A;  2IZB A;  4AZR A;  3QKG A;  4NYQ A;  3HPE A;  2BT9 A;  2CM4 A;  3IFB A;  4EKV A;  4GD9 A;  4KII A;  1N4J A;  2HKD A;  2JMB A;  1IKE A;  2W2B A;  3CQR A;  1G7N A;  1JV4 A;  2WWP A;  4TQ2 A;  3EW2 A;  2Z4I A;  3ELZ A;  4WFV A;  3B2J A;  1AB0 A;  1SXY A;  2RCT A;  1IIU A;  1IJ8 A;  3OE3 A;  2FS7 A;  4YGZ A;  5LJD A;  1Y55 X;  3SLJ A;  5F6B A;  1W5R A;  3AEH A;  1KZX A;  4U46 A;  4WFU A;  4NNS A;  1LPJ A;  2ACO A;  1Y0G A;  1FDQ A;  2FTB A;  2OFR X;  4U8U N;  1I06 A;  4ZH9 A;  5LJG A;  2AMM X;  3K3L A;  5EDC A;  1VWO B;  1ZNE A;  1ZND A;  2I5Z O;  3BDR A;  3KFH A;  3PPT A;  4LZV A;  3SLT A;  3ZI8 A;  2A5B A;  5D8J A;  5B5F A;  1FEL A;  2KW1 A;  1SWQ A;  1QFT A;  1BEB A;  4MVI A;  1YWB A;  1VYG A;  1X8O A;  1BSY A;  1GKA B;  2OY8 A;  5IRA A;  2NP1 A;  1S2P A;  1JJX A;  2Y3E A;  1LCZ A;  2OY1 O;  3WBG A;  2FT9 A;  3KVN A;  4XME A;  1HQQ A;  4NLJ A;  3RSW A;  3B2I A;  2OF9 A;  2R56 A;  2AT8 X;  3WJD A;  1XCA A;  2WEW A;  1D3S A;  2A2G A;  1HY2 A;  2PI3 O;  2X8S A;  4YBU A;  5FQ7 E;  3S5V A;  5FEN A;  1AQB A;  1G85 A;  2UYW A;  1SRH A;  3HOL A;  2OZQ A;  1NC9 A;  1TOU A;  4GUZ A;  3SZJ A;  4INN A;  3PED A;  3PH6 A;  1VWA B;  2C4I A;  3NQK A;  1MX8 A;  4EDE A;  3FR5 A;  4YGH A;  3I17 A;  4ZFX A;  1GGL A;  1GKA A;  4IAB A;  2X46 A;  2OF8 A;  1HMR A;  2AKQ A;  1QWD A;  3TGB A;  2LFO A;  3DTQ A;  3RDM A;  3ZZV A;  3TGC A;  1SA8 A;  1SWU A;  2AL0 X;  4JHQ A;  1IFB A;  5AQ6 A;  5IRU A;  3Q34 A;  3FW5 A;  5LKF A;  4AZM A;  1MX7 A;  2Q4N A;  1MEP A;  1SY3 A;  3FID A;  3VG4 A;  4NV7 A;  1DZP A;  5H9L A;  4L1N A;  1ZNG A;  3RDO A;  3VG5 A;  1NDJ A;  1VWM B;  1I9H A;  2BS5 A;  5EZ2 A;  4HFO A;  1TXL A;  1ZNH A;  4FBR A;  1KT7 A;  1AVG I;  1OBP A;  5IO6 A;  1SLF B;  3FEL A;  3CKG A;  4ORW A;  3U9P C;  1NQN A;  3KZA A;  1SWC A;  1VWH B;  3P02 A;  5AJC A;  1U17 A;  3I0A A;  3D95 A;  3STN A;  3TGA A;  3ZUI A;  2Q39 A;  3JQO A;  5CHK A;  1QY2 A;  2LKK A;  4I6S A;  1W6F A;  4QAE A;  4MVL A;  2BLG A;  1LIC A;  1R0U A;  1SRJ A;  3ZQ3 A;  5HZ9 A;  2RTP B;  1L6M A;  1HMS A;  2GTL O;  4BVM A;  1ALB A;  1FE3 A;  1O1V A;  1SMP I;  3WXQ A;  1OBQ A;  1SRI A;  1GXA A;  2A8G A;  2IFB A;  2IZJ A;  1D2U A;  2LBA A;  2JOZ A;  2RN4 A;  3UEW A;  1TVQ A;  2YG2 A;  2RTA A;  2I5V O;  2POA A;  3KQ0 A;  4QZU A;  1CBQ A;  4UU2 A;  4GZV A;  1UZ2 X;  5H9N A;  4YFR A;  1N43 A;  1STR B;  4IMN A;  2IZH B;  3WOV A;  1DF8 A;  3LV4 A;  1N9M A;  4IAW A;  2RD7 C;  4EEJ A;  1BM5 A;  4I3B A;  2LB6 A;  4Y0P A;  3FA6 A;  5JD2 A;  2DJG A;  2Y3F A;  2OFB A;  4KCA A;  2QMI A;  4NLI A;  4NNT A;  4AZN A;  5DG4 A;  2RTG B;  2FHL A;  4EXZ A;  1EII A;  3BX8 A;  3STM X;  1LDQ A;  3ZUO A;  3UEU A;  4IB7 A;  1IKJ A;  2QCB A;  2Q9S A;  3DSZ A;  1EPB A;  1LEL A;  4RUN A;  4CPH B;  4COT A;  1W4T A;  3T2W A;  5EDB A;  3HWD A;  1LCV A;  2DM5 A;  4IB6 A;  1QG5 A;  3RDX A;  2WPU A;  3T6F A;  4TNN A;  2MO5 A;  2HYS A;  4QRL A;  3VHH A;  5L8I A;  2X8T A;  1KL4 A;  1P6P A;  4YGG A;  4A8Z A;  1VWK B;  3BLG A;  4O9S A;  2GH7 A;  4IB9 A;  4Z2V A;  4ZJ0 A;  3HWE A;  3P6D A;  1VWR B;  1X8Q A;  4EFG A;  2IZK A;  2XKL A;  3MG5 A;  2MM3 A;  4EQA C;  1BWY A;  3F8A A;  1HBQ A;  4CPH A;  5IXG A;  5K06 A;  1T68 X;  4GKC A;  4Y0Q A;  1U0X A;  2W2F A;  3KFF A;  2OVD A;  2X55 A;  1ICM A;  4U8U M;  1JMX A;  5BVS A;  4IB8 A;  4KC8 A;  4GGT A;  4R0B A;  4OS8 A;  4TKB A;  4O4U A;  4UU3 A;  3LHN A;  3VG2 A;  3SZI A;  1IFC A;  3B2H A;  1LIE A;  3RKG A;  4GJS A;  3H3I A;  4YBP A;  1KL5 A;  4TJZ A;  3F9D A;  5B27 A;  4M6S A;  5HCD C;  3Q6L A;  4FBV A;  3D9W A;  4MVE A;  3RDU A;  1EXS A;  3EBW A;  1BLR A;  1YP7 A;  4IMO A;  3NQ9 A;  3O19 A;  1ERB A;  3C76 X;  1SY1 A;  2OL7 A;  4I60 A;  5B29 A;  2GC9 A;  4Z2O A;  4GRJ A;  1E2T A;  4YCE A;  3SLO A;  3VG6 A;  1EIO A;  1RST B;  5F1E A;  2QM9 A;  1ZNK A;  3WJE A;  1EI5 A;  1PM1 X;  2ASN X;  4HPA A;  4O3X B;  1PBO A;  1Z24 A;  1RXK A;  4ZH6 A;  2WQ9 A;  1NBX A;  1DZJ A;  1G5W A;  1A3Y A;  1DZM A;  1Y52 X;  1H91 A;  1SY0 A;  2RTJ A;  4O3Y A;  2CZT A;  2AT0 X;  1JJJ A;  2HLV A;  4XMC A;  4AZP A;  2Y32 A;  1I04 A;  3VE1 A;  2CAM A;  4BX7 B;  1RBP A;  2XST A;  1KT3 A;  3OD9 A;  1JBH A;  1OEE A;  3IA8 A;  4I9R A;  1EUO A;  2C1Q A;  2G5L A;  5LKE A;  1ML7 A;  3AUM O;  2WSJ A;  3HTY A;  4ORU A;  1QAB E;  1SXW A;  4HPD A;  1SWT A;  4ORR A;  5D4A A;  4Z6J A;  2KD2 A;  5EEE A;  2CBR A;  4Z27 A;  4ES7 A;  2UZ2 A;  4YH0 A;  3P6F A;  5LJH A;  2LA7 A;  1RAV A;  4GDZ A;  1SWN A;  3PK2 A;  3KFG A;  4BQU A;  4BX7 A;  4CDF A;  4GNY A;  1AEL A;  1A18 A;  2G79 A;  2PY1 A;  2RTF B;  1GM6 A;  3GAQ A;  5KIC A;  1JZU A;  3LTW A;  1YUP A;  2KTS A;  2N93 A;  1K24 A;  4HPB A;  5AJB A;  1E02 A;  4ALO A;  4Z2P A;  1SY2 A;  2QO5 A;  1CBR A;  2DJF A;  5LJK A;  5B5G A;  2M4L A;  1DZK A;  4I3D A;  4BOE A;  1SWA A;  4GET A;  1SWJ A;  1JQP A;  4Y5D A;  3FYF A;  2ZSC A;  5HTE A;  4ARH A;  3WJB A;  2RTR B;  1E00 A;  3ZW1 B;  1STS B;  5HA1 A;  2FS6 A;  1GT4 A;  5F2B A;  4RUU A;  1JYD A;  1LF7 A;  5HAE A;  1IW2 A;  1VWN B;  1VWI B;  3MX7 A;  4YFP A;  5D48 A;  2IZL B;  1DF3 A;  1JJU A;  1OBU A;  1HXL A;  1X71 A;  3D97 A;  4ZGU A;  1SLG B;  2Q2P A;  2OL8 O;  4A1H A;  5HCE C;  2FRS A;  2RTN B;  1I05 A;  2F73 A;  2JU3 A;  4JO6 A;  3UEX A;  3PQS A;  1DV9 A;  1Y53 X;  4D6B A;  1VWJ B;  4ID2 A;  3ZW1 A;  5AEO A;  2IZA A;  2OL6 O;  3B2L A;  1CJ5 A;  1SWL A;  4U8U O;  1EAL A;  4O3W A;  3APV A;  1WBI A;  3RY2 A;  1E5P A;  3S26 A;  2HZQ A;  1FEM A;  2Z4H A;  2BS6 A;  3KFI A;  1HQP A;  1SWG A;  1MDC A;  4KH8 A;  4OEL A;  1WUB A;  3EM0 A;  1HXZ A;  1PTS A;  3PH5 A;  3HWG A;  5B10 O;  1QY1 A;  1E06 A;  1VWG B;  3F6Z B;  4QZT A;  1FJ1 E;  1SWE A;  1XKI A;  3C77 X;  4O3Z A;  1I78 A;  1EPA A;  1KGL A;  3GE2 A;  1UYO X;  3EMM A;  4GK9 A;  3FW4 A;  1FTP A;  3T6L A;  1BSQ A;  2K23 A;  1SWF A;  2RTH B;  2G7B A;  5HZ5 A;  3RDS A;  5HZ6 A;  3NX1 A;  2OVS A;  2P8G A;  5FQ6 E;  2A0A A;  4LKT A;  5CE4 A;  1BRP A;  4N7C A;  3STK A;  4FGI B;  2RQ0 A;  5IRW A;  2RA6 A;  3JS1 A;  4DQ3 A;  4CPF A;  4ZHD A;  2GJ5 A;  3E3C A;  3PDF A;  4LQZ A;  1YWC A;  4IRW A;  4CPE A;  4ZGF A;  2JU8 A;  5L3Y A;  2ZAI A;  1KT4 A;  4U3Q A;  4YDA A;  2CZU A;  4Y0R A;  4WHI A;  4A1Y A;  3V8U A;  4MIR A;  4GH7 A;  1T0V A;  2VDF A;  1KT5 A;  1VWL B;  4DCB A;  5LJE A;  5H9A A;  3AKM A;  1MOY A;  3CMP A;  1OSP O;  2OY5 O;  4CK4 A;  4YVB A;  4NV8 A;  2IZG B;  3MBT A;  1GX3 A;  3BX7 A;  1PMP A;  1QY0 A;  5IO5 A;  2CBS A;  3S60 A;  1A2D A;  2R73 A;  4XMG A;  2A2U A;  3JSQ A;  3WZQ A;  3VGW A;  1S44 A;  2OFM X;  4DNE A;  3HWF A;  1JYJ A;  4KC7 A;  4CSB A;  5HZ8 A;  2JU7 A;  1YWA A;  2RTE B;  3CKF A;  3P6C A;  3TF6 A;  1LIF A;  2IZF B;  3FDC A;  3PEC A;  3RBY A;  4XMH A;  1B56 A;  3WJF A;  1VWC B;  2NNE A;  1N0S A;  1MVG A;  3APW A;  2QO6 A;  4ML7 B;  1QFV A;  1UYN X;  3D4R A;  4QYP A;  5KID A;  4NP1 A;  5H8T A;  1PEE A;  4HPC A;  2E4J A;  4QQ1 A;  4ZHF A;  1BSO A;  1HN2 A;  1SLD B;  5CYB A;  5LJB A;  1PBY A;  1SWK A;  3MVF A;  4OMW A;  5F58 A;  3NX2 A;  4U9C A;  5EED A;  2ZAG A;  2RTK A;  1LNM A;  3ZW0 B;  1SWO A;  2RTI B;  3RE5 A;  1BJ7 A;  4WBK A;  1NP4 A;  2FR2 A;  1MK5 A;  1OEK A;  1Y9L A;  4FQB B;  1STP A;  1SWP A;  1X89 A;  2RTC B;  2X34 A;  3APU A;  4ODD A;  4AW8 A;  4B55 A;  1LIB A;  1AVE A;  1LFO A;  5F7G A;  3EC5 A;  2RTD B;  3NQ3 A;  4JNJ A;  4NYR A;  4QYN A;  3CR6 A;  3RY1 A;  4ALB A;  3L4R A;  2RTO B;  3WZP A;  4AZQ A;  2X56 A;  2KTD A;  4C5P A;  4M7M A;  2X8F A;  4K19 A;  4ZHG A;  3ZW0 A;  3WJC A;  2FKJ A;  2ALL X;  1LDO A;  2CM9 A;  2NNQ A;  1KXO A;  3PP6 A;  4GU8 A;  4BX5 B;  4TKH A;  3FEN A;  3SAO A;  4I9S A;  3WYQ A;  1LUQ A;  4IBA A;  5HZQ A;  1GX9 A;  1X8U A;  3HK1 A;  4O49 A;  1G74 A;  4GGR A;  4YFQ A;  1ACD A;  3BY0 A;  4XMD A;  3BU9 A;  4GNW A;  2QO4 A;  4TLJ A;  1B8E A;  2BC3 A;  3WYP A;  1VPR A;  4QGV A;  4OMX A;  5B3M O;  2NND A;  3OJY C;  4BX5 A;  2EU7 X;  1SWS A;  1KZW A;  1ADL A;  1AVD A;  3ZW2 A;  5LJC A;  3RE6 A;  2HMB A;  1NP1 A;  1VWD B;  1ZRY A;  1URE A;  1KL3 A;  2G8C O; 
#chains in the Genus database with same CATH homology
 1OPB A;  2GTL N;  3FEP A;  4XMF A;  3ZWE A;  3CWK A;  4OS3 A;  3RWX A;  1DC9 A;  4OS0 A;  1Y9T A;  4O4O A;  2OVE A;  1YP6 A;  3VU1 A;  3CBS A;  4LKP A;  4ORS A;  1OPA A;  3G7X A;  4QGW A;  2JW1 A;  1ZNL A;  1SXX A;  3HOE A;  4ON1 A;  3VG7 A;  1LID A;  1JIW I;  3FLL A;  3FEK A;  3P24 A;  4FBO A;  2HNX A;  2ACP X;  3FA8 A;  4JGL A;  1DFV A;  1YIV A;  2HZR A;  2YMS A;  1O8V A;  4YMY A;  3NP1 A;  1ERX A;  4N7D A;  2L67 A;  5FAZ A;  5L8N A;  2FLJ A;  4O4X A;  3NPO A;  4PJ2 A;  4CV7 A;  4I3C A;  4ORY A;  2MJI A;  3FR2 A;  5D45 A;  2FWV A;  2AT6 X;  3FA9 A;  4ORX A;  2KT4 B;  5DPQ A;  1B0O A;  1LKE A;  2QOS C;  4L3R A;  3UAQ A;  3BU1 A;  1HBP A;  4LZU A;  3BRN A;  4IAX A;  5L8O A;  4O4S A;  4AZO A;  2FR3 A;  5KHP A;  5BVQ A;  4ZHC A;  1TOW A;  2WR6 A;  1BBP A;  3RZY A;  1O1U A;  5HWZ A;  3U03 A;  5HA0 A;  4MIS A;  4KT5 A;  1GX8 A;  5HBS A;  2OVA A;  3C78 X;  3EYC A;  1S7D A;  2A3F X;  5C0N A;  4HWM A;  1X8N A;  5BVT A;  2G78 A;  2X45 A;  3APX A;  2GTF X;  1GT1 A;  1ICN A;  5BYP A;  4YCH A;  5FQ8 E;  1GT5 A;  1FEN A;  3D96 A;  3UEV A;  3VE2 A;  5EPQ A;  1I4U A;  2AT5 X;  1A57 A;  1CRB A;  3WVM A;  3VPJ E;  1NGL A;  3TZS A;  3ELX A;  1YWD A;  4A60 A;  2JN3 A;  1MUP A;  1TW4 A;  1T8V A;  2ANS A;  4YKM A;  2WQA E;  4GE1 A;  1KQW A;  4YKO A;  5D47 A;  2AH7 X;  4MVK A;  4TKJ A;  1BRQ A;  3CQN A;  1EW3 A;  5FFH A;  1CBI A;  3P6E A;  3P6G A;  3FA7 A;  2WEX A;  5H9K A;  2WUT A;  3FMZ A;  3BS2 A;  1EQD A;  3FR4 A;  3PQU A;  3WJG A;  1CBS A;  1HMT A;  3FIQ A;  1GT3 A;  5IO7 A;  3N91 A;  1KQX A;  3EBK A;  2RCQ A;  3AKN A;  3BSZ E;  2K62 A;  3OBL A;  1X8P A;  3SOT A;  1B4M A;  2L5P A;  5F6Z A;  2W2A A;  4PSQ A;  2Q2M A;  2L68 A;  2O62 A;  3O2Y A;  4I95 A;  1VYF A;  4ZHH A;  3VG3 A;  4AYH A;  3U0D A;  5HCC C;  1OEJ A;  2GTL M;  3B2K A;  1KT6 A;  4QNI A;  3O22 A;  2L9C A;  2MWH A;  4Y0S A;  2BHV A;  4ZCB A;  4ZR2 A;  1KOI A;  3NBX X;  4NW4 A;  3NR3 A;  4YDB A;  5JR8 A;  4D6A A;  2R74 A;  1U18 A;  3CBC A;  3P6H A;  3T1D A;  4QGX A;  2F09 A;  2AT3 X;  1RLB E;  2LBV A;  1QQS A;  2A13 A;  5HTD A;  4DQ4 A;  2MHD A;  3S5X A;  1SXU A;  3NAD A;  4AZR A;  3QKG A;  4NYQ A;  2BT9 A;  2CM4 A;  3IFB A;  4KII A;  2JMB A;  1IKE A;  2W2B A;  3CQR A;  1G7N A;  1JV4 A;  2WWP A;  4TQ2 A;  2Z4I A;  3ELZ A;  4WFV A;  3B2J A;  1AB0 A;  1SXY A;  2RCT A;  1IIU A;  3OE3 A;  4YGZ A;  2FS7 A;  5LJD A;  5F6B A;  1KZX A;  4WFU A;  4NNS A;  1LPJ A;  2OFR X;  2ACO A;  1FDQ A;  2FTB A;  4U8U N;  4ZH9 A;  1I06 A;  5LJG A;  4YBP A;  2AMM X;  3K3L A;  5EDC A;  1ZNE A;  1ZND A;  3BDR A;  3KFH A;  3PPT A;  4LZV A;  3ZI8 A;  5HZ5 A;  5D8J A;  1FEL A;  2KW1 A;  1QFT A;  1BEB A;  4MVI A;  1YWB A;  1VYG A;  1X8O A;  1BSY A;  1GKA B;  2NP1 A;  1S2P A;  1JJX A;  3WBG A;  2FT9 A;  4XME A;  3RSW A;  4NLJ A;  3B2I A;  2R56 A;  3WJD A;  2AT8 X;  1XCA A;  2WEW A;  1D3S A;  2A2G A;  2X8S A;  4YBU A;  5FQ7 E;  5FEN A;  3S5V A;  1AQB A;  1G85 A;  3HOL A;  2OZQ A;  1TOU A;  4INN A;  3PED A;  3PH6 A;  3NQK A;  1MX8 A;  4EDE A;  3FR5 A;  4YGH A;  3I17 A;  4ZFX A;  1GGL A;  1GKA A;  4IAB A;  2X46 A;  1HMR A;  2AKQ A;  1QWD A;  3TGB A;  2LFO A;  3DTQ A;  3ZZV A;  3TGC A;  1SA8 A;  5AQ6 A;  2AL0 X;  1IFB A;  5LKF A;  4AZM A;  3FW5 A;  1MX7 A;  2Q4N A;  1SY3 A;  3VG4 A;  1DZP A;  5H9L A;  4L1N A;  1ZNG A;  3VG5 A;  2BS5 A;  5EZ2 A;  4HFO A;  1TXL A;  1ZNH A;  4FBR A;  1KT7 A;  1AVG I;  1OBP A;  5IO6 A;  3FEL A;  4ORW A;  3U9P C;  3KZA A;  3P02 A;  5AJC A;  1U17 A;  3I0A A;  3D95 A;  3STN A;  3TGA A;  3ZUI A;  2Q39 A;  3JQO A;  1QY2 A;  2LKK A;  4I6S A;  4QAE A;  4MVL A;  2BLG A;  1LIC A;  1R0U A;  3ZQ3 A;  5HZ9 A;  1L6M A;  1HMS A;  2GTL O;  4BVM A;  1ALB A;  1FE3 A;  1O1V A;  1SMP I;  3WXQ A;  1OBQ A;  1GXA A;  2LBA A;  2IFB A;  3UEW A;  1D2U A;  2JOZ A;  2RN4 A;  1TVQ A;  2YG2 A;  2POA A;  3KQ0 A;  4QZU A;  1CBQ A;  4UU2 A;  4GZV A;  1UZ2 X;  5H9N A;  4YFR A;  4IMN A;  3WOV A;  3LV4 A;  4IAW A;  2RD7 C;  4EEJ A;  1BM5 A;  4I3B A;  2LB6 A;  4Y0P A;  3FA6 A;  4NLI A;  4KCA A;  2QMI A;  4NNT A;  4AZN A;  5DG4 A;  4EXZ A;  1EII A;  3BX8 A;  3STM X;  3ZUO A;  3UEU A;  4IB7 A;  1IKJ A;  4COT A;  2Q9S A;  3DSZ A;  1EPB A;  4RUN A;  5EDB A;  3HWD A;  2DM5 A;  4IB6 A;  1QG5 A;  4TNN A;  2MO5 A;  2HYS A;  4QRL A;  5L8I A;  2X8T A;  1P6P A;  4YGG A;  4A8Z A;  4ZJ0 A;  3BLG A;  4O9S A;  4IB9 A;  3HWE A;  3P6D A;  1X8Q A;  4EFG A;  2XKL A;  4EQA C;  2MM3 A;  1BWY A;  3F8A A;  1HBQ A;  5K06 A;  1T68 X;  4GKC A;  4Y0Q A;  1U0X A;  2W2F A;  3KFF A;  2OVD A;  1ICM A;  4U8U M;  5BVS A;  4IB8 A;  4KC8 A;  4R0B A;  4TKB A;  4OS8 A;  4O4U A;  4UU3 A;  3LHN A;  3VG2 A;  1IFC A;  3B2H A;  1LIE A;  3RKG A;  3H3I A;  4TJZ A;  3F9D A;  5B27 A;  4M6S A;  5HCD C;  3Q6L A;  4FBV A;  4MVE A;  1EXS A;  3EBW A;  1BLR A;  1YP7 A;  4IMO A;  3NQ9 A;  3O19 A;  1ERB A;  3C76 X;  1SY1 A;  5B29 A;  2GC9 A;  4GRJ A;  4YCE A;  3VG6 A;  1EIO A;  5F1E A;  2QM9 A;  1ZNK A;  3WJE A;  1EI5 A;  1PM1 X;  2ASN X;  4HPA A;  4O3X B;  1PBO A;  1Z24 A;  4ZH6 A;  2WQ9 A;  1DZJ A;  1G5W A;  1A3Y A;  1DZM A;  1H91 A;  1SY0 A;  1JJJ A;  4O3Y A;  2CZT A;  2AT0 X;  2HLV A;  4XMC A;  4AZP A;  1I04 A;  3VE1 A;  1RBP A;  2XST A;  1KT3 A;  3OD9 A;  1JBH A;  1OEE A;  3IA8 A;  4I9R A;  1EUO A;  5LKE A;  1ML7 A;  2WSJ A;  3HTY A;  4ORU A;  1QAB E;  1SXW A;  4HPD A;  4ORR A;  5D4A A;  2KD2 A;  5EEE A;  2CBR A;  4ES7 A;  4YH0 A;  3P6F A;  5LJH A;  2LA7 A;  4GDZ A;  1AEL A;  3KFG A;  4BQU A;  4GNY A;  1A18 A;  2G79 A;  2PY1 A;  1GM6 A;  3GAQ A;  5KIC A;  1JZU A;  1YUP A;  2KTS A;  2N93 A;  4HPB A;  5LJK A;  5AJB A;  1E02 A;  1SY2 A;  2QO5 A;  1CBR A;  2M4L A;  1DZK A;  4I3D A;  4BOE A;  4GET A;  3FYF A;  4ARH A;  5HTE A;  3WJB A;  1E00 A;  3ZW1 B;  5HA1 A;  2FS6 A;  1GT4 A;  4RUU A;  1JYD A;  1LF7 A;  5HAE A;  1IW2 A;  4YFP A;  3MX7 A;  5D48 A;  1DF3 A;  1OBU A;  1X71 A;  3D97 A;  4ZGU A;  2Q2P A;  4A1H A;  5HCE C;  2FRS A;  1I05 A;  2F73 A;  2JU3 A;  3UEX A;  1DV9 A;  3PQS A;  4D6B A;  4ID2 A;  3ZW1 A;  5AEO A;  3B2L A;  1CJ5 A;  4U8U O;  1EAL A;  4O3W A;  3APV A;  1E5P A;  3S26 A;  2HZQ A;  1FEM A;  2Z4H A;  2BS6 A;  3KFI A;  1HQP A;  1MDC A;  4KH8 A;  3EM0 A;  3PH5 A;  3HWG A;  1QY1 A;  1E06 A;  4QZT A;  3F6Z B;  4O3Z A;  1XKI A;  3C77 X;  1EPA A;  1KGL A;  3GE2 A;  3EMM A;  4GK9 A;  3FW4 A;  1FTP A;  1BSQ A;  2K23 A;  5HZ6 A;  2G7B A;  3NX1 A;  2OVS A;  2P8G A;  5FQ6 E;  2A0A A;  4LKT A;  5CE4 A;  1BRP A;  4N7C A;  3STK A;  4FGI B;  2RQ0 A;  2RA6 A;  3JS1 A;  4DQ3 A;  4ZHD A;  2GJ5 A;  3E3C A;  4LQZ A;  1YWC A;  4ZGF A;  2JU8 A;  2ZAI A;  1KT4 A;  4U3Q A;  4YDA A;  2CZU A;  4Y0R A;  4WHI A;  4A1Y A;  3V8U A;  4MIR A;  4GH7 A;  1T0V A;  1KT5 A;  5LJE A;  5H9A A;  3AKM A;  3CMP A;  4CK4 A;  3MBT A;  3BX7 A;  1PMP A;  1QY0 A;  5IO5 A;  2CBS A;  3S60 A;  1A2D A;  2R73 A;  4XMG A;  2A2U A;  3JSQ A;  1S44 A;  2OFM X;  3HWF A;  1JYJ A;  4KC7 A;  4CSB A;  5HZ8 A;  2JU7 A;  1YWA A;  3P6C A;  3TF6 A;  1LIF A;  3PEC A;  3RBY A;  4XMH A;  1B56 A;  3WJF A;  2NNE A;  1N0S A;  1MVG A;  3APW A;  2QO6 A;  4ML7 B;  1QFV A;  3D4R A;  4QYP A;  5KID A;  4NP1 A;  5H8T A;  1PEE A;  4HPC A;  2E4J A;  4QQ1 A;  4ZHF A;  1BSO A;  1HN2 A;  5CYB A;  5LJB A;  5F58 A;  3MVF A;  4OMW A;  3NX2 A;  4U9C A;  5EED A;  2ZAG A;  3ZW0 B;  1LNM A;  4ALO A;  1BJ7 A;  4WBK A;  1NP4 A;  2FR2 A;  1OEK A;  4FQB B;  1Y9L A;  1X89 A;  3APU A;  4ODD A;  4AW8 A;  1LIB A;  1LFO A;  5F7G A;  4QYN A;  4ALB A;  3NQ3 A;  4NYR A;  3CR6 A;  3L4R A;  4AZQ A;  4ZHG A;  2KTD A;  4M7M A;  2X8F A;  4K19 A;  3ZW0 A;  3WJC A;  2ALL X;  2CM9 A;  2NNQ A;  3PP6 A;  1KXO A;  4GU8 A;  4TKH A;  3FEN A;  3SAO A;  4I9S A;  4IBA A;  5HZQ A;  1GX9 A;  1X8U A;  3HK1 A;  4O49 A;  1G74 A;  4YFQ A;  1ACD A;  3BY0 A;  4XMD A;  3BU9 A;  4GNW A;  2QO4 A;  4TLJ A;  1B8E A;  1VPR A;  4QGV A;  4OMX A;  2NND A;  3OJY C;  2EU7 X;  1KZW A;  1ADL A;  3ZW2 A;  5LJC A;  2HMB A;  1NP1 A;  1ZRY A;  1URE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...