4I9TA

Structure of the h258y mutant of the phosphatidylinositol-specific phospholipase c from staphylococcus aureus
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
305
structure length
305
Chain Sequence
SDSLSKSPENWMSKLDDGKHLTEINIPGSHDSGSFTLKDPVKSVWAKTQDKDYLTQMKSGVRFFDIRGRASADNMISVHHGMVYLHHELGKFLDDAKYYLSAYPNETIVMSMKKDYDSDSKVTKTFEEIFREYYYNNPQYQNLFYTGSNANPTLKETKGKIVLFNRMGGTYIKSGYGADTSGIQWADNATFETKINNGSLNLKVQDEYKDYYDKKVEAVKNLLAKAKTDSNKDNVYVNFLSVASGGSAFNSTYNYASYINPEIAKTIKANGKARTGWLIVDYAGYTWPGYDDIVSEIIDSNKLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1-phosphatidylinositol phosphodiesterase
publication title The cation-pi box is a specific phosphatidylcholine membrane targeting motif.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Hydrolase, lyase
total genus 121
structure length 305
sequence length 305
ec nomenclature ec 4.6.1.13: Phosphatidylinositol diacylglycerol-lyase.
pdb deposition date 2012-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00388 PI-PLC-X Phosphatidylinositol-specific phospholipase C, X domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.190 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphatidylinositol (PI) phosphodiesterase 4i9tA00
1DJWA 1T8QA 4PTDA 3V1HA 4RW5A 3EA3A 4RW3A 1DJYA 1O1ZA 2ISDA 4I9JA 2P76A 4S3GA 4I90A 4F2TA 1ZCCA 3KS5A 2PTDA 3MZ2A 3KS6A 3QR0A 3EA1A 5T9BG 1V8EA 1VD6A 2O55A 1YDYA 1PTDA 5T9CE 4OECA 4R7OA 6PTDA 1QASA 1DJZA 3V18A 1GYMA 2FJUB 1DJXA 2OTDA 2F9RA 5PTDA 4I8YA 3OHMB 1QATA 3H4WA 1DJGA 2PZ0A 2OR2A 3H4XA 4RV3A 1AODA 3QVQA 3I10A 7PTDA 4F2UA 1DJIA 3NO3A 4I9MA 2PLCA 4Q6XA 5T91A 1PTGA 3QR1A 1XX1A 3L12A 2ZKMX 3RLGA 3V16A 2OOGA 3RLHA 4QJ3B 4I9TA 3PTDA 3EA2A 4QJ4B 4F2BA 4GNKB 1DJHA 1T6MA 3CH0A 4QJ5B
chains in the Genus database with same CATH superfamily
3R6IA 3H4GA 3A5FA 4P7LA 4Q6JA 4F79A 1TA3A 5LA0A 4J7RA 1E70M 3MVTA 1M68A 3C61A 1EDGA 3IV3A 3GC5A 2TMDA 1UKQA 3C8FA 3LLXA 1FWNA 4LUYA 1DYSA 3HGSA 3PBUA 4NRRA 3B8TA 4QHRA 4MWAA 3QLDA 5GNXA 3LQGA 5A2CA 1B90A 1HN1A 5E6YA 4GG9A 4OU1A 1J5SA 2J75A 2OT0A 3MUAA 4S3KA 4AD5A 1S5VA 1JPMA 4ADUA 1OYCA 4P7NA 1ITUA 1QASA 1RCQA 3WQGA 4ENLA 1E1EA 5LXEA 4A2SA 1KCXA 5GQBA 2BVYA 1TWIA 1X1OA 1MQQA 2X0SA 4H8VA 4JZ5A 1X6NA 2WO5A 3NPVA 3RM8A 1XF0A 3VFLA 3OVGA 4HOWA 4WQ6A 1H50A 2X1RA 2REQA 3QHOA 4JFVA 4CQDA 2AQOA 1ZL1A 4ACZB 2DGAA 1Z48A 1IQ8A 4HU4A 2R9RA 3OLGA 3UYIA 1WAUA 1W17A 3EX6A 4CNTA 1OIFA 1E6NA 2J8FA 4C60A 1VIWA 3CZEA 4F0MA 2TSYA 1TRDA 5C8BB 1XCXA 4O52A 3FK4A 3MS8A 3W25A 5FAGA 1ICSA 4LYKA 2BLEA 3W88A 3SN0A 3WUFA 1A50A 4PMQA 1WPCA 5TQLA 3BDKA 3HQOA 3G6LA 2V5DA 4H7CA 3EX2A 2YFOA 3ZWSA 5DCDA 1GWJA 1DXIA 1H4PA 1V3LA 3E0IA 2G50A 1DWGM 3CIWA 1RVGA 1X7IA 4FOUA 1KM6A 5AY7A 2ZWYA 1FFQA 1H7OA 3V0UA 3MUZ1 5AN7A 4JQ1A 4P8XA 1PKLA 5TNVA 2VRQA 3EKLA 2HDJA 2PDYA 3EXRA 1UH3A 1DWAM 3GBDA 4KFPA 1S2UA 3U5UA 3M64A 4IG2A 4MM1A 3OHMB 4JTCA 1XUUA 4H00A 4YCOA 1SFJA 3W70A 4FNTA 1NJJA 1R3VA 4C6FA 3F5KA 4XKMA 3TXVA 3WNKA 3WLIA 1KBJA 3TAOA 4G5DA 1V6WA 4WGHA 4LV9A 4S3DA 2J8GA 4IFKA 3SFKA 1PPIA 1SZNA 3BSMA 3BWWA 5RUBA 3W84A 3W2UA 4QFUA 1CGYA 1O5KA 3S9YA 3SN4A 1QO2A 1XLFA 1VHNA 2GGJA 1BG4A 3H2AA 1I75A 1IHIA 1HL9A 2ASHA 3BAXA 1E43A 4ZQOA 4HOXA 3FEQA 3AS1A 3MMDA 3RAOA 1OX4B 3CV1A 2Q71A 3N15A 3JUGA 4ZOAA 5FJIA 5HMDA 3A21A 2VC6A 3BAKA 2WCGA 1K4GA 3U5YA 1GQKA 4IL0A 2OELA 3R0DA 1S2CA 1ONXA 5JU6A 3L7RA 2ALRA 3W00A 4YTSA 1DXEA 4LOCA 4PZVA 1QI3A 4Q4QA 4A21A 3H12A 5BOFA 2D1ZA 3KOFA 2ZUNA 3AIRA 2Y89A 2EQDA 1VZWA 1A5SA 2PDIA 2WQPA 2ZXBA 4MYXA 4MF4A 2POTA 4O53A 2PSNA 4HK7A 4FR1A 4IQEA 1ZTVA 4CD8A 2C7FA 3WUGA 4F2UA 4AY8A 5D38A 4LS0A 2O7SA 4E4FA 5DX7A 5LNSA 3P62A 3MWCA 2QUMA 3L2MA 1W1VA 1OGBA 4HP5A 1N7KA 3HQ1A 1QVBA 4ZOEA 2DZUA 3TNBA 4F48A 3U0HA 2OYKA 1X8CA 4GY7A 2QDDA 1ZAHA 3OQ8A 3NCOA 2A1YA 4E4UA 3VGHA 4NJHA 2XFRA 3UR5A 4RKAA 4ZQNA 1Z41A 3GKFA 3U48A 2GSJA 3ZFHA 4WCJA 2VR4A 2PWFA 1GVOA 2ATMA 2R1MA 2DH3A 3CZKA 3P0XA 4H6KA 5E0FA 3K8MA 2ISDA 1P0BA 5DN1A 1DIEA 2VURA 3R7MA 2Z2AA 3MUXA 4KERA 5CKSA 4WSHA 2NT0A 3LV6A 4TOQA 1E0VA 1HP4A 4OTKA 1LT7A 4C6NA 3SCNA 2BASA 1JGIA 5AHIA 3KRZA 3HOJA 3FSTA 3COTA 4M1BA 1H7NA 3WDIA 1PHQA 3STCA 3TMLA 3QF0A 1O94A 1ZRQA 4XZBA 3C0LA 3EX4A 4IIBA 5AHNA 3STPA 1TV3A 4JY8A 2FLIA 3RPDA 4U2ZA 4LTSA 5BRPA 5HWJA 1C29A 3WBEA 4AG0A 4HIBA 4YYFA 1VFHA 2QCLA 5REQA 3PAJA 1PHWA 1TPH1 4H83A 2E0PA 3ZWTA 4JCLA 1UWUA 1U33A 1LQAA 1KM5A 3L21A 3IIZA 4Q8WA 3HPAA 3EMZA 4ZO8A 3GLCA 4AHPA 4HA4A 2XVKA 4F8XA 4H8UA 2GFTA 4LRSA 1K8YA 3W6MA 2CBJA 1LLZA 4OE7A 4RNHA 4MHBA 4GABA 3TIMA 4QTGA 1KXQA 2YW4A 1BQCA 1HFBA 4I6KA 7A3HA 1RV8A 5AC8A 4TX6A 3PJTA 2GOKA 1JUBA 1S2VA 3OG3A 4B4FA 3M9YA 2HBXA 2WVVA 1TMQA 3M6DA 3WEZA 3EX1A 3L67A 4HU0A 3SIZA 4CQBA 4R88A 3NJ3A 2PP0A 3BGGA 2O56A 3PN8A 3TJ4A 4G7EA 4C7GA 3N12A 1H7WA 4KWVA 3GC4A 1XYFA 4US5D 1XWYA 2PDJA 4A2RA 4EPEC 1B3VA 3WLOA 3P67A 2FZBA 3PNZA 3AMKA 3C4UA 2I16A 3S47A 1K9TA 4TTUA 3PWGA 2FZ8A 3VDHA 4FNSA 3CHEA 4E5TA 2OX1A 3JR2A 4CEXC 2VCCA 3LNMA 3NYDA 1HKKA 4C5YA 3WL0A 3NNTA 4HNLA 1Q6GA 2BVTA 1FCBA 1I2NA 3POHA 3N9SA 3VD4A 1AQFA 4IJRA 1RJQA 1KFEA 5IOBA 3WJZA 5FJTA 4GYKA 3GNXA 4PB3A 3N29A 4BF5A 3TYCA 3H8AA 4PMXA 2HS8A 3RIKA 2E7FA 1L0PA 3O8AA 1A5OC 3LZ3A 5LHEA 2QPXA 4DELA 1UQZA 2DJXA 4H8HA 1X39A 3QZEA 4MFDA 2ZOXA 4EWJA 1KKRA 2XISA 3VDCA 4CVUA 2FB2A 1E55A 1MFVA 4NIRA 5CZ0A 3PP7A 4JTAA 4LAUA 4FK9A 4AIBA 4DUVA 3RR1A 1XKJA 1DWJM 1LYXA 3QQ1A 1IYXA 1XDJA 1OZQA 4S1FA 4LBSA 1TE1A 1H0GA 1JXJA 5LSMA 1RD6A 1AZ1A 4V33A 3MZNA 1YKWA 4US5A 4PL1A 1JDEA 4GYJA 3ZT5A 1OEPA 3G2GA 1MDLA 1FP9A 3LBOA 3W0KA 1JUKA 1TFVA 3JZEA 3IPWA 3SCVA 2BGNE 1SW3A 3VIOA 3GTNA 3B04A 4QNWA 3ITCA 3RO8A 3TCSA 3TYEA 3T0TA 5DANA 1LG2A 3TK7A 4RDZA 3S2NA 1RSCA 2FFIA 2Q8XA 4O8AA 5F2MA 4AUBA 4DO7A 4W89A 4N7QA 2NT1A 5ECVA 1TPUA 2W61A 3P80A 2GGHA 2VFEA 1ALDA 4QEEA 4YTTA 1LLWA 4TXEA 1PX8A 3WNNA 4E8CA 4JIIX 4M6UA 3WLPA 1WP6A 2DQWA 2W66A 4LC8A 2QYGA 5D2TA 2NWRA 1LORA 3SURA 4XIMA 1PZ2A 1FHLA 1W1A1 3TFCA 1YXDA 4K8GA 2XHYA 8A3HA 1V3KA 4J2PA 4GK8A 4W86A 5ENLA 1PAMA 3NWRA 3GHTA 2OEKA 5HXMA 1HVXA 1O66A 3UZYA 3W1QA 1NOWA 1H0IA 3LTSA 4XKYA 3CLWA 1OZMA 4GIRA 1G69A 3SY1A 2EPKX 1YYAA 3E2VA 4LY4A 3GDBA 4FXFA 2OWCA 3WIJA 2E5DA 3DZ1A 3ERPA 3PTKA 2WNWA 3CEPA 1JNDA 2A5HA 4AYGA 2PCQA 1TTJA 3TN5A 3DH7A 1FDZA 1WYIA 3C2FA 1MNSA 1Q4NX 1A5BA 3FYYA 2Y1HA 3QC3A 1ZHAA 5K9DA 3CYVA 3TOPA 1IZKA 1TPWA 4REQB 2J79A 2DT0A 1MXDA 1TR9A 4FX7A 4RE0A 3HIJA 5KZEA 3PUEA 4NNCA 3LEPA 4CCDA 4JTKA 4QS5A 2QQ6A 5E6ZA 3E96A 2PWUA 4AAJA 1CCWB 3FS2A 4HCDA 2PDXA 3ABZA 2BTMA 3APTA 4ERAA 4C6PA 3EWYA 1OFPA 4HNCA 3UW6A 3CAQA 6XIMA 1IIGA 2C19A 3CU2A 2OKOA 3M0IA 3HMJG 3W7KA 4AVNA 4BCEA 5BROA 2J7FA 1U22A 3ABQA 2F8QA 2VX6A 4L5ZA 3BW2A 4RW3A 1Z7AA 3QV7A 4M29A 5BMWA 3IV8A 4DHGA 1LOQA 4FLRA 5LGXA 1AD4A 5A6LA 5DFAA 2CXEA 5I77A 1EEXA 4KCTA 5IBXC 5M5DA 3C52A 3W1AA 1XD0A 4FO4A 3CPGA 4G8TA 3U6WA 4A8NA 1VFTA 2ABAA 1OABA 1FVPA 2QKFA 4DF1A 4K38A 4FMVA 5E09A 3B9OA 3PFMA 4BS0A 3WLSA 1XYMA 3CS2A 2V3GA 4FLOA 2VGBA 1PEZA 1MUCA 1CT5A 4CQCA 3APGA 5A6JA 3FEMA 3EOSA 2G97A 2IPFA 1R85A 1ZCOA 5A8NA 3S5SA 3TTEA 4O1AA 1BKSA 3F03K 5IDIA 1DHKA 4Y6GA 4C7DA 4QEHA 3WF1A 6TIMA 3TQPA 2CEQA 4O4WA 3M0VA 1MVYA 3UZWA 4Y96A 3OQEA 1M7PA 4J3WA 4DAIA 1I9CB 2D0HA 5FJUA 4JKMA 2PTZA 1U1HA 1SSDA 4PBGA 5DMLA 3TC7A 1KCLA 3NEHA 4HCHA 3TYAA 4HK6A 3V5FA 1XPGA 2BOFX 4LVFA 1XM3A 1ISVA 2XSXA 3FYPA 1DQUA 5KSWA 3ARXA 2QZRA 4E3TA 1IXPA 4JTQA 2UV8G 1H3GA 3ATYA 4HPXA 4Z08A 3VDAA 2IPJA 3ZVHB 7XIMA 4HA3A 4XZLX 3QBUA 3H2MA 1GQJA 4IICA 5C9UA 3LB0A 5CPSA 5HUOA 3WLNA 3B40A 1M6JA 3NQDA 2FPTA 3VCRA 3M0HA 4FAMA 3W7IA 2W92A 1RY0A 5HBFA 2W91A 4UWMA 4PUWA 1RQHA 3NM3A 4RCXA 1I1WA 2ISSA 5JBEA 1CDGA 2VTFA 1NELA 4LWWA 1HXJA 4PTVA 5LIUX 2A3CA 4Z1YA 2D0FA 1VB9A 3WK3A 2VHLA 2QUUA 3CBWA 8TIMA 2FPYA 2WJZA 1B57A 3KHDA 1UBSA 4QX4A 3VILA 4XZHA 4A35A 1RQEA 2KZHA 3VD7A 4D6FA 1Z32X 3BCFA 2FTYA 3AQUA 4FNUA 4NI8A 3TU9A 5F4WA 3P3BA 3WF3A 3Q67A 1GCYA 1WDDA 3OG2A 3NIYA 3BMWA 4S39A 3SCQA 3GG0A 2DVXA 1SJAA 2FJKA 2YB1A 1LRQA 2PUZA 4V27A 3VGEA 4DF0A 4Q8PA 3AXHA 3UPWA 3PBYA 1KBIA 3UWVA 1SZGA 4HHLA 3T9PA 1QNVA 3TN6A 2I57A 2O55A 2ONEA 4GYPA 4AFYA 3L4UA 2J8TA 4FIRA 5AOUA 2ZX9A 3IUHA 1AZ2A 2FGLA 5DT5A 2PU0A 4NF7A 4NRSA 2RFGA 1AH0A 1SJBA 4O0KA 3I4KA 1GGOA 4AIEA 2ZA3A 3DKJA 1ZU8A 3LGDA 3PJXA 3GFXA 2I7GA 2Z1SA 1KA9F 3WMBA 4DY1A 5A6BA 3NZPA 1UA3A 4UTFA 2VR5A 1J12A 1JFHA 4UMAA 3VUSA 1KV5A 2C14A 1UWSA 5I09A 1N8WA 3SRFA 4MWAE 1SPQA 3GIPA 4IMDA 5LGZA 4C90A 3DEQA 4P8UA 5LA2A 4W8BA 5D8WA 3DCPA 1AG1O 2VZSA 3B03A 4ZO7A 1OWQA 1K8CA 2YDRA 2ISFA 3G3MA 3PFRA 3Q2DA 1WDWA 3KAOA 3T07A 5A6TC 4YN5A 4JD4A 4H2CA 1OX4A 4GXPA 3WH6A 3OIXA 3QGKC 3NYZA 3TE9A 1VPYA 4W88A 5JBDA 3URBA 4HYVA 5EMKA 4O1DA 3BVJA 5XIMA 1XLIA 4IFOA 5FEXA 4MUPA 2ZZ1A 4QDMA 1WNOA 1ZCCA 2JF7A 3EWCA 3RCMA 2PE4A 4ZMGA 3LY0A 2KAUC 4DI9A 4A3HA 2R6OA 1GOOA 3AU2A 3AXIA 4HJWA 3BV4A 4DZAA 2A7NA 2WLYA 1Y5VA 5LIYX 3NO1A 3EPOA 2B81A 3B0UX 3VABA 1AW2A 3WH7A 1W32A 2PP3A 3DGBA 3CAVA 3QMRA 4GZJA 3PPCA 2PDGA 4AC7C 3CC1A 4JCMA 5IBXA 3BURA 1QPNA 3NQ7A 2VJXA 4B5WA 3SDOA 1JAKA 4F0HA 1DTUA 4XIAA 3C2EA 3W2MA 2BXZA 1ONWA 1QBBA 1L6FA 1W3KA 3R0KA 4O0QA 2CC0A 2ZX8A 1RBOB 4S3BA 4LC6A 2QCNA 3QQ0A 2WB5A 2RDXA 4U5IA 4DYJA 4ZFMA 5A8MA 1TIMA 2Y61A 4FXSA 4V2XA 3WKZA 4S2CA 4XZNX 3GR7A 4Y9OA 3WQDA 3NDOA 5E0KA 2A85A 4NL1A 1UKPA 4IX2A 3PUGA 1E1FA 4DF2A 3HPXA 3HFTA 1FWIC 4NQ1A 4J3ZA 1PCWA 3LCHA 5F4XA 1XDMA 3FYOA 2J13A 3N4FA 2VP8A 1OF6A 1FOBA 2D20A 3KWXA 3M47A 5FCZA 1PKMA 4O10A 4KRUA 2ZA1A 3C2RA 4Y7EA 4AMAA 3L4YA 1YBQA 1VFUA 3GHRA 4KKXA 1Z3NA 3K5XA 1UWQA 3MYPA 1S2AA 3NPXA 3O05A 2Y5SA 2GDVA 3W4RA 3GHSA 5IM51 3KLKA 1HKIA 5G2WA 4DUOA 5C9XA 1XSJA 3C2YA 4C6LA 2QGHA 1KC7A 4PTWA 1I0DA 1Q45A 4PCTA 1W56A 3WD4A 5PTDA 1QNOA 1Q6LA 1GOIA 2B7PA 3P0WA 4WXZA 2VVSA 2EJAA 1XBYA 1EYEA 1BKHA 3MV01 3WFAA 3HV8A 4X22A 2VFFA 1OIMA 2XSBA 1AH4A 4PL2A 3QXBA 1ITXA 4F40A 3THQA 4FF7A 2C71A 2DIEA 3KM8A 4QGCA 5DMMA 2ZUUA 3EEGA 4NP7A 4UNKA 4IQLA 2FPVA 5G4WA 4ZL1A 3WBYA 1PVNA 1XLAA 2WMKA 3FHQA 3EPNA 4GUIA 3M46A 3GW3A 4GJIA 1FBAA 1T6MA 1EP1A 3NM1A 3LHYA 1GQLA 3GVVA 4DBWA 2VOTA 1IT7A 3RU8X 4LH8A 5FOOA 3N73A 1A4LA 3MUIA 1EUAA 4O11A 3NZGA 3ARPA 3VIFA 1PE1A 3MY9A 4GKTA 5M17A 3ZIZA 3VNJA 1UD8A 3QJAA 3TEVA 4W5ZA 4B90A 4LCRA 1LWIA 1UROA 5HNNA 3GNPA 1OFQA 4M24A 3BICA 3IK2A 1HW6A 2ON3A 4I7UA 5FF0A 3PG9A 3AS3A 4CNSA 4DO6A 3WJWA 2GVJA 5H6HA 4MNMA 3V36A 4LEFA 1UR8A 2ZBTA 4FX8A 4YU1A 3T08A 1C9DA 2YBTA 3GUWA 3DECA 4I7VA 4ALDA 3THUA 3O1NA 1EA0A 3MHGA 2G3IA 4L1XA 3SADA 3KX6A 3TW9A 4D2JA 2HE8A 2CLPA 1ONRA 2P8CA 5AHEA 2GVGA 2VWTA 3WENA 1JQXA 2QVHA 3ALFA 5I00A 3I7QA 4YTRA 1TELA 3RLGA 2CBVA 3V16A 1ECQA 2PDLA 3RCNA 1K7XA 1PDZA 2X1SA 5TIMA 2VZUA 3EOLA 1QO5A 4WD0A 1SW0A 1R6WA 2AL1A 1VFMA 1OCQA 4YS1A 1W3NA 4WHBA 3M5ZA 5KZ6A 1OINA 1YNPA 4PTXA 5A2AA 5JIPA 3KE0A 1EYWA 3T0AA 2CYGA 3VA8A 4M80A 1ZJHA 5K4XA 2OGJA 2Z1WA 2CKSA 3OA3A 4WK9A 4KT2A 5EKYA 1A3HA 5EMMA 3DHDA 1FWJC 5EMUA 2GUUA 1A53A 4GUJA 2NVDA 8XIMA 3SFWA 4JTUA 4U28A 4JN6A 3K1DA 4NZ1A 2VEKA 3UJSA 4AF0B 3PZVA 1TJ0A 1E1CB 1W5PA 4PEEA 3GU9A 3ANUA 1LCOA 2EPLX 5CGTA 3MMUA 1ZENA 3M7SA 3ES7A 3U2EA 5F1VA 4J40A 4NT0A 4XUGA 4MLJA 3W7QA 5FAJA 3LQLA 1NIUA 5DO8A 1S3TC 2PDFA 4YLWA 5FEZA 5HINA 4W7UA 5DLCA 4FZIA 2ZRWA 1QI2A 3UG3A 3BTNA 1DVJA 3EB2A 3P8IA 3GNOA 3NFUA 3S9ZA 4KRTA 1ECEA 3GRIA 2V2HA 3USZA 2FIQA 4QDWA 1LG1A 4RDVA 1GVQA 2XJ7A 3W28A 1WKYA 2ZUVA 5CSRA 1NSJA 3B8WA 1ZNNA 3WDHA 2V2DA 4BI6A 1AJZA 1HUVA 3VUPA 3UERA 4BHYA 3EWDA 3VNKA 1UOZA 2QCEA 4IMCA 4L80A 2YYTA 4RNIA 3PF3A 1S3HA 3L4ZA 2P0IA 2WBKA 2ZC1A 2ACQA 2GDQA 3CB8A 4J35A 5CPQA 4DXXA 4IOTA 1NY1A 2PTWA 1TSIA 2VCAA 1XSKA 1R9XA 5A8PA 1M3UA 3UNTA 3LMYA 4GI6A 2VEFA 4U4MA 4CQ8A 3AWOA 1W1IE 3AICA 4RZ5A 1C7SA 2PLMA 5DQPA 3SUTA 1SYTA 4M8UA 4PMYA 4MUZA 2WMFA 3G6MA 1FWCC 3LU2A 3BCDA 1ZQ5A 1XLMA 3W53A 3MKKA 3ONBA 4E2VA 4XSMA 1W3JA 4JX5A 3W72A 1W37A 2CNCA 4GH3A 4JHMA 3VAVA 4RXGA 1H1ZA 4AWEA 3LENA 4GNKB 1TE6A 1RLDA 1MMFA 3IUDA 2GK1A 1I6NA 3E0VA 4JNZA 2VC5A 2PTYA 2VYOA 4F3HA 1G67A 1T8QA 4EWND 3LUTA 4EE9A 5J5DA 4X9YA 5CZTA 1RXOB 4IP5A 3VD5A 3IIPA 2NQ5A 1L2UA 3D47A 1EGZA 2PDHA 5MKGB 1ZLPA 2PMQA 4B5SA 1EFZA 1ZP4A 5T9BG 4WJEA 3B8SA 1JZ8A 3UJFA 1CYGA 4D6JA 3AO0A 1OBAA 3ZM8A 4I5UA 4K36A 4L65A 3U57A 1DJZA 1VBGA 3WD0A 2YL5A 1SJCA 2JKAA 3LI1A 2J66A 4GWEA 1Y0EA 3STGA 3GY1A 1Q13A 3CJPA 1QI4A 4LAZA 2FMNA 2Y0FA 3BOFA 3LI0A 1C90A 2ANUA 4Q4KA 4DWSB 1LRNA 1H1YA 1UC4A 3D6NA 4IGNA 4F0RA 2GQ8A 3ARTA 2GSHA 1NWRA 1Z8AA 3AYVA 1K02A 1TPDA 2OQHA 4C65A 3WF0A 1EPXA 1ZJIA 4KIRA 1KTCA 4WSJA 1UR0A 3GXDA 4D1JA 1V08A 2WJDA 1LM1A 1WOAA 1RZMA 1TREA 1LJYA 5EBUA 2NLYA 4LBRA 3PY2A 3CUZA 3P60A 4YVPA 1FXPA 4NKCA 4YHEA 1YHTA 3FVDA 4I90A 1DBTA 4OHQA 3CWNA 1M1BA 2E9LA 3TKFA 1I2RA 3GYEA 3AIBA 5AFDA 6REQA 2A3EA 2BBFA 1QR7A 1FWFC 2WZMA 1AUSL 3RILA 2B0MA 3LTPA 3N4AA 5D9NA 5KZMA 2FJUB 3W7EA 5D2WA 4DO5A 1HO1A 3S1XA 3SCUA 3W2JA 1I1XA 1EDQA 1QNRA 4D6HA 1I2QA 3HURA 2Z6JA 2XVLA 4OFCA 1YTKA 4WOZA 3SCTA 1OD8A 4F0SA 3AIWA 2QJIA 1QRQA 3W6YA 4AW7A 1PB0A 4C6CA 4JOMA 3UEQA 4Q7NA 1ME9A 1EGMA 4FP1A 2BS9A 3O6AA 5D4YA 3RG6A 5G5IA 5D30A 2JE8A 2X7VA 1MEWA 3PZ9A 2J62A 3I65A 3NZ1A 2PU1A 3TH6A 2G8ZA 2E68A 5L6UA 3VIMA 3GD6A 3T8LA 4K37A 4A8LA 2V69A 1OYBA 4MAVA 2EGZA 4DO4A 3DG3A 3OLEA 3SCPA 1JCXA 4UTJA 4MB3A 2FH8A 2JKEA 3NDZA 3CB3A 2C1HA 2INFA 4JR5A 5KZDA 1QWKA 4O54A 3JU2A 3GNDA 3FJLA 1MFUA 5C9ZA 1OT1A 3GC2A 3M44A 1DPMA 4GXWA 1VYSX 1JZ4A 1CNVA 3A4WA 1MXGA 3ZJ8A 1ZAIA 4HHHA 1H41A 3V5OA 4MSSA 3I3BA 2DZBA 1J4EA 3QH2A 1B31A 4JTFA 1VEOA 2G3MA 5D04C 4IIDA 3VIGA 5G1YA 4ZSTA 4RV8A 4Y90A 5HUPA 2PLCA 3WO8A 4O28A 3L0NA 1EXPA 4PFMA 3LHVA 5BOOA 1YMYA 3BG3A 3NVDA 1XX1A 1WKFA 1TJRA 3ITOA 4UOQA 1N8IA 4EF9A 1TB3A 1G7UA 4C6MA 2WCAA 1UR9A 1VHCA 2YIHA 2AQVA 4BKNA 2OG9A 4YPJA 4IF2A 2XWDA 9XIMA 3GTIA 4JKKA 2BVDA 1BFNA 1NARA 1D3HA 2RAGA 1Q2SA 2ZRVA 2G0WA 2VC7A 1P48A 3E0LA 2V9DA 3U9IA 5BRQA 4IUGA 3VGDA 4ZXOA 3CNYA 5I3JA 3CPUA 1ODUA 1QPOA 1VC4A 3MDUA 4HNOA 4XO7A 5CPLA 2PGEA 4N4PA 4UR8A 1I45A 1H7RA 3R10A 3GYCA 1JL8A 2IQTA 3KRSA 2B31A 3R8GA 2QR6A 2ZDRA 4LNYA 3C3UA 1MYRA 1W2PA 1Q8AA 1XH0A 4M6QA 1V03A 3CZLA 2OZ8A 2W63A 2YCLB 2ATSA 4L56A 1QHZA 2BY2A 1JDDA 3ZSSA 2QF7A 4M3PA 2DUAA 4NX0A 3ARSA 1JULA 2W5FA 2FDSA 3DHPA 2CLFA 2YCJA 1BD0A 2HWGA 5EU9A 2PLKA 1S1RA 3ZVIA 3W83A 2QVNA 5D2YA 4AD1A 5BWFA 1WUEA 4Z1AA 4HNUA 4XZ9A 4EANA 4J4KA 2CZDA 3MP4A 1FHDA 5TF0A 3SB0A 4AEFA 1VP5A 1TA3B 1VEPA 3EA2A 5D03A 1M53A 3KWSA 2VDIA 1DP0A 4BF7A 1KM4A 2J7HA 4MDPA 2ZVIA 2VDHA 3JRKA 3OW1A 3UXDA 4MWAB 4NAFA 3S2LA 4XAFA 3RMJA 5D09A 2ZE3A 4ORMA 3R12A 2AL2A 4GX8A 2ZTJA 1S1PA 3F5LA 1S2TA 4Q33A 4D8LA 1EQCA 2DIJA 1B3WA 1V8EA 1EZ2A 4FPSA 4C1NB 1LQ0A 1X98A 3R94A 1LUCA 2A3AA 2WWCA 4L9YA 2OO6A 4BY3A 5G2HA 3OGRA 3S5OA 4HHPA 1THFD 5AZ1A 3VGGA 4GIYA 2PBOA 4GLEA 4DAFA 4GJJA 1MW1A 3JZUA 3GU2A 1KRCC 3PWIA 1TZ7A 2DZTA 2E25A 1EJRC 2H8ZA 2XGBA 4R34A 5LXXA 3OYXA 1BVNP 4EK7A 1IT0A 3KL5A 5HQMA 1XBZA 4UTKA 3LLFA 2VCBA 6ENLA 3UWYA 4AIOA 1K7FA 3G1HA 3TLLA 2XIIA 2RJHA 1H49A 1O5RA 3IIVA 4J3VA 3KCJA 3PTDA 3SUUA 2AMXA 5JMUA 1FH8A 4WLCA 4L6OA 4HZ8A 1REQA 4UTUA 3QSRA 1BWKA 3PTQA 2W67A 4RL3A 2IKIA 4JNMA 4QJ5B 4E8GA 3AYRA 5JIWA 1MNZA 2FFCA 2J25A 2GZXA 1KCKA 4E2DA 3LCLA 4O19A 2DQXA 5EY5A 1HGWA 1XRVA 4CQAA 3QEZA 1G94A 1GJUA 3BH4A 4C6OA 5I07A 2C0HA 4NZ3A 2F84A 4NU7A 1Q65A 2OX4A 4I7WA 2WLZA 3OVPA 1TQJA 1ELSA 1XYLA 2WZHA 5DT7A 2VEMA 5LA1A 4TX9A 4LFYA 5DBUA 3DAQA 2QCCA 3BL3A 1C8XA 1EJUC 3V18A 5I3HA 2VEIA 4MMWA 3WLHA 2X0YA 3G0XA 1CGVA 3XISA 1TWZA 3PK7A 4ASTA 2HVMA 1UOKA 1J2BA 4GNVA 1AJ2A 4MZ1A 1LL4A 4IFKB 3A47A 4PBEA 1PZ3A 4JYDA 1E4MM 4YYCA 4UFJA 2Y7DA 4I9MA 4GUFA 1XXXA 2ACUA 2E8YA 3H21A 4RZ6A 3G1DA 5FJPA 3L0KA 1V02A 1XLKA 4W85A 3TQKA 2QPUA 3CV2A 1F76A 2Q3OA 4JQ2A 1NU5A 3PBVA 1B0IA 3DG7A 3FDKA 4KEZA 1EJSC 3CV7A 3OLDA 1WDRA 2QCFA 3O3RA 1IE7C 1VLWA 1UKTA 4A3YA 2RDTA 2NQZA 1OFDA 2GJNA 5KINA 4RLIA 3E02A 4JIPA 5I3IA 3A13A 2WMGA 1FDJA 1CGXA 2I17A 5FF4A 3QPZA 1OB0A 4N9CA 5HANA 1KCZA 4JAWA 1ZGDA 4FSAA 4Z0SA 1PV8A 5AB3A 5IHRA 1HKWA 4AF0A 2CLHA 2C8NA 4QJ1A 1V6XA 5H8PA 2R94A 1DWFM 3E3HA 2RJGA 4Q4MA 1XLDA 1AW1A 1KWKA 4PCFA 4J3UA 5HA7A 3ZYZA 3ORWA 1GW9A 3M0ZA 4O57A 4LUIA 3DC0A 4RX0A 5CPMA 1HJUA 4UTWC 4MB5A 4LF1A 2P0OA 4XK2A 2YZ5A 2PB1A 4JPGA 1TX2A 4IP7A 5M03A 1XICA 4FALA 4CKQA 3WQ6A 1X1ZA 4J27A 3NO3A 1U30A 1OFOA 5F2GA 4FXJA 4KRZA 4XISA 3MQTA 1JDCA 4JDBA 2W27A 4K8EA 4S38A 1BSLA 3W1PA 3W1RA 4RPPA 2G5WA 2WK2A 3M0LA 3RUBL 2QCDB 3AYSA 5HOSA 1D7KA 1GKPA 2FGBA 3CV6A 1VFLA 3BO9A 3N3MA 2Y7FA 1S5MA 3B0XA 1PL9A 3AIVA 3GXTA 1UASA 1ML1A 3L4WA 3VM5A 5D2VA 4QR6A 2CKRA 2VEPA 3B9AA 3DI1A 3L66A 3KCLA 1UWRA 2CZ5A 4TUFA 3HF3A 5HATA 2YXOA 2ACRA 3WLRA 3FY1A 4XAGA 5E9XA 5I2UA 3M0KA 1P43A 3CAWA 4L7ZA 3OU8A 3T42A 4WZHA 2PDCA 2VX4A 5D9PA 1KV8A 1R3YA 3AHZA 4TV6A 4XD3A 2D69A 1UUMA 1SM9A 2YCIX 1KTBA 4AZGA 4M0XA 4PE8A 4MY1A 4PCNA 3ARRA 3F4DA 3CZ8A 2PAJA 6A3HA 1B30A 1N82A 3L68A 4P8WA 2P5NA 3RRAA 5A1AA 2D23A 2INZA 2H3BA 4QIUA 3IAQA 2PDMA 3ARYA 4GBUA 2CESA 2V5LA 1GG0A 3V3WA 2QGYA 3GAYA 1VIZA 1YDVA 4DJEC 5CAKA 4GCXA 2PD5A 3H24A 1UD5A 4LCQA 1DIKA 1W3HA 2FQIA 3GDLA 5GNZA 3VE9A 1LLOA 4AISA 3KZPA 1JGMA 4FR6A 3EEZA 1D3CA 3UWQA 3QW4B 2WVVB 3VKCA 2Y8KA 3GSMA 1YW1A 3EA3A 1S39A 4G7EB 2VUYA 1CXIA 1XKYA 4IWWA 4ZO9A 3THCA 2YA1A 4ZB2A 3LCXA 3WBWA 4HKPA 1J6PA 1XG3A 1YXCA 1QU4A 1OFEA 3N4EA 4JS3A 5CGMA 1GVYA 1VPXA 4ROPA 2BDQA 1DQXA 4OOZA 4DEFA 1XH1A 2HK0A 1SO3A 2V5BA 3AUJA 1P0EA 2E6DA 1V6VA 3OZYA 5D32A 1B9ZA 4TR9A 4IUOA 5C5YA 3H6OA 4H3DA 3BOLA 5F7UA 3S9IA 2GQ3A 3CTLA 4QNEA 3LXCA 4DBDA 3MBFA 1OM0A 4WOQA 3FJNA 4KF1A 3SCOA 2DZPA 1TJ1A 4H9UA 2GVLA 1SZFA 2ZX7A 4PUKA 2X41A 2BXYA 4ATDA 1BGAA 3N34A 3CQKA 2HPIA 2J9YA 1KFCA 3BJSA 3ITGA 4D1IA 4LV4A 4D6EA 1ZS2A 3LZ5A 4N02A 4RE2A 3CQJA 2R24A 4U3AA 3Q65A 3LSBA 1GOMA 3R58A 4A22A 3AIQA 3QMTA 3LA4A 1H1NA 1V0LA 3NO5A 4LNCA 3T6CA 5C70A 1Q7ZA 3RDKA 1UMYA 3KBSA 2UBPC 1VPQA 3VOHA 3O0FA 1G5AA 4H6EA 3W23A 5A8QA 1LBFA 4GZIA 4JXCA 1ZY9A 2NX9A 2E6FA 1G0CA 3RPMA 5E93A 5CC5A 4XSLA 4K6AA 2XWEA 3QYQA 3EA1A 4Z2IA 3UBPC 7REQA 3I6EA 4RE3A 3P7YA 5AYBA 3T0CA 2PPGA 4ZZ9A 4UNIA 1G4TA 1SO6A 1EJTC 3BSGA 3WH9A 4ERGA 4A3UA 4YNGA 1PO9A 1KO0A 3T44A 4PEKA 2JEQA 1KXVA 3D3FA 1DJXA 1M9HA 2VVNA 2PCEA 1R30A 4E4PA 4DVOA 2NQ9A 5AKQA 1IT8A 3DG6A 5DY3A 1DJGA 5E5CA 1NP2A 1B3OA 1U5HA 3WSUA 1Q85A 5FL1A 2J7GA 1VBHA 1G7VA 2F61A 3CGTA 7ODCA 1OC6A 2FZDA 1PSCA 1AA1B 3GQYA 3LXAA 2CXGA 4NASA 3E6EA 4XWUA 3VKJA 4HD5A 1VCGA 4OIFA 4BQ4A 4MG4A 2IXUA 4HU8A 4UTWA 2NW0A 5E1QA 1V0NA 1ISXA 1L2QA 1B9BA 1OCJA 1R46A 1QOXA 3GX9A 4EXAA 4ZOCA 3UCCA 3ES8A 4N9EA 3ABXA 3BAWA 4AQLA 2PWDA 1EWEA 1K77A 2X8RA 2PBGA 1TMHA 1E0WA 1XPYA 2VWSA 2H3DA 4O8RA 3FV9A 3W7CA 1A5AA 2HZGA 1F6PA 3KBNA 3M0XA 3XINA 1XRSA 1K6WA 3W6LA 1H62A 4XKYB 5KETA 3GB6A 1NVMA 3K4AA 2NUWA 1MXSA 1OY0A 2D24A 1DJYA 4NNAA 1WX0A 3E0FA 1DEDA 1KD0A 2V3EA 5KITA 1I4NA 3FAXA 1RA5A 1E9LA 8XIAA 4GQRA 4F66A 1YPXA 1J0IA 1KTNA 3G5EA 3MCNA 2P8BA 1J0HA 3E74A 1QDSA 3BLLA 2J9XA 1S38A 1XLEA 4UQAA 4AMCA 4TMCA 2O0TA 1UCWA 4D6GA 2XIJA 5I3KA 5KTLA 3VX1A 2QXWA 1LF1A 3NVTA 1KLZA 1CENA 3BJTA 3O16A 3UZXA 2IUZA 4C6EA 4O18A 2VNCA 3P14A 3I7RA 1YPIA 5CH9A 2QJJA 4YVVA 4DZHA 2YDQA 4FNRA 3ARVA 1OX6A 3CUJA 4KETA 1K9DA 2OO0A 2Q01A 4GXMA 2GVEA 1ICPA 3AIUA 1S46A 4B3LA 1XGEA 4HMDA 3VC6A 5HAOA 2YGYA 4IPNB 3UPBA 2BY3A 2WMIA 4IISA 3VGFA 3JVAA 1NDWA 5HJXA 2Z6IA 4L4OA 3NZQA 4QSFA 4DJEA 2XIBA 4UOZA 1EEPA 2C15A 3THDA 2EPHA 4X3ZA 1S5TA 2J78A 4UQDA 4O1EA 4AWSA 3T78A 3WJXA 4A4AA 2YLAA 1EO7A 1ENUA 1W1ZA 2BHYA 1DE6A 4CD5A 1F6KA 4AZ6A 4DUWA 1ZBKA 1OFBA 1SW7A 2FB3A 2VQUA 4ORIA 1JXKA 1VQTA 3MV11 1E71M 2PWGA 2OTDA 4UQCA 2XG9A 4DNHA 6TAAA 1NH6A 1XQKA 2QHAA 2W3ZA 1WZLA 3T4WA 4CNNA 3F4CA 4ZQPA 1ZUAX 2L5HA 2YBUA 4PUMA 3VDBA 5AYZA 2Z29A 4YXGA 4HYRA 1JRCA 2PODA 3BLEA 3SI9A 1GVFA 3WD3A 3EX3A 1SFTA 4HZ7A 2ICSA 4CEUC 4EPKA 1YPFA 3B9EA 1ZBVA 3UA4A 3ZXWA 1E9YB 4HGXA 4QDPA 2A3BA 4G6CA 3C8NA 2XYLA 4QJ3B 4I9TA 1Q7MA 1O95A 3VGBA 3SGUA 3EDFA 5H91A 4Z2JA 3PBGA 3PBMA 2FTWA 3VDGA 2NUXA 2ZQ0A 1CXLA 1C91A 3GDTA 3MKCA 2OOFA 4AZ7A 4AB4A 1H09A 1EC7A 3MO7A 1JDFA 1OVDA 5HWMA 2XINA 1UMLA 1H60A 5FL0A 3EYPA 4UFMA 3ZZ1A 3PZQA 3H26A 4IL2A 4C1NA 2A7RA 1RQBA 2PD9A 1FP8A 1AMYA 3RJXA 4H9YA 4M56A 2FVLA 5DEZA 2XUCA 3L23A 3VZZA 3KDNA 4A6GA 4PTMA 5ECUA 1TTQA 4NYYA 3WMCA 4Q7IA 3GWQA 3SBFA 4QSHA 1S5WA 3PZNA 2I9UA 1PZ1A 3MUY1 3TROA 6CGTA 2JBMA 3W7MA 3MI2A 3AOFA 3QTGA 2XGIA 3BK0A 2OT1A 1XIGA 1X8FA 3NL5A 2X1UA 2WSPA 1W3TA 2ZWZA 4JYEA 5B80A 1R3QA 3M7WA 3S2MA 2E5BA 3FVMA 1XISA 2P53A 3M0YA 1F8MA 4Q4PA 1UG6A 1NFPA 2MNRA 2DJLA 3BOXA 3SUVA 1ISZA 1JRBA 3NTYA 3S1WA 5LNWA 3WH5A 4BA0A 4KMQA 3WLJA 2V63A 4JY9A 3ID7A 3NPWA 2QDHA 1CX9A 4AC1X 3GR4A 1V0KA 3GXIA 1TV4A 3UXLA 4IM4A 3UVIA 3CUGA 5CQ1A 1JPKA 3TVAA 3GZ3A 3P8JA 1YXYA 2G4FA 5F2LA 3N6HA 1TPFA 1VRXA 2YA2A 1ITCA 3QGVA 3C0SA 2ZE0A 4I9JA 4RJEA 2C18A 3PSVA 1G4SA 4IMEA 1Y8BA 2QIWA 3SY8A 4MZ8A 4ONVA 3TW6A 4GIEA 3RM9A 1A3XA 3DI0A 3GH7A 3W1UA 1D8WA 1WZAA 1XC4A 2G4JA 1XIDA 2GPTA 4Z1DA 6XIAA 1POKA 3LS9A 5AHFA 2GUBA 1RJPA 4CQ9A 2CITA 2Y6ZA 1VR6A 4AEEA 3NR0A 3V75A 2VQTA 1V77A 1A3WA 4TVCA 1LL6A 4IPJA 1AK5A 5HQLA 2CWXA 3SQLA 3SSZA 3KVMA 4KGJA 5E9AA 2ZZ2A 4DJFD 3CTTA 3B8VA 4D9PA 1H5VA 3NQMA 5E70A 2V81A 3CPRA 3R4IA 1KW1A 3DDMA 3NG3A 4O0ZA 1HJWA 4IPIA 2O9OA 5BU6A 1KGUA 3HU7A 1NWUA 3TOYA 5EMLA 5A6KA 2PI6A 1IZCA 1A5NC 3AS0A 3KHJA 2O92A 4LX4A 2HTMA 5HNTA 4JICA 4NJGA 4L9XA 1H63A 5C7HA 1W5MA 3BJFA 3GNRA 3OPSA 3I68A 4MNLA 3H22A 3UXKA 2OMAA 1PXGA 3DFOA 5CG7A 2HS6A 3ENLA 3QHMA 1WKEA 4KW2A 1QW9A 3MHFA 3OODA 4HMEA 2G96A 3TA6A 1QT1A 1K9EA 2E77A 2P50A 3HG3A 4HOZA 1Q5MA 3NQVA 2WQDA 4F0LA 2DVTA 2W62A 1H11A 4LU0A 6ALDA 4LYRA 4RXFA 3YPIA 1LZOA 4OV4A 1CWYA 4UTMA 3LHTA 4RE4A 3HGJA 1KGWA 4YMZA 3K13A 4AY1A 4BZYA 1JCYA 2AMGA 4OUIA 4QCEA 3MKVA 3NQ8A 1EOKA 2NSXA 4TU1A 4GVIA 4C1KA 4JFWA 1XYCA 1JYNA 1A5CA 4R9OA 3IUIA 2PGRA 4LW7A 1W6TA 1K7EA 2DSWA 3GO2A 1QW7A 4Z2GA 4HTBA 3KEHA 2DVUA 4UFIA 3AZTA 4C6QA 2ZXQA 5FJOA 1DJNA 2QCDA 2VX7A 2QJNA 1TTIA 2BX7A 2ZUMA 3L5LA 3AALA 1HTIA 3UXIA 4QJ4B 1E5NA 1NM9A 3CLMA 1QCWA 4H9VA 3VMPA 1RR2A 2E3ZA 3WQEA 4ES4A 1E6RA 3W86A 3GAKA 1R5YA 1X6UA 1X1NA 1YBQB 3WJYA 3GHUA 4QAIA 3UU0A 5CC7A 2IS7A 3WNPA 1LWJA 2QDGA 1HIZA 2BV9A 9RUBA 1JFXA 1FH7A 1J11A 3A9BA 2EKGA 3KVLA 4UOJA 2DSZA 2NUYA 4W84A 4P5UA 3OZOA 4FF5A 1XCWA 4WDTA 1M7XA 3RK8A 1F6YA 4QXIA 2CERA 5A69A 3AXKA 3KS6A 1R3WA 4GYFA 1E5JA 3N19B 1YNYA 3E12A 1FKWA 3IVSA 1V02E 1R2SA 1VAHA 3UGVA 2A0NA 1FWBC 4QISA 3EWBX 3UJRA 2WW5A 1GPFA 3CQIA 1PCKA 3SIMA 3KBWA 1BXNA 1H61A 1TYGA 3GXNA 1QW8A 2TODA 2OGYA 1EX5A 4XX6A 4W93A 1R86A 1OX5A 1JNEA 4KEMA 1DJIA 1TPVA 4F9DA 5C2GA 1WQ5A 2RKXA 3CWOX 3DFTA 3N11A 2PURA 1A5UA 1L6GA 4H6RA 1NFGA 3GIYA 3HB9A 4WDWA 5AYIA 1EX1A 1R7AA 3VNZA 4B2DD 4GZEA 4QLKA 1DIDA 5K9XA 1DORA 4PBFA 4GMEA 1Q6CA 4QQUA 4X0VA 5CZKA 2YCKX 3N6JA 3VU2A 3TTSA 5CC6A 2I5QA 1LROA 4J3TA 3L4XA 1V4YA 3W7RA 4UTLA 2R1PA 3VIJA 3T8QA 3ZOAA 5KMYA 4NJKA 3G18A 1XI3A 3A9IA 4O1FA 4M51A 3RYSA 3BLDA 1ISWA 1KNWA 2VFGA 4L6DA 2ZZ4A 1V93A 2V82A 1K4HA 3SJ3A 1Y5XA 2WNNA 2OZ0A 3O6CA 2I9EA 2GWNA 1U2YA 4KWUA 3IGUA 1JZ3A 4DJDD 1ICQA 4P2VA 2VUNA 3FGCB 2F2HA 2V68A 4G9PA 4QE1A 1XDLA 1MUWA 4HT3A 1R47A 1QBAA 4AZIA 1EF3A 3GM8A 1KKOA 1FWRA 3H2CA 1E6ZA 3EKGA 1MW3A 1O5QA 3LGEA 2CPUA 2YYUA 4Y2WA 4NXKA 1MO0A 2RH9A 1OYAA 2PZ0A 4OVXA 1AODA 4DXVA 2V3FA 3QVQA 5HNUA 2Y63A 1CLVA 3WF4A 3WH8A 3FKKA 3QV9A 1U83A 3RMEA 3LERA 3V0TA 3PHAA 3N6QA 4MKVA 5K4ZA 1BXBA 1W0MA 1V51A 5BXSA 2QJMA 5IXEA 1UB3A 2WC4A 4RNFA 3WNOA 3DBNA 3HFYA 1CLXA 1FDYA 3W24A 1IEWA 3CO4A 1JCLA 1VCVA 2PDBA 3ITLA 1NQ6A 5ABHA 2ALDA 1EOMA 2JK2A 2NV1A 3IJ7A 4QAWA 1Z69A 4GH1A 3VCCA 3T2OA 1XIIA 2YL8A 1EO5A 5LZLA 5M3WA 3MO4A 3S1VA 4CVWA 1KR1A 4GOAA 1YE6A 3WN6A 3F4VA 3W2LA 1BVWA 1XLCA 4BK9A 4POCA 5LIKX 4N9BA 3H53A 1H51A 3PPGA 3QGAC 2H90A 4OT7A 3BW3A 3MBDA 4D6DA 2I56A 4BFAA 2BHZA 3W1LA 1WUFA 4K1GA 1JPDX 2X2GA 4ML9A 4U3CA 1KQYA 4GQQA 1W8GA 1BSIA 1FH9A 1FWGC 3IEBA 4NNBA 2C79A 4J28A 1HO4A 1IV8A 3HZ3A 5I78A 5XINA 1RUSA 2QCGA 3OYZA 2VELA 3IJ9A 4BEUA 1GKRA 2R82A 2CLEA 3TQ0A 2QNEA 1EHNA 3QFEA 2QIIA 3W7LA 4B5NA 4PUNA 4BI7A 4UFLA 3O2LA 1QI0A 1Q66A 5IRPA 2HJPA 1EXBA 3NQ6A 4IPPA 4GQBA 2VRJA 3KP0A 3RGTA 3R11A 2ZC8A 3G1RA 1TPC1 4KWOA 3A4XA 2XTKA 4DWSD 1VYRA 3MTWA 2OLAA 3OBEA 4QE4A 2G95A 4GI9A 3T40A 1OC5A 2YXXA 4PUEA 4DI8A 3VOIA 1W1YA 1AQMA 4K3ZA 3WEOA 1HP5A 2OXNA 1P6CA 1CXHA 1HL8A 2Z25A 3E5PA 3UQNA 1E4NA 1O7AA 2OEJA 4IT1A 3VNDA 3N2TA 1F7BA 2PRLA 1XQLA 3O6YX 1R38A 4AD0A 4JL2A 5HMFA 3NQ2A 1C8VA 2ZUSA 4Y9NA 5D9OA 2Q02A 3VIKA 1HKVA 4LVBA 8CGTA 1EJ7L 3AHXA 4Z1BA 2JKPA 2WVSA 3ISIX 1Q6OA 3O06A 3DUGA 3TR2A 4KS0A 4K39A 4FX6M 3W7HA 3UY7A 3VIHA 1U5VA 4DZIA 5I3FA 1W8SA 4ZB0A 2O4QA 4ECLA 2GGEA 1R8LA 1J96A 2GGGA 1L8PA 2UY4A 2WOQA 4O16A 3HPZA 4JTRA 1Z6KA 1WDSA 5MHBA 3OBKA 2ZZ5A 2GK1B 2QULA 1O4UA 2PWVA 4GNJA 4WKHA 2YJQA 1P7TB 4GE8A 5AC5A 3DERA 3B9NA 5M2FX 3GK0A 4I8DA 2B7OA 4NG3A 3D3AA 1XL9A 4E2BA 5KEZA 1R3SA 2IKJA 2HRWA 4DLMA 3MC5A 1GORA 5BWAA 2DSUA 2ZRZA 3VVGA 2PTXA 4M82A 2RGMA 2Z27A 4BQ5A 2DU2A 3C2VA 3CT7A 3LBCA 2AOSA 7CGTA 3FSUA 4FS9A 3KS5A 4M7SA 1O60A 2PTDA 3EOOA 2HK1A 3HV9A 3LPGA 2X1IA 4QLJA 5FEWA 4OWGA 3KP1A 3UVAA 1W3LA 3BAIA 3GS6A 3H7RA 4DBEA 3UWEA 3Q45A 2VENA 3EAUA 1QNPA 3BV7A 1RJRA 1GONA 1VJIA 2BGSA 3NAVA 2H8XA 3TFXA 3WFZA 3H2FA 4I8YA 2HSAA 3FHAA 3TONA 3W1XA 3DOPA 3M5YA 3TYBA 3TLQA 2A21A 4D6CA 5I23A 3H7UA 3VNMA 1WDQA 2TAAA 5FA5A 2ZTKA 1GHRA 4E38A 1P1MA 5CEWA 2GSEA 1MEHA 1TPEA 3RM4A 5J8LA 4RNJA 2YLLA 3WQ8A 3V0SA 2PRMA 4ZTYA 1TWDA 1F3XA 1SR0A 4CD7A 1FCVA 2F7FA 2Y62A 3SGZA 2VFHA 3FCPA 3AMLA 3NURA 1D3GA 1KM0A 1GZGA 1JEZA 3F5JA 5BXTA 1DJWA 2VZTA 4RUBA 3SQMA 1ME7A 1UH2A 6REQB 3W81A 3XIMA 1NOFA 8RUCA 1CI1A 1CPUA 2HEJA 4IIGA 4S23A 5I03A 2AGTA 3MZ2A 1EJXC 3QR0A 1JIBA 1UP3A 1WBHA 3GVGA 3AXXA 4XZWA 4L4PA 3ZSTA 4UQBA 5EA9A 2FYMA 3WLMA 4J3SA 1A5MC 4U2YA 3KBJA 4XB3A 2ISWA 6PTDA 4C1LA 3Q58A 1JCMP 1UUQA 2C6QA 1JZ5A 5FESA 3SQSA 3KUMA 3K46A 3CMGA 4C6BA 1E56A 2JIEA 1KFJA 3OTRA 3H2NA 2E6YA 3TX9A 4BR1A 5C2XA 1R9YA 3DGRA 2DZXA 2XN2A 2YSWA 1WB0A 4GFIA 1NDVA 4FLSA 4LY8A 3RXZA 3SRDA 1E73M 5JH2A 1A47A 1W5NA 3T2PA 1ME8A 4ZXLA 2FDMA 3DFQA 5D02A 3R5EA 4R5EA 3RRXA 1GJWA 1TWSA 1DXFA 3VZXA 1AW5A 3TMQA 4CN4A 2D3NA 1IEVA 3UY8A 3LCGA 2FVMA 4L64A 3PULA 1R9ZA 1KBBA 1GEQA 3E9AA 4B3KA 3ANYA 1XD1A 3GTHA 3QOKA 2Y8UA 2CLMA 2DP3A 1KM2A 3IVTA 4DRSA 1K1DA 2GJXA 2VZVA 3UG4A 4OZOA 3IIXA 2DT3A 5IDZA 3P84A 3C86A 5C55A 2X16A 3S46A 1TO3A 3NQEA 4H9XA 3VD9A 3VOCA 3HGRA 3B0PA 1EJVC 2NX1A 2AKZA 5D05A 2P76A 3QRHA 3O15A 2EG8A 4WKFA 1SGJA 1AL8A 3E49A 2V3DA 4Z17A 2FZ9A 1QPQA 1X6LA 2XZ7A 4MADA 4UFHA 2I5GA 4MWAD 3PZIA 5A94A 2J27A 4PYSA 4JTSA 5EMJA 4Q8VA 2RDWA 4WGXA 2VI0A 3WMLA 3H7VA 3W82A 3HQNA 1K8XA 1YDNA 4N6FA 3MP5A 4O17A 2Z1XA 4WRHA 1EH9A 4OUEA 5TAOA 1GUVA 1XIBA 3LPFA 4GUGA 3W37A 4JKLA 1J9YA 4GGHA 2V8ZA 1GVIA 4XZMX 5HK4A 5CJ5A 1EP3A 2CCRA 4W4QA 3P5ZA 1MSSA 1EZWA 2VGIA 3D0CA 3TTYA 3WQPA 2AAMA 4WVXA 2OLSA 3QC0A 1VJZA 1WCGA 3VKDA 4H1ZA 4RK8A 3R8RA 2IPGA 4GY1A 3LN3A 3CAKA 4UMCA 3T0DA 3TTQA 2Q09A 3N2OA 4DLFA 1TVNA 2E8ZA 2V0TA 5HDRA 2WBGA 1V7AA 3A4JA 5DCEA 1VJSA 4S3AA 3RPTA 3H23A 4HPNA 4PRWA 3T4CA 2E28A 3W7DA 3IJQA 2Y8VA 2CZFA 4PRRA 4Q8OA 3EPMA 3WNMA 5I0DA 1GQNA 1RALA 1IGSA 4KFOA 1A4MA 1G4PA 1TMLA 3HN3A 3IARA 3UJ2A 2DT2A 1V5XA 5B7YA 1H2JA 3WELA 1UR3M 4PH6A 3QY6A 3U4FA 4L61A 1UZHA 4PB5A 4JTGA 3POCA 2H9AA 2RDUA 3R2GA 3LCIA 4MJ4A 2WJEA 5HWNA 3CWHA 5HMSA 4S3CA 4YTQA 1KFBA 3UNDA 5A5WA 1QPKA 1M04A 1E4IA 1UBPC 2Z1KA 4QROA 2JF6A 3UCQA 1VFFA 4GUHA 2XDFA 3PTMA 4LS1A 4WY0A 5CLTA 3S1GA 2CFFA 4Z2HA 3I3EA 2CZVA 2GVYA 2YDSA 4O1BA 2QW5A 1R0MA 3DBPA 4K7VA 4V1XA 1PZ0A 1T7LA 3TWBA 3GFZA 4NAFB 3CASA 4AWUA 4X2RA 3BLOA 3QZAA 4PUUA 4XVDA 1B4KA 2AL2B 3GVRA 1KWGA 4HMNA 1QNSA 1EUNA 4Z1CA 1BGGA 2A3HA 3R25A 2X30A 2Z1BA 4JTTA 3V7PA 3K8LA 3KXQA 4G1NA 3V1HA 1SU5A 1LBLA 1VCFA 5C54A 4Z0JA 1O5XA 1J0KA 5HJYA 1KFLA 3F2CA 3G1FA 3A24A 3UZZA 1LUCB 3WFLA 3PZUA 4Q32A 4XV0A 4JIRA 1WA3A 4IGHA 5A8GA 4F2TA 1GOQA 4UBPC 4UQEA 1EB3A 4UZSA 5ABFA 1X97A 1B54A 3GU1A 4ZR8A 4DXKA 2DEPA 5DELA 3VTRA 4XZIA 3F4NA 4WDUA 4JHOA 1YLVA 4LBUA 5T9CE 5FSDC 3L2IA 2HNEA 2QPSA 1UH4A 3SN1A 3F2DA 4AH7A 3C5QA 5AC4A 3TP4A 1E4LA 2C1GA 2IKGA 2VR2A 1XV8A 3WQFA 2PF0A 2I14A 3OIHA 4JEQA 4M6VA 3C3NA 2XIOA 1EP2A 3OA5A 4ATLA 2P10A 4X60A 2W79A 5ABTA 2HNHA 4GO8A 1REQB 3EOUA 3QW3A 3GDMA 3ITTA 2BVWA 3L12A 1UZ4A 4M19A 4JN8A 3TR9A 4PSPA 2XPKA 4GCAA 1B3ZA 3R13A 1UIOA 1G01A 2WSRA 2HPMA 2AAAA 2X42A 1QK0A 1DWIM 2EG6A 4UMBA 1F8IA 1R2RA 1M7OA 3K1GA 4GI4A 3RLVA 3DXIA 1DKWA 1XFBA 3CIXA 1CZ1A 3ITYA 3CHCA 4R3UA 2YX0A 2A7PA 2DUXA 2CLIA 1L6YA 1IXOA 3B8DA 3WQ5A 3WYZA 1RA0A 1UKOA 4J5NA 3WLKX 2B7NA 4HZ6A 3FGCA 4ZQRA 2EPOA 3IRDA 1V6YA 2QS8A 1T40A 3CYJA 1XIHA 3VMNA 2YL6A 1SO4A 2ISVA 2Y7GA 3UA3A 1V3JA 3W38A 1NF0A 4Q4OA 3CMJA 4JNYA 4IMGA 1UYQA 3LHUA 4C6KA 4AY7A 4WKAA 1MUMA 3B05A 2WAGA 2ZYFA 4KEUA 1TX0A 2DORA 1OK4A 1HJQA 2YB4A 1P4CA 2DZAA 1TQXA 2CETA 3UD6A 3U7VA 3TJIA 3NXFA 3TYZA 1XRTA 4JN7A 3N14A 3ZT6A 4DYKA 1Q6FA 2V5CA 4PN2A 1TJPA 5L9FA 3S5YA 2VD9A 2GJPA 2VC9A 3OJGA 3OOQA 1HL2A 2CLLA 3B9DA 4IGMA 3MT1A 2WZIA 4S3FA 5TD4A 1JCTA 1VKFA 1Z44A 2DT1A 4D71A 1KLYA 3AZSA 5K9CA 3BXWA 4JIQA 4MNJA 2J7CA 3G0SA 3GH4A 1TCMA 4PTDA 3EDDA 1XYBA 2JQXA 3UCDA 1VH7A 4B9YA 4Z42C 1Q6DA 3N17A 4Q8QA 4ZTXA 1OD0A 1HVQA 4NI3A 2FGZA 3IACA 2QCHA 1JAEA 3N2CA 5IFTA 3LOTA 4N0RA 3N3TA 1TV5A 3CUXA 3MI3A 2Z7KA 1WO2A 3NSXA 3Q94A 1AJ0A 3MMTA 1P0KA 3K2GA 2QT3A 4HA0A 4HVXA 3MANA 1RVKA 1UD4A 2GQAA 4O14A 4DX3A 3KRUA 1QATA 2R1NA 1DHPA 3UFYA 1CB7B 1U5JA 3SR7A 3IS4A 3FA3A 3MPGA 2BSLA 1JZ7A 2CZEA 4O13A 1GTHA 3QHNA 5GPRA 4JFTA 3OO2A 5BXRA 3M0JA 2QMKA 2OKTA 2WYSA 2EBNA 4WDXA 2XM2A 3IJ6A 1CIUA 4CD4A 2OWXA 4MB1A 1UWAA 2HXUA 3PSWA 3WDPP 3P6LA 1UW9A 4P7QA 1VBUA 1J18A 2E1DA 1FHVA 1EHAA 1B5TA 1CXKA 4HSOA 1EL3A 3M41A 3OBAA 1CW2A 1CGUA 3J7HA 2QV4A 2NQJA 3SCRA 3BZGA 1JZ6A 1G1YA 1BWVA 1CXFA 4BQ3A 1O1ZA 2CHRA 1KFWA 1NF7A 2WMJA 2HMCA 4G2DA 3BMVA 4JQ3A 1OQFA 2DZWA 3B4UA 1M03A 4ZEPA 4CGTA 3G24A 1F9CA 2OODA 1IF2A 2O9TA 3WQOA 1W31A 2UWFA 1YTDA 1XRFA 1NQKA 3L4VA 4TV5A 2YCEA 4BQ2A 3LHWA 3WQWA 5G2IA 1J01A 3PC0A 1MWOA 1GYMA 4KWWA 4ZA0A 3V4BA 4FB7A 2YW3A 4XQ6A 2D2HA 5HQEA 1M7JA 3ZJKA 3K4DA 4TVUA 2MUCA 2PEVA 1A0CA 5G4HC 3MYOA 4C6JA 3WMSA 1A49A 4LVGA 3LG3A 2IPWA 5FKYA 3CO8A 3QTPA 4H7VA 4F9JA 2TPSA 3N13A 3INPA 2VFIA 4N9DA 2ZRYA 3M6YA 3M1ZA 1XBVA 5HJLA 2VD8A 4ZODA 2EJ1A 2YKKA 1YTEA 4ZQCA 1P7TA 4GINA 1A80A 3GR8A 1MZRA 1VS1A 3MB9A 1AQ0A 5EFDA 3VO0A 3THAA 2ZDSA 1L8NA 1YIXA 4PSRA 3AU6A 4XTDA 4UCGA 2PRHA 3CH0A 1HQTA 3UESA 2XU2A 3U2CA 4RZBA 2F38A 1TPB1 1XLBA 3P2VA 5EGRA 2WZTA 1EIXA 4AHQA 2PFHA 1VBRA 1TV8A 1C8QA 2IQ0A 4F4RA 5HR6A 3TQVA 3OHIA 4PA8A 4E6MA 4ICCX 3LCFA 4NZCA 2NQHA 4HYWA 2WSYA 3PG8A 3NQBA 3S8HA 2OLHA 3EWZA 1F61A 1RBAA 1WBJA 3WQCA 3N04A 3TW7A 1YDYA 1WZMA 4DPQA 1DOSA 2BGQA 4Y9MA 4DB7A 2WNZA 3ABSA 4LQ1A 4MFEA 5CZJA 1ONEA 4AZBA 4LUSA 1IIHA 5H8UA 4AZCA 4NJIA 1B2YA 3K30A 3S2CA 2I5IA 5LIXX 2CHOA 4XBKA 3T05A 2PDWA 2OSYA 1VRDA 1RP9A 2E5CA 3AC0A 3A5VA 4JX4A 3W02A 5ABGA 5DMNA 4CCZA 2OFJA 2Z2BA 1XLJA 2HE5A 4IZGA 1PX4A 2OYMA 2RHGA 4DN1A 4BF9A 1FCUA 4CCEA 1YNQA 3PAOA 5F4SA 2GL5A 3A3HA 4E0CA 1BHGA 3QPYA 3T2QA 3RX4A 4R33A 1E3XA 1US3A 2WVTA 4LVAA 5G4EA 3STFA 7REQB 5BYWA 3MVIA 1XLGA 4IHCA 3AUOA 3CK5A 1F73A 1FWTA 4Y9AA 4OOUA 4FNQA 1R2TA 3B0YA 3T0BA 3ANVA 5C71A 4GYPC 1RCXB 4TO8A 5GJNA 3CHDA 1RY8A 3VX0A 5CJNA 1BRLA 1QMLA 1RH9A 4Z2LA 2X2YA 1WOBA 4PUJA 1RK6A 3ZR6A 3IJLA 3DHFA 1CEOA 3TCEA 3O0KA 4EXBA 4QG6A 4GIAA 2DY3A 1Q63A 2OSWA 4YHGA 3VOGA 4MIMA 2B7QA 4W5UA 4BEQA 3I10A 3OZMA 1JQVA 4XBJA 1CGWA 3MUCA 2F2KA 4QG8A 3QZ6A 3WG6A 5CLWA 1IGWA 3ZLFA 4GJ1A 1JPIA 4H01A 4YIWA 1DQWA 2EPMX 5BCAA 3PB0A 3D46A 3WX7A 4MDOA 1EJWC 2VGFA 3AMGA 1W9XA 3AS2A 4IIFA 3RLHA 4BI5A 3TDFA 3RX3A 5I06A 2UZ9A 4ATWA 5BU9A 4C6DA 5U4NA 4E2OA 5CSUA 5I3DA 3WD1A 2HBVA 4OBTA 1Q7QA 3OLIA 2WMHA 1NFBA 4U33A 3REQA 1BTCA 4D8AA 1ADOA 4NZFA 1OCBA 2ZX5A 1W91A 3N9RA 3SRKA 4DIAA 3TUUA 4MNKA 3RNDA 3VMOA 3BMXA 1JDAA 3GXFA 1MDRA 4X63A 2F6UA 5CGQA 2ZZ3A 1WXYA 3JW7A 3OGSA 1JD7A 2R1LA 3NQFA 3H2EA 2XIMA 1OFAA 2E40A 4P8VA 3TJXA 4KCUA 4GFSA 5DXXA 3RO6A 2WHJA 3WL1A 3EWXA 3KW3A 2G3NA 1E6QM 1FWDC 5AHLA 3GXMA 4FEZA 5DXYA 4I5XA 1BYAA 1RP8A 1MQPA 1R3RA 3EGJA 4LXFA 2WMIB 1RPXA 3DC8A 4W9TA 5CPNA 5T91A 1JPHA 4DWDA 4HCLA 4LF2A 3GTXA 3GUGA 4XAPA 4WF7A 1RHCA 5MF5A 2NVCA 2Z4GA 4Z2KA 2FVKA 2JIWA 3S1UA 3ONCA 2ZZ6A 3ICJA 1TIWA 4Y9PA 3G1SA 3N18A 3TN3A 4P61A 1R7OA 4NZ4A 4CN6A 1OC7A 1HJSA 4XG1A 3T7VA 3W75A 1XLHA 2HVNA 2Z28A 5D9MA 4AHOA 4H9ZA 5EYWA 3EB4A 3P82A 1BG9A 1ZPTA 4AX7A 3SO7A 3QMSA 4PMJA 3O07A 3AMCA 3MDWA 4AEOA 5HPCA 1M5WA 4Q7BA 3LSCA 4FLQA 2Q8LA 3V35A 1UQYA 1YQ2A 3VNLA 4H04A 4DBUA 5HULA 4PTNA 5EFFA 4MLRA 4GO9A 2WPGA 3NUKA 3LLDA 1GT8A 3SRHA 1Z9AA 2ZICA 4QS6A 4WXYA 2WVUA 2X05A 4K2SA 3E5BA 5CXPA 1IEQA 1PKYA 3HTWA 4OQVA 3WUBA 1GHSA 4GGBA 1W9DM 3N2BA 5J5RA 2WPBA 2AKMA 2OYLA 3IRSA 4LYPA 4EF8A 1FA2A 4A3RA 1QUMA 3GFYA 3BSHA 3KTCA 2E4TA 1F5ZA 2NWSA 1FXQA 1RAKA 1Y65A 2EXOA 2J4GA 2PWHA 4IQDA 3L65A 2CBIA 3UWZA 4GKLA 5LNRA 5A6BD 3H70A 3BAYA 3P5YA 4Q3MA 4GVGA 1NOUA 4HNNA 2FKPA 3NDYA 2EG7A 5JQ9A 3EMQA 2O9RA 4ACZA 3K8KA 4W7WA 3ARQA 3VC5A 3ARWA 1SFSA 3G1AA 4H8NA 3Q37A 3GIQA 1F07A 4LAKA 5K7JA 2JGQA 4ERIA 2CWNA 3LX9A 1V3MA 1E15A 2QUTA 1GG1A 4IIEA 3WQVA 1W9BM 3O6DA 3PUDA 5I7GA 4NYUA 1NP0A 3UXAA 1XG4A 2DSKA 4I3GA 2ZZ7A 3DHUA 1QAPA 1ZAJA 1D7FA 1UZ1A 1V0MA 1GVEA 3MJYA 1UPPA 3CUHA 1UHVA 3T55A 1UUOA 4PMDA 1HKMA 3ZJ7A 4LS2A 3F2BA 2IMRA 1XR2A 2TYSA 5G1TA 4QBXA 4X0NA 3TSDA 3NPUA 1TZ9A 4NXSA 4KBXA 3SW6A 2D2JA 3IIOA 4V15A 3S83A 1TRIA 3UR7A 4R7WA 4H7ZA 1TCDA 3U7BA 2AGKA 5HNRA 2QDEA 4EPBC 3TN4A 2OR2A 1GPWA 1E0UA 3QPEA 4RV3A 3ZMRA 1BYCA 1FY6A 1O12A 1VLIA 3KOYA 1W1TA 2MANA 1UZDA 1F4AA 4DM2A 3WK2A 4LT9A 1PTGA 3L5MA 3M5XA 1ZBWA 3QR1A 3UG8A 4LUTB 2ZKMX 3G0UA 7ENLA 1EQPA 3TZNA 2OB3A 1BWLA 3LV5A 3B4YA 3UR8A 2C13A 2NV9A 3N2MA 1W5QA 2V38A 4MOZA 1GOXA 2WJFA 1C93A 4H6QA 4NY2A 3SGGA 3LGGA 4BJHA 1TG7A 1IWBA 2A2IA 4UTIA 3VCNA 3KZSA 3UR2A 4S2BA 3W2KA 1QPRA 4V1YA 2OJPA 1LT8A 3MW7A 2YOCA 4HN4A 2JGYA 4U5KA 1YEYA 2E09A 1AD1A 4YL2A 4MPKA 2XFWA 1XHGA 1XJBA 1HX0A 1PTDA 4H2HA 5F2IA 3HO8A 2XIQA 4HQVA 4RZ4A 3TYDA 3A23A 2ZVRA 3S6DA 5T26A 4XBSA 1JUEA 3C0JA 2XH0A 3VYLA 1YE4A 1EKOA 3AWNA 2ZUTA 3H55A 7PTDA 4YCPA 2CLOA 2W4XA 4FOKA 2YA0A 3FXGA 3WEMA 3A64A 4UQ9A 3K4WA 5CG0A 3EDEA 3GVWA 2Z1VA 2ZFAA 3U8GA 4DYEA 2J77A 4MPQA 1N55A 5EPDA 1TJ2A 3N9KA 1HT6A 3G1YA 2WSKA 4WY0F 3GNNA 1J8VA 3B0VC 1BXCA 4LUJA 4B4HA 4ICMA 1GK8A 2J47A 3PPHA 4IP4A 1LRTA 3PM6A 3A22A 1AMKA 4PR4A 3RHGA 4EOUA 5DRIA 3FX4A 3ZQ9A 4R9XA 5AVNA 1SQ7A 4XVEA 4CUCA 1R87A 1IZJA 3U2ZA 3W76A 2ZXDA 4CNPA 2OZTA 1OT2A 1JYXA 3V1PA 1GOWA 1PDYA 4H9MA 2BP1A 1GW1A 3CIVA 3W7OA 3WLQA 1BYBA 4CN1A 1QJWA 4MY8A 3IJDA 4WJXA 3S0CA 5FD0A 5JVLA 3GH5A 4JIEA 1M41A 3CZGA 2EHHA 3BARA 1SVDA 4GI8A 2OCZA 1DV7A 4L6HA 1CXEA 1GNXA 1PIFA 3VFCA 1JF6A 2XN1A 4HTYA 3W26A 4IFRA 4HPJA 5FIPA 4ZE4A 1UR4A 3VI2A 4K7YA 1XCFA 3N2XA 1JCJA 3FN9A 3UPMA 3GZAA 3MMWA 4H19A 4UTTC 3WK1A 3BQ6A 3EDKA 5TBOA 2DZSA 2PGWA 5CCZA 2OZ3A 5FSEC 3QV8A 2BFGA 4R7JA 1C9WA 5C2CA 4ADTA 4AVFA 1MW0A 3W74A 1FKXA 1DJHA 5H2ZA 3WLLA 3LYEA 2FMOA 2VZOA 3FLUA 1QNQA 4A29A 3SAZA 2Z24A 3ABOA 2R91A 2FZNA 2NXIA 4L1GA 2BHUA 1F3TA 4QITA 2QJGA 4K1WA 1LWHA 5G1MA 3WDRA 1Q2RA 2WM1A 3G8EA 1KR0A 1Q8JA 1ADSA 3JS3A 2F6KA 1G6CA 2Y88A 2WC7A 3DYOA 3EZ4A 1AFSA 4K68A 3AI0A 4EIVA 1U1JA 3QKEA 3P61A 4I5RA 4CNOA 1N2VA 4LVDA 1P6BA 3LRLA 3RN6A 1BF6A 2I1OA 1XGDA 3TC3A 3QFWA 3W73A 1EC8A 2ZUWA 3IAPA 5K3VA 3B06A 4GX9A 1QOPA 3E2RA 2WM0A 1OG6A 4IMFA 1VEMA 3MCMA 3FAWA 3DFNA 3LHZA 2BB0A 4AWTA 1EGVA 1E51A 5GJPA 3HJZA 2J6VA 4NVTA 2ZA2A 3L2LA 3O7UA 4FHAA 4G56A 3WK0A 3VM7A 1Q6QA 1J6OA 1YX1A 5BNKA 1HKJA 1MZHA 4MB4A 1G4EA 2DIKA 4JTJA 2PDPA 3WUEA 2YXGA 4JHZA 3BGJA 1HGYA 4MTVA 4U10A 1OCNA 5CSYA 2ZADA 1OGSA 2PWEA 1FWSA 3DYPA 4A05A 3VIPA 1ITQA 2PDUA 4MKSA 3KVKA 4IIHA 1SFLA 1TWWA 4P7OA 5DCBA 3W85A 2FHFA 1YDOA 5SWUA 2QLYA 3NZRA 3DFSA 4RDYA 4YWIA 4LCSA 3I6RA 2BWGA 4NILA 4LJ3A 1IR2A 2X0HA 4JTHA 4KGLA 2J7DA 4FA3A 3HG2A 3FJ4A 4GVFA 1W1B1 5JUVA 2PF8A 4V28A 3NSNA 5IHSA 4JEJA 4D72A 2H6RA 3M4HA 3LPPA 3URQA 4PMRA 1PWLA 5U7SA 1C92A 3TYUA 1SMAA 2V6AA 1US2A 4HN8A 3SUSA 1EBHA 1Y7VA 3MA8A 3E2QA 5I24A 3VINA 4GPNA 3RR4A 3B8IA 3ZR5A 1ZP3A 1MW2A 5C9WA 3BE7A 2Q3RA 3BQ5A 4PMVA 3QY8A 3VZYA 2F9RA 1OF8A 5EL1A 3ZLHA 2UY2A 1SO5A 4UIOA 1P0NA 4PFHA 2ZX6A 2XFYA 1DL3A 2QUNA 4DM1A 2DDXA 4N6EA 3IGHX 4GA8A 4N42A 2HVOA 1T41A 4TX8A 4GD0A 4OBRA 4M7TA 5DRCA 3NQGA 2YR1A 2WHLA 3WDQA 1KM3A 3CUFA 1QFEA 3SECA 2J7EA 3TJLA 3G3DA 7TAAA 2INEA 3D5HA 1GOKA 2BY0A 3GG8A 4TIMA 1WKDA 3AZRA 1RLCL 4C5ZA 3E1F1 4DBSA 5LHFA 4FI4A 1H5YA 1T0OA 3LK6A 2V5KA 2X40A 4UR7A 3BG5A 3W71A 3LBMA 4S3JA 3ME3A 3CMFA 4D6IA 4JIHA 3I7SA 1A5KC 1O68A 1GKQA 4NZ5A 4UTHA 1EC9A 3URNA 3HQPA 2G37A 1JI2A 3HBLA 4QM1A 3BGAA 2NLIA 4MY9A 1BQGA 4X2PA 3T81A 1BEUA 1SJDA 2ABBA 3LXBA 4AXKA 3AFBA 1V7YA 4Q4SA 1JD9A 2YL9A 3CL8A 1UD3A 3W3OA 1KFKA 2X09A 5CPTA 1EBGA 1J5TA 1ZZMA 2PC8A 5HPOA 5I3GA 3C0QA 2Y7EA 4AXNA 4GISA 1LDCA 4PUDA 4LPCA 1JF5A 1H7PA 4LEQA 3FJ6A 5AYXA 4OV9A 3I3DA 4XD5A 1P6WA 3N25A 2CBUA 2OVLA 4D8ZA 2NQLA 1VFSA 5LIWX 3HGOA 4REQA 3DENA 3KTXA 3QM3A 3EWWA 4WSKA 4Q4RA 4UTTA 3DX5A 3MI6A 1POJA 3BAJA 3MSDA 4HK5A 3GDKA 3NSMA 1SZRA 5I5RA 2YBVA 1UWTA 1KXTA 3ABRA 1TV7A 4HU3A 1WE5A 3TNOA 3ZLGA 4C7FA 3FOKA 1JI1A 3G1VA 4L4MA 3CEUA 1WZKA 1XIEA 4KIEA 2O4MA 3P74A 4EKJA 3FA5A 3QY7A 1CB2A 5B7ZA 3H2OA 3I4EA 1OSEA 3W9ZA 4E3VA 1N8FA 1PKNA 5LNUA 1V3IA 4AZ5A 3CT2A 3BLIA 4IXXA 2XFFA 1L6WA 3ITVA 3A3XA 1PUDA 5FF2A 3RFAA 1KXHA 2XVGA 3MSYA 3WDJA 3UF9A 2YPIA 3KBMA 4PRTA 1A5LC 1E6PA 2GUYA 3R1ZA 3FKRA 1W1PA 3GDRA 4FOJA 5F1UA 3PR2A 4UZUA 3FA4A 3TSMA 2GJLA 2C91A 4M1RA 4IX0A 4JFSA 3SEPA 1D8CA 1T5AA 3NEVA 3MU7A 5LYRA 5C0QA 3PBWA 2BZNA 4EPDC 3CL6A 1F74A 4ZSUA 1E6XM 1U1UA 5EBAA 3W01A 4IGSA 2YDAA 3PWAA 5JBFA 5LNVA 1HG3A 1PIGA 4NJJA 3VPLA 1EA9C 4M6PA 1LQ2A 3G8RA 3DESA 1BPLB 5A6AA 2HROA 1K8ZA 3GE7A 2UY5A 3S5NA 3L0GA 4PMNA 4YWSA 1OJXA 2ZXAA 3NGJA 1L6SA 3W2NA 3LTYA 1W2VA 3AYTA 3ITXA 2DUZA 1VGAA 2J88A 3QLLA 2QEZA 2WXDM 3S42A 4B92A 4ZGYA 3UT0A 3UZJA 4DJFC 1FWEC 5DY2A 1OHLA 3H54A 3RJYA 1UR1A 4JTDA 3UJEA 3M0MA 2XZ9A 4LSBA 3HPFA 1B4EA 3BZJA 3GXPA 2DH2A 1K9FA 4HNTA 3DU0A 3IK4A 2GYIA 1W54A 2WANA 4AX6A 2A6NA 1KB3A 3L9CA 4PCSA 2P1FA 3ZVHA 1LL7A 4IMAA 2D2OA 1KRBC 3BLKA 2Y2WA 1PWMA 3VNIA 4RPQA 3O63A 4G1KA 2CLKA 3WJSA 4QLLA 3BW4A 2UY3A 2Z7GA 4O15A 4OBSA 3BLPX 3BG9A 3S2JA 1E72M 2X1TA 3NXLA 1XINA 2ACSA 4H4IA 3HA1A 1W9UA 4ICNA 1KM1A 4ZB5A 2OPJA 2W0UA 1PYFA 2WHMA 1XS2A 2OEMA 2G41A 5CZSA 4UFKA 4WIWA 3EWUA 5EMYA 4W7VA 1RPKA 2Q6ZA 3GBEA 3UZ5A 4F0KA 3CM4A 5AZ0A 2YFNA 3LM7A 5D33A 5A95A 2D2GA 4IJCA 1XP3A 4H41A 3E38A 3G77A 4GY0A 1ZB5A 1WAWA 2PDNA 3ZT7A 4PMZA 3CL7A 4AYSA 4MVAA 3G1XA 1TUFA 4MYAA 2VOMA 5D8ZA 4B9ZA 2EKCA 3EXTA 1V6TA 2Y5EA 5FF7A 1BVZA 4MJZA 1W9PA 2DPEA 4L1WA 1UA7A 3U2OA 1K70A 3UETA 4UB9A 3R0UA 3UP8A 5CPOA 1HJVA 2V67A 3A6OA 4HNVA 3HG4A 2HXTA 3FW6A 2JALA 3MCOA 1TV2A 3GG1A 3KVJA 2J24A 4KFNA 1B1YA 5CBBA 2D0GA 3A4AA 2BOGX 2DW6A 3F7JA 3E0WA 1IXQA 1AVAA 3KLLA 4LUTA 2D3LA 2HCVA 3C6CA 2QF8A 2GJXB 3PZOA 4CD6A 1IWAA 4GZ7A 4HB7A 4AD4A 4KH2A 1GVSA 4L4LA 2R14A 4Q8MA 3UWUA 3NOEA 1IR1A 1F4HA 4US6A 5M1TA 1RBLA 4J2MA 4WUIA 2XN0A 4PMOA 4J3XA 4O1CA 1XYZA 4XTIA 1K6AA 1ESWA 4RW5A 4GC4A 5J04A 5IFPA 4URIA 2P88A 2C16A 1ZJBA 2Y70A 1UP2A 5FEPA 1US0A 1YRRA 2GOUA 1FWAC 4M5PA 1X96A 4R7OA 2DV0A 3NL2A 3T09A 3KRBA 4WR3A 2FH6A 2NSOA 4B5TA 3OZPA 1UP0A 1OGGA 1XLLA 3DN5A 3URAA 5AVHA 1WDPA 1OFRA 4YJ5A 3NQAA 1JG9A 1XW8A 5K2ZA 3TXZA 4TQTA 3VE7A 2OQLA 4H9TA 1FHUA 4L9ZA 4K8HA 3AJXA 3PZGA 3AIEA 3M07A 2X7WA 3KFTA 3PPFA 1RCOB 3ELFA 3OP2A 1NWSA 4NAEB 4B16A 2G3JA 4UXDA 3W1NA 3W29A 2VGGA 1I8JA 1ZFJA 3NOYA 2A79A 3PUOA 3CUIA 2WKLA 3QOMA 1GYNA 4DJDC 1P0DA 3DFHA 1GTEA 5I79A 3STEA 1DTNA 2ZRXA 3GVQA 1MRQA 2E1WA 2CU0A 3CQ0A 3ZO9A 1K03A 2WSQA 2FHCA 1J2WA 4HBKA 3UYCA 1UJPA 3IGXA 4MJ2A 2Z26A 3EBVA 5BXPA 3SUWA 4UNLA 3EXSA 2R1KA 2ZCGA 4NSBA 1NDZA 4W8LA 3OVRA 2PP1A 2VT0A 2H9AB 4IH3A 5JXQA 4XD4A 1VD6A 4O12A 1J0ZA 1BLIA 2CW6A 3LMZA 4ZCWA 3AHVA 3EMCA 3BUVA 4S3EA 4WY0B 3S5ZA 1Q3NA 4ADSA 3R8HA 1JJKA 4PULA 3VK5A 3VNYA 3W1MA 2W9MA 4UC5A 1KRMA 2G3FA 4Q22A 4KPLA 4DJFA 4KCVA 3QQWA 1XUZA 5FI8A 4LRTA 3WZ0E 1PX3A 2E9BA 1SMDA 2KX9A 4GHRA 3V5CA 1LOSA 5BZAA 1QK2A 2REQB 4I9AA 4Q6XA 1VBJA 2NXGA 4LGXA 4RR4A 2HV5A 4ACYA 3IGSA 4UR9A 5BRBA 1BF2A 4XUYA 1J93A 1HNYA 3I6TA 4XAZA 1K3UA 3AHYA 1CGTA 1CECA 3W22A 2ODOA 2Y24A 2Y4SA 1Q6EA 5AYYA 3CHVA 4CCCA 2D73A 4IJBA 3BPWA 1Z89A 3B3DA 2EAWA 2Y5JA 5ABFB 3W7JA 2Z0IA 4XO6A 3NGFA 3ZS4A 2A6LA 3M43A 3MHUA 1WXJA 3PJWA 1L9WA 2BODX 1I60A 4CLMA 2PC4A 4LALA 3RU6A 2PLJA 3RLUA 3VXGA 3IJ8A 3O9NA 3TTOA 1GEHA 4CU6A 1E0XA 2CHNA 4FXRA 4Q8UA 2PDQA 2WC3A 1QHPA 2R8WA 5I6SA 2QAPA 4IG2B 4MZYA 4DWSC 3L4TA 1TR1A 3VKBA 3WY1A 1I2PA 2XGZA 3AHTA 1R3TA 4CU7A 5DMYA 1XIJA 2P3ZA 4N2YA 2CIPA 3AISA 3II1A 1GYLA 2Z00A 1Q6RA 4BWLC 3OEXA 1PS9A 5BMXA 3DFYA 2VFDA 2ZRUA 1EPVA 1OG0A 3HJEA 4PC8A 4EXQA 4EP8C 2J7BA 3GTFA 1CBGA 3ARUA 4KEVA 4C91A 2XVNA 3M5VA 3EOEA 5C6MA 3W27A 1GQIA 4O4VA 1UD2A 2Z2UA 3IVUA 3N1AA 1HZYA 4QCFA 1KBLA 1WV2A 4I6VA 5A6MA 2LLEA 1ZSXA 1LOLA 2GQ9A 1KBKA 3VOFA 5EB8A 2WCSA 2E6AA 4Y8EA 1JCNA 1V6UA 2P3EA 3W07A 4ZVJA 5DBTA 1QI5A 5T8GA 3AAMA 3PZTA 1ZBCA 2DFAA 4ROQA 9XIAA 2PZNA 1BYDA 5FF3A 3TA9A 5HR7A 5XIAA 1DWHM 3F1QA 2DSVA 3T1GA 2Y85A 3HM7A 4JDYA 5GNYA 4R85A 4A8RA 5LKYA 4HMCA 3PVFA 4AZHA 5CBJA 4MJMA 1FCQA 2EEXA 3HPSA 1ZJAA 3VOJA 3TZFA 4DPPA 4RDWA 1PYMA 3TV8A 4HPHA 2V5JA 3CQHA 1E1CA 3H4XA 4LAMA 4X61A 1Q4WA 4B2DA 1V79A 2VDGA 5FJRA 3AJ7A 4JTIA 1T8XA 2WNQA 4A3QA 2VKZG 4KESA 1UC5A 3VKAA 4AVOA 4JBRA 4R27A 4Q8TA 2OQYA 3QKZA 2BY1A 2ESCA 3SCWA 1LBMA 3VKKA 3B97A