4I9UA

Crystal structure of rabbit ldha in complex with a fragment inhibitor ap26256
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
331
structure length
323
Chain Sequence
AALKDQLIHNLLKEEHVPQNKITVVGVGAVGMACAISILMKDLADELALVDVMEDKLKGEMMDLQHGSLFLRTPKIVSGKDYSVTANSKLVIITAGARNLVQRNVNIFKFIIPNVVKYSPHCKLLVVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHALSCHGWILGEHGDSSVPVWSGMNVAGVSLKTLHPELGTDADKEQWKQVHKQVVDSAYEVIKLKGYTTWAIGLSVADLAESIMKNLRRVHPISTMLKGLYGIKEDVFLSVPCVLGQNGISDVVKVTLTSEEEAHLKKSADTLWGIQKELQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-lactate dehydrogenase A chain
publication title Fragment growing and linking lead to novel nanomolar lactate dehydrogenase inhibitors.
pubmed doi rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 109
structure length 323
sequence length 331
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2012-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4i9uA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4i9uA02
1YBAA 1E92A 3E9MA 3GT0A 4TRNA 5T8KA 3WR5A 4ZQEA 4DC0A 3DOCA 1J49A 2Y0DA 3FR8A 1JN0A 1GUZA 4YJDA 2X9NA 1V8BA 1W6UA 2HU2A 3H2SA 3JD2A 4YJFB 3GVCA 3U4IA 3VH3A 4QUKA 1UP7A 4DIBA 4Q3DA 4PLVA 2V6GA 2ZB3A 4MVJM 3LU1A 3ZWMA 4CMJA 1T2EA 4AFNA 1KVRA 1MC5A 5IZCC 2RHCA 4CMCA 1ENOA 2UDPA 3MJSA 3DBRA 3L4BA 4MP6A 3ABIA 4A0SA 4CMIB 4NDNE 2VZ9A 4BS9A 1ISHA 3KBOA 4GSKA 4PG5A 1KOLA 4CLEA 4CR7A 2DBZA 2B4TO 4XA8A 1EK5A 2Q1UA 4YCAA 4GKBA 2JD1A 3DWFA 4EDFA 3FF4A 4E0BA 5A4DA 2GD1O 1X1TA 2OOSA 3NYWA 2Y1FA 1VL0A 1ZKMA 2C54A 3ASVA 4BO6A 1ZK2A 1MV8A 2O50A 3OSUA 4YRDA 1PJTA 2O3QA 4GGPA 4HFNA 4L9RA 3LQFA 2VYND 4J3FA 3T4XA 5BSEA 5KKCA 2BD0A 1VJ0A 1XA0A 4CV3A 1NFRA 3L77A 1ADGA 1YE3A 3JQDA 3DQPA 3QV1A 2Y1EA 3ADPA 5TS3A 4A27A 1LJ8A 4WK6A 4J43A 4KOAA 1JVSA 4QFCA 3NX4A 2GRAA 1E1LA 3AFNA 4PRLA 3HZZA 1NAHA 1H2HA 4NI5A 2NUAA 4NIMA 4RVUA 5KWEA 1A4UA 2G17A 4A7PA 2OFPA 3D4NA 4IDBA 5JDIC 4FW8A 2BGLA 2CY0A 3OA0A 4FFLA 1S7CA 3FPLA 4BKRA 4DPMA 3GLQA 3ETGA 1RJWA 4LCJA 1P1JA 4LSWA 4ND4A 1SBYA 4QSMA 3ZI0A 3BHJA 2VNSA 1E6EA 1EZ4A 1Q1NA 1QORA 2CDAA 3ONFA 3UCEA 4JN6B 2XAAA 4B3HA 4OXKA 3IUSA 2NU9A 2WD7B 4Q3NA 7MDHA 1ZK0A 5FF9A 3JQGA 4UULA 3UW3A 4ZQHA 4BVAA 3QSGA 4WNCA 1A4IA 4OSPA 4OXNA 3DFUA 4FGSA 1JQBA 1Z73A 5I7FA 3IJPA 1DRUA 1DAOA 1ORRA 1WDKA 2JD0A 3LF2A 4NQZA 3PGJA 2LDBA 3I23A 4DA9A 2G5CA 5K6AC 2EG9A 4BOYA 3I3OA 3RC9A 3KVOA 1TB4A 4YQZA 1HYEA 4KWHA 1R37A 3RC2A 4LMPA 4MIEA 4W4TA 5TF4A 4LRTB 3WWYA 1QYCA 5KVCA 3AFMA 4B8ZA 4K28A 2X1HA 3PI7A 2IRWA 3Q6IA 1GYQA 1GQYA 1N5DA 3MJEA 5T6BA 2W2KB 4B3IA 2DU8A 1H94A 2DBVO 1QXSA 1A27A 1I36A 2O3JA 1I32A 1QR6A 2HK7A 4OSOA 1SZJG 3NV9A 4CLXA 1X7DA 1SMKA 3WYBA 2VTDA 3W6UA 1O94A 2OXIA 4QO7A 4BNMA 2NTJA 4G2NA 5TJHA 3C1TA 3U3XA 2AW5A 3H5AA 5I9MA 5GZ1A 1DJNA 3M6IA 4Q9NA 3GAFA 3F5QA 3F6YA 5ICMA 2NLOA 1QV7A 2I3GA 2EIHA 3ETDA 1VSVA 1EDZA 1GU7A 3C3XA 3PHIA 2UUOA 3BMNB 1GUFA 4XGIA 1PJSA 2OGUA 3MJVA 3PWSA 4CR6A 4DIOA 4J1SA 3NKLA 5EIOA 1BRMA 4FJ0A 2X4GA 4CLOA 1Y1PA 2JHFA 5DP2A 2DBQA 5DCYA 3AM5A 2EW2A 1T24A 4F46A 3NTOA 3FNHA 4GH5A 4ZQBA 5JY1A 3BTVA 1RM5A 5BR7A 3GK3A 1XEAA 5ER6A 4CUJA 3DZGA 5AOVA 4BNKA 4E5KA 1LDBA 1PJBA 4PLTA 2D1YA 4FFRA 4WLVA 4M1QA 3KEQA 4RVGA 2I6TA 3VOSA 5CPFA 4GLOA 1JU9A 4CUKA 3G79A 3JCZA 4IGFA 1JAXA 1GQ2A 4XYGA 4BNGA 3C7CB 3BMQB 2EXXA 1UUFA 2BHLA 1XWFA 4IINA 3KHUA 1LLUA 1XQ1A 1EVJA 2GASA 2GO1A 1D1SA 1OI7A 2CSUA 1R0KA 1BVRA 1BMDA 3A1NA 1B14A 1I8TA 1N8KA 3AY6A 5IDYA 5G0TA 1XU9A 4BB6A 1I24A 3DTTA 3W8FA 4AJ2A 1IB6A 2Z1MA 4BUCA 3D4PA 1T2DA 1RM4A 2DPGA 1E5LA 1GPJA 1P31A 1DB3A 1LSUA 2I5PO 3MZ0A 5CPBA 5U4QA 3CXRA 3U9LA 4CMAA 4XD2A 2PKQP 3DHEA 2YYYA 4P22A 2HRBA 4EW6A 1JKFA 5DCUA 3RFVA 2O3SA 2PH5A 1H9BA 3U49A 1ZJYA 3G0OA 1Y7TA 3LYLA 4PZEA 1V6AA 1ULUA 3WWZA 2PGJA 1EEHA 1RYEA 5L7WA 4UVHA 3JTMA 3RQSA 4P4NA 1FXSA 3O8QA 1LDNA 2QRLA 1N92A 2R2GA 2HMUA 1F12A 2HQ1A 1I3KA 1DHTA 4XR9A 5TT0A 2WTBA 4QT0A 4FFMA 2GERA 5I9NA 1HZZA 3ORFA 3ZWWA 2E4AA 3V8BA 5BT9A 1E0DA 3WQSB 4EEZA 2Y1GA 3HWRA 5T57A 1EVZA 4IS3A 3MWDB 4DREA 2ZJ0A 3E1KA 4B79A 1DHRA 3JQBA 4N5NA 1ZH8A 1ISJA 3UVEA 2A94A 3LSYA 3JQFC 1PEDA 4L74A 1VJTA 2AQIA 1PQWA 4TRMA 1M75A 1B15A 2ZTVA 3GGGA 3ZWCA 4ALIA 5B4TA 2V6MA 3KSDO 3R1IA 4GX2A 4JJIA 3SC6A 5TIIA 4YPOA 1N7GA 1I3MA 2P9EA 1ZK1A 3DZKA 3HHPA 4YAGA 1F8FA 3AU9A 2R00C 3GDFA 4D0RA 5IZ4A 3RKRA 5DBIA 4JCOA 1E6UA 4EJ0A 4WECA 4J7CA 1E6WA 5AXBA 5TQVA 1NAIA 3FR7A 4MVJE 3V2UA 1XHLA 3TJRA 4FPXA 2Q45A 4E2XA 3HG7A 4DUPA 4YA6A 4BO3A 4RLHA 2ZJ1A 3VZQA 4U8GA 5CDTA 3BTUA 4L4XA 2AQHA 4EUHA 2RBEA 3H2ZA 1JKJA 4JNKA 3QWAA 3KOUA 3RVDA 3JQ8B 5DF1A 5T5QA 5CEJA 4II3A 5JCJA 3D7LA 3GMSA 4YJHB 2B4QA 5LCXA 4YAJA 3UICA 4TKLA 4TZTA 4FC6A 1Z45A 3KETA 1TEHA 2EF1A 1U9JA 1E7SA 1N7HA 3KLMX 2Z95A 4KTVE 3TZCA 5L7TA 3WNQA 2X5JO 1MFZA 1B26A 4E3ZA 1AXEA 2UVDA 4BB5A 4A03A 1Y5RA 3FI9A 3GHHA 3OQBA 4CQMA 1PWZA 4HWKA 3QIVA 1BTOA 1GADO 1P1KA 2GN8A 1QP8A 3HJAA 5I7SA 4MOWA 3RD5A 5BQFA 3TNLA 3IOYA 3VC7A 4AJEA 4CLRB 1U4SA 4M49A 4PG7A 4CL8A 4O59O 1FK8A 3MJ4A 4RGBA 3HDQA 3G49A 2B69A 5A9RA 3B1KA 1U1IA 1BDMA 5G0UA 3EY4A 2P68A 3PVZA 2HUNA 4R5MA 2Y1OA 3IKVA 4JIGA 2GF2A 3WGYA 4BNXA 1QYVA 3Q2IA 4K6FA 4BMVA 2RH4A 4OKNA 3PQDA 3VTFA 3DZBA 1PJ3A 2FZEA 1DBVO 3PGXA 4JJFA 3G17A 3C7DB 4ZA2A 1LDGA 3GDGA 5KKAA 1HTBA 3HQ4O 3K8ZA 1U3VA 2YUTA 1J4AA 5A3JA 3F4BA 1L7EA 4P38A 2IEDA 1ONOA 1QLJA 2Y93A 3K6JA 3JYPA 3VZPA 1KY4A 1PTJA 4PLFA 3UCFA 1NQAO 3L9WA 3IUPA 2Q1TA 4ND2A 1VL8A 3WTBA 1CF2O 5A02A 5MGBA 4BNTA 4ZN6A 1PU2A 2FR8A 4L0QA 3JD4A 4BNYA 4NFSA 1Y8QA 2NACA 3PHHA 2HCTA 4RDIA 3AW9A 4NK5A 4UAGA 2BRUA 3CZMA 3MJTA 4I5DA 4Q3EA 5EPOA 1M6HA 1W4ZA 4N18A 1C0LA 1D1TA 2YHIA 4DC1A 1X0XA 2CF5A 5JYEA 3FBTA 4GKVA 4BGEA 1PGNA 3DR3A 3JQ7B 4R1UA 1R12A 1B7GO 4KUGA 4Y6RA 2EW8A 3DONA 4BO9A 2I66A 3KXDA 5JSFA 3BZUA 1KVUA 1G6KA 2JHGA 1HYHA 3OIFA 3D5QA 3GPDG 4AJNA 1NM5A 3SXPA 1ZSYA 1WVGA 3KM0A 3DBLA 2IZZA 3FHLA 2HK8A 3TN7A 4XX0A 4BL5A 1EE2A 1R6DA 3K92A 4WLNA 1GZ4A 4RF3A 3LF1A 3I52A 1LRLA 3UAGA 2OMEA 4KZPA 3JD1A 4ND3A 4AJ4A 2NM0A 4B4WA 5B12A 4BNIA 1R15A 2A4KA 2PY6A 4M86A 2EGHA 3W8EA 4D79A 2W2LA 4JK3A 2X58A 3IP3A 3HSKA 3UGKA 4NNJA 4E32A 5HTOA 4I9UA 1LQUA 1LI4A 4IMPA 5EERA 1P1HA 3QQPA 3KLPX 4FN4A 1GYRA 4NG5A 1I01A 3LC2O 4BGIA 3C1OA 3R3JA 2BFPA 1TI7A 2Q50A 4FB5A 1HLDA 1E5QA 2ZIZA 1GL3A 5T64A 2W90A 2SCUA 3PRJA 4BKPA 4CMBA 4BO7A 1HDXA 5L3ZA 1N9GB 2C59A 5DDIP 4DLLA 1ULSA 4DTIA 5L9AA 1HXHA 4J90A 2VRCA 4QXMA 4YVFA 5JO9A 2E48A 1HETA 3T7CA 1A9ZA 5HRUA 4TZKA 3JD0A 2LDXA 3D3EA 3WB9A 1E3WA 4QECA 2VUSA 5JDCC 1KERA 5A04A 1E7MA 2VHZA 4E12A 3DZJA 1RM3A 5LDHA 4A73A 3DBVO 3DXFA 4MPDA 1PJLA 1YGYA 1M6WA 1IL0A 3VZSA 2FMUA 2HDHA 1KETA 4XKJA 5A06A 4Z9FA 1BXZA 3ONDA 3GZNA 4PFJA 1E7RA 3AU8A 3VDQA 2OP0A 1U3UA 3D64A 3FWNA 5H81A 4RJTA 5B1YA 1AGNA 4U0KA 3UFXA 4L4SA 4WCDA 4GX0A 1PIWA 4NBVA 1G0NA 5C7LO 3M2TA 1LXCA 1DRVA 2H1SA 3H9EO 4M87A 1U7TA 1ENZA 4IPTA 5U9CA 1B3RA 1BW9B 2Q99A 1B2LA 3ZWBA 1YKFA 1YQDA 4I1IA 4LK3A 2OBYA 3ROPA 4KQWA 3QW2A 4JROA 1XQ6A 5IF3A 3W4JA 2FSVA 1U4OA 4WCFB 3JQGB 4E13A 1HKUA 2PWZA 1OC2A 2VUTA 3EYWA 4Q3CA 5I8WA 4CM6A 1KEVA 1W0CA 1LLDA 2DVMA 4AJOA 1YL7A 2PLAA 3OETA 3AY7A 2C2YA 2VNAA 1HYGA 3OJOA 1NWCA 1P33A 2IXBA 4OO3A 3PHGA 1Y5MA 3U4HA 3WGZA 4CJXA 2E37A 5JYDA 5A9TA 2HMVA 2AEMA 2D59A 3OICA 3NDIA 1U8XX 4W99A 2YV3A 4MINA 3IC5A 3DZIA 3E48A 2C5EA 4S3MA 3RUHA 4D46A 2POQX 3TPCA 2CVQA 4MP3A 5DN9A 2IYPA 4BMSA 4Y8VA 4QEDA 5GZ6A 4PRKA 1H6AA 3BHMA 4D43A 1B8PA 3I9NA 4TSKA 5G4KA 1PJCA 4OAQA 4EGFA 4EYEA 2CDCA 1H6BA 2PD4A 4J9VA 4QX6A 3RU9A 2WSBA 2ZQYA 1TT5A 5JCJD 3Q3CA 3C8MA 3X2FA 4GI2A 4G5HA 2DC1A 1U5CA 2NVUA 1NXQA 3P7MA 1AHHA 4D41A 3I83A 4E2YA 2QX7A 1R16A 1ISGA 2BMAA 3TFQA 4E5MA 3AUAA 2O3UA 4WPGA 1U2GA 5IXSA 4MJLA 5I9LA 1XG5A 3GAZA 4CQMD 3PYMA 3IL2A 4GQAA 1HSZA 1DXYA 3HB5X 4XGNA 1KIFA 1GAEO 5JXWA 5DBFA 1T2FA 4YT8A 3WOHA 5TX7A 1IHYA 3D4OA 1HDGO 4B4VA 4XR4A 5FFFA 3SJUA 4BO2A 3ONEA 2OUIA 2EHDA 4E21A 4R1SA 1T26A 3QWBA 1PS0A 2Q2WA 1GY8A 5TRTA 4CUZA 3RU7A 1MG0A 4NJMA 4GMFA 1WNTA 3H9QA 3U0BA 4IMRA 3JQFA 2HAEA 4XQ9A 3WBFA 4W9NC 3ZWXA 1LSOA 2F00A 3CTMA 1E3JA 1P45A 2QZ9A 3RFXA 4F3YA 2WMDA 3L6EA 4KDEA 5JCXA 9LDTA 3D0OA 4Z3KA 2RHRA 4IZHA 4IIUA 4NFHA 2FN7A 1ZCJA 2DTXA 4NK4A 1CJCA 4Z3DA 3GF4A 3CMMA 1L1FA 1MG5A 2CFCA 1R0LA 5JY6A 3RI3A 2AE2A 4EI2A 3VPSA 1MUUA 1OZAA 3D3WA 3JV7A 4YYZA 2JL1A 3QRWA 3W1VA 5C37A 1C0KA 1PSDA 3JQCA 5KVQA 5AVOA 4B7UA 1LLCA 3GR6A 4I5FA 4YAKA 4TROA 2RCYA 1PX0A 2VUUA 3NGXA 4AJLA 4TVBA 4UEJA 1VI2A 3O8QB 2VHVA 2PKRA 3HADA 3Q9UA 4W7IA 3VH2A 1FDWA 4RDHA 4WASA 1SB9A 1H6DA 2VHWA 4FCCA 5L4LA 1ADBA 4NZ9A 2EERA 3KYCA 3I9KA 4IQ8A 1ZMOA 2AHRA 4XQGA 5A03A 3S1LA 5A9SA 3FTNA 4PZDA 2QHXA 5DBGA 3X2EA 1WAMA 4AJPA 3EMKA 4H3VA 3LDHA 1P3DA 2IZ0A 2PD6A 5EL0A 4ZQGA 4YDRA 4RO0A 4YBZA 3WG9A 2NU7A 3DB2A 3WGOA 3GN1A 4R4JA 2CMDA 3ZHYA 2DFDA 3D5TA 4O0LA 4K6CA 1NASA 3ZWOA 2P4QA 1ISMA 3F3SA 3INRA 2V65A 3FNFA 3ZW9A 4JLWA 4IQGA 1O89A 3VH1A 1ZK3A 2ZTMA 3ICCA 1OOEA 4FBGA 4FDAA 1V35A 5HM8A 2YQ5A 1SOVA 4B4OA 2YFQA 2W2LD 4CM8B 3ZN2A 2B0JA 4NBUA 1U28A 1DIHA 2FP4A 3ULKA 4YJGA 1NHWA 2VTEA 1Y81A 3A28A 1DPGA 1XELA 3I5MA 1JWAB 3RUEA 3IQDB 3KV3O 1PS8A 1X14A 2ZK7A 1W73A 2ZB4A 3U09A 4I9HA 2DT5A 2DUWA 3RBZA 1YB1A 3QWFA 3AOEA 2WYUA 3BTSA 1SC6A 1CYDA 1LQTA 5JMWA 2VT3A 1A9YA 3JQEA 2Q2QA 2RAFA 2VRCD 2W98A 3SC4A 1IHXA 2VRBA 2Z1NA 3I4FA 4PVCA 1NYTA 2C07A 1YB5A 2ZYDA 3MCVA 1R66A 3SLGA 5BNTA 4DVJA 3AY3A 3JD3A 1IZ0A 3P19A 3ZHZA 1K89A 3SBOA 1F17A 3OM9A 3ANLA 1A72A 2QW8A 1B8VA 5K9ZA 4YTEA 4CM7A 1HRDA 3PYXA 2BI7A 3JQ9A 3Q11A 3UN1A 5EINA 4BNNA 2NWQA 2Q2VA 3L6DA 4XB1A 2NQ8A 4CM4B 1ID1A 5JC1A 2ILTA 2YDYA 1XR3A 2JFGA 3R3SA 1T4BA 1DC3A 1LRKA 1UH5A 5I7VA 2DKNA 4IDDA 3WMWA 2Y67A 4J16A 3WICA 2JCVA 5A5EA 3ZHBA 1YOVA 4J4HA 2XPCA 3HN7A 2C7VA 5CHEA 3LC7O 2EP7A 4RZHA 3GPIA 3WBBA 2HSDA 3DZHA 4BNUA 3I1JA 1MP0A 3DAFA 3S2GA 3EVNA 1QYXA 2CDBA 4MVJG 3S2EA 4EZBA 3DMTC 4GL4A 4RF5A 3EVTA 4PZCA 5TGDA 3ZV3A 2NSDA 3TWOA 5ITWA 1KEPA 3JYNA 4GX1A 1Y8QB 4HADA 3F5SA 5BSFA 2YHIB 4II2A 3KO8A 4RVSA 3V2GA 3NJ8A 4O1MA 5TJ9A 3VHRA 1RWBA 2DLDA 3SX2A 4ONEA 2HJRA 3FN4A 1NNUA 3PWZA 1GDHA 2TMDA 4HFJA 5C7IO 3P2OA 5BNIA 5F1OA 3JQAA 3LT1A 2OP1A 2CVOA 1PZEA 4P4LA 1X7HA 3U62A 3GNSA 4D45A 3O03A 2B4RO 5L7YA 2HJSA 2FZWA 1MC4A 2VOEA 1BXGA 2X0NA 3MJCA 3EUWA 4JP2A 1Y9AA 3JSAA 4RORA 4CQLA 5JO0A 1JDJA 4Z0HO 4I08A 4BKOA 3FPCA 4IY1A 1R4NA 1P1RA 3DHNA 3GEMA 3ROKA 1JLLA 4RPKA 4BNJA 2H63A 4HNGA 1DAPA 4BNLA 1G0OA 3LK7A 3WYEA 2PR2A 1JA9A 3OHSX 4E4YA 5L4SA 2FWMX 1C1DA 2IZ1A 4J1QA 4LSMA 3GC6A 3PJFA 1EUCA 1LNQA 1B16A 2VWQA 3JYLA 3ON5A 4BV9A 2ZB7A 2YJZA 3OEYA 2GUGA 4MO2A 1HE4A 2Q3EA 3M1AA 4M55A 3RSHA 1UP6A 3CPSA 1OFGA 1P9LA 1HE5A 2NTNA 2DPHA 4L73A 1H9AA 4B3JA 1GCOA 3PJDA 2ZB8A 3V1TC 3W4IA 3IDSA 1R4MB 3H5RA 4YWJA 4BNFA 1ZMTA 3ZU2A 3PJGA 2H9IA 1ZK4A 4YJFA 5F21A 2I76A 1NR7A 1QYDA 4YB8A 1O9BA 4XZ3A 3WSWA 4Y9DA 4QO8A 4UEOA 4TKMA 4C7JA 3DFZA 1P0CA 1XDWA 5DOVA 1SO8A 3E18A 4E6PA 1ISFA 3N74A 1E3WB 2YQ4A 1F0YA 1S6YA 4BNWA 2QYSA 4CMIA 2QQ5A 1TXGA 3PXXA 1IULA 3ZNQA 1VJ1A 2J5KA 3PTZA 4BQPA 2P4HX 4IQ0A 5IDXA 1GEEA 1KVTA 2Q46A 3OA2A 1AHIA 1YH3A 3WMXA 4CODB 4LMRA 3BA1A 4R51A 5THKA 4LVCA 4E31A 5CDGA 4K9DA 4OOEA 3A14A 1ZSVA 3QWHA 3PZBA 3H3JA 3VPHA 3G1TA 4IS2A 1DIBA 1NPTO 1AE1A 4HFMA 4PCVA 4BO5A 4CV2A 2G0TA 3BIOA 3BXXA 2VZ8A 2Y1CA 3AUSA 2G1UA 5KNLA 3H8VA 4KUHA 1JVBA 5T8KC 2ZTLA 2ZTUA 3DO5A 3UHAA 4NR0A 1PJ2A 1VM6A 4J49A 5DZSA 2X0JA 4EBFA 3PLRA 1NQ5A 1A7KA 5F5LA 4CMEC 3WIDA 1RYDA 2JFFA 5CAEA 4ALKA 4HBGA 4ALMA 4UREA 1NX6A 2B5VA 5IN4A 1NPYA 3INGA 4Z9YA 1LTHR 2WEKA 3DTYA 1MA0A 1EFKA 1NVGA 3TRIA 4CMHA 5T67A 1NPDA 3GDOA 3L4BC 4DRYA 5CDSA 3H7AA 1E7QA 4BNZA 4CMGA 3DBHB 1BVUA 2O3RA 1XKQA 3NAQA 1IYZA 2PA3A 3SEFA 4EJMA 2V6BA 3EZLA 4EUEA 2EKLA 2GNAA 1HDRA 1PR9A 1YS4A 3M1LA 1H93A 4B8WA 1U5AA 2NADA 3T7EA 3I6QA 4RVFA 3OQ1A 2WWRA 1YDEA 1DFIA 2PFGA 1FDTA 3FRJA 4MKRA 3U4CA 4GGOA 1CETA 5A1TA 1EUZA 4OIMA 5BSGA 1M67A 3OIDA 4YQYA 4BKQA 2O23A 3FCOA 6LDHA 1K3TA 3QVWA 2Y05A 4UUMA 1PJQA 3LZ6A 1UJMA 5KIAA 1VRWA 5ADHA 4ALJA 1P77A 4WLEA 4DGSA 2AMFA 2AG5A 4CLHA 4BNHA 1D7OA 1LRJA 3ANMA 5A5FA 3DL2A 3B1FA 1PZFA 4GAEA 1EVYA 1H2BA 5HS6A 2YDXA 2J8ZA 1ARZA 4I5EA 1TT5B 1A5ZA 1HLPA 4FD3A 2GGSA 2PGLA 4INAA 2NVUB 2EKQA 3LC1O 3ZH2A 1P74A 3OIGA 3ENKA 4PN3A 2Y66A 4D0SA 4DYVA 3FNGA 1KVSA 1WLYA 4U5QA 1IUKA 4UUOA 4BO0A 5K0ZA 1EVIA 4BNVA 5COBA 4O6VA 4WCFC 1O0SA 3CSDA 5L51A 1FDSA 1I3NA 2IYOA 5IZCA 4WLFA 3S8MA 1C1XB 1IOLA 1KC3A 2QRKA 1Q0HA 3TF5A 2WYVA 3S55A 2NNLD 3PYLA 4BQRA 1MFPA 1O95A 1Q2XA 1UXGA 3BMNA 5DT9A 2IXAA 1QKIA 4R5HA 1YL5A 4PLCA 1HE3A 1I30A 1O8CA 3KTDA 1Q7GA 1UZLA 1WWKA 5DP1A 2HRZA 1N1EA 3HB4X 4RQUA 2Q49A 5JNLA 3AM4A 2YV1A 8LDHA 4GX5A 5HA5A 3K5PA 1DC5A 1ZIDA 3L0DA 4J0EA 3AWDA 4AJIA 4RPJA 4W82A 4H15A 3PQEA 5JS6A 1KBZA 4IDCA 2J6IA 2BKAA 2VOJA 4MDHA 4RVDA 1EE9A 4URFA 2X8LA 4TRRA 1HZJA 2VWHA 3A06A 4WEOA 3GRPA 3GFGA 4FJ2A 3IKTA 4MIYA 2PV7A 1E7YA 4HV4A 3OJLA 3BMQA 1I2CA 3D3WB 2JKVA 4RL6A 4I8XA 1JKIA 1FDUA 3NDJA 1F06A 2I9PA 2X86A 1O6ZA 1WMAA 1PZGA 4NMHA 2D8AA 1L7DA 5ICSA 4E2ZA 1UR5A 4MVJI 3DBRB 1ONNA 5AXDA 1T1RA 5JDIA 5KCZA 2G82A 5C3MA 2ZATA 4NHEA 2EV9A 3CZRA 4FS3A 1NR1A 4Y6PA 4KP7A 1CDOA 5IAAA 2BFMA 2EKPA 2FR0A 2BF7A 3WFIA 1HEUA 2V7PA 4R3NA 1ZUD1 1UXJA 4UVGA 3WNVA 2CUKA 1K6JA 1GEGA 1Z75A 1LDYA 1X7GA 2P9CA 4GBJA 3TZHA 1N2SA 2Y0CA 1YJQA 2P2SA 3JQAD 3H9UA 1K6XA 5JW6A 5L4NA 3EW7A 8ADHA 4A10A 5IJZA 4LRSB 1VL6A 3L9XA 1UXHA 2DUUA 3BTOA 3DEYX 1M2WA 4WNIA 4CV1A 3E9NA 4MP8A 1YRLA 4BO1A 5K6AA 4BGUA 2VQ3A 3WYCA 1XCBA 1JAYA 3GVPA 3KYBA 3O4RA 4GWGA 1LLQA 4ZRNA 2PNFA 1GFSA 3I9MA 1WXDA 3OBBA 4ALLA 4YEDA 1VKOA 2YV2A 1XU7A 1IPFA 1YWGO 3MTJA 4A5OA 3QJ5A 2WJPA 3RUIA 1EMDA 2JD2A 4Y67A 1EQUA 3JYQA 3GVXA 3WXBA 4GSLA 1O5IA 1VKNA 1ZVMA 1MXHA 2NU6A 2WE7A 5CG1A 2CVZA 4NH4A 3K30A 4PLGA 5TC4A 2AEFA 2I65A 4TRJA 4IJUA 1P44A 2PH3A 1E3EA 2FPGA 3EGOA 3QHAA 4ZD6A 3CUKA 2J5RA 3AJRA 2GZ1A 1WDLA 4OMUA 2GN9A 5JMPA 4R9SA 4FC7A 1W8DA 3UXYA 3DDNA 3I6IA 2DBRA 4PVDA 3F4LA 2W8ZA 3JQ8A 3LLSA 5B4VA 4YJHA 3GUYA 3KSZO 4BKUA 4F6LA 3PP8A 3QVSA 4I5GA 4S1VA 2D0IA 3HE3A 3OFSA 1IPEA 3ZV5A 3HFSA 4MVJP 1Q0LA 7ADHA 1BXKA 1GTMA 4Y6SA 3ZU4A 1GV1A 3DOJA 3K2BA 3JQBC 1Z82A 4XQEA 4HY3A 3TFOA 1VPDA 3AK4A 3LVFO 3STHA 3QA9A 4BO4A 2VWPA 1YQXA 1DLIA 2PZLA 4DIFA 3GNQA 4CR8A 3TOZA 1DOHA 3L4SO 1DO8A 1E1KA 2Y0EA 1V9LA 4IDAA 4ITUA 5FI5A 4ROSA 2FR1A 2AE1A 4FFNA 2J3JA 1IY8A 2XOXA 4M89A 3VVBA 3OQ6A 2VZ0A 1DLJA 4R1NA 3GNTA 4IDFA 1CERA 2GLXA 3NEPX 4OQYA 4EITA 2D4AA 5AQ1A 2B35A 1HSOA 2FPIA 4NBRA 1KEUA 4IJKA 4ID9A 5IN5A 5L95A 4QFDA 1XLTA 4J4TA 1PR3A 3C1AA 1EFLA 5IXYA 2NVWA 4GMGA 2X7HA 4JP3A 1GYPA 1VC2A 4OM8A 1K5HA 3UUWA 4AL4A 5AXCA 1PZHA 1CEQA 3TL2A 1ADCA 4CM1A 1YBMA 2VHXA 3MTGA 2HMWA 1GV0A 9LDBA 1FF9A 3H4VA 4B4UA 5KVSA 1BSVA 2GCGA 1U7HA 5L53A 2Q1WA 4ALNA 3B1JA 2QIOA 1LSJA 4J9UE 4YRAA 4JBHA 3WQQA 4CLOB 4C7KA 3K96A 1JW9B 1QYWA 2IE0A 3PFWO 4M8SA 1GD1O 1ONPA 4O5OA 3E82A 1PL6A 4R68A 1Y6JA 2BI8A 3IIEA 3MOIA 4R9RA 2AXQA 4I9NA 5CP8A 4HXYA 4N5LA 2WDZA 4IDGA 1DSSG 2PTGA 3K2EA 2D5CA 4E5YA 2QRJA 5CDUA 5COQA 1PQPA 3S2IA 4MIOA 5THQA 1E3LA 4RV9A 1I10A 3JQ7A 3ZU5A 3ICPA 5DULA 2EGGA 1LEHA 1DJQA 4K1LA 2BELA 3WLEA 5G0WA 1NVMB 1U2DA 3K73O 1UDBA 1LC0A 3CH6A 1KS9A 4E30A 5KOIA 3ZGYA 2C29D 4M54A 5L45A 4MVJA 2Q4EA 4XYMA 1C1DB 5C5IA 3Q0EA 1HE2A 3NTQA 5FEUA 2R00A 1RPNA 3VDRA 4FSHA 4TQGA 4WOJA 4N54A 2O2SA 3EDMA 3DHYA 1V0JA 2ZCUA 1HF3A 1RM0A 3VKUA 3HFGA 1QMGA 2Q1SA 1BWSA 3H6KA 4Q3AA 1HDCA 2VCYA 3V1YA 3GN2A 3EC7A 4CMEA 2BFAA 2YZ7A 3RROA 1UDAA 4DXHA 2O3TA 4P4GA 2X9GA 3ASUA 2X0RA 3TSCA 3WGTA 2EEZA 1ENPA 4IIVA 4YAEA 3GRKA 3ROQA 1TT7A 1ZBQA 3WGQA 1VE9A 3O9ZA 1P0FA 4EJ6A 3E9QA 3ZDFA 2IDZA 4L75A 4ZJUA 3GEDA 5EQDA 2YY7A 1LC3A 4AJ1A 5ITVA 1N9GA 5LDGA 2FOIA 4UVDA 2OO5A 1ZFNA 2AG8A 4LW8A 4NBWA 2O4CA 1KC1A 2AQKA 3BMCA 5JE8A 1EUDA 5JAIA 5G4LA 2HK9A 1OC4A 4NJOA 1UAGA 5ILOA 4QQRA 4O63O 4FOOA 4XQCA 3ZZNA 3TL3A 1WZEA 1FMCA 2P91A 1ZW1A 3FNEA 3P2YA 2AEJA 2JCYA 2G76A 4J2OA 4WE3A 2C82A 1C0PA 3GFBA 2YFHA 3DAPA 4OOFA 1TA4A 5JAQA 1X0VA 1ZZEA 3ZV6A 1GZ3A 1QSGA 1D4FA 2PD3A 1PS9A 4J7UA 3F1LA 3KYDA 5F5NA 2GN4A 3E5MA 3FBGA 3GVHA 2EWMA 2WYWA 5EMHA 1DIRA 2YHUA 3GHYA 5KJ1A 4WKGA 4U6SA 3UCXA 1YO6A 1YL6A 4UUNA 2C7GA 1K6IA 1SCUA 4EUFA 4CQMB 1Y8RA 3ENNA 2B36A 3AI2A 4OXYA 2GSDA 1BW9A 4UVIA 3VKVA 5H82A 2DTEA 2O4UX 3TOXA 4CM9A 5FWNA 1NVTA 1OAAA 1JWBB 1Z6ZA 4J0FA 2P5YA 3L07A 4WUVA 3FTPA 3FWZA 4PIVA 4RVHA 3GZ4A 1CQIA 4WCFA 4EEXA 2W4QA 1AXGA 3INTA 4ZVVA 1H6CA 4J1NA 5GY7A 2BGKA 3EZYA 1I0ZA 5AXAA 4IXWA 5GMOA 3WGHA 3ZHXA 1I2ZA 3TQHA 4L8VA 4B7XA 1ZEMA 3MOGA 2BH9A 4OJNA 5KVVA 2FPPA 5J23A 4FQ8A 1B8UA 4FJ1A 5KJ6A 2FRDA 2C0CA 4XDZA 1PGQA 5AYVA 1ZEJA 3L6OO 3H9GA 4YT2A 3GVIA 3OECA 3PK0A 3WX0A 3MEQA 4LGVA 1YB4A 1EDOA 1SB8A 3RIHA 1TVEA 5JLAA 3RBVA 3DAGA 1F14A 4R16A 1GQQA 1XGKA 1NP3A 1M66A 3AOGA 3VPGA 1NQOA 3ZNNA 4ZRMA 1G1AA 1VSUA 2RIRA 4YAIA 1J6UA 1SNYA 5JC8A 1SEPA 2I3AA 2PZKA 3WSVA 4BMNA 3BMOA 1DRWA 1KVQA 1BHSA 1PGJA 1GCUA 5JAMA 4F6CA 3NT2A 2WM3A 1HL3A 4P8RA 1UDCA 5TSDA 2H5LA 3BAZA 3CEAA 3PLNA 2XXBA 4XIYA 3FSRA 3OF2A 3GEGA 3F1KA 3F46A 4DPKA 1FDVA 3FD8A 3I9OA 4XB2A 3ZWVA 5B37A 1D3AA 5L40A 3MWEB 4HX5A 4OYRA 1LX6A 4R3WA 3WDSA 3WJ7A 4DPLA 1JTVA 3PJEA 5ER9A 2DM6A 3VVCA 3DBLB 3PZRA 1V3VA 5G0VA 3I4CA 4JGBA 4DLBA 4R41A 5JDCA 1ZO8A 3NJ4A 4KMSA 2VYVA 3QP9A 2YW9A 4QTZA 1PQUA 5IFLA 2H6EA 1E3IA 3GGOA 2A35A 4IDEA 2JAPA 5LC1A 2E49A 3V2HA 5HBRA 1DC4A 2X9VA 2JJYA 1DIGA 5KTKA 2I67A 4GPD1 3U5TA 1Q7CA 1ML3A 1AN9A 2NV6A 2X5OA 1CIVA 2R6JA 2ZCVA 3WJAA 2X5KO 2ZQZA 3A4VA 2X22A 2ET6A 1J0XO 1E1NA 2CZCA 1Q7BA 2GDZA 5BSHA 3OEWA 3RUDA 1Z7BA 3CMCO 1H0KA 1UZMA 3A9WA 5F3RA 4Z0TA 2UYYA 4CM5A 4IXTA 4IM7A 3GG2A 1I3LA 5DOZA 2CF6A 3NT5A 1I5RA 3QE3A 3UF0A 3VAZA 3VPXA 3HDJA 1EBUA 4TMFA 5IDWA 3I9LA 2O7QA 2PZMA 2O48X 2UV8A 4J1TA 3E6AA 1D8AA 2VWGA 4IZIA 1MXFA 4Q39A 1HDZA 1T4DA 1I33A 4CMKA 1NWHA 3QVXA 4K26A 4XJSA 4DL9A 4JX8A 1ZXLA 2Z5LA 4HFRA 5TNXA 3ITDA 2WE8A 1ZSNA 2IEBA 2HMSA 4Z6KA 2D3TA 4G65A 5EJ2A 2X0IA 1UXKA 4XYLA 1MB4A 3D1LA 4PLWA 3VPFA 1BG6A 4WLUA 2BGMA 1MLDA 3GZNB 1GPDG 4AG3A 4AJJA 1T1SA 2GR9A 2P9GA 5MDHA 4DMMA 1PGPA 1E1MA 5HWSA 1V3TA 1NTOA 3E5RA 2B37A 1LBEA 5TLSA 4MVJD 3K31A 3Q9NA 1YBVA 2GZ2A 3DOOA 4NU6A 2FHSA 2WD8A 2A9FA 4BHTA 6ADHA 1RKXA 3CINA 3RJ9A 3H65A 2Y68A 3RAJA 1P1FA 3CE6A 3O38A 1WPQA 2NVBA 1C0IA 1DFHA 4R1TA 3PHLA 2QYTA 1PGOA 3E03A 3LT4A 4XYBA 1LUAA 4OHUA 3N58A 2VT2A 5F1KA 5C7OO 4WGGA 5DCWA 3U4DA 5I7EA 4CM8A 5FYDA 3QY9A 4FFOA 3TZQA 5B4UA 1SAYA 1OBFO 2PGDA 3PDUA 2Y99A 3H5NA 3QVTA 5CG2A 5I8ZA 1GUYA 4R69A 3Q2KA 3IS3A 5GZ3A 4WJZA 5A3VA 4AVYA 2P5UA 2PKQO 4YACA 4H7PA 1A7AA 1GZ6A 2WD7A 3GA0A 1U3TA 1PWXA 3TDKA 4ESOA 4UEKA 4UVEA 4TVOA 2EP5A 3N7UA 1BGVA 4DWVA 4U6QA 4IGEA 4GLLA 1HDYA 3CIFA 5HS4A 5IG2A 4ZQFA 2B83A 1C3VA 2OBNA 1NQTA 3K9QO 4F45A 5EN4A 3RFTA 2D2IA 4J2HA 4XDYA 3ZWNA 4E5NA 5CEEA 4OQZA 3PEFA 4RPHA 4BO8A 3BHIA 3JQ6A 2J3HA 3QWIA 4PG4A 1LDMA 4N7RA 3P5SA 3RWBA 1XSEA 1TLTA 5G2OA 2X23A 2C20A 1T25A 5G4KB 5JAZA 1NBOA 3HNPA 1P1IA 1U3WA 3M2PA 3OJFA 1KYQA 4W9NA 1CRWG 3NTRA 3PWKA 4PG8A 4PG6A 4JQCA 2W2KA 4KTTE 4XRRA 3KSUA 3WLFA 4CM4A 2CNBA 5JBIA 3IMFA 4JJGA 4FOSA 5DNAA 4WEQA 4NU5A 4XJTA 4DBZA 4D42A 1Q0QA 3PIIA 3RBXA 4OL9A 4PLZA 4IUYA 4IJWA 4ND1A 4RPLA 1K2WA 1WDMA 5U1PA 5ES3A 2C2XA 1LDEA 2BFOA 3AOEC 4N5MA 3RUAA 3T4EA 2B5WA 4CPDA 1R0SA 1ZNQO 3EAGA 4RPGA 4CM9D 1CQJA 1QG6A 2HKIA 2JAHA 3HN2A 5CEFA 4MKZA 3PIDA 3W8DA 1T2AA 2ZYGA 4PLPA 1B0AA 4LN1A 3RKUA 2JFHA 2O2YA 4R54A 2QG4A 3NUGA 4OH1A 2PZJA 2HO5A 4RLSA 3GUCA 4L76A 4NJMB 4A26A 2F1KA 4LCEA 5FI3A 3O26A 1QLHA 1X13A 1EBFA 3JQ9C 3PQFA 4OGWA 2VN8A 4Z9XA 5JPIA 4DBVO 3AM3A 1C14A 4GVLA 3ITKA 4W6ZA 2VYNA 1HT0A 3VH4A 5A05A 4AJHA 4XRGA 3S2FA 4XCVA 4XGKA 1MX3A 5G0SA 4YXFA 1J5PA 2EJWA 4Z0PA 2DQ4A 3B6ZA 3WS7A 1UP4A 4LISA 1NFFA 1Z74A 4RF4A 3GG9A 3AUUA 3TZKA 4PGFA 4DMLA 4HNHA 2FSSA 1PL7A 2VHYA 1A71A 4CV0A 2IODA 4YRBA 2E82A 5ILGA 3G1UA 5KJEA 4C4OA 3G3EA 2OL4A 3GMDA 2Q4BA 1PJ4A 4U7WA 4D44A 3W6ZA 1E7WA 4PLHA 5H83A 3ADOA 4NPCA 4ZU3A 1HDOA 5TT1A 3ROMA 3ZU3A 4D3FA 4DQVA 3DZFA 3KYCB 3RUCA 5COAA 1YXMA 5A9SB 1YJ8A 3NGLA 3VZRA 3LLVA 1UZNA 4WOKA 3RASA 5KJCA 3SJ7A 1ZXBA 1LA2A 5IDQA 1R4MA 1WP4A 1IE3A 3BYZA 1EQ2A 2TMGA 3ZV4A 1YQGA 4E33A 3ZWYA 2XXJA 4Q3BA 3Q1LA 3COSA 3GY0A 1NFQA 3GGPA 3ANNA 2Y1DA 1SEVA 2GYYA 2DAPA 3DC2A 1DDOA 4L4RA 1DC6A 4LVUA 2J5QA 3GH3A 2VYVD 1PL8A 3PHJA 4H16A 3GOHA 3BMCB 3R0IA 4D7AA 3ZWAA 4MVJF 3EK2A 3JYOA 5CFZA 3RCBA 4ILKA 4UUPA 1B3BA 4ND5A 4XIJA 3PDJA 3QLJA 1E3SA 4MVJH 1U8FO 4YT4A 3IJRA 4Y98A 1XYGA 3B20A 4CL3A 1YVEI 3VTZA 3OMLA 5ENDA 2RH8A 2AQ8A 4XYEA 3IAHA 4YJGB 1M76A 3I9JA 4BV8A 1UAYA 3OP4A 3KUXA 2O7SA 2UUPA 1ADFA 3KYDB 2C5AA 2AA3A 4HUJA 3OJ0A 4ZICA 3F9IA 1EK6A 1ZJZA 3ZWPA 1X1EA 4R01A 1N1GA 1X15A 1YONA 3AI3A 3UOGA 1KEWA 4W7HA 3PFFA 4DQUA 4FIZA 4FGWA 5BNFA 4RCVA 3CKYA 1Y8RB 3DMYA 5KJFA 4J4BA 4JBGA 2I99A 4NFYA 3GQVA 2E6UX 3DMTA 2OORA 3ZNPA 4YT5A 3SLKA 3HDYA 2XF8A 4RF2A 4WLOA 4X54A 4ZGWA 5CDYA 3NT4A 3ZW8A 3V1UA 2ZKLA 1LSSA 3DBHA 4ZHSA 4E5PA 5F1PA 4KDFA 4RZIA 3UH1A 1QRRA 2FY8A 3KEOA 1KY5A 3PPIA 2V6FA 1I2BA 4GVXA 4JXKA 4CLDA 4IJVA 4G81A 2HMTA 2OZPA 1DIAA 4RQTA 3NRCA 4KQXA 4YR9A 4CLRA 3KB6A 4IBOA 1NHGA 2PK3A 1GR0A 1SOWA 2BLLA 4DYDA 3LT0A 4KWIA 2OHXA 1FJHA 1WMBA 1BDBA 1WZIA 3WTCA 3RJ5A 2CD9A 3H3FA 3RUFA 4DLAA 3WGIA 4J7XA 4B7CA 3TZ6A 1XIVA 5EQFA 3KRTA 4CM3A 1YOVB 4KUEA 1ISIA 3F47A 1E77A 3AI1A 3ETEA 4D3DA 1IZ9A 3HUDA 3H9JA 1AUPA 4J6FA 1F8GA 1HWYA 4J91A 4TWRA 1WW8A 3BMOB 4XWYA 2NQTA 1Z7EA 3ZCXA 3WGGA 1QV6A 3B70A 2GPTA 4BIIA 2HLPA 2DTDA 1YDWA 2D5AA 3IP1A 3W4KA 3C24A 1SPXA 2J3IA 3AUTA 3RC7A 1MGOA 2UAGA 2X6TA 1LU9A 2ZYAA 3HDHA 2JCXA 4JBIA 3QVOA 1T2CA 3JQAB 3ZNOA 4HKTA 1DFGA 4E2WA 3WQRA 3KZVA 1CWUA 3E8XA 1UXIA 4MKXA 2EJVA 2GN6A 1BXGB 3LT2A 4U0JA 1K0UA 3WFJA 1ENYA 4CQLB 1C1XA 2QZZA 4GWKA 3WIEA 4PLYA 3UKOA 1H5QA 1R4NB 3V5NA 5EESA 4AJKA 3OH8A 4HP8A 1OMOA 1DEHA 4FFPA 4BGVA 4DQXA 4FR5A 4D3SA 3OJEA 3R6DA 5ENVA 3C7AA 2A92A 2DFVA 2J3KA 2NTVA 3RC1A 3NDRA 2GZ3A 3SVTA 3EHEA 4XEHA 3ST7A 1V3UA 4A2CA 1Y9EA 4NBTA 1VLLA 2NU8A 4AICA 4OKIA 3C85A 5JFOA
chains in the Genus database with same CATH superfamily
1YBAA 4DV5B 3TE6A 3WR5A 4G0MA 1M8GA 2BN4A 3V7YA 2IYSA 3CT6A 3R5FA 3DOCA 4HB3A 4MEJA 5LQMA 1IONA 1GUZA 5AJWA 2HNKA 2X9NA 2GBGA 1V8BA 2GBIA 2Q5EA 4CTJA 1M2VA 2R85A 3JD2A 3D8SA 4M83A 4QOGA 1ABBA 1M2EA 2VL7A 2XE4A 4QUKA 5KOYA 1W9HA 1UP7A 1N2IA 4JLBA 1IBSA 4PLVA 3ZGZA 5HMLA 1Y3AA 4TS9A 1QRSA 4EKNB 1U8AA 3W5CA 2QF7A 1RU3A 4JJ7A 2ALJA 5IZCC 1RCTE 4G26A 1FQKA 1XMSA 5L3QA 1Z39A 4Z4IA 2CE7A 3L0BA 4R1PA 1KAQA 4OJTA 3PUIA 1OZHA 2X8BA 3TECE 3WDKA 4EA6A 4BS9A 5C8XA 4PG5A 2B4TO 2XB2A 1U99A 2Q1UA 4GYWA 5EJ9A 1VRVA 2R9VA 1E18A 3DWFA 5K2MA 5EP3A 2Q6TA 3VBEA 2GD1O 3TLCA 4JEUA 2V4ZA 3EXEB 2QAGA 1M74A 1VI5A 2BEVA 3NYWA 3RYCB 1ZXXA 3VR5D 1YMUA 4J03A 3VKGA 2C54A 1NW5A 2ZDGA 1N6PA 1FX0A 1N2GA 2I55A 3MYYA 3OSUA 1J2TA 1L7VC 2CYCA 4YRDA 4DIKA 3ODGA 2JB9A 5FIUA 1RRFA 3ORQA 5KI6A 4EF4A 4JP5A 5LR6A 5AT1A 2QNIA 1E9VA 4L9RA 4RC9A 5SYNA 1NNI1 2LP4Y 4CI9A 2GXAA 1Q0UA 1WSBA 1A9SA 4Y0VA 3IDFA 2OBFA 3TCKA 3WDMA 1SXHA 1VJ0A 3BRWA 2C3OA 5AKHA 1QHYA 2YYAA 1GPMA 1BKSB 2XGSA 2CUZA 4NECA 2E87A 4Z4FA 4C7OB 1JG1A 3ADPA 2AWOA 3KTFA 3AR3A 1EFPB 3MT8A 3M5WA 4HLUC 4J43A 2DWPA 3VR0A 3NX4A 3U31A 4X6YA 2GRAA 4UCQA 2G70A 4TL7A 1E1LA 3NC4A 4KQJA 4PRLA 5FP0A 2Y76A 1NAHA 3L5KA 5A4KA 4PQGA 3QVGB 1LK7A 1B41A 3WWCA 4FW8A 4FFLA 3A25A 1P18A 3U17A 3ICEA 2B21A 4DPMA 5AKLA 3UGJA 4BX2A 2QN7A 1CX9B 2J9RA 4KN9S 4U9UA 4CW7A 4QSMA 4P4TA 3AUXA 3BMXA 2C9OA 3BB1A 5A0FA 5LQNA 5H4HA 2D1QA 2Q5CA 3VJMA 2AMLA 2CV0A 4QUJA 3W2GA 1G3UA 1ZGGA 3ONFA 1WUTA 3UCEA 2J59A 3VU0A 2BUCA 5ETJA 5H02A 1GZ5A 1T2NA 3TCNA 2YWRA 2C5SA 1IIRA 1X1CA 2XTZA 2D4HA 2ES4A 3FWHA 3I37X 3L6BA 4RFSA 1KFKB 1Z4IA 3L0SA 4Q66C 1Z0SA 4ZQHA 5EP1A 4B34A 4ZYYA 3QSGA 4LI3X 1A4IA 2D0PB 4KH0A 5MN6A 3C8HA 3ABOB 3OHPA 4D25A 4EGCB 1OROA 2AB0A 2B7CA 3OFNA 1DAOA 3EVCA 1ORRA 1LLFA 3LF2A 4HS9A 2VVTA 3TZBA 4AP9A 3PGJA 1L5WA 5B36A 2HBZA 1IIBA 2G5CA 5GV8A 5L8VA 4X20A 5KYVA 2EG9A 4G4JA 3T0FA 4EA9A 3C6MA 4KB5A 1C80A 5K6AC 1LI5A 3CUTA 1Y4DE 3KVOA 3O95A 1BHQ1 3OOYA 2DWQA 4KWHA 5F5XA 2DHEA 2ERXA 2VJMA 3IOCA 4D1YA 3BAFA 1ZIXA 1NDHA 2VF2A 3O73A 3RAGA 3VR2D 4MIEA 4AMGA 3ZCTA 4W4TA 1QK4A 3H1TA 2F9FA 3NIFB 1VKZA 1NJGA 3NGMA 5KVCA 5AW9A 4B8ZA 1H8HD 3DLBA 4PQRA 3QXHA 3PI7A 5FOVA 3TW8B 4XWOA 4B81A 2IEIA 3TEFA 1QE5A 3DUFA 1E2GA 4QNNA 2W2KB 3TVTA 4D8UA 4TTTS 3ZGLA 3U1VA 2DU8A 2VEOA 1OIWA 4FHFA 4BPRA 4C4YA 2O3JA 1SK9A 1QR6A 3AF5A 3NV7A 3NV9A 5IT0A 3KAPA 1R8QA 2BZGA 1U2EA 1X7DA 1SMKA 1E79A 4TUYB 2VTDA 2G4LA 3R77A 1F7VA 4UDNA 5EKTA 2NTJA 4MUBA 1QIEA 4QBIA 2J6CA 4KJXA 4BN5A 2WB4A 5I9MA 5LZ7A 3VU8A 3M6IA 3GYGA 5JD5A 4N7MA 5C51B 1ZPDA 2WG2A 1KYZA 2CLKB 4MZDA 4O33A 3HYNA 3FLAA 2I3GA 3I5AA 4PEVA 4E5SA 1VFNA 3PX2A 4NE7A 1VSVA 1EDZA 1Q2UA 2VBGA 3UTCA 1RVV1 3ZCVA 3UV3A 2CMKA 3BMNB 3PXBA 1PLLA 2Z4TA 4MW4A 4U1RA 1AUOA 3U4GA 4QATA 4F06A 1Z08A 1T9GS 2LCFA 2O8EA 5EKDA 3NBKA 2VJDA 1AKMA 1C9KA 1EFRD 4X44A 3HGQA 3R9XB 4FJ0A 4JBWA 1HI9A 2X4GA 2I8LA 1Y1PA 2ORVA 5F77A 2JHFA 3LY9A 4W6QA 2GCIA 2DBQA 5DCYA 2WNHA 1ZIOA 1QS0A 2EW2A 1T24A 2PCJA 4KQ6A 4OYYA 2HQSA 5HFNA 2PUCA 3E9DA 3TDMA 3FNHA 2XOEA 4W1PA 3TQRA 3N0TA 4GH5A 1PHPA 2IGBA 2J09A 5KQRA 1NOIA 1KNQA 2QTFA 3STVA 7ABPA 1O4VA 1AZLA 4Y6GB 2I6SA 4BNKA 2OC9A 4E5KA 3ZJ4A 5AW7A 3FYHA 4S0XA 3KEQA 4RVGA 2RMKA 3ICQB 4OQFA 5IULC 4PO8A 1KK1A 1WXWA 2FMXA 2W0MA 3KQOA 4GLOA 5CPFA 4Z4GA 5FOXA 5J2UA 1AHPA 4PYIA 1JAXA 1GQ2A 2NUPA 1JNYA 3D8BA 5LP6C 4IXMA 1J8DA 1JYSA 3BMQB 4JUBA 1UUFA 4PCLA 4YQFA 2F3UA 5HDQA 2XOKA 4A8JB 1RI4A 1ST2A 3VR3D 1RNLA 4B6GA 6REQB 3H2BA 1B14A 2CLSA 3R2JA 3AY6A 4WDQA 5IDYA 5G0TA 3W9UA 5K03A 4HDQB 1EXVA 1YFZA 3TRHA 1DU4A 1V2GA 2H2FA 1W2HA 2RGUA 1GGEA 1IB6A 3PT5A 3D4PA 1CRZA 5DI3A 3ZQ6A 2I5PO 5DYIA 3QG5A 5CPBA 1DB3A 3TW4A 4W1RA 3MZ0A 2XUKA 3CXRA 4GPD1 2G09A 2DCMA 5LUBA 2YYYA 4YH1A 3EXHC 1JKFA 3MSXA 4UM8B 5DCUA 3RFVA 2O3SA 2PH5A 5BR8B 2RH9B 1ZJYA 4QA9A 2W6NA 1OH7A 1ORTA 3FHTA 4B83A 3C1UA 2CCGA 3HCNA 5C5EA 3P4YA 4R2XA 3JTMA 4R81A 1KMIY 1CUHA 3O8QA 4L7VA 3F49S 3NTVA 2QRLA 2R2GA 4U63A 1Z4MA 3MUFA 2VJLA 4TYPA 3U3ZA 1JIUA 1PV4A 2WTBA 1U0SY 3KQLA 1EX9A 3P2MA 4OK5A 1ZRHA 2GERA 3H11B 3ZWWA 3ORFA 2E4AA 3KJXA 4P3PA 1VMIA 1XDSA 4DLWA 2PZ8A 4V03A 2GCNA 2JGNA 3X44A 3B13B 1JQ5A 1DHRA 4HLCA 3LSYA 3UHOA 3H1EA 1NI4A 3ES9A 1Q0ZA 1OGIA 3F6BX 4L74A 3I28A 3D0RA 4JITA 3PBKA 1N6OA 2HSZA 4F9FA 1MOQA 1SKBA 5EFZA 1VGRA 3QIAA 3WK5A 1ZL0A 4F1KA 1MO6A 5FWXB 1B15A 2ZTVA 3ZD6A 4HX2A 1EB8A 1YK0A 5BMOA 3KSDO 4R0NA 5K0TA 1WOMA 4YMUA 1H2WA 4JJIA 1MX1A 3BXZA 1ZIPA 1T4MA 4IHQA 4NRDA 4ZVQA 5AVUA 1IMJA 4FT2A 2CWWA 4YPOA 3HHPA 1ZK1A 2XTJA 3U48A 5L3QB 2R00C 1JMKC 5IZ4A 3ZVNA 1E6UA 1C7EA 4IKPA 4J7CA 5AXBA 3FR7A 4MVJE 3TSZA 1N7IA 3L82B 2BIFA 1Z4JA 5EG5A 4DUPA 2HC9A 3SSAA 4BO3A 1U6KA 4QULA 1K7CA 2ZJ1A 4PCAA 3OESA 1SQ5A 3E9EA 2AQHA 4HYTA 4QPZA 4JNKA 2YZMA 3KOUA 1Z28A 2C2WA 4QGBA 5CB4A 5ECYA 3QBVA 1WETA 2BR4A 5JCJA 3GMSA 4YJHB 2IA5A 1NKSA 4C4SA 4MS4B 4QJ3A 1DO0A 1G291 2FRVA 3I01M 1D4ZA 2R6R1 2DFLA 2QSYA 1GKUB 1ABFA 1TEHA 3CJTA 3D3JA 5IK2A 5CA1B 4GP6A 4QLOA 4TQ9A 3KLMX 1SKYE 2RI6A 2Z95A 4I2VA 4KTVE 2ZP1A 4Q03A 3TKLA 3ABSB 2C2GA 3UMRA 1GAQA 2G25A 3O83A 1D07A 5HGJA 2UVDA 2JIOA 2J3DA 1Y5RA 4FXPA 1NBMD 3GHHA 1G4UR 4AUEA 1IVSA 1GLVA 5CNIA 2LCQA 3ETLA 1PWZA 3DMGA 3OKFA 5LA6B 2ZBGA 3UJAA 3QIVA 1BTOA 3VR6D 1XFDA 3RD5A 2QTGA 3HA3A 4JI7B 2RB4A 1NUHA 1BCRB 3GB9A 1KFEB 4ZJPA 4M49A 4PO3X 3FM9A 3GQBB 2B3TA 2A58A 2AJBA 2FPXA 3O2SB 3FY4A 2CLDX 3G89A 1SBCA 4GOLD 2XRFA 3HDQA 4RGBA 4RE5A 2BHTA 2B69A 4I9FA 4N9QA 1B73A 4TS4A 1T6NA 3H2JA 3ZR4B 1U1IA 3NWEA 3Q5GA 4I5IA 1BDMA 3EY4A 1E6LA 3KD3A 4LOJA 3HLKA 4KVGA 4R5MA 2JBWA 4N8EA 2VNIA 4HEHA 2QUAA 1BWRA 4BNXA 2QGNA 3UATA 1SOAA 4MR7B 4BATA 4BMVA 4G09A 1GU1A 3PQDA 2HOQA 3VTFA 2FQQA 4HB4A 1PJ3A 2PVSA 4LDNA 3RUPA 2H07A 1DBVO 3RO7A 3ZX4A 1PE0A 5IM4A 3KPVA 2WQ7A 1IB0A 1HPLA 2X2FA 1CY7A 2FQXA 3OLXA 4OREX 1CW2B 1LDGA 3GDGA 3I4LA 3WNCA 1Z2PX 3HZHA 1OIXA 1JDPA 2YUTA 1J4AA 3ZJTA 4KFRA 1T9ZA 1CR1A 2OXRA 3JAWA 1W35A 3NC1C 4KBYA 1KY4A 3T1YB 5BSWA 4ZVLA 4CCAA 5H4GA 1IY0A 1C29B 1PTJA 1WZNA 4PLFA 2QTRA 5LYJA 3LUJA 3UV7A 3W7VA 5HF9A 2XD4A 3QHQA 3IUYA 3SQOA 1VL8A 3MUEA 2V6JA 1TCBA 2DHCA 1U7PA 5MGBA 1NXPA 1NULA 3BIXA 1EAMA 1PU2A 4X92A 4L0QA 3VHXB 4ZN6A 3FUXA 2W2OA 4WJLA 3NORA 4NV0A 1XKLA 3WLSA 2LWIA 3CRRA 1PFVA 5GOTA 3KB8A 4Q3EA 2B8EA 4I5DA 4RH1A 3TIFA 3BICA 5C7YA 1JLKA 3EBLA 1M6HA 1QVVA 3RABA 3RLIA 2RK4A 4H31A 2Z4RA 1X0XA 5AK6A 4YMHA 5E7MA 3V9AA 2PYZA 4YCJA 4AMUA 1GO2A 3DR3A 3DDHA 4R1UA 1FJXA 1B7GO 1TYCA 2Z9BA 4UMEA 5CDHA 3R44A 2A0KA 2EW8A 2PKEA 5JSFA 1QIDA 1OAKA 5JNWA 3BK2A 1SA0B 2W6JA 4JX9A 4PICA 4U7PB 3RWMB 1YCHA 5C8YB 4YP5A 1IMOA 1S2DA 5LBIA 3A9TA 2FRDC 4AJNA 2PMKA 4XW2A 2JI7A 1PW5A 4HNSA 3DBLA 2IZZA 5CU7A 4MA5A 4F3CA 1QAMA 3LRTA 4NNOA 4FBMA 2NYRA 3M4ZA 5JNUA 4X1IB 4ZOAA 4IFEA 3DO6A 2X40A 3GD5A 3I52A 4QBHA 3UC9A 2C4TA 4EJFA 3CRVA 4AJ4A 5ADVA 1QG4A 2H1IA 1R15A 1JHOA 1BFUA 3KXIA 1L4EA 2QRZA 5GM2A 1LD3A 2P3SA 1IJBA 2EL7A 3PXAA 4FDLA 3FYUA 5AW2A 1UXOA 4JAVC 1P5FA 2W2LA 4Z53A 3EC1A 1SKYB 2C2BA 3CO0S 3ECCA 3UGKA 4XM2A 1DDGA 1H66A 3OCWA 5IJ9A 4UFNA 2C95A 3HKDA 3KLPX 1GYRA 3GT3A 1KJJA 1I01A 2O0KA 3LC2O 4BGIA 3NTUA 2AMJA 1IAQA 3E3NA 2NSYA 1TI7A 2SKDA 4NV1A 2BEWA 4K6KA 1TADA 2BGGA 4FB5A 1HLDA 1P2TA 4UATA 5T64A 3LRPA 1ZGHA 2BFEB 4YUWA 1Y3FE 1NI5A 4BKPA 2GKSA 3M6VA 2H4WA 1HDXA 1CUIA 2M1ZA 2VHEA 3OZSA 4XOUA 5DDIP 5F12A 3V4SA 1SRQA 3HRIA 3CLUD 3O90A 3SM3A 2VRCA 3C3BA 5F4BA 3LFHA 5JO9A 3C4JA 5F4ZA 3PPWA 4MI9A 1M8FA 1W5FA 1RBMA 4HQFA 4CIWA 5KWSA 3DAYA 5HRUA 1E3WA 3LP5A 4DUYB 1WMEA 3P0JA 3VMMA 3QEBZ 5EWJB 1TUGA 2V7EA 5ALFA 1AMNA 1F4VA 3LUBA 1U98A 1E7MA 1X86B 3DV0A 5ALQA 2VHZA 5I47A 2X9QA 3R0QA 3DZJA 5LZ8A 3WAGA 4D5GA 1U5BA 3SN6A 4HB2A 4M9SA 4MPDA 1R9JA 1TM4E 4UM9D 2VSYA 3C7TA 2WC1A 4YV7A 1M6WA 2OGTA 3PD0A 2PUWA 1GSIA 1KETA 3GMTA 3ISTA 4KNWA 4QGSA 1BXZA 4S2UA 1MBZA 1TTQB 2V96A 3SNKA 1AA6A 3X1ZA 4KPYA 1I4LD 4PFJA 1GNVA 1G8KA 3AF4A 4FGJA 3WRXA 1UQTA 4YRIA 2OP0A 4RJTA 1XJQA 1FYVA 4LWZA 1CR0A 3UFXA 4X90A 1OH5A 4DLYA 4DR5B 2W71A 3UV6A 2W8BA 4FEYA 2QPOA 2Q0HA 4DWOA 4NU0A 5C7LO 4ZAGA 3COJA 3H5WA 4KV9A 721PA 5FX2A 3O8CA 3SGLA 4HRXA 4H3SA 2VP6A 1GPAA 1J07A 4LS3A 4WN9B 3WRYC 1H05A 4F4FA 2IIBA 2DOKA 5PGMA 3U5ZB 3EEFA 1A2OA 1EWYA 2HLHA 3OWOA 4IDOA 3AKZA 4Q18A 1B2LA 1E60A 4J1TC 3ZWBA 4RYLA 4YCSA 1U1CA 2CBZA 2XF2A 2OV2A 4JODA 3W06A 5EMJA 2ZRNA 3X1MA 4KQWA 4FGLA 2CJXA 2YWDA 1QG0A 2F9MA 1KY2A 1T4CA 3C3JA 4KXYA 4LZOA 4YWHA 3TCXB 1ZIYA 3KSMA 5DVZA 1QAQA 2AHOA 1XVLA 3ILHA 5DHSA 3LPMA 5I9BA 3ELWA 3UQZA 1OC2A 3JVUA 4BMZA 2JLYA 1S5PA 2WV9A 1I5OA 3AERA 3DDUA 4C2BA 2PNJA 3TIIA 5IUJC 4KFCA 5H68A 3VR6H 1I0LA 3BRQA 4POAA 3VSEA 2HBQA 3FFAA 3T7AA 3TXAA 4B0PA 1YL7A 5L3SA 2PLAA 1IVNA 1LF5A 1P60A 3AY7A 2VNAA 1HYGA 3OJOA 1NWCA 1P33A 2PXHA 2CLEB 3PHGA 2BM0A 2VXYA 1Y5MA 1WHSA 2DJIA 3OPYI 3F9CA 1FTYA 1USWA 1VLZA 2G67A 4V2IA 1FRVA 1O87A 2VA9A 3UMCA 2J9YB 1ZG3A 2YV3A 4C0HA 4HGRA 4S3MA 3R5TA 2JASA 2POQX 4UUQA 3TPCA 4F6RA 2YWXA 1KEEB 1FJGB 4UOEA 1CQWA 3SKVA 4X00A 4PZYA 1L5VA 3X1DA 4QEDA 1KS2A 5ICGA 1B2RA 1T10A 1EPUA 1SG9A 3QKSB 4D43A 5IASA 2QTMA 2F8MA 4RABA 4EYEA 3LHFA 4G4IA 1FFXA 1ICEA 1JDNA 3D7NA 4I2NA 3R3WA 3VFDA 1N0UA 4D97A 4JP8A 3BCSA 5F2EA 1TUIA 1TT5A 1VG1A 1VKRA 3H5OA 1ODLA 1SULA 1QQ6A 3P9NA 3Q3CA 2XZDA 3AUKA 4KX3A 4GI2A 4QARA 5CVJA 3HJCA 4BTLA 3LY8A 1OXKB 3P7MA 1UC5B 2CJPA 3HEMA 3W9BA 4EG1A 1AV6A 1VKHA 3I83A 5LUAA 3FLEA 3ZZ1A 1I80A 4MW9A 1E4EA 1FBTA 3L6UA 4QGAA 1R6VA 4E5MA 3BBPA 3AUAA 1E0AA 4OHRA 3HKCA 3N07A 4MJLA 4YROA 4JL8A 5HCNA 4QT4A 4CQMD 2RG1A 3RSLA 4RM2A 1FYXA 1HSZA 3HPRA 3OUTA 2NUBA 2IF2A 1KIFA 1GAEO 3ZHQA 2C0QA 1DJOA 5DEOA 4HD8A 2O6LA 1C9MA 1W85B 3NUQA 4L0MA 5TX7A 2OV1A 1K4MA 3D4OA 5D8DA 3LTNC 2Q07A 3A6HA 3UWKA 4MQ4A 5ESDA 1NTRA 5HRAA 1CD5A 4QNRA 1NU6A 1PW7A 1SVIA 3I8OA 2PUDA 5K8IA 3ONEA 5FBWB 2D6FA 3P5BA 3ABQB 2GS9A 4OLHA 5TPZD 4R1SA 1T26A 1Q50A 2XRYA 4JP1A 3TSWA 2Q2WA 1SCJA 4RK0A 2G6TA 4AC9A 4WINA 2OILA 1CUFA 1OYYA 4K3VA 2OA0A 1I9GA 2EKBA 2Y9MB 5EE5B 3CU5A 1FLDA 3JVIA 1WM1A 3HO6A 4FBLA 4G84A 4TXLA 4KWEA 4KJZA 1NONA 5AWFC 1LSOA 2F00A 4KBGA 4BP9A 4IJMA 2EBFX 2ONYA 3RFXA 1DV1A 4X24A 1O8BA 3FCAA 4TMTA 5HGXA 4Z3KA 2RHRA 2OXEA 2V03A 5D1HA 4PPNA 2IYEA 4CTOA 1NOJA 2DTXA 1KY3A 3SYMA 2R5NA 1KMNA 1M6VB 4GR4A 4NK4A 2AOUA 2E1RA 1ZN7A 1O6CA 1L1FA 1TK3A 3GEEA 3OCYA 1K8RA 1YTUA 2OZEA 4M1OA 1Z4QA 4EI2A 3IBFA 3VPSA 3WISA 5JJLA 1MPTA 1DO2A 4O02B 5B3AA 4C0XA 3QRWA 3AZOA 4QAQA 5E2IA 4LTDA 1M5RA 3BA6A 10MHA 4GKJB 2IV2X 4M9ZA 3VVLA 1XMPA 2GAFA 4HH3C 3T4UA 1JG3A 1JNXX 1OWPA 4FMBB 4JA0A 4F91B 4V0OA 4CVNA 4HATA 3GR6A 2ATXA 4RSHA 2YJ5A 3V4OA 2RCYA 1PX0A 2VUUA 4AJLA 3CUEF 1HLGA 1AZTA 3LQQA 4UEJA 3PUHA 2ZT7A 1O95C 2H2AA 4FDVA 4W7IA 3VH2A 3K5HA 4RAOA 1GTL1 5LKRA 4WASA 4KE7A 2VHWA 1H6DA 2H5IA 5AM0A 4YX9A 5DTIA 1HMYA 3R9KA 5DSZA 5AVTA 4XQGA 3EYAA 3QBDA 1E9CA 3ZH9B 1UM9B 4H1UA 5DBGA 3X2EA 4QICA 1DQZA 1WAMA 4CHTA 3G2HA 4H3VA 3LDHA 2DLCX 1D4AA 2QZSA 4K6OA 4TWJA 1BWQA 1M7BA 5IJ0B 3P9YA 1SR8A 1ULZA 5LD2B 4QWMA 1SOUA 3KPUA 2WKRA 4D92A 1NNSA 2W83A 3B1WA 3M5DA 4YBZA 3WG9A 5CCEA 4FYVA 2NU7A 2EKZA 4Q9DA 4L6AA 5K0SA 4TWZA 5AKZA 3IDAA 2R62A 1Z13A 3HUUA 3PPVA 3BQ9A 5CXQA 2WIJA 4R8MA 3INRA 3F3SA 1E2HA 2BC9A 4MVXA 2OOKA 1M6NA 4PXSA 5BSUA 2MCFA 5JLJA 3P94A 1XZQA 2TYSB 4OVKA 1ZK3A 4E15A 3ICCA 2IYZA 4FBGA 2QDKA 4HSGA 4Q82A 1GT6A 1T3LA 2DB3A 2OC4A 4QOEA 1KO1A 4B4OA 5I7HA 3G2IA 1NA5A 5AIBA 2B0JA 2J33A 1F2DA 1FS5A 4KN8A 3RVRA 3GGSA 3U7EB 3W2EA 3FGZA 1MJHA 5IVHA 4P0TA 4L51A 3U37A 3HJRA 1ECFA 4MGIR 4NEHB 2KE5A 5BWMA 5KBYA 1R9MA 2QJOA 2OYSA 4O4JB 4EY8A 4OYHA 2B7BA 1T0JB 2ZJAA 3SR3A 2OK8A 2O5CA 2PAFA 3K1YA 4LGCA 1R0BA 2VRWA 3I5MA 1VJ5A 3KV3O 3NOVA 3V3KA 1ZD3A 4MDFA 4W8GA 3A31A 2Q7DA 4GUAA 3UICA 4DKJA 1JG7A 3BTSA 1XF9A 3MMXA 1SC6A 2E5LB 1LQTA 2P77A 1SWVA 3OPYA 4AD8A 3ZOKA 1Z0UA 4YMTA 4HAXA 2D7JA 2HWUA 4EHHA 3FVQA 2Q3JA 2W98A 2R96A 1IHXA 2PSDA 2WFMA 2WHPB 3CLTC 2W5UA 3I4FA 4OQEA 3AHGA 2ZYDA 3QW4B 4PVCA 4UNSA 1UFQA 1NP7A 3THSA 3F97A 3MCVA 3ZGNA 3CZ5A 1G3RA 2YCLA 3OIUA 3TYXA 2AI1A 5BNTA 1PVOA 3ZC3A 1EP2B 2L0XA 3QPBA 3ZDAA 4DY6A 3T5PA 3AY3A 3G9QA 3HR8A 3P19A 4GI7A 4I3FA 3CKKA 1K89A 3ZHZA 2J7PD 3TBKA 4X66B 4LWPA 2PCLA 1AO0A 2GARA 1XTJA 2WZDA 1P2BA 2QW8A 1B8VA 3DZDA 3DXZA 4YTEA 3HXLA 2FQWA 2JDIA 3PYXA 2QVXX 4Q93A 4N47A 2WJ4A 1FYWA 3K0KA 1AGYA 2WILA 3Q11A 3JYHA 4FZRA 3MAGA 4BNNA 3UGQA 2Q2VA 2Q3MA 2H11A 1IATA 3IPXA 3RSQA 5JC1A 2ILTA 3U13A 5A7FA 1LPPA 3ZE0B 1VPTA 5FPSA 1T4BA 4ZO8A 2NO0A 5I7VA 1ZUNB 2DKNA 1Q91A 4I8IA 5K8VA 4J16A 4F60A 3AVTA 3SZLA 4N9WA 4O4JF 3AJ9A 4HI0E 5A5EA 3ZHBA 4ZVNA 4CKWA 1SUSA 1KFJB 4NCJA 2R3SA 5CHEA 4FGUA 4ENTA 4RZHA 3WBBA 5FB3A 2F1HA 1YRWA 2HSDA 1KYVA 1FUYB 4KR3A 1Q21A 1ORDA 1MP0A 4BLPA 4GKKB 5ALTA 1W0KD 3S2GA 1U7DA 3DKVA 5EUCA 1SXJA 3GJYA 2CDBA 1ZL2A 3EVDA 4MLZA 4XOIA 4WZAA 3VZCA 2CV2A 3VSCA 1G17A 4FYMA 3ETJA 4JYPA 3FHOA 3TWOA 3F5SA 4HEQA 2XQKA 1UAAA 3SJCA 2FX3A 1F48A 2IP4A 1AJEA 5T4BA 3CRW1 5IKXA 5CVUA 5DTJA 2BFWA 5TJ9A 3W2HA 3HBAA 2W42A 4ANFA 3C3WA 1JSCA 3OMWA 2HPZA 1RD4A 2G4VA 1DARA 1QYRA 4QRHA 2WUEA 5EIHA 3TLJA 1L8AA 3KXKA 4D6YA 3JQAA 5C7IO 5LNK1 2WR8A 2O0LA 3K0FB 1FS6A 1JHPA 1OXSC 2OYRA 4B45A 1FFHA 2CVOA 2OP1A 4Z7JA 4D45A 3GPBA 3IHWA 4LNUB 5GPBA 4L07A 4O2RA 4DQKA 2XUDA 3ZHCA 4XUGB 5FUVA 4PAGA 4Z9AA 3RHTA 4IFBA 2QN3A 3P2IA 4JWKA 4CQLA 4JP2A 1Y9AA 1NE7A 3TVDA 3WL7A 2JIQA 4BKOA 3GEMA 1BZYA 4MQFA 5FOWA 1IM8A 3ROKA 3I2HA 1T3HA 1KRWA 1NMQA 1UPFA 5CD1A 1B0UA 4IV5A 3ROTA 4UHBA 3WYEA 4ZC8A 1JA9A 2DQKA 4H0FA 3B82A 4UCXA 4CYMA 1U04A 2CT8A 3PJFA 3W9SA 4EA7A 4LEIA 2GNOA 3WP0A 3ON5A 1VZ3A 2JGRA 2XVAA 1ZS9A 2ZB7A 3QKIA 1E9EA 3H05A 1P8AA 2NZ8A 4R31A 5ANRB 3MJRA 2XYGA 2PM8A 4M55A 3AUYA 1Z5WA 3WZMA 3IXMA 1P9LA 1A8PA 2VH1A 1HE5A 3S29A 2FA9A 2NTNA 3ZZ0A 3CNOA 4GEKA 3NBZC 4EVIA 5MF6A 1CC1S 2WTMA 4PHFA 4MTLA 3LKDA 3OJCA 2GJ4A 2IL1A 1WY7A 3B52X 4YI3A 1YZNA 1RYYA 1Y4ZA 4N40A 4REMA 3T95A 3IA7A 3SHQA 3GT7A 3U4MA 4DNQA 3ZU2A 4QOHA 1QHSA 4AKIA 2OHJA 3PCXA 3HVIA 1CKEA 4N41A 1JEDA 4NCKA 2VKQA 4AZ3A 1YS2X 1H1LA 1JA0A 1EXMA 1O9BA 1UBEA 1ACMA 2B8TA 2H7YA 2OKGA 2VBFA 2W2XA 2ZBFA 4G3XA 1W30A 1SZPA 2DKFA 3RVQA 4BNDA 1P0CA 1XDWA 4PYLA 3IJ5A 1SO8A 4WGFA 4JHXA 1O0CA 3N74A 1JP7A 2JAXA 1RLIA 1T1GA 2I03A 2VDWB 2Y6VA 1S6YA 4QYIA 3VOTA 3PXXA 1TXGA 3GLIE 3DE3X 3GRAA 4ISBA 5E0OA 2MSEB 2XVYA 5JSYA 3E7WA 4O0MA 1JMVA 5C1OA 1VJ1A 1DTWA 3C7KA 4NHOA 2ZIUB 3PTZA 2G5PA 2PV0A 4PY2A 4XD7D 5BORA 1YB7A 2P4HX 6GPBA 2L69A 3ODPA 4IQ0A 4W9MC 4AF6A 1GEEA 3WMXA 4FQ5A 2VQDA 1QLWA 1RHQA 3FNBA 4HAYA 5THKA 3THXA 5CDGA 3GJ5A 1S4MA 4GMKA 4K9DA 3MGCA 3A14A 1ZSVA 5EIWA 1FW8A 1L9KA 1LPBB 1TQ4A 1CZHA 3BB4A 3KSRA 4PCVA 1ZUHA 4GDMA 3VPHA 2ID9A 3K8YA 1GNLA 4WERA 2BTEA 4O2AB 4CKYA 1G8YA 4WFJA 5J2TA 4HQOA 2P90A 2AVDA 3H8VA 5HDBB 1PJ2A 4J49A 5DZSA 4PZ9A 4A16A 3QMMA 1A7KA 5F5LA 4I6EA 4WADA 3USCS 3WIDA 5GJBA 1OFUA 2FQYA 4NDAA 2JFFA 1DMSA 1VBNA 4P5DA 5B53A 4EG4A 4HBGA 4ALMA 1NX6A 4PPGA 2BKXA 2D1RA 3BM5A 5DM1A 2VXCA 4D4HA 2N1MA 4RMGA 1MA0A 1EFKA 4UPEA 2OHFA 3A4TA 3K0BA 4P5PA 1EGQA 5DGTA 2GPBA 2I2XB 1E2EA 5T67A 3D8RA 4P4SA 3H7AA 1U0JA 4OI2A 2CHEA 5CDSA 5CFRA 1XNQB 5CFQA 1N2CE 3ORHA 2FZVA 5FJJA 1C3OA 4GNRA 4CMGA 1Y1LA 1S3IA 3UZUA 5BPFA 3G02A 4ZAVA 3HABA 2R6ZA 4XWGA 4YJ2A 1X38A 3DD5A 3ZTTA 5F1YA 3WNZA 3PR1A 3MS2A 5BYBA 2OO5C 4WY2A 2QA5A 5C34B 2C9CA 1VLHA 1GSOA 2AUMA 3LCRA 4R7TA 1U5AA 3PVSA 1LV7A 2V0CA 5JXGA 3U7IA 2F67A 1P4AA 3D7KA 3TTXA 3I6QA 1XTBA 4TZ6A 1AQUA 3GA5A 3HXKA 3OQ1A 3K2IA 4P6VF 3T3PB 1NE2A 3CEMA 1DKNA 3W5BA 2PFGA 1FDTA 5FFNA 1KGSA 4UUBA 5F9FA 5LLTA 4C20A 3U4CA 4GGOA 1CETA 3UHFA 4F4IA 5A1TA 1CSEE 1M67A 1ZLXA 4PYJA 1VP9A 6LDHA 1YDGA 2WSMA 3F5MA 4UUMA 2JK0A 1JBKA 1JR3D 1T3GA 4FX2A 1NVBA 1RXUA 1V4VA 3PQCA 3ZBPA 4U02A 4DGSA 4UU7A 2WJ6A 4ZJZA 1JA1A 1LRJA 1YQWA 2WZQA 5A5FA 1OWMA 3DL2A 5A3QA 1EVYA 3WLMA 2P3LA 4ZJYA 2YDXA 2PMCA 2P2NA 4I5EA 2WSIA 1JR3E 4NAHA 3RYIA 2WTUA 1A5ZA 1HLPA 4HL6A 1V5EA 1QP7A 1WABA 2GGSA 3UB2A 1ESNA 4WXRA 1RVDA 4NP6A 3D1JA 2SHKA 1U94A 2XUZA 3G68A 2IVZA 3ENKA 2Y66A 4EMTA 2HIAA 1EX6A 1WVMA 1XXHE 1KJZA 3RRJA 5K0ZA 1VB3A 1PVDA 2AN9A 5F3DA 2BGTA 4MCAA 4ZCLA 3KOOA 2I80A 4EVRA 3GLIB 1RZRD 4ND8A 4TYWA 4A91A 3FUVA 4KACA 5FWDA 4Q4LA 5LQDA 4QPCA 3CSDA 4ABYA 4ZMBA 1FDSA 1G19A 2GWHA 3PG5A 4GKAA 4JJ4A 4IIHA 4U2DA 2R6HA 5FOSA 3VSDA 3DNFA 4GYKA 1P6QA 4X65B 5HR5A 2A67A 3TF5A 3S55A 5FEMA 2NNLD 5I51A 2IYWA 1AQYA 2ZULA 1E98A 3P2KA 5DT9A 3NALA 5BYAA 1STOA 1WB6A 2R65A 4P3YA 3C5HA 2LKDA 3FMGA 3PFBA 4PLCA 2COUA 1HE3A 1I30A 3G0DA 3X1YA 1XLVA 1IDOA 4DA7A 5JT1A 5LQCA 4RPIA 2X3YA 1WWKA 3HR7A 1GA4A 4D9EA 3AM4A 2YV1A 3QKWA 3Q5DA 1SCDA 1KR2A 4Q7KA 5DYYA 4DJJA 1ZIDA 2NU8B 5DNVA 1XNJA 3FCXA 3HNRA 1RXIA 4AJIA 3VSBA 4HDSA 3FYTA 3EEYA 4ZVKA 3QLTA 4RFLA 1R8XA 2CNLA 3V34A 1O97C 2AMYA 4URFA 2X9LA 2VWHA 8ATCA 1A3CA 3DEAA 1O94C 3IKTA 2PV7A 2XB9A 4HEA1 4KMMA 4HV4A 3OJLA 2B1IA 4GRIA 1E5VA 1I2CA 1UT6A 1JFRA 1FFDA 2PXAA 2YFKA 1N2CB 4COOA 2NAFA 3NDJA 1F06A 4U3JA 1HYBA 1RQNA 1PV2A 1PZGA 3BKWA 1K5GA 1WMFA 2FWBA 4Y9SA 3KQHA 1W6RA 4AY5A 1ONNA 3K16A 2PRJA 3FPFA 3L18A 3MYRA 3AEUA 2I6GA 3A1FA 4GYJA 4R84A 1PEYA 4NHEA 5KCZA 1JU3A 4M0MA 5JSKA 4FS3A 4ZYWA 4Y6PA 1Z38A 4P86A 1ZGCA 4LPKA 3E1SA 1MAWA 3WP1B 1HEUA 1NJ8A 1ZUD1 1SUEA 5F1PA 3WNVA 1ZQ9A 2CUKA 2GYVA 4H9GA 1Z75A 4PYMA 2ERCA 3AETA 4KRXA 3V55A 4HGNA 4GBJA 1R64A 5JR3A 3KQYA 1WY5A 4FYXA 4FSDA 2WUWE 2VJPA 1K92A 3H9UA 2V0GA 1X3LA 3AI7A 1JXOA 5L4NA 1XMIA 4RIHA 3IQIX 1QHGA 3QE0A 4LRSB 3WLKX 3L9XA 2DUUA 1P4JA 2OCIA 5H0IA 2PTHA 4Z49A 4M0FA 1RW4A 4V3CA 1YRLA 5HHTA 3EPKA 3P9IA 2QMHA 1XTQA 1NXOA 3W05A 4ZQCB 4BGUA 5HBGA 1EP1B 1URPA 3PDHA 4KO8A 3UAYA 3HSSA 1XCBA 1JAYA 1PZMA 1P7ZA 2CXSA 3BS4A 4N82A 1V96A 1L7AA 3H8WA 3VTKA 3DP9A 1GFSA 3ICVA 3OBBA 4ZVUA 5GONA 4ZTBA 2AR7A 3SYTA 1AQLA 1XU7A 4Y2SA 1YWGO 1JQAA 2OSBA 3CRNA 1RI2A 1RJDA 2WJPA 1ZHFA 2H8GA 3OG9A 5EE0A 4CKBA 3RUIA 5FBVB 5KHLB 2JD2A 1ZUIA 1EQUA 4PWZA 2A5LA 2CC2A 1XXHB 1Z0KA 3JYQA 4M3NA 3AEZA 2WKWA 3FDXA 1PFGA 1XRSB 2WE7A 1QHIA 2CVZA 4NH4A 4PLGA 4RIFA 5LU9A 2JH3A 4FHZA 2XQIA 3GLFE 2NNWB 4XE5A 4CKCA 2CNKA 2DFNA 2FPGA 2QTWB 2QJFA 4X5OA 2J5RA 5E4YA 1KHTA 2GZ1A 2EFHB 3H04A 3OT5A 3TIXB 3WKAA 2A0WA 4DMGA 4R9SA 3IEIA 3G0IA 2V54A 3UXYA 3DDNA 2NU9B 1E9AA 2LCIA 4PC6A 2BDTA 3LLSA 4HDCA 1FLAA 1XMJA 1Y5IA 5B4VA 2X0KA 4EKYA 3PNSA 2IELA 4BASA 1J0CA 4N3AA 5JATA 3CNQS 4YP9A 5D5QA 1AKRA 1JB9A 4JR2A 3TE7A 3VTAA 3GFRA 5IUNC 1HZZC 3BT7A 2NW6A 3OQHA 3OQIB 3X2SA 3HY4A 2VPPA 7ADHA 4KLZA 1JQKA 1GV1A 3AHCA 1MA3A 3DOJA 3T9EA 2H3HA 3K1TA 3EGXB 3DCIA 1J5EB 2BFDB 2BEUB 3CJRA 3NONA 4KFUA 1KKMA 2FF5A 3AK4A 3LVFO 1JQEA 3UWDA 3TFOA 1EUYA 4YMSA 3C4QA 1YQXA 1DAFA 1HL7A 3DW1X 1JSRA 2HZBA 2OHVA 3M1YA 1Q11A 4JD5A 1WBJB 4CR8A 5BUCA 5FI5A 1DO8A 2Y0EA 5C4MA 1V9LA 3OZCA 1UOEA 4D3YA 1UWVA 2FR1A 3GRVA 2AXEA 3QXJA 2J3JA 2DFPA 3LZDA 2IZOA 4DW8A 3NCHA 2C7PA 1IZYA 1YU6A 1DC8A 4DCPA 1VG8A 1DLJA 1LI7A 1MNAA 4M1TA 3GNTA 4JVLA 2J4DA 3UH0A 3QE9Y 3QLUC 1CERA 3AEKB 3C43A 4Y1FA 4OQYA 3FKQA 3T5MA 4EITA 3D6HA 1HK7A 2X6RA 4MCJA 4KXNA 1HSOA 1NC1A 2QZJA 4NBRA 1UFVA 3OT1B 5IN5A 4EG0A 4QIHA 5FXMA 3AY0A 3AFOA 3G88A 3I04A 5NLLA 3S4YA 4S2EA 1XLTA 5JS1A 2HLDA 1HBJA 3C1AA 5DHTA 2EC5A 4B2LA 3AVXA 1YQTA 1M0TA 3DOFA 4JP3A 4OF4A 4KIFA 2HV9A 2WFLB 4OM8A 5CT6A 1M2OA 5FR1A 5AXCA 1K0FA 1ADCA 2IYRA 1DE0A 4TMWA 1WUJS 2XA1A 1YBMA 3MTGA 4L0CA 4QDJA 3RLFA 2HMWA 3WC4A 4D8VA 5UKDA 2OWEA 1ZESA 3EBOA 5KX5A 2PKCA 4QQFA 3TSAA 2VXBA 3WRVA 2DUMA 2Q5IA 4BUZA 5L53A 1LBSA 1YCDA 1OLOA