4I9UA

Crystal structure of rabbit ldha in complex with a fragment inhibitor ap26256
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
331
structure length
323
Chain Sequence
AALKDQLIHNLLKEEHVPQNKITVVGVGAVGMACAISILMKDLADELALVDVMEDKLKGEMMDLQHGSLFLRTPKIVSGKDYSVTANSKLVIITAGARNLVQRNVNIFKFIIPNVVKYSPHCKLLVVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHALSCHGWILGEHGDSSVPVWSGMNVAGVSLKTLHPELGTDADKEQWKQVHKQVVDSAYEVIKLKGYTTWAIGLSVADLAESIMKNLRRVHPISTMLKGLYGIKEDVFLSVPCVLGQNGISDVVKVTLTSEEEAHLKKSADTLWGIQKELQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-lactate dehydrogenase A chain
publication title Fragment growing and linking lead to novel nanomolar lactate dehydrogenase inhibitors.
pubmed doi rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 109
structure length 323
sequence length 331
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2012-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4i9uA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4i9uA02
2HQ1A 3ZWVA 5I9LA 4GPD1 3KETA 1E1KA 4XJTA 2VYND 8LDHA 1R12A 3GHHA 2CUKA 4MJLA 5ITVA 1ULUA 1WMAA 2QZZA 4IQ0A 3WQSB 1AGNA 4M55A 4GWKA 1ENZA 5DZSA 1YWGO 4GX5A 5COQA 1OC4A 3FBGA 4DVJA 1PJLA 4KWIA 4Y9DA 1RYEA 4IDAA 5A5EA 4XQGA 3ABIA 4AJ1A 1EDOA 3IS3A 2QX7A 2B37A 5I8ZA 2WTBA 1LRKA 1HDXA 4CMKA 3O4RA 2YZ7A 1AHHA 3KZVA 3UVEA 1IPFA 2QRKA 4K1LA 4LSWA 4L4XA 1A72A 1JW9B 2C59A 4LGVA 2CD9A 5DN9A 3D4PA 3QQPA 1O8CA 3BMNB 2DLDA 4WLUA 4A10A 2ZB3A 4J90A 1HYHA 1YKFA 1UZMA 1N1GA 1I01A 3WGYA 3GG9A 1GCOA 1GQ2A 2BH9A 4FFOA 1B2LA 1U8FO 1K5HA 1QYCA 1UR5A 4CMEC 5EINA 5IF3A 2QRLA 4R5HA 1VI2A 3GFBA 2V6BA 3TL3A 5KTKA 1GPJA 2W2LD 3PEFA 1OZAA 2VYVA 1IOLA 4BQRA 1SOVA 4D7AA 3GH3A 1DJNA 1PS0A 3L9XA 4A5OA 2VOJA 1JWAB 1Q0LA 1PJQA 3D64A 1A5ZA 3WGGA 4OGWA 2HK8A 4Q3DA 3WMWA 1Y8RA 1DBVO 1XU7A 4NBWA 4A26A 3QWBA 5KJCA 1DIHA 3JD0A 3W6UA 4FIZA 3I3OA 1XDWA 4IGFA 4Y6PA 1SO8A 4AJEA 3JQ6A 3PZRA 3ICPA 5G2OA 4TKLA 4WEOA 1U4OA 9LDBA 5HS6A 2NVBA 3DFZA 3RASA 1NTOA 1LUAA 4CV3A 5KKAA 4WNIA 4TMFA 1KERA 4IQGA 3NDIA 4JQCA 4W9NA 5EPOA 3PWZA 4CMAA 1HDRA 1N8KA 1JN0A 5B4UA 2W90A 1E6EA 3BTOA 4HADA 4X54A 5I7EA 2YUTA 3OIDA 3C7DB 1DC4A 5A1TA 4QEDA 4BIIA 3PWKA 4BO1A 4CQLB 3E1KA 1E0DA 4DLLA 3WDSA 4YAIA 2FR8A 1W8DA 5JY6A 1YS4A 2JFFA 3ONDA 1KY5A 3L4BC 4FBGA 4TVOA 1DC6A 2RH4A 3KEQA 4LMPA 1NHWA 3JQBA 3JD1A 2NU6A 2VWQA 4XGNA 3GDFA 4WK6A 2X1HA 3GFGA 3GMSA 5KJ6A 1LI4A 3ASVA 3PJGA 3KM0A 3HQ4O 3WG9A 3WLFA 1OAAA 1PTJA 2AE1A 3HSKA 4CV2A 3WQQA 5DULA 2G1UA 1E5LA 3H2SA 1GY8A 1XWFA 1H94A 2Q3EA 3N58A 2BRUA 4RVDA 3PJEA 3BZUA 3NTQA 4DQXA 3DC2A 1OFGA 3WIDA 3GVPA 3H65A 2F1KA 1HDCA 3I1JA 3F46A 1Z7EA 3GK3A 3Q3CA 4LN1A 1HYGA 3ZU4A 4AJ4A 4LRSB 4K26A 2EV9A 4RVUA 5C7LO 1C1DA 1HSZA 3DBHB 5IDQA 2OFPA 4NBVA 2O2SA 3MOIA 2B5WA 2P5UA 2D2IA 1F14A 4PGFA 3WTBA 2YJZA 1P1JA 4Z0TA 1PSDA 2GD1O 4J6FA 2UAGA 2Q1WA 2IZ0A 1V6AA 3I52A 1GUFA 4WE3A 4J1NA 3KRTA 3WQRA 5JBIA 4XD2A 5HRUA 1GQQA 4EUFA 1R37A 4PZDA 5AOVA 3IQDB 2B4RO 3ZV6A 4BNJA 1E5QA 2XAAA 3GZNB 1YB5A 4XCVA 3TNLA 3PDUA 3AY7A 1QYDA 1CIVA 1T2AA 2EEZA 3VAZA 5JAIA 1CWUA 3EVNA 4Q3CA 1N2SA 2ZQZA 2PA3A 2UYYA 3LLVA 3GGOA 2ZIZA 5JDCA 4FGWA 5A9SB 4U5QA 4P22A 3SLGA 2Y93A 3NTOA 3D0OA 3H6KA 4XRRA 4YDRA 1GU7A 5CAEA 2WD7A 1SB8A 1WZIA 3ICCA 3CPSA 1YJ8A 3BTSA 4ZRMA 4NU5A 3TOZA 3E9QA 1VSVA 1E7MA 1HWYA 3VKVA 1R0LA 2I3GA 2NSDA 4NMHA 5G4LA 1NPYA 5COAA 1O95A 4L76A 3QWIA 1QYVA 2DTEA 4JROA 1G0OA 3VZRA 3VC7A 3K2EA 4YT4A 2JHFA 1KY4A 5I9NA 1Q0HA 1ZH8A 2AG5A 2J3IA 3AY6A 3F3SA 3OQ1A 2GUGA 2PTGA 1PL8A 1GZ6A 3WYEA 4AJOA 4XIJA 1EZ4A 1E1NA 5DBGA 2X0RA 3FNFA 1IULA 4F6CA 3EK2A 2ZYGA 4RLHA 4XGIA 5BNFA 2VCYA 3IDSA 4UULA 1ARZA 3DMTC 4DBZA 3DO5A 2C2XA 1PQWA 1Y9AA 4NBUA 3OA2A 5EN4A 6LDHA 1DPGA 3PGXA 5L7TA 4YR9A 1UJMA 2PKQO 5DBIA 3MJ4A 3RUAA 3V1TC 2HK7A 4J0FA 5IDXA 2Y1GA 1HKUA 2VUUA 3CMCO 5TNXA 4C7KA 1QP8A 2CF6A 1X0XA 4GH5A 3VPHA 4PG7A 4GX2A 2R00A 5TT1A 3TFOA 4BUCA 5ER6A 2JKVA 5ENVA 4R51A 3ZWPA 5L40A 3B1FA 4UUMA 3NRCA 1BXKA 1G6KA 1MGOA 2BFMA 5DCWA 4BO7A 2GF2A 4CM1A 2NWQA 3K8ZA 1UZLA 4NFHA 1QYXA 4PVCA 2E6UX 3PTZA 4TSKA 3AW9A 2EF1A 3QRWA 5JCJA 5F1KA 4RDHA 1FF9A 4MDHA 4GGOA 1UDCA 2P4QA 4OM8A 4DMMA 1U5CA 4R1TA 4PFJA 2PZJA 1YONA 4YB8A 3ZWBA 1X1EA 4OOEA 3P2OA 2FP4A 2VHXA 1H9BA 2FWMX 2YW9A 4FFRA 1O5IA 4CQMB 1UXHA 3KUXA 3TPCA 2B36A 1IY8A 1NR1A 3JQFC 1HRDA 3F6YA 3UN1A 5A02A 1CQJA 2YY7A 1ZZEA 1DFHA 1HYEA 4BNTA 4D46A 2WD8A 3OJEA 3RQSA 5B4VA 1T4DA 4DQVA 3AK4A 3OJOA 4ZQBA 4NH4A 3W4KA 1YBAA 3DBHA 3EYWA 3OEYA 4O63O 2HSDA 4OQZA 4TKMA 1TVEA 2O3JA 2HMSA 4IBOA 4BKOA 3ETEA 1VJ1A 4U8GA 4MKZA 3D3WB 3FN4A 4D79A 3UF0A 4P4LA 1H6CA 2XOXA 5IZCA 1DIRA 2FPGA 2VNAA 4NHEA 3GQVA 4A27A 2Z5LA 1VJTA 1D1TA 3DEYX 1O9BA 1PGQA 3NUGA 3GUCA 1KBZA 4BGEA 1GUZA 1LQUA 3GEMA 1LJ8A 3RD5A 4XJSA 3M1LA 4M1QA 2QYSA 4U0JA 5K6AA 3OM9A 4FGSA 1C3VA 4IUYA 5DT9A 2AMFA 3ZU2A 3KO8A 5A9SA 4WNCA 4JJIA 2VZ0A 1P1RA 4O0LA 4EUHA 3S1LA 4EJ6A 4D0SA 2H9IA 2PNFA 1KETA 3E5MA 1UDBA 3S55A 3WNQA 5LCXA 3MJEA 4NBRA 4TRRA 1FDTA 5CPFA 4QO8A 1Y8QA 3IMFA 1E3WB 2VN8A 3CTMA 4NJOA 4IM7A 3VOSA 3QVWA 2ZQYA 3SLKA 4CODB 4D3DA 2CVOA 5L4SA 3DZKA 1T25A 2OO5A 4G65A 1FK8A 4UUNA 2Z95A 2DBVO 2HMVA 4OKIA 4EYEA 5JY1A 5FWNA 2ET6A 4MIEA 3B6ZA 4FOSA 4BNMA 1RJWA 2RAFA 1PZHA 3UXYA 2AW5A 1T4BA 2HUNA 4HX5A 2BFOA 4P4NA 1GL3A 3AJRA 2CDCA 3D1LA 4CLRA 4IS3A 2EGHA 1VPDA 3OQ6A 3S2FA 3F4BA 2ZB4A 2D8AA 4CM8A 4WECA 2QW8A 3BYZA 4CMJA 4CLDA 1IL0A 1VRWA 1YL7A 1WDKA 4F45A 5JAZA 1I33A 1E7SA 4QO7A 4YJFB 4E2XA 2TMDA 3JYOA 4AFNA 1FXSA 1OOEA 4ZHSA 1Q7BA 1A4UA 3LQFA 2VWHA 2O3UA 4ZQEA 4DC1A 4UUOA 3GDGA 4H15A 3QVSA 2FPPA 2QZ9A 1CYDA 3HHPA 2DM6A 3FR8A 3SVTA 5CEFA 4CR8A 2FR0A 3M2PA 4QQRA 4XEHA 2IYOA 3DZBA 1UXIA 4I1IA 5HBRA 3WYBA 2GNAA 4MVJH 4PLWA 3RBXA 2QRJA 4JP3A 4CJXA 4ZICA 5BSFA 4PRLA 1I8TA 3LF2A 3FI9A 2AQKA 4Y6RA 3AUSA 3MJSA 3DOOA 3M2TA 4R1UA 3ZW8A 2QQ5A 5C3MA 4IQ8A 1HE3A 1M75A 3F1KA 3AFNA 4PLVA 5CDUA 2B35A 4E4YA 1D8AA 4F6LA 2JCVA 2DPHA 2O48X 5L95A 1I0ZA 1A7AA 1E3IA 3EMKA 1AXEA 1YQGA 4GKBA 2GN6A 4OXYA 4NR0A 2J5QA 1H6BA 2OHXA 1KS9A 2EKLA 3INGA 1EDZA 2Q45A 3FF4A 4QT0A 2ZTVA 2O2YA 1SNYA 2CVQA 3K92A 4GKVA 4Q3NA 1DO8A 3HB5X 1N92A 3RC2A 2QHXA 4RZHA 4BNNA 4XDZA 3WR5A 4NDNE 1E92A 3B70A 4BV8A 1I3NA 1B7GO 1WLYA 3A4VA 4KQXA 2EKQA 3KB6A 1UP6A 1WW8A 1P1HA 4IJUA 4R1SA 4CL8A 2C07A 3FBTA 3I9LA 3NGXA 5JDIA 4FB5A 4TRJA 4JLWA 3GAZA 3ONFA 3GNTA 4BNIA 3W8EA 4P8RA 1VE9A 1EUZA 1JLLA 3OJFA 3IJPA 3K9QO 4DC0A 1XHLA 1HZZA 1IHXA 3O9ZA 3WTCA 3CMMA 3R0IA 1M2WA 3T4XA 1ZNQO 1UH5A 4CLOB 3TSCA 1HF3A 3KV3O 2AA3A 2GASA 2VTDA 2X9GA 4BO2A 3BMOA 3OJ0A 1HZJA 4DRYA 3AOEC 1K6XA 4E6PA 1GUYA 1I30A 2A92A 5LDGA 3VVCA 3WMXA 3B1JA 4G2NA 3LVFO 4Q3EA 6ADHA 1W73A 1K2WA 4XR4A 1GV1A 5G0TA 4CMCA 4INAA 3SC6A 2NUAA 4J2OA 1DIBA 1BDBA 2X0IA 4RPGA 4CM9D 3GN2A 3DAFA 3MWDB 3VH1A 5G0UA 4GGPA 3V8BA 3WJAA 1MUUA 1SBYA 1RM4A 4GBJA 5CDGA 2W2KB 1ML3A 2QYTA 3PK0A 3DZIA 1E3WA 1NYTA 3JTMA 4GSLA 4PVDA 1MV8A 5HTOA 2PR2A 2IEDA 3EVTA 1EVZA 3OETA 1YB1A 5AXCA 1RYDA 3QWAA 4JCOA 3AI1A 4BHTA 3GT0A 1R4NB 4J4TA 4IDGA 5HA5A 3EDMA 1X14A 3PWSA 2X5KO 3I9JA 3WSVA 2HKIA 2NQTA 3KEOA 4YJGA 2CF5A 4ND4A 2NACA 3OEWA 2UV8A 4KUGA 4CR6A 4J3FA 3DDNA 3LT2A 4OH1A 3GGPA 2FZEA 5IFLA 1C0KA 1FDWA 3O03A 4ILKA 3VPGA 1CETA 2FPIA 2Y1OA 1P9LA 3NGLA 4NI5A 2DFVA 4Z0PA 4XWYA 4DPMA 4UUPA 5U4QA 1XU9A 1GDHA 1W6UA 5F1OA 3PHGA 3G1TA 2DKNA 3ZV4A 3EZYA 2DFDA 4I9NA 4YJFA 1KVRA 2YHIA 2J8ZA 2VRCD 1ZK1A 3IJRA 3DB2A 3GMDA 3DAPA 4MKRA 1T26A 3D5TA 3ROPA 1VLLA 3FWNA 1V3UA 3C1OA 1UAYA 2AQHA 1I10A 4GVLA 4RVGA 4I5EA 1PQPA 1CRWG 4YAGA 2XXBA 3E6AA 4AJIA 1F17A 3B20A 4FOOA 1EEHA 1X7GA 3RFXA 1C0LA 4NPCA 4GMFA 4GWGA 4XR9A 3ZNQA 4BGVA 1EK5A 2DU8A 4NZ9A 1ZFNA 3SJ7A 3GOHA 4ZQHA 1HE4A 4A2CA 4AVYA 1NQTA 2B4TO 2I65A 2XPCA 3WGTA 2EP7A 4BGUA 2EIHA 1LRLA 2I99A 1RPNA 4B8ZA 2QG4A 4CUKA 4F46A 3DZGA 4A0SA 1PS9A 4FW8A 2Y1DA 4CM6A 5AVOA 4WJZA 2FOIA 3TJRA 3JCZA 1LLUA 4TZKA 3EGOA 3GZ4A 2GERA 5IN5A 3ROQA 4PCVA 4GMGA 1C1XA 1LQTA 2Z1NA 3UHAA 1LDYA 4IDEA 1E7YA 5GMOA 4QSMA 3JV7A 1Y6JA 2NVWA 2Y0EA 3DXFA 5JMPA 4YYZA 1ONPA 2BHLA 2JCYA 4QXMA 2RIRA 4Z6KA 1Z7BA 4YA6A 3H5NA 2PD3A 4EW6A 4YT8A 3N74A 3CUKA 2ZK7A 3VPFA 1Q1NA 1MC5A 2D5AA 3GA0A 3HDHA 3OECA 4E12A 4Y98A 1OMOA 1EUCA 1XGKA 2EW8A 3V1UA 4BO5A 4HNGA 5B4TA 5K9ZA 1DC5A 1RM3A 1LEHA 4ND1A 3NAQA 3RC9A 3GVCA 4CLOA 4LW8A 3ZWXA 1BRMA 3FTNA 1DB3A 2O7SA 1AHIA 3V2UA 2EW2A 4FN4A 3UCEA 1PWXA 3AUAA 5CDYA 1GPDG 2W8ZA 1ISFA 5A9TA 4YVFA 3WJ7A 2Y1FA 4OQYA 2RHRA 4ZU3A 4FPXA 3DOJA 3BMQA 5EIOA 4YJHB 4OXNA 1QLJA 3HN7A 1I2BA 2VT3A 1S7CA 3RUDA 4U6QA 4YACA 2C29D 3DBLB 4R4JA 1E7QA 3VH2A 5EJ2A 3ENNA 3PPIA 3ZU5A 2D59A 4OSOA 4IDBA 3DTYA 1FDUA 2VYNA 3WGQA 5DDIP 1A7KA 4JJGA 4DIBA 3B1KA 3QVXA 5FEUA 1Y1PA 2D3TA 1X13A 1Y5RA 4J0EA 1R4NA 3GNSA 3BA1A 1C0PA 1I2ZA 5ES3A 5TRTA 4OXKA 4R54A 4EBFA 3PHJA 1FJHA 3RC7A 1BMDA 4NK4A 2YDYA 2VT2A 1HE2A 2DC1A 3D4OA 3G79A 4KP7A 4I08A 3R6DA 4RV9A 2J3KA 5A03A 3EUWA 3I9MA 4HFJA 2IEBA 4JK3A 5CP8A 1NFQA 1MXHA 3CZRA 3JD4A 4UEJA 2Y0DA 1DLJA 1E7WA 3RKRA 3LT4A 3H9GA 1HXHA 1TEHA 2ZJ0A 2WDZA 2NTVA 5IDYA 3ZWMA 3AWDA 1YBVA 2BFPA 5JMWA 1ZVMA 5ENDA 3QJ5A 5I8WA 4Y67A 3F4LA 3D7LA 1DAOA 3UH1A 3LLSA 3IOYA 1SAYA 4AJNA 1ZK0A 5AXDA 4U6SA 1IPEA 3ENKA 2GR9A 2UDPA 1M6HA 3PFWO 4QECA 4QFDA 3IAHA 4E5MA 4CMEA 2Z1MA 1BGVA 1B16A 2Q49A 3OH8A 1D4FA 3ZWWA 1MFPA 2VHWA 1H6DA 4HFRA 3TZKA 1AUPA 2OUIA 1ZW1A 1I32A 2CSUA 1YXMA 1YB4A 5T64A 2BF7A 4UVDA 4YJDA 1MG0A 2PD4A 2OBYA 1PWZA 3QVOA 5FI3A 2I66A 2ZYAA 2X86A 3UAGA 1YO6A 3GGGA 3JQ8A 3LU1A 5H83A 2C82A 4XYEA 4BNLA 1Y5MA 5EMHA 1ID1A 3R3SA 1VL0A 4TRMA 4NJMB 2GN4A 4U7WA 1BWSA 3FSRA 3RFTA 4ONEA 3VVBA 3JQ7B 1PGPA 3E48A 4PG6A 4R3NA 4CPDA 2VWGA 4IPTA 4CV1A 3NTRA 2WWRA 3AM4A 3GF4A 3DMYA 3HB4X 3AI2A 1YOVA 3INTA 3DFUA 3FWZA 4XB1A 3GVXA 2DBRA 3AM3A 3U4CA 3TOXA 2ZKLA 3ZU3A 1N7HA 3NEPX 2NU9A 4CL3A 4AJLA 1ISHA 3VH4A 3UUWA 2X5OA 3H5RA 3WNVA 4RDIA 1IB6A 3BTUA 1CDOA 1F06A 5T5QA 1QSGA 1LSSA 3JQAB 2G76A 2NM0A 1GYPA 2ZJ1A 3RC1A 4AJPA 3PHHA 3RKUA 4YPOA 4JIGA 2C5EA 3G17A 1A27A 3L4BA 4IMPA 3CZMA 4YT5A 1U3VA 3ZH2A 1EFKA 5TC4A 4L74A 2R6JA 2G0TA 1PZGA 3UGKA 1Z45A 3DZFA 4B4UA 4WCDA 1DDOA 1O6ZA 1X0VA 5C7OO 2I76A 3CE6A 3DHNA 3ZGYA 5DOVA 2G17A 3I83A 5A06A 2J5KA 1O89A 3JYPA 3CSDA 3LK7A 2Q2WA 3GEGA 4PLCA 4EZBA 4OHUA 3BMNA 5B1YA 1WWKA 3U49A 3FTPA 4AJKA 2C54A 2OXIA 4KUEA 3I23A 1JAYA 4MVJE 2GPTA 2OZPA 4DPLA 3AU8A 1PU2A 3I9NA 5IN4A 4URFA 1I36A 1RKXA 4IIUA 4B79A 1MX3A 1WZEA 2YHUA 1ONOA 1FDVA 3JD3A 1F8FA 2VQ3A 3ZWNA 1Y81A 4J1SA 5HM8A 4D41A 2R00C 5A05A 2PZLA 1LDNA 2YV1A 2OBNA 5BSEA 1E7RA 4EDFA 2VUTA 2GN9A 7ADHA 4Z0HO 1E77A 2EXXA 2YV2A 4CMIB 1ADBA 2PKQP 1B15A 1NP3A 1PJ4A 3MZ0A 2VZ8A 4NQZA 3PHIA 4B8WA 4J9VA 1YGYA 4O6VA 4GLLA 5JCJD 2O7QA 4PLFA 4CM7A 1S6YA 1OI7A 1C0IA 3JSAA 5B12A 3UCFA 4H16A 2Q2VA 4J1TA 3PQEA 5I7FA 4W4TA 2GGSA 4PG5A 4CLHA 5THKA 3L6EA 1E1MA 1JTVA 1P74A 2X5JO 4B4VA 3GNQA 4B7UA 1UUFA 1U3WA 3FPCA 4CQLA 2I9PA 1EVJA 1I3MA 4ZRNA 4DBVO 4FFLA 1I3LA 4J43A 4E13A 1XG5A 2FMUA 5CEJA 5KIAA 1HDZA 4NFYA 3ROMA 3ETDA 4ALIA 1DJQA 3CEAA 4ALNA 2PK3A 4RQTA 1PZEA 4I5GA 1M6WA 3KVOA 1EE2A 1MXFA 4YEDA 3K5PA 4BV9A 3VZPA 1BXZA 1XCBA 3WWZA 3BHIA 3AUUA 1HLPA 1LRJA 4GAEA 5JYDA 4MKXA 1UXGA 4RPJA 2AQ8A 1GD1O 2GZ3A 4GVXA 1LSUA 1P44A 4R1NA 2C7VA 4IDDA 5KNLA 4GX1A 1VC2A 4TQGA 1YDEA 4HUJA 2DVMA 3D4NA 4RGBA 3U4HA 1ENOA 4RPHA 1EQ2A 1EBFA 4BO0A 3VDRA 4MINA 4FDAA 1WNTA 2BGMA 2EG9A 3DMTA 3F5QA 2A94A 3U4IA 2E37A 4KDEA 3VDQA 4EEZA 4N5LA 3W1VA 3W4IA 2GO1A 5IAAA 2W4QA 4DREA 1KC1A 3U4DA 4RF4A 1NR7A 3DBVO 1VKOA 3PLRA 4E5PA 4XYBA 3JQ7A 4PG8A 1ISIA 2BKAA 2X9NA 5I7SA 1TT5B 2NLOA 4OIMA 2OORA 4J2HA 5IZ4A 3IUPA 2Q1SA 3TWOA 1QORA 2C2YA 1J4AA 4E2ZA 4FSHA 4LCEA 1E6WA 4E33A 4EEXA 3JQAA 3G0OA 1IYZA 5JW6A 3QWFA 3UFXA 3ZWOA 3HNPA 4OO3A 1LA2A 1WDLA 4IDFA 3VZSA 3WGZA 2BFAA 5JCXA 4WCFB 3GZNA 1R16A 2NVUB 1LC0A 5L3ZA 5T8KC 3X2FA 2GDZA 1NXQA 4CLEA 5ILOA 1T1RA 4JX8A 2GZ2A 3RJ5A 4LRTB 4BNVA 5L4LA 3I4CA 2EKPA 2FHSA 2GRAA 4FR5A 5K0ZA 2DUUA 1L7EA 3SXPA 1R4MB 2JAHA 2E82A 2X0JA 3A06A 3C1TA 4DPKA 2D0IA 4BB6A 1UAGA 3VKUA 4BKRA 3HADA 4IMRA 4YQZA 4BNGA 1ISGA 1HDOA 1K0UA 2JHGA 4BO6A 3IP3A 2LDBA 4KZPA 3T4EA 2ZYDA 1UXKA 3ZHZA 4XIYA 1PJSA 3RWBA 1MP0A 2O4CA 3IKTA 3AU9A 3IKVA 4NNJA 3GR6A 3N7UA 2Y1EA 1PGJA 4TVBA 4XQEA 4DLAA 3BIOA 1MB4A 3JQDA 2VZ9A 5AXBA 2HMTA 5I9MA 5CHEA 2HCTA 1Z6ZA 2YFQA 2E48A 2IXAA 3PQFA 1JDJA 3O8QB 5GY7A 1E1LA 3OIFA 3NT2A 2GZ1A 2Y1CA 2A35A 4Z9FA 2D5CA 2ZTMA 5JNLA 4CMIA 4DWVA 1B8VA 3O26A 4FFMA 4MP3A 3DL2A 4MP8A 4PLZA 4A7PA 3PHLA 1EMDA 1IE3A 4D45A 2DTDA 2GSDA 1T2EA 1HDYA 3GAFA 4XKJA 1J0XO 1ZXLA 5CPBA 5JO9A 2O3RA 3P7MA 2JL1A 1HLDA 4KUHA 1YDWA 4E5NA 3IIEA 4CUJA 2HAEA 1EBUA 1HE5A 1Q7CA 3TN7A 2EERA 3ASUA 1F12A 2Q99A 4MIOA 1VL6A 3KYDB 4FJ1A 4YRBA 1HT0A 4EGFA 2X8LA 3DTTA 4A03A 5FYDA 3K6JA 3NDRA 4XB2A 3JQ9C 3ST7A 4BVAA 2GLXA 3DAGA 3NJ4A 4W6ZA 2HO5A 1TLTA 3H9EO 4BMVA 1V8BA 4J9UE 1J6UA 4JJFA 4MP6A 5DCUA 3OJLA 3MCVA 1H2BA 2O23A 4Q9NA 4WCFC 3FPLA 3F1LA 5IXSA 2BD0A 5JO0A 1DIGA 4RCVA 4ZVVA 3PRJA 1LSOA 1X15A 4BNHA 2OGUA 1J5PA 1SOWA 2PGLA 4MVJP 1DRWA 2ZTLA 1U8XX 4HFNA 3OICA 3NX4A 4BNKA 4FC7A 4EUEA 2JAPA 3MJTA 4CQMA 2P68A 3KOUA 3RCBA 3WGHA 3C24A 4UREA 1DXYA 3GEDA 4OL9A 4YCAA 1DOHA 3GDOA 4HKTA 5MGBA 5JAQA 5JE8A 3G1UA 1V3TA 1PJ2A 2EP5A 1KVQA 3PI7A 5JFOA 5U9CA 1LLDA 1BDMA 1VM6A 4UVEA 1FMCA 1M66A 2NNLD 5ER9A 1W0CA 1KYQA 1LDMA 5F1PA 1UXJA 4FFNA 2C20A 3LC7O 3QSGA 5TS3A 3ZNPA 3RSHA 3L9WA 4R41A 2Q1TA 2RHCA 5ICMA 1P1FA 3UKOA 3D3WA 3VPXA 4S1VA 3PFFA 3I6QA 3SC4A 5JAMA 5DP2A 3HN2A 4F3YA 3A14A 4NBTA 2O3QA 3TFQA 1C14A 5U1PA 3V5NA 3EW7A 1PR9A 4AG3A 4D44A 1B8PA 1YVEI 2PGJA 4CMHA 1U7TA 1WAMA 2VNSA 4PLHA 5CDSA 2AEJA 3V2HA 5BNIA 4ALJA 2JFGA 4L73A 1H2HA 1T1SA 5C5IA 3U5TA 1WMBA 5IXYA 4MVJG 1SEVA 5L51A 2IZ1A 2Y66A 3F9IA 3MWEB 4K28A 4WEQA 1DIAA 2I5PO 4BL5A 1GCUA 4IY1A 1CQIA 3PGJA 2HLPA 1XELA 1U5AA 3OQBA 1DC3A 4WLEA 1H6AA 1T2DA 3E82A 3ZDFA 3HFSA 4Q39A 1NFFA 1YH3A 4N7RA 3ETGA 1P0FA 1N1EA 1GEEA 1EFLA 1P31A 3PIDA 4Q3BA 2ZCUA 1Z75A 4R16A 1KEWA 1ENYA 1GQYA 1DSSG 2WSBA 2OOSA 3HJAA 2HMWA 4QUKA 3V1YA 4WLFA 2OL4A 3AM5A 2FSSA 4FCCA 3O8QA 3H3FA 3ANLA 4L4SA 1V0JA 2FR1A 1XQ6A 2W98A 1TA4A 4BO3A 4MVJF 1DLIA 3INRA 1P1IA 4BO4A 5CG1A 1GEGA 3MTGA 4DMLA 2NADA 3AOEA 3P19A 1VJ0A 4D43A 1Y8RB 4M89A 4N5NA 5KJEA 1T2FA 1NQOA 3MTJA 2IE0A 4QTZA 3SEFA 4CUZA 5DOZA 2HU2A 1QV7A 1RM0A 1ZK3A 2J5RA 3LF1A 4FS3A 4UEKA 2I67A 4J7XA 2P9EA 3WX0A 3MOGA 1QV6A 1BVUA 2AG8A 2Q4BA 3RIHA 5KVSA 3KYDA 5KOIA 1KIFA 3F47A 9LDTA 5F5LA 2HMUA 1YL6A 4LCJA 4AICA 3C7AA 5TGDA 1ADFA 4UEOA 3ULKA 4IZIA 1L1FA 4L4RA 1ZSYA 1B0AA 5T67A 5ILGA 5H82A 2WM3A 1NAHA 3TQHA 1M76A 2J6IA 4E3ZA 1NNUA 3WWYA 2DBQA 1KVSA 3ON5A 2BI7A 2HJRA 3VTFA 2BGLA 4G5HA 1ZMOA 5A4DA 3KYCB 4E2WA 1NASA 1XR3A 3ITDA 3SJUA 3H4VA 2OMEA 4DGSA 2I3AA 4RF5A 1GAEO 4HFMA 4ITUA 1A4IA 4HXYA 1Y9EA 4RZIA 1B3BA 5FI5A 3ZV3A 3C85A 3A9WA 5CFZA 3AFMA 1BVRA 1ZK2A 1I5RA 1EUDA 4OSPA 3LT1A 4XQCA 1K6IA 4XDYA 1LLCA 4E0BA 1E6UA 3JYNA 4RO0A 1NHGA 4JBHA 3KSZO 4L9RA 4TWRA 3C3XA 3WFJA 1HEUA 4YAKA 3NKLA 3L07A 3I4FA 4PG4A 3PYLA 1ADGA 4WPGA 4BNYA 3KLMX 5BSGA 1R15A 4MO2A 4R9RA 4YXFA 3WICA 3H3JA 2PY6A 1GR0A 4E2YA 1U3UA 1Q2XA 4K9DA 3VHRA 4B3HA 2HRZA 4R69A 4CMGA 1ZUD1 4ZQFA 3NV9A 2VYVD 1VL8A 4MVJA 2AE2A 3H2ZA 5T57A 1SEPA 3OHSX 2OP0A 2YYYA 2O3SA 3HWRA 2C0CA 3HDQA 2EJVA 3ROKA 2XF8A 1U2GA 4NK5A 2CMDA 1ISJA 4I5DA 1ADCA 4D0RA 2AHRA 2Y99A 4MVJM 4BNXA 4CV0A 3Q2IA 4JBGA 4MIYA 3RU7A 3GVHA 3PYMA 4HWKA 3JQGB 4W9NC 5TJ9A 3K73O 4FQ8A 1BXGB 2W2KA 3HDJA 5L9AA 2NTNA 1QYWA 2Y67A 3H5AA 2WD7B 3P2YA 4BKUA 3L4SO 4J1QA 1K89A 1QR6A 2DT5A 2YQ5A 3CKYA 2YV3A 5DCYA 1N9GB 4ZJUA 2EWMA 4IGEA 4II3A 1D7OA 3W4JA 1ZEMA 2VHVA 4YBZA 3WOHA 4M86A 3JQEA 2IODA 4OMUA 4AL4A 3ANMA 3JQBC 1XEAA 2VHZA 5AYVA 1UZNA 5EERA 3ZWYA 4GX0A 4ZGWA 2C5AA 1KEUA 1PGOA 1CF2O 4YAJA 2PLAA 3GPIA 5TQVA 5L4NA 1NQ5A 4R5MA 2F00A 4OAQA 3E9MA 5JS6A 3QY9A 5A3VA 3TRIA 1DEHA 1YJQA 4CMBA 3BHMA 5JSFA 4CLXA 2X58A 3E03A 3F5SA 3GRPA 3P5SA 2GCGA 2NU7A 4OKNA 1LU9A 3W6ZA 2PV7A 1XYGA 4Y6SA 1X7HA 4MVJI 1F8GA 3UOGA 2O50A 4WUVA 1QKIA 4IXTA 3PYXA 4KTVE 5KKCA 1G0NA 3PZBA 4GLOA 2W2LA 3EZLA 5G0WA 4EJMA 3U3XA 1NVMB 3IUSA 2ZCVA 4BMSA 1ZMTA 4YT2A 2RH8A 2FRDA 3KTDA 3GRKA 2J3JA 2XXJA 1G1AA 3EHEA 5A5FA 1KEVA 1UP4A 1NQAO 1Z73A 2B0JA 3RUFA 2I6TA 3GY0A 5L45A 4N54A 3A1NA 4ZD6A 2LDXA 3ZHYA 1KVTA 3KYCA 5IJZA 1BW9B 3MJCA 3DWFA 4QFCA 2Q50A 3C8MA 2UUOA 2ZB7A 3RBZA 3VPSA 1PQUA 1J49A 5JDCC 3BXXA 4DA9A 5KVCA 1GYRA 2X23A 5EQDA 2PZMA 4YAEA 1KOLA 4ND5A 4GL4A 4DXHA 3R1IA 3VH3A 3LT0A 4WLOA 1NM5A 5BNTA 2PD6A 4J7CA 5C7IO 3FNEA 1BSVA 4I9UA 4KWHA 4JNKA 2Q46A 1PGNA 5DF1A 3HFGA 4BS9A 4LVUA 3RBVA 2EJWA 1IHYA 5TLSA 2UVDA 1KC3A 3C1AA 3W8DA 1V35A 4N5MA 4GQAA 1YQXA 4EITA 3G49A 5JC1A 4IJKA 3WFIA 1P1KA 3DBRB 1QXSA 3CINA 4AJJA 1ZEJA 1WPQA 4PLYA 1TB4A 4IDCA 4HNHA 1B26A 3E5RA 1N5DA 1E3LA 3NDJA 3Q11A 3RVDA 5BSHA 5FF9A 4RJTA 1ZK4A 1QMGA 1MFZA 3QA9A 3WS7A 2BMAA 2P2SA 4HY3A 4ZQGA 4FJ0A 4D42A 1HTBA 1UP7A 3NT4A 1OBFO 5GZ6A 4YJHA 1H93A 4Z9YA 2DAPA 2IRWA 4ID9A 3E18A 4DLBA 1QLHA 3S2IA 1P45A 4YTEA 4NU6A 1Z82A 3JQGA 2VTEA 3HDYA 3DBLA 1WXDA 1BXGA 1CJCA 1IZ0A 3HZZA 5KVVA 1GYQA 3PXXA 2P91A 4GSKA 4BO9A 3ZCXA 1U9JA 3I9KA 5LC1A 1Y8QB 3FR7A 2VHYA 2PKRA 5KJ1A 2QIOA 4B7XA 1Y7TA 1N9GA 3DZJA 3PJDA 3GVIA 4HP8A 3TDKA 5KWEA 4NG5A 1PZFA 2DPGA 4BKPA 4CR7A 1ENPA 1SB9A 4J16A 1HETA 3QW2A 2H5LA 3E9NA 1JVSA 5B37A 4BKQA 2V65A 3U62A 2Q4EA 3H9UA 2ZATA 3H9QA 5JC8A 2WYUA 3DOCA 4CM4B 1PL7A 2G5CA 4JP2A 3AUTA 1LDEA 3RUHA 5A3JA 3RI3A 3EC7A 3GHYA 1E3JA 1H0KA 1HSOA 1VSUA 3BTVA 4CLRB 4DL9A 1Q0QA 5EESA 3LZ6A 1U7HA 4CM8B 4II2A 1BHSA 1NPDA 1V9LA 3CIFA 2HDHA 3KXDA 1E3EA 1NWCA 4RVSA 3SX2A 4E5KA 5F3RA 1KVUA 5CG2A 4PIVA 1MA0A 2P9GA 3OF2A 2PH5A 1O94A 4LSMA 4BNWA 4E5YA 4WKGA 4Z3DA 4WLNA 4E32A 1YBMA 3EAGA 5KJFA 5I7VA 4Z3KA 5IG2A 1GV0A 4ND3A 2J3HA 4RORA 1YE3A 5KVQA 5ADHA 3QV1A 4LISA 2RBEA 2VOEA 5HWSA 1OC2A 5HS4A 4IJVA 1BTOA 2V6FA 2Q2QA 2WE7A 3KSDO 1PEDA 4DQUA 5IZCC 5ICSA 2JD0A 1U1IA 1X7DA 4XA8A 3C7CB 4XGKA 3T7CA 3Q9NA 1UDAA 2A4KA 5LDHA 1ZO8A 1F0YA 4J4HA 4PLPA 4R3WA 4BQPA 4EJ0A 4I8XA 3H7AA 3DONA 3KSUA 4HV4A 3JQAD 3ZWAA 4G81A 3ZV5A 1BW9A 1A9YA 2JD1A 3MEQA 3TF5A 5K6AC 1MLDA 1TI7A 4NJMA 1DAPA 3ADOA 2UUPA 5EL0A 1JKJA 4DIFA 2DQ4A 4B3JA 3IC5A 5GZ1A 3FD8A 4RQUA 4B7CA 3ZHXA 1B14A 3PDJA 1JKFA 1EK6A 3LDHA 5FFFA 1EQUA 4JBIA 5TSDA 1WP4A 3ZI0A 5CEEA 2EGGA 1GTMA 2JD2A 2WJPA 4O1MA 5THQA 3DHYA 2GN8A 3M1AA 1QG6A 4FD3A 3TZHA 2BELA 1MC4A 2X6TA 5IDWA 3LYLA 2OP1A 5TF4A 5GZ3A 4DYDA 5L7YA 3GPDG 4HBGA 1IUKA 1IZ9A 4L75A 4RLSA 2C7GA 4M8SA 3AI3A 4QX6A 2CDAA 2IDZA 4YQYA 2V6GA 3NJ8A 4R01A 1PJBA 3DBRA 2Y68A 4FJ2A 2DTXA 4KOAA 1L7DA 4AJHA 4B4WA 4ALKA 2E49A 4ND2A 2CY0A 4IXWA 1R6DA 4M49A 3OIGA 5BT9A 3SBOA 4LVCA 3DQPA 1T24A 3L6DA 4K6FA 1GZ4A 3ZNOA 3JQFA 3BMCB 5G4KB 3BMOB 1JQBA 1DHRA 1ULSA 1GADO 1W4ZA 4U0KA 1YL5A 1K6JA 4PLGA 3PP8A 1TXGA 4N18A 1PJ3A 2HJSA 2CNBA 3L6OO 2PH3A 4RF2A 1EVIA 3FCOA 1NWHA 3RJ9A 3S8MA 1P33A 3PIIA 1PL6A 2P5YA 3O38A 1DRUA 1JVBA 3WIEA 3I5MA 4BMNA 3GUYA 5F5NA 3JYQA 4C7JA 4BOYA 2NTJA 2AXQA 4XX0A 1KEPA 4UAGA 4K6CA 4BNFA 4YRAA 1JWBB 2SCUA 2CFCA 4H7PA 1HL3A 4FFPA 2DBZA 2H6EA 1JKIA 1MG5A 2WYWA 1GZ3A 3LSYA 2RCYA 5C37A 1ZCJA 4NFSA 5L53A 3X2EA 2B69A 5T8KA 1N7GA 3KBOA 3ITKA 4S3MA 1DFGA 3KHUA 3Q0EA 7MDHA 2VWPA 4L0QA 5AXAA 4YJGB 4CM4A 3TZ6A 3UW3A 4E30A 1AE1A 4J7UA 4YWJA 3L0DA 2BGKA 3WBFA 2R2GA 3IP1A 1P3DA 3WBBA 1ZJYA 4D3FA 3OBBA 4FC6A 3QE3A 4ROSA 3TZQA 1H5QA 3K2BA 4IS2A 3PLNA 4PZCA 1ORRA 3RAJA 4MOWA 3TZCA 4MPDA 5KCZA 3I9OA 3K30A 4CQMD 4E21A 4H3VA 1SMKA 2FZWA 5G0VA 1X1TA 4Y8VA 4PN3A 2YHIB 4YRDA 5F21A 3G3EA 3I6IA 4UVGA 2FSVA 3GLQA 4I9HA 2Y05A 1LSJA 1NPTO 3HUDA 2D4AA 4CM5A 3QHAA 3ZWCA 1ZKMA 5JDIC 3Q1LA 4RPKA 3U9LA 3KYBA 1JAXA 2AEMA 2O3TA 1EE9A 2ZTUA 2WEKA 3VZQA 4ESOA 1U28A 1Q7GA 4J91A 5TIIA 1U4SA 2Q1UA 4E31A 4TZTA 4IINA 1PIWA 5JXWA 1ZJZA 2ZB8A 1NFRA 5TT0A 3FRJA 3D3EA 4DIOA 4JN6B 1LTHR 3HG7A 4TRNA 2P9CA 4M87A 4W99A 5J23A 1NAIA 4WASA 4DTIA 3QLJA 2H1SA 3PJFA 4BGIA 2HK9A 2V6MA 1LLQA 5T6BA 3QIVA 3WLEA 3CXRA 3DZHA 3DR3A 2AEFA 1ONNA 1TT5A 3A28A 4UVIA 1C1XB 4ALLA 1PJCA 3NT5A 2ILTA 3ORFA 2PGDA 3TL2A 2X9VA 4NIMA 3JQ9A 4KDFA 1ISMA 4J49A 1NX6A 3OFSA 3BAZA 3FNHA 4WLVA 5H81A 1XQ1A 4J4BA 3U0BA 3QVTA 1CEQA 4ALMA 1TT7A 1R0SA 3WB9A 3W8FA 1H9AA 1LX6A 1LNQA 1LDBA 1PS8A 4P4GA 4WCFA 5AQ1A 1YRLA 1B3RA 4P38A 1NVTA 2NVUA 1ZSNA 4O5OA 3KLPX 4B3IA 3OMLA 1PJTA 2HRBA 3GN1A 3E8XA 3UCXA 1XLTA 3FNGA 1SPXA 4BNUA 2X0NA 4R68A 3JQCA 2FN7A 4A73A 3DHEA 2FY8A 1R4MA 3GC6A 5DP1A 1QRRA 4OYRA 1ZBQA 4XQ9A 3U09A 3WXBA 1PR3A 3ZHBA 1RM5A 5L7WA 1NVGA 2PZKA 4PLTA 1WDMA 3BMCA 5G4KA 1DHTA 3COSA 1B8UA 4GI2A 4ZA2A 2EHDA 3ANNA 2IXBA 2B83A 4B4OA 3R3JA 2YDXA 2Y0CA 3BHJA 3S2GA 2X22A 4CM3A 5CDTA 3RUEA 2E4AA 5JYEA 4DUPA 3BMQB 4ZN6A 1LDGA 1BG6A 4XYGA 1SCUA 3HE3A 3PVZA 2VRBA 1DFIA 4C4OA 4PRKA 3VTZA 1WVGA 3GG2A 1D3AA 2IYPA 3ONEA 4RVFA 4BB5A 1XA0A 5BR7A 3FHLA 3H9JA 4JXKA 5A04A 4DYVA 3OA0A 3RROA 3RUIA 3CH6A 1R66A 1U3TA 3RFVA 2B5VA 2X4GA 5DBFA 4XYMA 1VKNA 2JFHA 1LC3A 2O4UX 2WYVA 3QWHA 4XYLA 1P77A 4RF3A 3STHA 5JLAA 3AY3A 4R9SA 3IL2A 3V2GA 4KMSA 1LBEA 2BLLA 8ADHA 4CM9A 1Z74A 4W7HA 3PQDA 4W82A 4UVHA 4WOKA 3OP4A 3OSUA 1I24A 2POQX 2V7PA 3D5QA 3RU9A 1I2CA 1P0CA 2VUSA 5A9RA 3NYWA 2NV6A 3UICA 1XIVA 2TMGA 3WGOA 4AJ2A 3Q2KA 4BNZA 5JPIA 4LK3A 3EY4A 2DUWA 2P4HX 1CERA 1O0SA 3ADPA 1ZIDA 4KTTE 5MDHA 4O59O 1M67A 2A9FA 2CZCA 1JU9A 4WOJA 1XKQA 3QP9A 4EI2A 1SZJG 4RVHA 5G0SA 3T7EA 4OJNA 2CDBA 2H63A 4W7IA 4IZHA 4PZEA 3K31A 1D1SA 4Q3AA 4Z9XA 2GYYA 2PFGA 4TROA 3S2EA 3M6IA 1DRVA 4XRGA 4L8VA 2WE8A 4IJWA 2X7HA 1RWBA 3Q9UA 4LMRA 3ZNNA 2BI8A 3H8VA 5BQFA 3WYCA 1A9ZA 2PWZA 3WSWA 2B4QA 4XZ3A 1HDGO 4WGGA 2G82A 5EQFA 1K3TA 2VRCA 1I3KA 2AQIA 2IZZA 3JQ8B 1SC6A 1R0KA 3K96A 3L77A 3LC1O 4JGBA 1ZSVA 4OOFA 2YQ4A 5DNAA 3JD2A 2WMDA 3ZZNA 4BO8A 3AOGA 4MVJD 4M54A 1YQDA 4KQWA 3RUCA 1ZXBA 1U2DA 4RL6A 1GFSA 2D1YA 1AN9A 1JA9A 1C1DB 1PX0A 1A71A 3ZN2A 3LC2O 3JYLA 1AXGA 5TJHA 3WGIA 4I5FA 1FDSA 3Q6IA 1NBOA 1YOVB 2CVZA 5ITWA 4RPLA 2NU8A 2JJYA 3MJVA 1XSEA 1T2CA 4IIVA 2YFHA 1EVYA 1LXCA 1V3VA 2JCXA 1E3SA 5COBA 4D3SA 2NQ8A 3ZW9A 5TX7A
chains in the Genus database with same CATH superfamily
1FBNA 1QH9A 2HQ1A 5E4TA 2AMVA 2PXAA 1TUBA 1CZUA 3EH1A 3H8WA 1XJ0A 4GPD1 3H13A 1MO2A 4XJTA 2P6PA 4BP3A 4C08A 2QL7A 3N7AA 3LVQE 1UBCA 4FB4A 2BFCB 4BC0A 1AGNA 1N75A 5FUVA 4TV9A 3U7QB 4M55A 4NJEB 4QUIA 4JP1A 5DZSA 1K8ZB 2MMGA 3SJCA 2IUYA 2PWPA 3CVWA 4CE6A 2FW7A 4XIGS 1V37A 5COQA 1ATZA 2I1VB 3OTIA 3R7LA 3S8EA 2PRYA 4HGQA 4Y9DA 2R60A 5EOVA 1RYEA 2W11A 4NONA 2GJSA 2X0KA 4P98A 1T9GR 3CXUA 4AJ1A 3RGWS 2VA9A 1ZUHA 3IS3A 4LDAA 5I8ZA 4JEMA 1HDXA 3FPBA 3NRJA 1NVBA 2Q1XA 3ELUA 4L7VA 1P9OA 1ZL0A 5DSZA 4CMKA 5J4LA 3UVEA 3BK1A 3FYUA 3IP6A 4X1YA 1EFDN 4JVSB 4C4YA 1Z0AA 3WIUA 4KGDA 3H19A 3NS7A 2LUOA 1TJ3A 3CUUA 1JW9B 1OPXA 3FJ1A 4LGVA 1JNYA 3JPWA 3T9DA 3BMNB 4ZRDA 3ENWA 1OX5A 1W59A 4GF5A 3P94A 5WRFA 1U2ZA 4BB0A 4DWOA 3A1UA 3EXIA 1JMYA 4H2DA 1FUUA 4J90A 4EKDA 3IAS6 3WL5A 4LNAA 1UZMA 1E9FA 2R1TA 3GG9A 1KZYC 2R7AA 2BH9A 4DMHA 5HHTA 1B2LA 1U8FO 1K5HA 1QYCA 1U7OA 1Z34A 2BJWA 2ZIEA 4RWZA 1IBMB 1KSHA 4MITA 1UMDA 2J9XB 4CTKA 2GZRA 2RJ3A 4Z4FA 2BPOA 2XIQA 1VI2A 1JT9A 1GP2A 5JZOA 5LNK1 2QTHA 5B3JC 4HQ6A 2W2LD 3PEFA 1OZAA 2WD9A 5GPBA 5ECYA 4LIPD 3VU8A 4HDNB 1VECA 3RYCA 2XMBA 2H5IA 1SQ6A 1PJQA 3S2UA 1G59A 3WGGA 2DWUA 1N0UA 5KSYA 1GZ5A 4Q3DA 1NMEA 4LOJA 3ZE0B 5BRNA 4E7PA 1XU7A 2IYYA 1X80A 3JD0A 4PC6A 1OXUA 1T15A 3IB3A 5JSZB 1YA8A 2BEWB 4UFPA 5CLIA 1SO8A 4AJEA 4EGCB 3NEJA 3ESXA 3JQ6A 5HS6A 3RASA 1DELA 2CGEA 2WB4A 1NTOA 2WPDD 3SJZA 2DCMA 2PO5A 2DBYA 3H5VA 5KKAA 4CV3A 1QWOA 1AQNA 2OILA 2R86A 4NLLA 4CT0A 3IQXA 4EA8A 5ARBA 2J9ZB 3VZBA 3U60B 3IUNA 1N8KA 1JN0A 4PBTA 1IAQA 1QTQA 1RJ9A 2PL3A 2W90A 1DX6A 3BTOA 2NGRA 4I4TF 2WT4A 4ZV7A 4X6YA 2GEUA 3RNLA 4QEDA 1XT6A 2RFLA 1FYVA 5EI5A 3USZA 2W5UA 2WUEA 2WG1A 2W2MA 2A3NA 3PWKA 4L3VA 3E1KA 3OG9A 3QG1A 1Z22A 1E0DA 4KLRA 3AUYA 5AMXA 3RG2A 1L7AA 4EG8A 2AXEA 3BXFA 4YAIA 2WW8A 3HCOA 2P5SA 3EDCA 1VJDA 1D0SA 1W8DA 4CCWA 1NV9A 2VRNA 1YS4A 3TLJA 2I22A 4RC9A 5FNVF 4YYEA 4Y9TA 1GGHA 3KEQA 3THXB 1GCIA 2XX3A 1ULAA 1TX4B 1TVCA 1W44A 3JQBA 3LY8A 3PXAA 5D87A 1HNWB 4X97A 2NU6A 3KIPA 2XUHA 1QFSA 2VK8A 1AHNA 1BYUA 1EM8B 5KJ6A 5AI0A 3PJGA 2WHQA 5ALZA 3WL4A 3KM0A 4G4SO 5DI3B 4YV7A 3MHTA 1EP1B 3M49A 2FW6A 5D3KA 1OAAA 4PE5B 2DJ5A 4OUDA 3TGWA 3ZG6A 5HR5A 4DCMA 3ZY6A 2G1UA 1EYZA 1DAIA 1IVYA 2PX4A 1YHYA 1W5BA 2L17A 4OQNA 1QQ6A 4CKEA 3DC2A 1G5HA 4GLJA 4DQXA 2YZKA 2RKOA 2JFUA 5I5GA 4Y0VA 2V7XA 5JSHA 1CFJA 4LN1A 5DWQA 3GK3A 1HYGA 3GRFA 1L5KA 4LRSB 4V3CA 3VAAA 4DUGA 5C7LO 1E20A 2REQB 2W7TA 3DBHB 1GO2A 2OFPA 3JARA 3LAWA 4IIBA 3A4YA 4IEEA 3Q5EA 1KYXA 1V8OA 3OOWA 4Q7KA 1XQXA 1P1JA 2R4QA 5AI9A 3KQHA 4WE3A 2CWWA 2KS6A 4KNYA 5K0TA 3F7NA 5IASA 2YBDA 3ZI7A 3VMFA 3NTUA 4W5WA 3ZGVA 1EFCA 5CCXA 1TAUA 4LYAA 2JFQA 3FDFA 3UV6A 3RVJA 5AOVA 4DDMA 1U11A 4TLCA 4BZQA 4OI1A 1T0BA 5BUCA 3KLNA 4BEVA 1DZIA 3TNLA 1MENA 1VYHA 2NUTB 3THYB 4JU8A 1QYDA 1CIVA 2N1BA 4HNVA 3VAZA 5AVQA 1YI8A 4L9WA 1KMHA 3EVNA 2RD2A 3P97A 4LV6A 2IY8A 3OC0A 2ZIZA 2P7HA 2OKGA 3UW1A 4C43A 4I4LA 4DZZA 3BGWA 1MAVA 4KR9A 1RPZA 3L7KA 2Y93A 1V6SA 3KHKA 3FGOA 4HN2A 3FYSA 4Z1MA 2FMHA 4ASUA 1XTIA 4Q3KA 2CLFB 1R6XA 3ZJTA 4XRRA 1XMJA 3NOQA 4DV1B 2DGDA 3MELA 1SB8A 5DV9A 1WZIA 1Q0SA 3NALA 5GOZA 4KR3A 1PZMA 2J31A 3PKIA 1YJ8A 3BFJA 4ZYUA 3KALA 2OV3A 1TM5E 4OMFG 3TW8A 4HXGA 4I4TA 5EXXA 4B3XA 3W6NA 3ZPXA 4DCCA 4KR0A 3TRHA 1R0LA 2NSDA 3RC3A 4M3NA 1P9WA 1UT5A 3QU4A 1Q0PA 2OSBA 3KLOA 3NHFA 4TXNA 4I55B 1O95A 1DG3A 4HVTA 2RGNC 4D92A 2DTEA 1SXJE 2XD9A 2J3EA 3VZRA 1PFYA 3LQQA 3HYSA 3VC7A 3K2EA 4GZLA 4YT4A 2X1LA 2XB2A 4Q9LA 5A6SA 2FMIA 1ZH8A 2AG5A 3AY6A 2FOXA 1PYGA 3OQ1A 4HUQB 4ESHA 3KQWA 4A6DA 2R6GA 1GGVA 4RH0A 1EZ4A 1E1NA 1V1MB 4EATA 3FNFA 2AC2A 5BNZA 3DVAA 3VX3A 3V1MA 3I5AA 1WX1A 3ROTA 1Z5NA 2QL5A 2Y76A 4PHCA 1PVOA 2GEVA 4X5OA 3BERA 2CE7A 1Y37A 2ACVA 1R6BX 5F3WB 1OA0A 1B43A 1RYMA 2GTHA 4YASA 1C3XA 5BUQA 1Y9AA 1AG9A 3PTAA 1DPGA 4LJ4A 4WL0A 1X1QA 3SBEA 1CJVC 3GFSA 1JLMA 3TI9A 4B6RA 3V1TC 2LZ0A 3BJZA 5I7RA 3SNHA 2Y1GA 5IDXA 1SOUA 1AJEA 4JB0A 4DRXB 2UZ4A 5AM5A 2Y3IA 3WAGA 3DS8A 5IJ9A 3ERCA 3FUVA 5TNXA 1VI6A 1M1YE 2CF6A 2IXFA 4G5OA 4OQQA 1PLLA 3UJ8A 1OBVA 5FNZA 1A1SA 5ER6A 2FE4A 2VA8A 5DCWA 2BFMA 3WRVA 3CF2A 2GF2A 3O8DA 2EJTA 3K8ZA 1EP9A 3ZCVA 1ZH2A 4PVCA 4EKYA 3PTZA 4L4ZA 2GX6A 4L5AA 4XQ0A 1CRQA 3QRWA 3EQ8A 5JIBA 4N6GA 4RAOA 5JQGF 2R97A 2ZRPA 2ZBEA 5HBGA 3EIXA 4V0SA 1GAJA 4MDHA 3VO2A 3OZAA 1FDIA 4D96A 1RABA 1GWNA 2BKXA 5F78A 1SUEA 3MMXA 3L7DA 3LBNA 4QUDA 4NCHA 1S8FA 1U5CA 4R1TA 5TMDA 3AJ8A 2PZJA 3W9UA 5B5SA 2ENWA 1EP2B 1OTYA 3IPRA 2PSSA 2FP4A 1QE3A 1H9BA 3SXJA 3O4IA 3WGUA 4AK9A 4IQFA 4P92A 1UXHA 3KUXA 3U7FB 2COEA 3TJMA 1JB9A 1EH5A 3F78A 2GOYA 3ZQKA 1ZN8A 1L0BA 3LZDA 1GSAA 1WD7A 1VA4A 2G28A 4PAGA 5CGQB 5H02A 2KYRA 2ZYIA 2P0AA 3AUJB 3B9PA 4L51A 5A02A 1CC1S 2YXDA 2H2AA 3OX2A 5IULC 3M6VA 5K0SA 2CMHA 3TM4A 3UPDA 3OJEA 2GCEA 5IVHA 1Z62A 4LZNA 1IG3A 2PLWA 4JEHA 1OT5A 4MR7A 1X1CA 3W4KA 1IXZA 1BS9A 1D04A 2IHNA 3BE8A 4GL2A 2SKCA 1NXWA 4RU1A 3E9CA 4HSGA 5KYYB 2ZIAA 2HMSA 2JRCA 2AG0A 3QNWA 5B7PA 5LQRA 1VJ1A 2D2FA 4U8GA 5E3JA 2TSYB 2BM9A 3D5EA 1BKYA 1PDWA 1H6CA 1KP9A 4P4LA 3TR6A 2QE7A 4RFLA 3DLHA 1CY7A 2GPWA 2J07A 1XXHB 3NETA 4BX0A 1FVOA 4A27A 3K0HA 5IVKA 1A2BA 1A96A 1VJTA 2DUNA 1TQ4A 4F21A 2IA5A 1J8QA 3MUFA 3QKSB 3U81A 1GUZA 4UASA 4BGEA 2JCSA 3GEMA 1IY9A 3QX9A 5FR1A 5DI9A 3F8WA 3PTLA 3FZEA 5CX4A 4KQKA 1WLSA 2OAQ1 3PQ6A 4U2CA 4ZHQB 2P75A 2QYSA 4IKOA 5K6AA 2PUJA 3SVLA 2JVKA 2WOJA 2FCAA 3NPMA 5J63A 1THTA 3DZCA 5GONF 1A4XA 4FMPA 2IXEA 4YNBA 3OVMA 4KXNA 5T3YA 4EUHA 4C0QC 4D0SA 2PGAA 5C8VA 2PNFA 1PAUA 1CQIB 1H66A 5K0CA 1YZKA 3MJEA 2NO9A 5LCXA 3VJKA 2C78A 2IPAB 3PFNA 1QVVA 3CX4A 2EQ5A 4Y18A 3Q12A 1Y8QA 5D3MA 4NCXA 4HS4A 1Y3AA 4NJOA 4IM7A 2J5BA 1F1BA 4P3OA 1CUZA 1WIWA 3QVWA 4D3DA 5JNSA 4X20B 4I1SA 4IUDS 1K6MA 1L5LA 3Q5GA 2XZOA 1LI7A 2LBPA 4UUNA 1IOWA 5HCIA 3EUAA 4B3MB 4XTCS 2HMVA 1BRTA 2ET6A 3HXQA 5L3VA 3E8MA 1RRKA 2LRHA 4MIEA 2HWKA 5JQGA 4LV5B 4O2LA 3EQ9A 4BNMA 1UBSB 2SNIE 3EH2A 1S01A 4BBPA 5LXTB 1Q91A 4UW9A 2AW5A 2G0AA 2QT9A 5L3SB 1B0UA 1T4BA 1M2VB 2XWPA 2XUDA 3THOA 4ESEA 3KT3A 1LW6E 1N8SA 4PX3A 4GMXA 2IYVA 4IS3A 2EGHA 2CMGA 4L72A 4Z4GA 2BTOA 1KOGA 2YJ3A 3F4BA 3WHPA 2HTFA 4YPFA 4CETA 1WHSB 1W25A 5JH7B 2O8BB 1IL0A 3U7GA 5F33A 1ACLA 3PL5A 1WDKA 3RTEA 1R9NA 1N1DA 4IVRA 4TL6A 5D86A 5ALTA 2E89A 3UATA 1TKBA 2ZI3A 3B6JA 4CI0B 4HNQA 2WSIA 4D9MA 3FX2A 1C9NA 1LBHA 4AFNA 1V8DA 2QLMA 4ITVA 1UWCA 3RSGA 4DC1A 4EWLA 2ZXUA 2BDUA 2R1VA 4Q4DA 3QVSA 4V39A 4FZJA 2V03A 3CPHA 2R751 4GPTA 2YN2A 1XPJA 3QPCA 2VHTA 1K3FA 3ECCA 1Z0UA 5CEFA 2XKJE 4LXIA 4A92A 4YJ2B 4OXXA 1JJAA 3CUEF 3CX8A 3LDAA 3DZBA 1F2VA 2PU5A 4I1IA 4QBFA 3AF1A 2OESA 2C0QA 5K3OA 3AFIA 2FW8A 3FPAA 3F67A 3H5TA 3RBXA 3TZLA 2P9TA 5BSFA 4GKAA 1O58A 4L5JA 3S40A 4A8PA 3FI9A 4FYWA 1AT1A 4OHWA 3MJSA 4R1UA 3PA8A 1TTTA 1M75A 2JZOA 3F1KA 3AFNA 3FE2A 3SQDA 3I01M 2MDTA 2V55B 4H9GA 5E4FA 1Y3HA 3U7JA 5CDUA 3UJDA 3SS8A 4F6LA 4FBMA 1DXQA 2VDUE 3T1VA 1R9GA 4UBLA 2VAPA 3GEBA 1HEYA 1I0ZA 2XAUA 3TD6A 3ZIAA 3HDTA 4UNQA 4PYKA 1A7AA 1E3IA 3BJIC 4IOMA 1WB4A 4OAPA 5GONA 1OSNA 3OWOA 5AW7A 1MB2A 4DJJA 3LOQA 2X76A 2J5QA 2OHXA 2WJ4A 1P5ZB 1SBZA 1WOMA 3BAFA 4X92A 4COOA 1E96A 3E5NA 3OT4A 1DO8A 4FHDA 3N53A 1RWNA 2W0SA 2CLHB 2QHXA 4RZHA 4BNNA 4MQEB 3W2IA 4NDNE 1JHZA 4C06A 4C04A 4URWR 1I3NA 1QVRA 2EKQA 3KB6A 1L5WA 1VG0B 1Y4UA 1KJIA 1P1HA 2QLFA 3HM2A 3P0FA 4R1SA 4BBJA 2GBLC 4EYKA 1ZNYA 1GKLA 3FBTA 3NGXA 4AD8A 4YMGA 4FB5A 5D3QA 3SZRA 1V48A 3N2GA 2R84A 4U9IS 3GNTA 1ZD1A 3MT0A 3AF6A 4N5IX 2VG8A 1FMFA 1EUCB 1F48A 3HKCB 1N6OA 2BEJA 2ZSUA 4OU4A 4B9AA 2PH1A 3D7MA 4TMVA 2IYAA 3SYTA 4HXEB 5B7NA 1IHXA 2ANBA 3O9ZA 4JQYA 4PO3X 2GETA 4E08A 5HKKD 4EDHA 3BXEA 3RAEC 3HPQA 2JB9A 4IIYA 5BW6B 2UZIR 4C1NA 2J7PA 2R6CA 3JYHA 5BRAA 5CYGA 1JI3A 2V3CC 3OLCX 3KQMA 3Q7SA 5EJAA 4X91A 1T5DX 3R5KA 1AF7A 1O77A 2C61A 3A3OA 4NENB 4ZI7A 1FNSA 3GV0A 1F2TB 2RARA 3VSCA 3LVFO 1ZC3A 4Q3EA 3TXXA 2IYUA 1JQ5A 3P5BA 1XNHA 1K2WA 4N49A 4XR4A 1LF5A 1LNSA 1SD5A 5G0TA 1IDN1 4CMCA 1US8B 2W70A 2NUAA 1EAYA 5H9WA 3U4QA 1BDBA 2X0IA 3PX2A 4D81A 5FOVA 3J80A 1BYIA 3MWDB 1S2DA 3OQJA 4KO8A 3GWZA 4JIMA 4KQMA 4D99A 4B40A 4RS3A 1IC6A 2JLCA 2OFFA 1MPXA 1O7JA 3PITA 3GLHB 1ICIA 3DZIA 3PK0A 4N3GA 4CGYA 4PVDA 3P20A 1L1EA 4HXFB 1G3QA 4K40A 1XTVA 5KO2A 3ABOB 4K0KB 2IEDA 1ZD4A 5CIWA 2IS6A 2OFXA 3OETA 3HACA 1G7SA 2L82A 1Y9DA 2QN1A 5AXCA 4S1OA 1GA4A 1DTSA 2E1RA 4CCYA 3QWAA 1OXSC 2EL7A 2ZYHA 3AI1A 4N6NA 4J4TA 4ZWNA 1PDVA 3N5CA 1TA0A 2RGXA 5HA5A 4F4HA 5CCDA 5SV2A 1I7DA 2BGIA 3DD5A 5BV2P 3WSVA 1L5SA 3CVOA 1XHEA 2A5DA 3FCCA 1XL1A 2NQTA 3FZQA 3E7PA 4YJGA 2CF5A 5EZYF 4ND4A 2NACA 1TYBE 2BR4A 3OEWA 1SK8A 2UV8A 5EKUA 4BLWA 4JOCA 4C5AA 4J3FA 421PA 3CS3A 3LT2A 5ELMA 4CR6A 4Q7QA 4DR2B 3EOAI 5HMMA 1KQFA 4W9MC 2FZEA 2IUSA 4TKUB 2OAP1 3Q41A 2FGKA 4G9EA 2FPWA 2O2GA 2V7WA 4UAUA 3B2NA 6NULA 4TS1A 4DJAA 1CETA 1HQKA 3R5XA 2GFIA 4FKMA 2GZDA 2Q5QA 2YWJA 4Z0PA 2DFVA 2G72A 4XWYA 2C1XA 3ZIUA 4UUPA 4QRHA 1GDHA 4XB6B 1OYWA 2YX1A 3H99A 3A9TA 3MMZA 2IVFA 1TE2A 3KWLA 3G8YA 1WXWA 1KKLA 3ZBPA 4PPGA 4YIKA 2DFDA 2ZAGA 4D8UA 2YHIA 2FVXA 4DV2B 1L8OA 4ER5A 3GCZA 5FLYA 2QTVB 3DAPA 3GLKA 1EDDA 3LKDA 1QR2A 5LMNB 2B98A 2QMEA 3AKDA 4QE3A 4BFSA 3PDWA 1Z37A 1KI9A 2D13A 3C1OA 2PX6A 4XVRA 4MHTA 5CLQA 4LOIA 1KP2A 3AVVA 2GCPA 2XXBA 3T3MB 4QNNA 4EGQA 2PUBA 3FOCA 3E6AA 1F17A 1EEHA 1X7GA 4LQDA 1C0LA 2Z8YA 4XR9A 2QV0A 3AETB 3ZNQA 4BGVA 1KJQA 4G2TA 4NZ9A 3IUYA 1X39A 4QOIA 2WY2D 3PVSA 1TZCA 4ZQHA 4JQSA 3F6PA 3EULA 4I99A 1L4HA 3OF5A 4G5RA 2D3WA 2O14A 4RM3A 4E88A 3FOWA 3DE6X 2HDWA 1Q83A 2HNBA 3ONVA 2DPMA 2P40A 1FTWA 3DO8A 4P4TA 2I99A 5LA6A 3C3DA 4V0OA 4KIJA 5FR2A 1G291 3MB8A 2Y6UA 4MR9B 3TJRA 3JCZA 4H08A 2A33A 1U2GC 1H1TA 5BQPA 1P0IA 2JAQA 4NMXB 1GAQA 1CF4A 2BBWA 4YHHB 1OW3B 1C1XA 2I33A 2JIQA 4PCLA 3ICOA 5K8VA 1S89A 2Z1NA 4RY2A 3UHAA 3USES 3BEOA 3HKEA 1T8YA 4IDEA 1PLKA 2WSSA 1E7YA 1RQ2A 2QZ4A 5J40A 1JIQA 1VJ5A 2A9VA 2JIZA 4AX8A 1NJGA 3JV7A 1Y6JA 3UG6A 3VOTA 2B1QA 5BN5B 1THZA 1XRRA 2BHSA 4QXMA 4LJAA 2AIRA 4Z6KA 1IHDA 2IDJA 4RM2A 4DA8A 5A6VA 5KOHA 5AQEA 3OHMA 4L8WB 4OLFA 4NVRA 4ZQIA 1T5IA 3L0BA 1Z9BA 1KZ6A 4JB2A 4WXHA 5A2GA 2VAWA 1RKVA 3M9XA 1Q1NA 1JMVA 4DIUA 1U65A 2I6FA 2VVTA 5JXGA 3OECA 4E12A 4QM7A 5ECWA 4LZAA 3R7DA 5B58C 1NMSA 1XGKA 3I2FA 4HNGA 3E27A 5EZYA 1DC5A 1LZKA 2PCLA 1RRVA 1LEHA 3I42A 1N2ZA 1A8PA 1SA0B 1Z2AA 4LW8A 4XCQA 2IV3A 2A9KA 2Q0QA 5H59A 1DB3A 4NXNB 4N3BA 3V2UA 1HL7A 2IDMA 5SY4A 2AKAB 2ZI7A 5I9BA 1HG1A 4BFYA 1AH2A 3WC4A 1VYVA 2QUIA 1Q1GA 1REQB 2QQGA 3K0KA 1XDSA 1PWXA 1XXHE 2E0IA 4H77A 4LOKA 4LWOA 4A2WA 3O9MA 4ZI5A 2Z2YA 4CJXA 5FBVB 1E94E 3QX7A 1SXJA 3WJ7A 2Y1FA 5EEGA 1MJFA 1T2NA 3OT5A 2O8DA 3BMQA 1GFIA 5EIOA 3OE4A 2XHEA 2J09A 4YMUA 4D4JA 2D0PB 1YAJA 4I50B 2L19A 4NE2A 5CJPA 2W2NA 4MUIA 1ZWKA 4U6QA 3UIEA 3D4BA 5HRCA 3VH2A 3O8NA 1OYOA 3E5HA 3V4FA 4TWAA 2WMNB 2PNJA 2XKAA 1W75A 2ZJ7A 3SIXA 1SIUA 3WSTA 4EMUA 2IWHA 4C78A 1LLFA 2FRDC 3WGQA 2VYNA 5KMGA 2XBMA 4MW5A 3WZMA 3RVMA 4CBVA 1BE8A 2C3MA 4J0EA 3QVUA 1R4NA 2WHPB 1G8KA 3W3AH 1C0PA 1RYHA 3IXQA 3KZMA 3R6TA 3NLLA 1Q92A 2B30A 2D5IA 4GYKA 3RC7A 4BDSA 2YDYA 5KTTA 1R4AA 3G79A 1I7LA 4ZOLF 4J29A 1K88A 3DTVD 4Q4AB 4O2AF 1PKEA 1U3GA 3I9MA 4BLOA 1KS2A 1SWWA 4D80A 5E6RB 4PF1A 4IGAA 5CP8A 4UEJA 1R8XA 4BJ6A 4CXMA 2Y0DA 4R7ZA 2MYNA 2WNSA 3KC2A 1TQDA 1BEZA 1TAQA 5HF8A 2CBXA 4V24A 4M0PA 2V3WA 3H9GA 5PGMA 4K5QA 1SUIA 4Z9AA 2CXTA 2BUCA 1FRVA 3AB3A 1SOMA 3C5WP 4FX2A 4G8CA 3W7AA 1ORIA 1NRJB 1YFJA 1ZVMA 4EX6A 1G63A 1PEKE 2F1IA 2PT6A 3F4LA 2IUEA 3O47A 1GITA 3PB3A 3QJ5A 1OZGA 3LLSA 3CH4B 1SAYA 2Y2VA 1K5GA 4PSCA 1ZK0A 3I0ZA 1IPEA 2F3PA 2IIVA 3C3YA 1M6HA 3IBTA 4BTVA 1OZHA 4AX4A 2ZITA 5AJZA 2CFRA 5TMEA 4U9UA 1YJCA 2RC5A 5F52A 5LSAA 2CLLB 1T0UA 4X61A 4G63A 6ABPA 1D4FA 1CHDA 4ZAXA 1MFPA 1CS0A 3G9TA 2FZCA 2A5JA 3TZKA 1AUPA 4KO4S 2Q3FA 2OUIA 1YXMA 4M7RA 5T64A 1P4RA 1JRLA 4YJDA 1MOPA 2QTRA 2PD4A 4XARA 5CT5A 5FI3A 3GROA 4KXMA 3UKDA 2X86A 3KOYA 2UVQA 3T9BA 1YI0A 1I4OA 3VR6A 1C3LA 1DDIA 1UMBB 4FFDA 5KQRA 4JZYA 1WR8A 1RTTA 3C4VA 5EIEA 3ZDBA 4MW7A 4N7BA 2C82A 1Y5MA 1E1QA 5AW8A 4K3VA 1OBOA 3RM3A 2QZSA 3R3SA 1Z3CA 1ORWA 4DNQA 1PD1A 4S04A 4UQOA 1BWSA 3KD2A 3FSRA 5KNDH 1JKJB 4PQYA 3VVBA 1QRSA 2ZIVB 4HL6A 2OB1A 2WWRA 3A6EA 3HB4X 3HVKA 3AI2A 1D03A 3DMRA 4XB1A 4YUAA 2B21A 3GVXA 3VA7A 2PXCA 3VJRA 3TOXA 1X7YB 2OY0A 1I1NA 2GD0A 5HK9A 3NEPX 3AW8A 1CJUC 1BQ4A 3F0TA 1L9KA 2EJBA 4KODA 4OK5A 4OTZA 3WLNA 1F06A 2C5BA 1QSGA 2NTEA 5T5QA 1GNRA 4D4HA 1KJ9A 1TF7A 3W0LB 3D4IA 1AGPA 1ZU4A 2GAOA 3V4SA 4JIGA 1EWKA 1K92A 3E81A 4LXGA 4TXLA 3NH9A 4GOND 3L4BA 1PFWA 4UM9B 2BFCA 4R0NA 4A5SA 3ZJUA 4YWHA 1RC1A 3D0RA 1J9GA 2QMZA 2ADFA 3KOMA 3U7QA 5IEJA 4WN3A 1I6MA 2YN0A 2X4IA 4ROTA 4UHJA 2FFJA 2PFKA 5HTKA 3FTDA 4D8XA 3FA2A 1J5XA 4B4UA 4IGKA 3K1YA 5F2KA 1M5TA 1KJWA 4H1HA 5AW5A 1X0VA 2HQRA 3CG4A 3L8ZA 2QI9C 3UT5B 2I76A 2V0CA 4ZOLA 1M2OB 4JLBA 3WXMA 4C4XA 1JDBC 4O2AA 5DN6D 3HI6A 3BL8A 4WXEA 1MVLA 4YP6A 4QPNA 3JYPA 1H5NA 3CSDA 2IEZA 3MILA 3LK7A 1RWMA 2Y71A 4U3JA 5DWDA 3LPCA 3K0CA 4X1IA 1TKCA 3D6NB 4ML3A 4OHUA 3BMNA 5BV1A 4NS4A 4ZKEA 2MT9A 3GEHA 4B33A 1O94C 2LV8A 2VDQB 3K3PA 4IJQA 4KUEA 2IXDA 2FYTA 1QIIA 2GPTA 3I9V1 4DPLA 1PU2A 2B82A 3I9NA 5AT1A 3SF8A 1I36A 2ZSEA 5ALNA 3SQNA 4N12A 4B79A 1M8PA 4JKOA 2FVYA 3IR5A 1JVNA 3D7RA 2R8XA 4Q15A 1Y81A 1QGOA 2JHAA 3OMXA 4N40A 4KHZA 5EWJB 4GKKB 3NTXA 1N3IA 1SD1A 1I14A 2C03A 3M6AA 2PPLA 4HDNA 4XX0B 5BSEA 1R1DA 3RIEA 2OV6A 1H3EA 1KIAA 3A7EA 1IM8A 1X3SA 2GJ4A 4LY6A 4GECA 1U7DA 4KGVA 3GLHE 4Z0HO 4IRMA 1E77A 2EXXA 4JU9A 4ZXFA 3QELB 1ADBA 2PKQP 4MWOA 3KU4A 4RTPA 1NP3A 1PJ4A 3CTPA 2YZMA 3V4PB 3PHIA 2OZLB 2BEWA 4INZA 1WDWB 2FKNA 4B8WA 1JG3A 3WNCA 3SOZA 1SD2A 4O4HF 5JCJD 4Z4IA 4PLFA 3U3ZA 1OI7A 1EAMA 1C0IA 2PX2A 2ECPA 3AIKA 3LPMA 5KNCH 3JSAA 2OK7A 5AHKA 3UCFA 1FDRA 1RWPA 4J1TA 1Y7LA 3VZCA 2EKDA 5I7FA 2ODNA 4W4TA 3DVRX 4CLHA 4TMXA 3WGVA 1NVVR 3L6EA 1E1MA 1P74A 1MO3A 3BCUA 3QEMA 4B4VA 2VQDA 5CXQA 1X3LA 4JC8A 1IWOA 2LCFA 2I9PA 1I3MA 4HNAB 5EEHA 1CY8A 1IHUA 4J43A 3RTCA 5CEJA 1ATIA 1XG5A 3HYNA 1CRLA 1HDZA 2OXEA 2Q7XA 5FO0A 2GRJA 3IIJA 4NZPA 3ROMA 2H1HA 3IQGX 2B25A 4BKMA 2Q5CA 1M6WA 3R24A 1EE2A 4YEDA 1TKAA 3CLUD 3K5PA 5KBYA 3THXA 2C84A 1P2DA 4BV9A 5GGXA 5KS2A 5H0IA 4A3SA 4GAEA 4UJ5A 3EQ2A 5EJ7A 4MKXA 4NBKA 5EJ4A 2YJ4A 1EM8A 4Q37A 5AUQA 4AUEA 3UWKA 5FB3A 4TMZA 5DHAA 4JBLA 4TQGA 3DOHA 3PSAA 2YHAA 4PHGA 1NVEA 1O6CA 1EQ2A 1EBFA 1W49A 2Q3HA 1RWQA 1JQ3A 3HHEA 1MEJA 3DUFB 3S70A 4DLZA 6REQA 3UC9A 1YZUA 1HRKA 4R8LA 1WNTA 3GP8A 5DTJA 3U4IA 5AI4A 2PS0A 2ZLBA 3DYBA 3K4PA 4O4IF 4DREA 2IYWA 2YY6A 2E87A 3A10A 4QTXA 2GM9A 4A6XA 1IIBA 2BGWA 3DBVO 1VKOA 4GZ3A 4XYBA 3JVDA 2REQA 2CK3D 1KK0A 1J0DA 1MRSA 2FLWA 2W00A 5CDFA 5EJ8A 4H6XA 4LBZA 3GJRA 3S27A 1NMYA 3O1HB 1WL8A 1FP7A 1QCDA 2NUPB 3MLBA 2TYSB 3TE6A 2OORA 1DQSA 2FMKA 2ODBA 2HK6A 4UREA 4ZOAA 3H2JA 1G41A 3AVPA 2AOTB 3MCUA 3BXZA 4MW0A 2JBAA 5ICFA 2B8EA 5AM4A 4FZRA 1GVHA 1PNOA 2C2YA 4Y30A 3A6DA 4LOLA 5DHPA 4MRPA 3A6JA 2JIRA 2AYXA 4G37A 1NN5A 2VDMB 5JW6A 1EGVB 3EBPA 4NP6A 3HNPA 4PM4A 3ZWOA 1CV2A 2ICAA 3SZ3A 2D7CA 5ALXA 4MW6A 2BFAA 3GRCA 3HO8A 2ZJOA 3THYA 3BCSA 1R16A 3MN1A 2ANCA 1FW6A 3L82B 2VPPA 4YRCA 4CHGA 5BUSA 1FZTA 2KQUA 1T1RA 3ESAA 4MEJA 2VXOA 3QVGA 4Q48A 4NL4H 1EIZA 1W94A 3LWZA 2VPWA 2KM1A 2J3QA 3A3PA 4LDZA 3SXPA 1R4MB 4GBED 1N5KA 4GIBA 1PNTA 4RZ3A 4KMOA 1E1CA 2QWXA 5DGCA 4ZEWA 4TWBA 4DPKA 3X44A 4B35A 3W1EA 1Z5UA 2X14A 2DFNA 2CB9A 3BFPA 3WV5A 4BB6A 1XRQA 1UINA 1RJGA 4D97A 3HADA 3TE7A 3F73A 3FAZA 4H35A 1LPAB 4KNVA 3IQHX 4W1SA 2XNDA 1MAAA 1QZZA 3MRXA 4KLNA 1K0UA 2JHGA 3G02A 3WFZA 4CKYA 5A7GA 2ROQA 1XD8A 3C43A 4J75A 2C3PA 4KZPA 1ZGHA 3OPQA 4U39A 2R5FA 3G68A 3W7BA 3OX4A 5JCZA 4GP9A 4X8OA 1RHUA 2WWTA 1P3Y1 5GV7A 3RWBA 2QTTA 2YS6A 2ZS9A 2FSVC 4I55A 4JDPA 1DT5A 1X87A 2XNSA 2C9YA 3WMFA 5DASA 5D1HA 4ZJYA 3IO3A 1EGQA 3M3DA 3IKJA 3G2LA 4BFUA 2BM8A 1N2JA 4N5HX 1EFTA 4XQEA 5C1PA 2A5GA 3G2IA 4KVGA 2YFQA 4EMBA 3K16A 5E9WA 4ZP1A 1V1MA 1YS9A 4G86A 4KQEA 5I8PA 3OIFA 3NT2A 4UTXA 2Y1CA 4QNRA 1KARA 1Z5VA 2VIIA 2Z4RA 5EMLA 2ZTMA 3JXEA 3QBVA 1R5NA 2FMXA 3QBDA 1W1WA 5G3ZA 3FPJA 4CMIA 4LEIA 1H8HA 4GOJA 3ZZMA 4BPRA 1RP7A 2IELA 1VP9A 5T4EA 2R1UA 2PMEA 1DKLA 1NBMD 2VQSA 2W0MA 4UQLA 5CPBA 4YUZA 2YMMA 1KI7A 5D00A 4O4IA 1HLDA 3IUJA 4KUHA 4MV3A 4ZIRB 4MV5A 2BE7A 2BEUB 2CHVA 3PR1A 3ENZA 1EBUA 3CVJA 2W4IA 1BXRB 1EK0A 3IOMA 3TN7A 1VL2A 2EERA 3ACBA 1F12A 4PYMA 1M2KA 1P72A 3SVZA 1V11B 1VPWA 2J4CA 3DTTA 5FYDA 1AB5A 3FB1A 1OUMA 3JQ9C 4UEWA 4XB2A 3ST7A 2GLXA 4K03A 4PCUA 3KVNA 4C87A 2HO5A 1QHHA 1TLTA 3RS7A 4MWTA 1HNXB 4EPYA 1YQQA 2JG3A 3DH0A 5ALJA 4BMVA 4J9UE 5DO9A 1Q84A 1G38A 4KPGA 4RULA 4RPCA 5JS2A 2O23A 4AJ9A 4ZZ2A 5DGTA 1HH4A 1QHEA 5LXTF 4XVQA 3AJDA 5JO0A 1CS4C 1Z47A 1C9KA 4ZVVA 1XLTC 3H1PA 1X15A 3OIUA 4TQ9A 4IUBS 2PGLA 2QY9A 1O6FA 3EIOA 4MXDA 4Q6WA 1YRAA 3OICA 2JC3A 2N0SA 5B1EA 1KJJA 3T5GA 4EUEA 2JAPA 4XPIA 3TH5A 3MJTA 2VQEB 3UXEA 4EB0A 1OWNA 2P68A 4C0XA 5JH7F 3WGHA 4GXQA 4LG1A 3ER9A 1KI6B 3AZPA 4RTQA 3SEQA 1E2MA 2WQ6A 1KQOA 3DLTA 3GFQA 5JE8A 3TPFA 1PK9A 1O6GA 2WG0A 2Z9DA 5U9CA 1YQEA 2RGGA 1BDMA 2YRFA 4EG4A 2WTXA 3QPUA 2HWUA 3LWNA 5ER9A 2IYQA 3IPXA 3OPVA 1S1MA 5JNVA 2D7JA 1AGRA 4RS4A 1LDMA 4EKGA 4N8SA 1L5ZA 1AO0A 5F1PA 4YMTA 2BHRA 1XZJA 3JWIA 4FFNA 2C20A 3LC7O 5HFJA 5A4FS 3W90A 4F72A 3QSGA 1EX7A 3B1YA 1EFVB 2FZ4A 5DW3A 2WYHA 2HBRA 3L9WA 4YJ2F 4R41A 5DEOA 5JYBA 3PEUA 4JH0A 4R83A 3MJFA 4YK7A 4AMBA 1U9IC 1Z2OX 3ZVRA 2J0EA 3ZZUA 4PBRA 5REQB 3WRXA 5KREA 3PFFA 3IILA 5J2TB 1Z4NA 2IH4A 3SC4A 4CTNA 1G66A 4ND8B 5EKTA 1XXHA 4CDNA 4OHRA 4EL0A 2EX4A 4GZMA 3T9CA 2NZUG 4JS0A 4KE8A 5U1PA 1FL9A 1Z2NX 4LY3A 4BFXA 4AG3A 2QE6A 2XI4A 2PBRA 2VF7A 1YVEI 3ZBUA 3GYGA 2JZNA 3KTOA 4GBMA 4JLMA 4QPDA 4RD2A 5BNIA 3GZTB 3IRUA 2JFGA 1M2GA 1XVAA 1Y6FA 2LW7A 3EUFA 4RMJA 3GRZA 1N6PA 2I8AA 5IXYA 4DMUB 1SEVA 4TTSA 2HZBA 3RIYA 1NXOA 1AX9A 5I4CA 4WEQA 4G0YA 4O29A 5IVDA 4FKBA 1GCUA 1GPBA 4ITRC 4CW7A 1DU4A 4AS3A 3NATA 1G7CA 2WKQA 1E6LA 3R74A 4DR1B 1CQIA 2G88A 4KYVA 2JIBA 3VPHA 1MX1A 1U5AA 3D02A 4PRZA 5CNMA 4GP7A 2F1OA 1TLLA 2AG6A 2ZPTX 3OPMA 4NZOA 5F3DA 1PG2A 3IUBA 5FJIA 1ES9A 1O03A 3KOWA 1V5IA 1I94B 1DKUA 3ZDFA 4JLJA 2VEDA 3EIUA 3ZQ4A 2JI6A 1GZ7A 4ZDWA 1YH3A 2I29A 3DPUA 4EVQA 2E9SA 1P0FA 1YK1A 4EA7A 1N1EA 1YA6A 2VZLA 4OGFA 1V5GA 1XOIA 2FMFA 5E4YA 3LDFA 3PIDA 2V98A 4RHYA 3SYMA 5A3QA 1Z75A 3VMMA 4UQPA 4X6LA 2IV2X 1ENYA 2RI1A 4ZEMA 2GXQA 1T0IA 2WSBA 4WBSA 2KI5A 2QX8A 1IJKA 3KELA 2HMWA 3CUVA 3COZA 4JVLA 3QJYA 1J1ZA 3SXUA 1EVLA 3V1YA 5JS8A 2YW2A 5LXTA 2BH2A 1OZFA 3ZCQA 4UTVA 4FOLA 2X8JB 1M2VA 4HX9A 3WA7A 4FCCA 2C4HA 3V7WA 3UJAA 4QFMA 2ABWA 5LQSA 1V0JA 2P41A 3DT8A 1DT3A 4HTFB 2W98A 1RZRA 1TA4A 2VDWB 2OAEA 3BG5A 1J2UA 2IOFK 4BO4A 1J70A 1WHSA 3QTTA 5CG1A 2CKDA 3PGVA 3HA2A 4S2EA 5DB4A 5JH7A 1FC0A 5CX1B 5BP7A 2ZT6A 2RG1A 4DV7B 1G21E 4OREX 5ALWA 10MHA 2Q29A 2M1XA 4GI3A 2RHJA 3KKZA 3MPUA 2IVZA 4GM4A 4Q47A 3E1GA 1WXIA 2YNMD 2VCHA 4QTZA 2ILVA 4KXLA 2WOOA 3RARA 2HA3A 4IWNA 3LF1A 4O0MA 1DCFA 4C0LA 3WZLA 3Q8WA 3WX0A 4KFUA 3QUTA 1QV6A 3LCJA 1TQ2A 2I3BA 2Q4BA 5D3ZA 2MSEB 1BE0A 2ZWPA 3KYDA 1R27A 1KIFA 4ISBA 4MYSA 3ET4A 3NHBA 4DWJA 2RGWA 3PUXA 4YJ2A 2Y1WA 1UKCA 3MCTA 3QNUA 4BVJA 5A71A 1QZXA 5LQAA 4IOLA 3I30X 1ADFA 4PSDA 4UEOA 5FTNA 3SIWA 3L18A 1J39A 1D1QA 1ZSYA 5ALIA 4Z3OA 3BWXA 2I8CA 3SK0A 4IDNA 1B6RA 4EFDA 1YMUA 4B8YA 1GJRA 3WIVA 2JAWA 2X4LA 3QFFA 4M0CA 2X6QA 5A0FA 1COWD 3WWYA 2DBQA 3BE6A 3LX5A 4GICA 4R2IA 5ADWA 4G5HA 5AW4A 4DKJA 1ZMOA 3G2NA