4I9UA

Crystal structure of rabbit ldha in complex with a fragment inhibitor ap26256
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
331
structure length
323
Chain Sequence
AALKDQLIHNLLKEEHVPQNKITVVGVGAVGMACAISILMKDLADELALVDVMEDKLKGEMMDLQHGSLFLRTPKIVSGKDYSVTANSKLVIITAGARNLVQRNVNIFKFIIPNVVKYSPHCKLLVVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHALSCHGWILGEHGDSSVPVWSGMNVAGVSLKTLHPELGTDADKEQWKQVHKQVVDSAYEVIKLKGYTTWAIGLSVADLAESIMKNLRRVHPISTMLKGLYGIKEDVFLSVPCVLGQNGISDVVKVTLTSEEEAHLKKSADTLWGIQKELQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Fragment growing and linking lead to novel nanomolar lactate dehydrogenase inhibitors.
pubmed doi rcsb
molecule keywords L-lactate dehydrogenase A chain
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 109
structure length 323
sequence length 331
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2012-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4i9uA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4i9uA02
2WYUA 4D45A 1LU9A 2Z1NA 4I1IA 2HK7A 1XCBA 3IIEA 3PHIA 3HDQA 1DBVO 3OMLA 3F4LA 5L4LA 4C4OA 1K6JA 1N7HA 3RU7A 3WJAA 1PGPA 4ALLA 3G1UA 5KOIA 1U3UA 4BNUA 4J1QA 1A4IA 3F9IA 3PZRA 4B7XA 1U5CA 1JVBA 3RWBA 4TWRA 2CMDA 3QVTA 3GGPA 1HDRA 4OHUA 4AJLA 1QORA 3DQPA 3JQBC 2D8AA 3RUHA 3OM9A 4LRSB 1C14A 3VKVA 1EFKA 2BD0A 2PZJA 4BKRA 4YAGA 2PV7A 1F8GA 4R1TA 3DZFA 1O8CA 4FOOA 2CVZA 1T26A 2OORA 4F3YA 3Q2KA 1QV6A 1LDNA 2OXIA 2HUNA 4W7IA 3PHJA 4GH5A 1PS9A 4HP8A 1ZCJA 3M1LA 5HM8A 4W99A 3VPSA 1OFGA 1D7OA 1HDXA 1NP3A 3DTYA 5JFOA 4PG6A 3BHIA 3ZV3A 3ZWBA 2HK9A 1B8UA 2Y1DA 1FF9A 1NHGA 4DREA 5IDYA 1S7CA 4CMGA 5IFLA 2CD9A 2FR0A 2E6UX 1NPDA 4IIVA 3TN7A 1WAMA 3C7CB 4MJLA 1QYWA 1XR3A 2FPPA 4E2ZA 1PS0A 3FWNA 1PJTA 4UUOA 3GVHA 5K6AC 4AJOA 5B37A 3UOGA 4PVCA 1WVGA 4BGIA 5JCXA 3SJ7A 1YOVA 4FR5A 4I08A 3U49A 4CL3A 5T57A 2DFDA 1O9BA 2GN9A 1I0ZA 2ZTVA 3RAJA 3VPXA 2HAEA 1IB6A 4WKGA 4D41A 4JJGA 4CM9D 5IXYA 1JQBA 4CLRB 1HTBA 3KSDO 4NR0A 1LC0A 2QYTA 3IJRA 3KVOA 3G3EA 1MA0A 5A03A 4YQYA 2E48A 4CMKA 2Q3EA 4CQLA 4DGSA 1WDLA 3PQEA 3OA0A 5BSFA 4O59O 3DZBA 3NDIA 4XDZA 3DBRA 2F00A 4WLNA 4BMVA 4N54A 2GRAA 4BV9A 2Q49A 1FK8A 2ZJ1A 4RVHA 3GK3A 1ONPA 2H9IA 2X22A 1TT7A 3SVTA 2IEDA 4BQPA 2HMSA 4R16A 3NUGA 3HUDA 5F1KA 1WPQA 3WQQA 5KIAA 5THKA 4TVOA 4BNLA 4JK3A 5DOVA 4AJEA 1U9JA 3IJPA 1D8AA 1Q2XA 2PGDA 1AXEA 4B4OA 5L53A 1GEEA 3WJ7A 3W8FA 4GGPA 2GZ3A 1J0XO 1ENOA 3JD0A 3L9WA 4HX5A 4LVCA 5TJHA 3WNQA 4J2OA 3CZRA 3H3JA 4J4TA 4OGWA 2VOEA 4HUJA 1T4BA 4A26A 1W6UA 2VYVA 4DTIA 2A4KA 2I9PA 3ZHBA 4IGEA 4NBRA 4QXMA 3KYBA 4CQMB 4A27A 5CAEA 1M66A 3C1AA 2BKAA 2W98A 5CPFA 5HBRA 2EF1A 1NXQA 1U2GA 3ZU4A 2NVUB 3Q0EA 2P5YA 1DJQA 4BMNA 3DBLA 2JFFA 1YJQA 1NPTO 1XQ6A 3K6JA 4R01A 4DBVO 2VUTA 3RC7A 2J5RA 3UFXA 1BG6A 1TLTA 5KKAA 3F5SA 5DCYA 3W6UA 1IUKA 1E7MA 1FMCA 4GL4A 3UICA 3ZV4A 3FCOA 4ALNA 2ZB4A 4BO3A 4R68A 4KQXA 4NZ9A 2XOXA 4ZQHA 3MTGA 4XZ3A 4YJFB 2IRWA 1HSZA 2Q1UA 4PG4A 3ZHYA 3GA0A 3GFGA 1Z75A 3I5MA 2J6IA 4U8GA 3KHUA 4IY1A 4URFA 2PGLA 1U4SA 2Q1SA 1M6WA 1H2HA 1XGKA 2ZB7A 2GN4A 1RPNA 1WP4A 3PLNA 4GBJA 5DZSA 5EINA 1LDGA 4R3WA 1JN0A 1P0CA 4ND2A 3U09A 2VRBA 1V6AA 2DBRA 3D5TA 5A5EA 1FXSA 4BNWA 4IMPA 4S3MA 3UN1A 4N18A 4MO2A 3K92A 4DQUA 3MJCA 2J3HA 2WM3A 4WLUA 1X13A 2XF8A 1ZK0A 1ZH8A 4NG5A 1JU9A 1XDWA 2C29D 2GSDA 1OC4A 2O2SA 4XR4A 1Y5MA 3H7AA 4E6PA 4LRTB 5JY1A 4KTVE 1YS4A 2P5UA 4WCDA 4YACA 1NAHA 3FNHA 3ORFA 3S2FA 2YQ4A 2C2YA 2NTVA 1ISFA 2EGGA 1WLYA 3JYQA 4PG5A 4DQVA 5GZ3A 5CG1A 3AY6A 1O94A 3FNEA 2FWMX 4MP6A 1CETA 1ULUA 4B8ZA 4K6FA 1UXJA 3ONDA 1LRJA 3K2BA 1GDHA 2JFHA 5HTOA 1YDEA 2P4QA 7ADHA 3E5MA 3HZZA 4MIOA 2JHFA 2NTNA 4L74A 1HZJA 5KVQA 4RDHA 4R54A 1ADGA 3C3XA 3ZWWA 3ETDA 5T8KA 1EUCA 2Q50A 4GSLA 4D43A 4BGVA 4NDNE 1R66A 1JKFA 1H6AA 1PJBA 4K1LA 2FHSA 3WQRA 1ZUD1 1E77A 1XU9A 1I10A 1JDJA 2G1UA 3NT4A 4YAEA 3GMSA 5EESA 3JQGA 2I67A 3QWBA 2PZLA 1NQOA 4ND4A 3I23A 4TKLA 4R3NA 4CM4A 1PS8A 3PGJA 4CPDA 1Y1PA 3LT1A 1KERA 4M49A 4OXNA 2BI8A 3VKUA 1R4MB 4FFOA 3OP4A 1Z6ZA 2HMVA 3ZWAA 3NYWA 4IDFA 3DBVO 3QW2A 1B3BA 1YH3A 1M75A 3NV9A 4LMRA 5DP2A 4W9NA 3RUFA 3FD8A 2JL1A 1BTOA 2VN8A 3LT4A 1LX6A 1NNUA 2X0IA 4YRDA 5A9RA 3QWFA 1Q7CA 1QG6A 3I6QA 4JBHA 2XPCA 2AA3A 1VM6A 4IZHA 3WS7A 3RI3A 2DPHA 4L4RA 2WSBA 3G17A 3EW7A 3JCZA 3P2YA 5I7EA 3DAGA 4Z6KA 5IXSA 4BIIA 3I9KA 1LDEA 1HXHA 2O50A 1DIRA 1HEUA 4OM8A 1E7WA 3RJ9A 3DDNA 1IPEA 3U3XA 1GUFA 3D3WB 3KXDA 1KVUA 1KETA 4KWIA 3GDOA 2GASA 4Y6SA 3DZJA 4MOWA 1ZFNA 4WPGA 5K0ZA 4B7UA 3NT5A 4WEOA 2VHVA 3QHAA 1QLHA 3SC4A 1C1DB 1AHIA 2BRUA 3P5SA 4XIYA 3EVTA 5KJFA 4XCVA 4PLCA 5LC1A 4B3HA 5KTKA 2GGSA 3JQAB 4RF5A 3BMOB 1TXGA 4PRLA 1PJ4A 2BGLA 3GVXA 4ZU3A 1QYCA 4EEZA 1ZK1A 2DT5A 3ST7A 4YCAA 5IG2A 3F1KA 3WYEA 1KEWA 2W90A 5ICSA 2ZQZA 3RUIA 1KVTA 4CM8A 1F06A 3PDJA 1H5QA 3AUUA 3I9LA 4HFRA 4OL9A 1QKIA 2EKPA 2YJZA 4G5HA 1K89A 1Z74A 2GLXA 3I3OA 3PHGA 1VI2A 5A3VA 1F14A 2R00C 5DNAA 1CF2O 2V7PA 4WLEA 1GUZA 2A94A 4GGOA 1ZZEA 4XJTA 3BTUA 3PFFA 1RM4A 3K73O 5ITVA 5IZ4A 2VHYA 4UULA 4WNIA 1MC5A 2BF7A 1Y5RA 2HCTA 1PL7A 1E3SA 2GYYA 4NBWA 5JCJA 2W2KA 1P1JA 5JDCC 2FY8A 4M87A 4BO2A 4Z0TA 3NAQA 1ZVMA 1Z82A 3VZSA 5AQ1A 1DAOA 2W8ZA 1B0AA 1K6XA 3DMTC 1KEUA 3ZU5A 1SO8A 1B3RA 2VNAA 3OHSX 1VE9A 4QFCA 1R12A 1D4FA 4UUNA 4DQXA 1QV7A 3UUWA 4XIJA 1GR0A 2BELA 5DBIA 2NM0A 3BMCB 3TZ6A 2Y99A 2BFOA 4EZBA 3FBGA 2X86A 3MWDB 3BYZA 4AJ1A 3LC1O 2CF6A 1GY8A 1XYGA 2UAGA 4B3JA 1VLLA 4ZGWA 4OXYA 4RF3A 4RO0A 2D1YA 2POQX 4O1MA 3WFIA 2C0CA 1OZAA 1DLJA 2WDZA 1VL8A 1ZK3A 4I5FA 3RUEA 4QO8A 1LDMA 1U3VA 1DLIA 1E6EA 3QY9A 3TRIA 5IDWA 2J3IA 4J7XA 4DPKA 3H2SA 3TWOA 1P45A 5ITWA 3E1KA 5C7IO 3ICPA 2Q2QA 1ZEMA 4XGIA 4XDYA 1H2BA 1Y8RB 2CNBA 2WJPA 3GNTA 5JAIA 1BDBA 4FBGA 1P1KA 1I2BA 3B70A 5A4DA 1GAEO 1I8TA 4HFNA 4JLWA 4IDDA 1JW9B 1NVMB 5DBGA 3FF4A 3GMDA 3B6ZA 3LF1A 4UVDA 4MVJP 3RUDA 2ZYDA 3L4BA 4R5HA 2P9GA 4BNKA 2VYND 1FDSA 2ET6A 1BGVA 5LDHA 2NV6A 2Z1MA 4H7PA 4CLRA 1EE9A 1G1AA 5JDIA 2PKQP 2DQ4A 1EMDA 4QECA 3SBOA 3IL2A 3Q6IA 3HDHA 3BIOA 3AM5A 3JYPA 4W6ZA 1PJCA 4J7UA 1U28A 2GUGA 3WYBA 4R4JA 3VH2A 2Y1GA 3ONFA 4WEQA 2A35A 2BMAA 3JQ8A 1I30A 3QP9A 3WTBA 1R4NB 4B7CA 1ZSNA 1E7SA 1EZ4A 1JAXA 1HE2A 3MCVA 4FB5A 3A9WA 2VWPA 3I83A 5AXAA 1OOEA 3ZU3A 2IDZA 1GADO 1O95A 5GZ6A 1L7DA 1OI7A 1UUFA 3AFMA 3PHLA 3JYLA 4FC6A 3V5NA 3ZWXA 2GD1O 3RKUA 4EUFA 1XIVA 2YHIB 4E2YA 2FR8A 2VZ8A 3EGOA 1UH5A 4CQMA 2Z5LA 2VTDA 4BNNA 4QO7A 3AJRA 1N9GB 1ID1A 3R3SA 4BO8A 1CRWG 2C20A 1KC1A 5DBFA 3DC2A 4MP3A 3RSHA 1BXKA 2Y93A 3QVWA 3INGA 2JCXA 4S1VA 2Y0EA 2Y0CA 4WK6A 1IHXA 3OIFA 1PSDA 4K9DA 2HMTA 1VJ0A 1NX6A 2Q99A 4Z0HO 5IZCC 4IXWA 4XJSA 5H81A 1J5PA 1NR1A 3GEMA 1B8PA 4BO0A 2CFCA 4RPHA 1G0OA 4M54A 4E31A 4UEOA 3Q9UA 1YBVA 2IXBA 3VOSA 1F12A 2EG9A 4TROA 4YEDA 3ZWMA 2ZYGA 1YKFA 3RKRA 1ZK4A 2CDBA 4DYDA 3ADOA 4Q9NA 2WEKA 3AK4A 3JQDA 3JQ7B 2VHZA 4A73A 3NGLA 4RL6A 3KRTA 3RROA 4FW8A 4KP7A 5I9LA 1UDBA 4EITA 3IKTA 2ZTMA 1SEVA 1RKXA 2OOSA 2EGHA 4WCFC 1H9AA 1T2EA 1YGYA 2DBVO 4NHEA 2FPGA 1E1MA 2PR2A 3ULKA 1Q1NA 1SOWA 2F1KA 3DFZA 4DVJA 1I01A 1M76A 4PG8A 3TFQA 2EHDA 1NHWA 1Q7BA 5C7OO 1XQ1A 3OIDA 1M2WA 2E4AA 3ZNPA 3GT0A 4IINA 3EZLA 2X5KO 3ENKA 2GNAA 5B4UA 3GDGA 3IAHA 1WW8A 2O3JA 3AM4A 3K31A 5AXBA 3E5RA 3ASUA 3RC2A 1LLQA 2AQIA 3S2EA 4XGKA 2YDXA 4LW8A 4E3ZA 1U5AA 1N2SA 1GYRA 4YJGB 2YFHA 3OETA 1OMOA 2AG8A 4XB2A 2ZB3A 4ZHSA 3U4CA 4WGGA 5ER6A 3OJOA 2JCVA 5BSEA 3KEQA 3KLMX 4GVXA 4OOEA 1LSUA 3ANLA 5U4QA 2O3UA 1ARZA 1XKQA 3JQFC 3G49A 5KCZA 2PY6A 4EJMA 1NM5A 1NASA 2B4RO 2WD7B 2VCYA 3VDRA 5JAQA 2HQ1A 1NFRA 5BNFA 3AOGA 1LDYA 4PGFA 2OMEA 5KNLA 4F45A 1OC2A 4XB1A 3WGIA 2WYWA 4K6CA 4HXYA 1I5RA 3PQFA 4RV9A 4CL8A 1GQ2A 2DM6A 5AXCA 3RFVA 3KBOA 2X0JA 1MB4A 5IDQA 4FJ1A 4BNTA 3CKYA 2W4QA 5TX7A 3WB9A 4ZJUA 1CWUA 3QVOA 3ADPA 1J49A 2IYOA 3GG2A 2C7VA 4BB6A 4I5GA 5CDGA 1C3VA 4LN1A 4GPD1 4MVJA 1X1TA 4OOFA 2HMUA 4RVSA 5EL0A 4AJ4A 2NU9A 3JQ9C 4CMJA 4E13A 2X8LA 5CDTA 4O63O 2EERA 1ADBA 3AU8A 5H83A 1HT0A 4GI2A 4NJMA 1PJLA 3TZHA 4BNZA 1I33A 1T2AA 4XD2A 4QTZA 3D5QA 3OJLA 4CR6A 4FFPA 3GZ4A 3ZW8A 1UDCA 4EEXA 3BMOA 2PD4A 1N1EA 4P22A 3TPCA 3KV3O 3NDRA 1BXGB 1T2DA 2FSSA 2Z95A 3LVFO 3QQPA 1YONA 1ENPA 3MEQA 4CLOA 3CMMA 1B26A 3C7DB 4U6QA 2PD6A 5JBIA 2YDYA 3NTQA 2DLDA 1GCUA 4XR9A 1V8BA 3WGGA 3FTPA 4P8RA 1I2ZA 3B20A 2Q45A 3P19A 1H94A 1EK6A 5K6AA 3K30A 3GY0A 3ENNA 4DL9A 3C1TA 1QYVA 5H82A 5A9SB 3CSDA 1VC2A 5IN4A 1FDUA 3CH6A 4YB8A 2G17A 3GZNA 8ADHA 3HJAA 4ND5A 3I4CA 3IKVA 1DIHA 2TMGA 4OAQA 1D3AA 1ORRA 3NTRA 4RPLA 4W7HA 4CV2A 3HN2A 2G5CA 4ZICA 4E33A 3EAGA 1P1RA 3ZV5A 4B4VA 1WWKA 3S2IA 1P31A 3KYDA 1PL6A 1SBYA 4ND1A 1PIWA 1AE1A 2CVQA 5BR7A 1SCUA 3TDKA 3O38A 5GY7A 2PWZA 1R0SA 2H5LA 4XQGA 1GU7A 1B7GO 5T6BA 3GN1A 1B8VA 3PWZA 3V2UA 3HN7A 1LRKA 3BHJA 4J0FA 4QT0A 1RWBA 1EVZA 4YDRA 2NVBA 4PLZA 1E5LA 5EERA 2OGUA 3H9JA 3L6OO 4LSWA 4JBIA 2A92A 1ENYA 5JO0A 4XQ9A 3VPFA 4UAGA 1U7HA 1LNQA 1CYDA 4BNHA 4E2XA 1VL0A 2B35A 3E18A 3WMXA 1MX3A 2BGKA 1JVSA 3L77A 3I9MA 4UREA 4B4WA 3GEDA 2QZ9A 4LCEA 4AJKA 1AN9A 3GGGA 3JTMA 1H0KA 3UCEA 1DPGA 3GF4A 4FSHA 3MOIA 3SXPA 1ONNA 1XEAA 1QR6A 1Y8RA 1T2FA 5KVCA 4L8VA 4IM7A 4A0SA 1UAGA 3UAGA 3PWSA 9LDTA 3BAZA 1DIAA 4PFJA 4WOJA 5BSGA 1ZKMA 2XAAA 4I5EA 1BW9B 3HB4X 4J1NA 4ZQEA 1E3LA 2O3RA 3E82A 3H3FA 2A9FA 3NT2A 2OP1A 1CQJA 4CR8A 2I6TA 4U0JA 2AG5A 4IJKA 4EGFA 3NJ4A 2B36A 1RYEA 2VZ0A 2VRCD 2LDXA 3BMNB 4W82A 3T4EA 1WZIA 1YQXA 4RPKA 4XWYA 1C0KA 1NBOA 2JAHA 1DFGA 2AQHA 4IBOA 5DDIP 1EVIA 5ER9A 4WECA 4IXTA 2O3SA 1BVUA 2FMUA 4Q3DA 5A5FA 5B4TA 1DAPA 1PZHA 2PZMA 3NRCA 3DBHB 4YRBA 2QQ5A 1HYGA 1WMBA 7MDHA 3M6IA 1GPJA 3WGQA 4AJIA 1LQUA 5IJZA 2PH5A 3LU1A 3OICA 4TRMA 4YPOA 3I9JA 4TQGA 1R4NA 3V8BA 4N7RA 3JQEA 4E4YA 3AOEC 1KYQA 4CM9A 3RJ5A 1BHSA 3ON5A 3JD3A 2NU8A 1F8FA 1X7HA 5JPIA 1U8XX 4Z3DA 3WR5A 4RPGA 1W8DA 5DCWA 1I3KA 3H9GA 1I24A 1U1IA 4WCFB 3X2EA 2O23A 4LSMA 4I9HA 2GDZA 1H6DA 3KLPX 4NFSA 4DPMA 2Y1EA 4YA6A 1NFFA 1HF3A 4D0RA 2UVDA 5G4KA 2IE0A 4L76A 4YR9A 3TZCA 2OFPA 5FWNA 4YAJA 1FDWA 5GMOA 4PLGA 3ZGYA 5L40A 1ISJA 2VNSA 2PK3A 1HL3A 4XQEA 4ALIA 1GYQA 4FOSA 2Y05A 3ZCXA 4MVJI 1I36A 4CJXA 4FJ2A 1A9YA 3QRWA 4NFHA 1E3JA 2ZB8A 1PQWA 5EIOA 4O6VA 3OBBA 1ISGA 2X9GA 2RHCA 3Q9NA 5DF1A 3MJEA 4YJHB 1U3TA 4QX6A 3QV1A 2FSVA 4J7CA 3WDSA 5L7TA 1ZO8A 2HJRA 3H9QA 3RVDA 1ADCA 1R0LA 1EE2A 1N8KA 4NBVA 5LDGA 4HBGA 4J0EA 3W4IA 3N74A 2NADA 3OF2A 1L7EA 1U4OA 2D0IA 3MJVA 3PQDA 5JC8A 3S55A 2IZ0A 4D7AA 2R6JA 4MIEA 3IUPA 3RCBA 3QLJA 3RBXA 3VVCA 4RZIA 4IJVA 3QIVA 1HRDA 4OJNA 1GZ3A 2UYYA 1DSSG 1WXDA 3OQ6A 4JJIA 1TT5B 5A1TA 1EEHA 3F6YA 4M86A 2ZQYA 2FP4A 3VH3A 1QYXA 4JCOA 2UUPA 2O2YA 3K96A 4G65A 4G81A 2J8ZA 1HYEA 4FJ0A 1PL8A 4KZPA 4DIBA 2R2GA 4NPCA 4MKXA 2B83A 4ZVVA 4CMCA 1I2CA 4RCVA 5JYEA 2ZK7A 1NQTA 1Q7GA 1YB1A 4EYEA 1C0IA 1LRLA 4RLSA 5CHEA 4RORA 4B3IA 1U8FO 4P4LA 3ZV6A 2BLLA 1EDZA 2B5VA 1PR3A 3JYNA 1WZEA 1PGOA 2V6FA 4WLOA 3ZWPA 1A27A 1DHRA 1IYZA 3F1LA 3L6DA 4MVJF 2HO5A 3U9LA 1Z73A 2AQ8A 4JJFA 3V2GA 4GWGA 2ZIZA 1HWYA 3ZWYA 4H3VA 4P4GA 3H8VA 1MV8A 4Q3CA 1EUZA 2VWGA 1IZ0A 1K2WA 1JKIA 1MFPA 1TA4A 3CE6A 1M6HA 3GRKA 2OP0A 2YQ5A 4KUHA 4QQRA 5JAZA 4RDIA 5EJ2A 2R00A 5COBA 3E03A 4ALMA 2NU6A 4N5MA 3WIDA 2NLOA 1EBUA 1NVTA 4UVIA 5G0SA 4C7KA 3QWHA 3TZQA 3BTVA 1MG5A 4CM5A 4CUZA 3SJUA 4TRRA 1MP0A 2Q2VA 4ZA2A 1HZZA 3WIEA 4E5PA 5MGBA 3MJSA 3UCFA 3GNSA 2PKRA 3DZGA 3IP3A 4FDAA 4CUJA 3WICA 4TRJA 1KEVA 2DTEA 1ZSVA 4EI2A 1JLLA 3PDUA 1E3WB 3OJFA 4Q3NA 4L4SA 3DMTA 1ISHA 2BI7A 1W73A 4IS3A 3OEYA 4XYLA 4OO3A 2CF5A 1W4ZA 4CM7A 3KYCB 3TFOA 4XA8A 5TGDA 2WE8A 5CEEA 5U1PA 3FR8A 1N92A 2H63A 3GOHA 2AE1A 3COSA 4DXHA 1IZ9A 1UDAA 3PRJA 3LF2A 3PWKA 2QX7A 3AUSA 1KC3A 3RFTA 2X0NA 4DA9A 1G6KA 4R41A 3RU9A 4DLLA 4J4HA 1DIBA 1PU2A 3K2EA 3AY7A 3GLQA 4ND3A 2BFMA 3UHAA 4E12A 1BXGA 4XGNA 3H5AA 1A72A 3C7AA 1MC4A 3RFXA 2CVOA 1GQYA 3INTA 4U0KA 3CINA 5I8WA 3VPGA 5L45A 4J9UE 2AEMA 5I7VA 1E3IA 3O4RA 3ZNOA 4WNCA 3ZZNA 4INAA 1BRMA 3IP1A 3IUSA 3PJEA 3FBTA 1YE3A 5CDSA 1DC5A 5LCXA 1X1EA 4CR7A 5CG2A 1E0DA 4IUYA 3GUYA 1R37A 3MZ0A 1HE3A 1YB4A 1R6DA 1YWGO 4HY3A 2LDBA 2O3QA 3JD4A 4R69A 4DPLA 1LTHR 4E30A 1YL6A 5ES3A 4UVGA 2VQ3A 4CV0A 2EJWA 3JQCA 1GPDG 3VZQA 3ZWOA 3H9UA 4LMPA 4RVFA 4P38A 1PGNA 4A2CA 1Z45A 1ONOA 3DXFA 4MKRA 1LA2A 2RCYA 1V3TA 3BHMA 1QXSA 4BO4A 2O7QA 1LDBA 5EQDA 5TIIA 4D3FA 1MXHA 1IY8A 3WBFA 4D3SA 5F1OA 5JMPA 1T1RA 3E6AA 3VH1A 3DWFA 1SB8A 2YHUA 1T4DA 3D64A 1HDGO 2J5KA 1A5ZA 4C7JA 5ICMA 3ITDA 4OSOA 1YOVB 5IF3A 1EFLA 3DOOA 2C5EA 4Y67A 2D2IA 3A4VA 3KB6A 4ZRNA 3SLGA 3BMQB 5ENDA 4J4BA 5A05A 1GZ4A 3DHNA 4QSMA 4XYBA 3GDFA 4R9SA 4CMIB 3HG7A 3NJ8A 4K26A 1H93A 1YO6A 4MVJH 4RF4A 4CQLB 3FR7A 1DHTA 2G0TA 5K9ZA 2I99A 3FPCA 1X15A 1T25A 2ZKLA 2ZYAA 2V6GA 3DBRB 1SB9A 4Y6PA 3TZKA 3JD2A 4CMAA 3PYLA 3SLKA 2I76A 1UP7A 1ENZA 5KJCA 3LC7O 1UXHA 3SC6A 2AEJA 4IQ8A 1FDTA 1JTVA 3HHPA 1D1SA 1V9LA 1UXIA 4KDEA 5BNIA 3CEAA 4PVDA 3KEOA 4PZEA 2UV8A 4F6LA 4EUEA 2Y66A 1H6BA 1MG0A 1BW9A 5F1PA 1DB3A 2QW8A 3I6IA 1NR7A 1DO8A 1Q0QA 4CM1A 4I9UA 1KIFA 1A71A 1K0UA 1SMKA 1PX0A 1VKNA 5T67A 5TRTA 4BS9A 2GCGA 3EYWA 3KTDA 3GR6A 1ZW1A 4GX5A 3BMNA 1HLPA 2QHXA 3UGKA 3CUKA 4R51A 2CDAA 4BGUA 5IZCA 3LLVA 2HLPA 4M8SA 3A28A 1B14A 3K8ZA 3ZHXA 1Z7BA 4BNIA 1HE5A 3GHHA 2PFGA 4G2NA 3T7EA 4B8WA 4CMEC 1IHYA 3DOJA 5L7WA 3BXXA 4A5OA 4AJ2A 2C7GA 4NU5A 2EIHA 2V65A 3DBLB 4RQTA 2X9VA 3HFGA 3DAPA 2BFPA 4Q39A 2NVUA 1XWFA 3AI2A 3G1TA 4HKTA 5CPBA 3L07A 2VYNA 1N1GA 3EK2A 3GPIA 3JSAA 1M67A 5I9MA 1LQTA 3AUTA 5JDIC 1O0SA 3AI3A 4IDEA 1X7DA 2C2XA 3FNGA 1GZ6A 4IMRA 5COQA 5L9AA 2D59A 4XKJA 5L95A 5JMWA 4HFMA 3DTTA 1FJHA 2UUOA 5I9NA 2DPGA 4H16A 4YJFA 3ROKA 3VH4A 3WGYA 4Y6RA 2PH3A 1T2CA 2HDHA 5JE8A 4L75A 4BKOA 4CV1A 1X14A 4JX8A 2YZ7A 1Q0LA 2YY7A 2VOJA 2GN6A 1PTJA 3OECA 1PWXA 4BVAA 3RBZA 3ETEA 3TQHA 5L4SA 3H4VA 1V3VA 2X9NA 1QMGA 3C85A 1S6YA 2AEFA 3PJFA 1LI4A 3ZHZA 1HDCA 4TVBA 3LLSA 3KUXA 5JSFA 3PPIA 1V3UA 1PJ3A 2D3TA 4HNHA 4EJ0A 3C8MA 3DZHA 3JD1A 2D5CA 2ZCUA 4GX1A 3F3SA 4NMHA 3I4FA 1C1XB 2GZ2A 3GFBA 3HQ4O 5KVVA 1UP4A 1EQUA 4JROA 5BQFA 3EVNA 3QVXA 2VUUA 3W8EA 3B1JA 3JQFA 2QRKA 2CZCA 1GFSA 5A9TA 1LUAA 4NJOA 1EUDA 3RUCA 1NFQA 1YVEI 1CEQA 2BGMA 3KM0A 3PHHA 4NK5A 4BOYA 3GVPA 4J91A 3VZPA 4GVLA 4EUHA 1MFZA 1UZLA 1EVYA 1YQGA 3PEFA 3ROPA 3WGTA 1TT5A 5TJ9A 4GMGA 1A7KA 3Q3CA 2H6EA 5DP1A 1E1NA 5TC4A 4BNVA 3PJDA 1O5IA 3WWZA 3WNVA 1HE4A 1HETA 4CM4B 1IL0A 1PEDA 4B79A 1GV0A 4TZKA 4JN6B 2B69A 1KY4A 1R15A 1DJNA 1TI7A 4HNGA 2QZZA 3NDJA 4J6FA 4JBGA 4RLHA 2I65A 3BTOA 5F3RA 1VKOA 3O8QB 3E9QA 1B2LA 1LSSA 2IZZA 3FPLA 3Q11A 3JQ9A 1ZSYA 4OKIA 3DEYX 3ZH2A 5JS6A 2X5JO 3GUCA 2VZ9A 5FEUA 5C3MA 1R4MA 2G76A 4BUCA 3N58A 4YJDA 3KSZO 1XA0A 3D4NA 5A3JA 5ADHA 5TQVA 4FGWA 1V35A 4NH4A 3VVBA 5IAAA 3TJRA 5DN9A 4Y98A 1EBFA 3IOYA 1E92A 1NTOA 3F46A 5AYVA 4LCJA 1CJCA 1X0XA 2E49A 2HSDA 3GVCA 4FS3A 4H15A 4JIGA 4OH1A 4RGBA 3GN2A 5G2OA 1KVSA 1LLUA 2Y68A 3Q2IA 1OBFO 1X7GA 3V1TC 4PLWA 4Z9XA 4BKPA 2QRJA 3D4PA 4E5YA 5TNXA 3S8MA 2DTXA 2PA3A 3JQBA 1GEGA 4OMUA 1HDOA 2B4TO 1LSOA 1P1FA 3PI7A 2O48X 3TF5A 3D3WA 1Y8QB 4K28A 4CLDA 2FN7A 5EN4A 2B37A 2RHRA 3QA9A 4D0SA 5TT1A 3FNFA 5JC1A 5DT9A 4YTEA 1C1DA 2EXXA 3WOHA 1VSUA 4JGBA 3WQSB 3DL2A 2HRBA 1I32A 3D4OA 3P7MA 3JQAA 1SEPA 4LGVA 3V1UA 4AG3A 2ILTA 2W2LA 4DLBA 4Y8VA 1Q0HA 3M1AA 1DDOA 4TMFA 1PR9A 1BWSA 4ONEA 4LK3A 2VT3A 1E7RA 3GG9A 3CXRA 4D46A 4GKVA 4DRYA 4KWHA 5ILOA 3GC6A 3I1JA 4AVYA 3INRA 3WGOA 4PIVA 3RC1A 3TOXA 1QP8A 1TEHA 4DMLA 3IS3A 1DOHA 3VC7A 2GF2A 2NTJA 2CY0A 5HS6A 3DAFA 3S2GA 1G0NA 3KO8A 2FOIA 2W2KB 2GN8A 3MWEB 2NACA 4XYEA 3ICCA 1PGQA 3DHEA 4U5QA 1E5QA 3PP8A 3JYOA 3NX4A 1DRVA 3E9NA 1YDWA 3QE3A 4JQCA 4ROSA 4BV8A 1GL3A 3F5QA 3HADA 3L0DA 4RVUA 2DFVA 3ANMA 2C59A 2B5WA 3U5TA 2PZKA 3X2FA 1UZNA 4DIOA 3ONEA 4XRGA 3WXBA 5JYDA 2Q1WA 5KJEA 4A7PA 4IDAA 1J6UA 3BMCA 4UEKA 4CUKA 2O4CA 3GHYA 2EWMA 1B16A 3H5NA 2PD3A 4PCVA 2Q1TA 2GR9A 3O9ZA 2X0RA 4GQAA 2Y1OA 4MKZA 3DONA 3MOGA 4J9VA 2RH8A 1E6UA 3D7LA 5JLAA 3QVSA 2HU2A 4FIZA 2GO1A 3QWIA 5MDHA 3HDJA 4N5LA 1ZMOA 1DRWA 5KVSA 4MVJE 4EDFA 1P44A 2OHXA 2VYVD 4KOAA 3R3JA 3I52A 1EQ2A 3AFNA 4GX0A 1LJ8A 1DFHA 1F0YA 1PZGA 3GGOA 3UKOA 5CDUA 5L3ZA 5HS4A 4YAKA 3ZWVA 3W4JA 3T4XA 4PG7A 1KVQA 2QIOA 3BA1A 4BGEA 2HKIA 3BMQA 5B4VA 2D4AA 3EY4A 4PLYA 4WJZA 4L0QA 5FI5A 4Y9DA 1E1LA 3AOEA 4OKNA 4FC7A 4CMIA 3KETA 2NUAA 5TLSA 4F6CA 3G79A 3OSUA 4D42A 1QRRA 1AHHA 1UXGA 1H9BA 4II3A 4ZD6A 3FRJA 2OL4A 4PRKA 1VL6A 3NKLA 3QSGA 1KS9A 4W4TA 3MJ4A 5CP8A 3SX2A 3WYCA 4NU6A 2EV9A 1E7QA 1NWHA 4DLAA 3FHLA 4DWVA 3JQ8B 4WE3A 5F5LA 2X4GA 4BNXA 2JCYA 4X54A 3ZN2A 2JD1A 3BZUA 4OYRA 3W8DA 4Z9FA 3BTSA 2BHLA 5JNLA 3DR3A 3AY3A 4HADA 3WLEA 1QSGA 3V2HA 3ZWCA 3ZNQA 4FFLA 4ESOA 4XYGA 3LT0A 1C0PA 3MJTA 2CUKA 4HFJA 4BNJA 1HDYA 4QUKA 1W0CA 5EQFA 1YBMA 2WD8A 5I7FA 3VTFA 2YV3A 4EBFA 1MUUA 1UJMA 2X7HA 4CLHA 4DIFA 4WUVA 1YQDA 3EC7A 3NEPX 3GQVA 2YHIA 3GRPA 4II2A 9LDBA 4IJUA 2V6MA 1I3MA 3W4KA 2CDCA 1YBAA 4TZTA 1XSEA 1AXGA 4JXKA 3OQBA 5EPOA 1QLJA 1N9GA 1AGNA 3LQFA 5L4NA 3L9XA 4LVUA 1LEHA 3PLRA 3U62A 3PFWO 3WMWA 1SZJG 5IDXA 3O03A 1E7YA 1VJ1A 2FPIA 1H6CA 2JJYA 3ANNA 3GEGA 1PZFA 4MINA 4M1QA 1MGOA 4MPDA 1A9ZA 2DKNA 4PLVA 1JA9A 4YVFA 2VTEA 1YJ8A 3NGXA 2VRCA 4J43A 3DB2A 4XX0A 4CM3A 2Q2WA 2I3AA 3L4SO 4KTTE 1U3WA 3CMCO 2ZTLA 3M2PA 2NQ8A 5ILGA 2Y67A 1PZEA 4P4NA 1E6WA 4BB5A 5GZ1A 3VZRA 5KJ6A 4R1UA 1RJWA 4AJHA 2FRDA 2DUUA 4D44A 2AE2A 2YW9A 5CEFA 4Q3BA 2YUTA 3UF0A 3DZIA 1F17A 3CPSA 1GD1O 1VJTA 1LC3A 1KOLA 4E2WA 5KWEA 2X5OA 3HE3A 4O0LA 3F4BA 4BO6A 2X58A 2AW5A 3IQDB 5HA5A 1N7GA 2RBEA 1Y81A 5A04A 3JQ7A 2P4HX 1DC4A 4IPTA 3DZKA 3LSYA 1XLTA 1TVEA 1V0JA 3DMYA 1C1XA 3UXYA 3ZDFA 3E48A 3IMFA 3DFUA 5T64A 5AXDA 2HRZA 3TL3A 1NPYA 4LISA 3PK0A 1WMAA 1PQUA 3S1LA 1JKJA 1DC6A 1EK5A 1Z7EA 2NWQA 3WG9A 1PJQA 3D3EA 3RD5A 1CQIA 2B0JA 5FI3A 1ZNQO 3G0OA 4FPXA 1ZJZA 2GZ1A 4MDHA 4F46A 5L7YA 4YT4A 2DBQA 4GAEA 4PLHA 4UVHA 3V1YA 1NWCA 2EW2A 4YQZA 1BMDA 5C7LO 5TSDA 4L9RA 1P3DA 4MP8A 2IODA 3LYLA 4FFMA 4PZDA 1MLDA 4RF2A 5A06A 1ML3A 4YJGA 3B1KA 2NQTA 1P1IA 4OIMA 3WWYA 3RASA 2PKQO 4XQCA 3AU9A 4RZHA 1ZBQA 1CIVA 1GUYA 1HYHA 3K9QO 4JP3A 3O8QA 1JWAB 3JV7A 5CEJA 1UZMA 4WASA 5CDYA 3GVIA 4FCCA 4BO9A 1LBEA 4ITUA 4CMBA 1EDOA 4E0BA 1IULA 2YV1A 1PJ2A 3D1LA 5B1YA 3LDHA 4J49A 4BQRA 2WD7A 1N5DA 1LXCA 4ALKA 2I3GA 3LK7A 4O5OA 3KOUA 4PLPA 1SPXA 4BHTA 1T1SA 3VTZA 5T8KC 2WYVA 5JCJD 2IZ1A 3CTMA 3EUWA 4BL5A 4PN3A 3A14A 1UP6A 2EW8A 3GH3A 3U0BA 1IE3A 1K5HA 3ITKA 5JDCA 4NQZA 3PZBA 2P68A 1EVJA 3WGHA 3H65A 4DYVA 2I5PO 4HWKA 4Z3KA 4XEHA 1ULSA 1SAYA 2UDPA 1JWBB 1Y9EA 4XYMA 4WLVA 4BNFA 4I9NA 1LSJA 1ZMTA 2ZCVA 1Y8QA 3R0IA 4FQ8A 2RAFA 4NJMB 4KUEA 5EMHA 2VWHA 4W9NC 4U6SA 4Z9YA 1P0FA 1GCOA 2C54A 3FWZA 1ZEJA 3ASVA 3RIHA 3EDMA 4IQ0A 4FFRA 3GAFA 4BNMA 4J16A 3SEFA 4RVDA 1U7TA 2C07A 4CLOB 3UVEA 3I9NA 1O6ZA 3QWAA 4CM6A 3ZNNA 3WGZA 2O4UX 1YXMA 2X23A 3OIGA 1DC3A 4FGSA 5BNTA 6LDHA 2DBZA 2DVMA 2H1SA 3OFSA 3C1OA 3P2OA 3F47A 3PXXA 2JAPA 3FI9A 3TOZA 3ZWNA 2EKQA 3GZNB 2IEBA 3WTCA 4OSPA 2DU8A 1VRWA 5JXWA 3GAZA 3PTZA 2AHRA 4OQYA 4ZQGA 4ZRMA 2HK8A 1K6IA 4GLOA 5A9SA 1RYDA 1RM5A 3IDSA 4GKBA 1E1KA 1FDVA 2VT2A 5TT0A 2P9EA 4YT8A 3ZU2A 3ETGA 2JD0A 3KYDB 2JD2A 2Q4EA 1UR5A 2OZPA 4YWJA 5FFFA 4AJPA 3ZW9A 4ALJA 3A1NA 4XRRA 2VWQA 5J23A 4IIUA 3H9EO 3K5PA 5DCUA 3WBBA 4E5NA 3AI1A 1NVGA 2FZWA 4J90A 3ROMA 1U2DA 3KZVA 5JO9A 4BO5A 1WDMA 1LLCA 1A7AA 4PLFA 4ZQBA 1B15A 1ISMA 5BT9A 4NBUA 3VAZA 2QYSA 4QFDA 1X0VA 3ROQA 4DMMA 1ZXLA 3U4HA 2OUIA 4DC1A 4I8XA 1ZIDA 3NTOA 2DC1A 4KUGA 4NNJA 5FF9A 2GERA 1PWZA 4GLLA 4CLXA 2ZATA 2ZJ0A 2BFAA 5G0WA 4FFNA 2WE7A 2VUSA 5I7SA 8LDHA 1OAAA 2P9CA 5G0TA 2PLAA 4YRAA 4DUPA 4IDGA 1BDMA 2DUWA 2O7SA 3UH1A 4BMSA 1RM0A 4DBZA 1HDZA 1RM3A 1DRUA 3DHYA 1P74A 1SC6A 4WLFA 5ENVA 3R6DA 3WX0A 2OBNA 1KEPA 3LC2O 4CQMD 2EP7A 4IS2A 5JY6A 3U4DA 4IDCA 5FYDA 4CMEA 1PJSA 1QYDA 4HV4A 4YT2A 3FN4A 4ZN6A 4FN4A 5DOZA 1DEHA 3PYXA 5HWSA 2ZTUA 3WSWA 2PGJA 4I5DA 2AMFA 3JQ6A 4UVEA 5THQA 4UUPA 3B1FA 4AJNA 3C24A 2YV2A 4KMSA 4IJWA 5JW6A 5TF4A 1AUPA 4NIMA 2DTDA 2P2SA 2NNLD 2I66A 3H6KA 1IOLA 1NYTA 2IYPA 4KDFA 4ID9A 5U9CA 1VSVA 1JAYA 4BNGA 2AQKA 2QRLA 2BH9A 3OJ0A 4KQWA 5HRUA 3U4IA 3PVZA 2Q4BA 2NU7A 3IC5A 1A4UA 3DBHA 1LLDA 4DC0A 2OO5A 1YRLA 5DULA 1UAYA 1DFIA 3L4BC 2EEZA 4IDBA 3TSCA 3HSKA 2PNFA 3I9OA 3ABIA 4UEJA 3EMKA 5KJ1A 4CV3A 3HB5X 4CMHA 2YFQA 4M55A 2EKLA 4Q3AA 2WMDA 1Y9AA 3T7CA 4WOKA 3WLFA 3CZMA 5I8ZA 4AFNA 1YL7A 3R1IA 4R9RA 4WCFA 1XELA 2Y1FA 1KBZA 2YYYA 3OA2A 1VPDA 4J3FA 4Z0PA 3EHEA 5G4KB 1DXYA 3M2TA 2JHGA 3VDQA 4BNYA 3VPHA 4J1TA 4ILKA 4RVGA 4R1NA 1YB5A 4NK4A 3PIDA 4GSKA 3CIFA 1Y6JA 4NBTA 4RPJA 2CSUA 4A03A 2J5QA 4RJTA 1KY5A 1SNYA 1GTMA 2OBYA 5AOVA 5C37A 3L6EA 2GPTA 4GWKA 1SOVA 1XG5A 2AXQA 4GMFA 4BKQA 1GYPA 1XU7A 3DO5A 3W6ZA 2EJVA 2JKVA 2XXBA 4FD3A 4NI5A 1DIGA 1P9LA 3UW3A 4MVJM 3DOCA 4A10A 3TNLA 1PGJA 1NAIA 3A06A 5F5NA 3HWRA 3PIIA 4YJHA 1ISIA 5C5IA 3MTJA 4IGFA 1IPFA 1T24A 1ADFA 2SCUA 3AM3A 4OXKA 4D79A 4OQZA 2HJSA 1BVRA 3VHRA 1WDKA 3PJGA 3PYMA 3AW9A 4RQUA 4NFYA 3LZ6A 4IQGA 1CDOA 5F21A 1NQAO 2EP5A 1GQQA 2B4QA 2J3JA 2PTGA 4IZIA 3N7UA 4E32A 3FSRA 1P1HA 3TL2A 2JFGA 4CLEA 5JAMA 2E82A 4E21A 3KSUA 3OH8A 4YAIA 4YYZA 2E37A 1P33A 5G0UA 1NQ5A 3OEWA 1BXZA 3E8XA 1HLDA 3JQGB 4N5NA 4L4XA 4YBZA 5BSHA 4TKMA 5G4LA 5AVOA 4U7WA 2O3TA 3HFSA 3RQSA 6ADHA 3STHA 4PLTA 4MVJD 5CFZA 4PZCA 2C5AA 1ZJYA 4BO1A 5L51A 4AL4A 2VHWA 3W1VA 1J4AA 5B12A 3WFJA 4YXFA 2WWRA 5A02A 3RBVA 1KVRA 1R0KA 5G0VA 1GV1A 1K3TA 3HDYA 4L73A 1YL5A 1XHLA 4J2HA 5T5QA 1ZK2A 3JQAD 2W2LD 1TB4A 2NVWA 2Y1CA 2X1HA 4AICA 1I3LA 4JNKA 2RH4A 1O89A 4M89A 3AWDA 1L1FA 2J3KA 4MIYA 2WTBA 4E5MA 4AJJA 2V6BA 4CODB 2XXJA 4EW6A 1UXKA 3H2ZA 2HMWA 1BSVA 3GNQA 1C0LA 1ZXBA 3E9MA 3LT2A 4GX2A 2FR1A 2G82A 2DAPA 2NSDA 1D1TA 1HKUA 1MXFA 4J1SA 3EZYA 3UCXA 2D5AA 4UUMA 2C82A 1P77A 3PGXA 3QJ5A 3D0OA 2RIRA 3FTNA 3OQ1A 2P91A 2IXAA 4R5MA 4YT5A 2Y0DA 2TMDA 4MVJG 2X6TA 1E3EA 2FZEA 3WSVA 1R16A 1Y7TA 1E3WA 3H5RA 3OJEA 4R1SA 4JP2A 4CM8B 1PQPA 3RUAA 1I3NA 2QG4A 4E5KA 4TRNA 3AUAA 3HNPA 4BO7A 4TSKA 5IN5A 1CERA 3Q1LA 1WNTA 3KYCA 4BKUA 3RC9A 4QEDA 4EJ6A 5COAA 4ZQFA 5KKCA 1HSOA 5TS3A 2VHXA 2Q46A 3GPDG 3ZI0A 4B4UA 4D3DA 4Q3EA 3O26A
chains in the Genus database with same CATH superfamily
4G8JA 4NMXB 4R31A 2C88A 1AQ6A 2X5NA 1V2GA 3T1QA 1G3MA 3CG4A 6ABPA 1E2BA 2P5SA 3WGVA 5BRAA 2GK4A 1Z2EA 3H6HA 2IIQA 3THYA 1N6LA 3NPMA 4C4OA 2PNJA 1N7HA 5EIAA 4OI2A 4CKXA 1YV9A 4MGZR 1OZGA 1XV5A 3G1UA 1EE1A 3HBJA 5FOQA 2I2AA 3PTLA 4P5PA 3UPDA 1KIMA 1Y4SA 1T5SA 2KS6A 3E27A 1ZMBA 1JVBA 3EZ9A 4JU9A 4N9QA 3AV3A 5GPBA 3ZY3A 3CO5A 4TWRA 1Y9DA 2ECFA 3HCAA 3N6VA 2WJIA 2WUEA 3QVTA 1Z8FA 3TLCA 3DTVA 5BWBA 2CLCX 4KQGA 3EAFA 1KQOA 3JQBC 3NUZA 2GPNA 5IYZB 2D8AA 3GW8A 2P2ZA 3R9KA 2PSSA 3VKVA 1WBJB 2IY7A 1XKLA 4K9LA 4M76B 4MI1A 3A37A 2W7TA 2PV7A 4UZEA 1F8GA 4R1TA 5EFOA 4B6PA 2O5RA 4F38A 2V98A 2FUNB 1ID8A 1CD5A 2CVZA 2N1MA 2QGFA 2NTYC 4LZAA 3GB9A 4X84A 3VJRA 3GELA 4G5QA 3U7QA 5KTTA 3S68A 2HUNA 3PHJA 3L79A 2UYCA 4GZ3A 5M2QA 4A0GA 3MTBA 4WRRA 1QHIA 3ZDRA 4QXPA 1QH8B 2QU7A 2O6LA 4MYSA 1E5XA 5T3UA 4OI0A 1WKCA 4Q0MA 4W99A 4TMWA 5JD4A 4COKA 4UAUA 3I45A 1N5RA 4PG6A 1N57A 3BHIA 3ZV3A 3ZWBA 5JFOA 4OU4A 5HF5A 1FF9A 1EH5A 1HQDA 2XSZA 4FZJA 4AJIA 4IEIA 5IDYA 2H4FA 3GFRA 1G8PA 2HF8A 4LBWA 5JS2A 4AS3A 3NFYA 4U7GA 1GNVA 1NPDA 4ZOLF 5D3QA 4KXWA 3SZRA 5HILA 5CFLA 2ZJ6A 5J47A 2D13A 4PBTA 4X6XA 3IVXA 3LPCA 2O05A 1XR3A 2FPPA 2QLLA 3EIHA 1XXHB 4Q1AA 1H4TA 2FW8A 3D1JA 3EVFA 4ZXFA 2ZJBA 1S4MA 3LD9A 5K6AC 3GJYA 3UOGA 5JCPA 3IPCA 3ELYA 3U17A 1WVGA 2O5VA 4TWJA 4BGIA 1DCMA 4GYJA 4Z5XA 1YOVA 5JCXA 1P5RA 2OPHA 4A3SA 3KQWA 3ESBA 2ZTVA 3USES 1I0ZA 5FL7A 2M9MA 3KALA 4XSHA 1IB6A 3D0QA 3I2HA 4W5OA 2PZFA 4QHSA 3VR5A 5JFGA 1WSBA 2ZRJA 1RBZA 2A1TS 4JJGA 4NJEB 2C5FA 4PYQA 5LZ4A 1JQBA 3FUUA 1JG7A 3VNVA 1LC0A 1PTKA 4KQIA 1MA0A 4YQYA 4CMKA 4CQLA 8OHMA 1RPJA 3T3NA 4MCAA 3DZBA 3NDIA 4JHXA 2NUTA 3EQ2A 4N54A 2XYVA 1MO2A 5JHHB 2CMFA 2IOYA 4RVHA 5CJ2A 4U1RA 4DDHA 5GIPE 2OD9A 1AK2A 3NCTA 5CXXA 2H11A 1TT7A 1HPLA 3FYUB 3GCZA 1SK9A 4X61A 3LW8A 3ZC3A 4R16A 3ZXSA 1UBCA 1R8JA 1WPQA 3WQQA 5FT9A 4NOLA 3VI4B 5KIAA 4JK3A 5HIMA 3M7IA 1KJZA 1YS6A 2XTNA 4L4UA 4O2AF 7ABPA 1Q7RA 3Q9SA 4QYTA 4HB2A 3WC4A 4DR5B 5FXMA 5AESA 1U8ZA 2UXDB 2PGDA 3OBIA 4HQRA 3KQTA 4R9UC 4BLWA 1UADA 2P62A 2Q3DA 1MTZA 1RWXA 3KZKA 1SQGA 5E8RA 3WK7A 4LVCA 3JD0A 4Z2YA 5DNWA 4HX5A 3SSMA 4C0WA 2EWWA 2QI9F 3O0TA 4P5EA 4A26A 3LPLA 4UOQA 2WI8A 2ONYA 4R0VA 4U2EA 1UPUA 1QH0A 4NBRA 4Y2RA 4B80A 2QMQA 4JAVC 4A27A 3NWOA 3E22B 1PW5A 1XD8A 3HUUA 2QVGA 1QRAA 3O9VA 5CPFA 4KMMA 2VQDA 5LLDA 5LYJB 4JXXA 1G20E 3NHWA 1G6Q1 3NM5A 3OQPA 4L15A 4KZKA 5FTMA 3ZU4A 2NVUB 1IXKA 2E7ZA 2B8WA 4LOAA 1KAOA 1TUIA 2ZAMA 3QVGB 1YJQA 5DEIA 2ZIEA 3K9FC 2PGXA 4Y2XA 3K6JA 2ZREA 6REQB 5FBLB 4D9BA 2VUTA 3KAQA 4KGVA 2J5RA 1IUPA 2EJBA 2CDRA 4GL4A 4DFDA 3UT5A 2VTBA 1Z6PA 4KQXA 1H0RA 1U7UA 2XOXA 3F71A 1I4WA 3QGMA 4UDNA 2GDJA 5F64A 3MTGA 4XZ3A 3T12A 4BN4A 5JNSA 1H8HD 2IYYA 2IRWA 3CF2A 3AEUB 4G67A 3GUHA 3MAJA 3QUTA 4EM6A 4ZVLA 1RRPA 3GA0A 1TFRA 4YP9A 3S8YA 4URFA 1XTJA 1JP7A 1Q77A 3EC2A 3TZCA 4UBNA 1M6EX 4EF6A 3T0GA 3DM5A 4EYSA 1NRXA 4I2VA 1P7CA 2C77A 4KV9A 1WP4A 5EINA 1TMKA 4R3WA 1JN0A 3FDZB 3IOEA 5DHUA 1ZN8A 3AR4A 1POWA 4MB6A 3ECCA 1KEZA 3N2ZB 2PSHA 5JHGB 3K92A 5TQ0A 1US8A 4KDRA 3MJCA 1AURA 3IVAA 3Q85A 1X13A 1ZK0A 4MV8A 1PDVA 2IDJA 1NONA 4R1PA 4MS1B 1OC4A 4R3UC 3H7AA 5IW8A 1U1FA 1QCZA 4ZVUA 4RA9B 1YS4A 3JYHA 3UAZA 3CF4G 1HI9A 4YACA 1DX9A 2YXBA 3IXMA 4U7TB 5DM4A 3TW4A 3WYFA 1ISFA 4B84A 3HGQA 5C8VA 3NTVA 4PG5A 4KLNA 3FVWA 1WHTA 1MQSA 5CG1A 3BEDA 1ULUA 3VV3A 3V4LA 3Q5GA 1IUOA 4AZ3A 3F6BX 5KREA 1XTIA 3CVWA 5CB4B 2XKJE 3ESAA 1UXJA 3EA4A 3FDJA 3K2BA 3QMPA 3GLFB 1GDHA 2JFHA 5HTOA 1GT91 1YDEA 2P4QA 4TQAA 4UEWA 3ND5A 4Y2HA 2ODNA 2ZWVA 4CF5A 3CF0A 1ADGA 1Q22A 1CR1A 3CVJA 4PANA 2VJMB 4BGVA 4NDNE 1R66A 1RZRA 1JKFA 1H6AA 1TRHA 2VQ6A 3K71B 3QLTA 2FHSA 4K1LA 1QQ6A 1A50B 5LP6C 3H17A 3K0KA 3JZFA 1C1HA 1JDJA 2FRXA 2G1UA 1F9AA 3LCRA 3NT4A 4AY4A 3A31A 1FNMA 1J25A 1FUEA 1H2YA 2NP6A 3B7PA 3H8SA 5DRTA 2D0PB 2PRSA 2ORIA 4FR0A 2WU8A 2OWDA 4LK2A 1NQOA 5FTKA 3W7VA 3WL4A 1ZI6A 4CM4A 5DN6A 4PNEA 5IBCA 2JLVA 4B0PA 2X6QA 1O57A 2WV7A 2ECQA 3AL2A 1OXTA 1KZGB 4TT3D 2QK4A 3N0RA 4OXNA 1BAPA 4JFAA 1R4MB 2DQSA 1Z6ZA 3TSAA 3ZWAA 3ZE8A 1KK2A 4WZBE 1YE5A 4GE0A 5DM1A 3RUFA 4AY2A 4RSMA 4DARA 2WVGA 5MN4A 3LL7A 1TKAA 4ZYXA 4R8MA 2VN8A 1YULA 3BH0A 5IU6A 1NNUA 1UF9A 5AJUA 3CONA 3NHJA 2ZJ5A 5FWYA 4DS3A 2J85A 2Z8ZA 5IARA 1JKMA 4W7SA 3FFXA 2X1MA 2AA3A 3ZCUA 4V0QA 5CLQA 1IXRC 3RI3A 2BP7B 2Q41A 4L4RA 3RTBA 5FUMA 2J5BA 5I7EA 2RHLA 3AKCA 4EY6A 1A97A 1UPCA 2BY4A 2GX6A 3AHFA 2E1PA 2FEXA 4BP1A 2HCJB 1G7CA 2O50A 2QW0X 3H1PA 4BLQA 5I7HA 4QWWA 1A1VA 1T36B 1EK0A 2AF3C 4PR0A 2BEWB 2Z08A 4EB3A 1KAEA 4ZDIA 4PC2A 2JPDA 2Q21A 2A5DA 1IPEA 1EK1A 2Z2IA 2HHCA 3CW8X 3DDNA 2ACEA 2JGDA 3IKMB 3KXDA 2MSCB 3I34X 4CIAA 3EPJA 3OQHA 4OK5A 3NW9A 3CVOA 4UTNA 3EUAA 3IP7A 1K9SA 3NEJA 3BD6A 2VHVA 1XKTA 2EZ4A 2WIAA 4WEOA 3KJZA 1PYGA 5IX8A 2AXEA 3JRXA 4FLEA 1SK8A 1Z16A 2AFIE 1SKAA 1P5FA 3P5SA 2PR7A 3HJRA 1O6BA 1RP7A 4B3HA 4LRXA 4H3SA 1ZGHA 3A1SA 4DLPA 4ENQA 3TNYA 4EMTA 2XB2A 5DWDA 4PRLA 3GVXA 2ZW9A 1M1ZA 3R8CA 2VK2A 1NBIA 4AI6A 1BKSB 4YMSA 5GTDA 2VL7A 1Z18A 3F1KA 3HP4A 2W90A 3R7WB 2R1ZA 1HA3A 4LOHA 3WYEA 5ICSA 3CB4A 5LMNB 1KVTA 1MR3F 3RS7A 4Q24A 3BRCA 4OYHA 4C04A 4CI0B 1H5QA 2J6HA 3I9LA 2VG8A 1QKIA 3S99A 4C76A 4M0PA 4G5HA 1Z74A 3ELDA 3NYRA 3RVOA 1ODLA 4EHJA 1X38A 1F14A 2FZ5A 4EY5A 1IDN1 3KHTA 1W19A 1NUPA 4XVHA 2V7PA 3R75A 4WLEA 2B2CA 4ZZ3A 4Q4LA 3TXXA 1LGYA 1NYQA 1GUZA 5FOXA 4AT1A 3LDUA 6NULA 3FUCA 1DC8A 3R41A 4KX3A 3STXA 4Y2TA 2VDLB 3BN3A 1G9XA 3DLCA 2ZSIA 4ASUA 5AFSA 5IZ4A 2VHYA 4IXNA 4WNIA 4UU0A 1MC5A 3RYIB 1DVRA 1RWPA 1Y5RA 2C9OA 3A6DA 3HCFA 4NBWA 2FN9A 5JCJA 2W2KA 5B64A 1JUDA 4CGYA 3ESXA 4CYMA 5FNVB 2RARA 3IALA 1ZVMA 1PT7A 2UVQA 1K75A 3E9EA 3K8QA 3ONWA 1H2RS 2PCLA 3CV3A 3MCWA 3D59A 4EI7A 3RWOA 2LUOA 4HDAA 4EZIA 3GLGA 1NSTA 1KH3A 1B3RA 2IXDA 4HPJB 3S44A 2Q27A 1D4FA 4UUNA 3RT7A 1QV7A 2ZJZA 3EGXB 1JBEA 5KNCA 4XIJA 2XVXA 2BELA 4YRFA 1X6VA 4JI4B 1SPBS 4ZT7A 4FEGA 4KBFA 2H16A 3PNBA 4UCWA 3VSBA 3ZE6A 2QX4A 3E9RA 2BFOA 2AK2A 3KPYA 1Y48E 3RR2A 2NXCA 2OD2A 3CM0A 3HDVA 3QKTA 4GOLD 1U0LA 2Y2UA 3AI7A 5E0KB 1AKUA 2G7ZA 1RI4A 2AFHB 2QQ0A 2XE4A 3NBZC 4PTYA 2YASA 4OXYA 4RO0A 1KOGA 3F7TA 3C48A 4V2IA 4OG2A 3B78A 3WFIA 4F8EA 5HKKD 2WDZA 4OFWA 1N2CA 1XVLA 1ZK3A 1Z5NA 3R4CA 5EHNA 3VV2A 2ZWOA 4G37A 4KW7A 2QY9A 4WADA 4DM4A 5JSZB 4FE7A 3L8FA 3QOFA 3UJ8A 2M2IA 2W71A 3LLUA 4JUBA 1Z2DA 3J7TA 1KJ9A 4JI6B 2DETA 5IDWA 1XYYA 4DPKA 4LY6A 5KYYB 3NWJA 1JI3A 2QE7A 1DZ3A 5ITWA 4ECAA 3IQXA 3QI7A 5E1DA 2HUPA 2Q2QA 2ZVDA 4PX2A 1J8DA 1Y8RB 2CNBA 4PNHA 5E1MA 4I3HA 3VX3A 5JAPA 3EPKA 2WUGA 1P1KA 1ZDMA 3MFYA 3PL1A 5A4DA 3PXEA 1MO5A 1T0JB 1J90A 1SVKA 4IDDA 4CKCA 2PM8A 1ORTA 2XMCA 1S4QA 2YHBA 3JAKB 3OOWA 2PAAA 2XYPA 1UKZA 3JX9A 3RUDA 2VS1A 2P6OA 4CL2A 4UBKA 3L4BA 3N5KA 4NAVA 4B3CA 1IQRA 1I1OA 3OZXA 4RH0A 1Q21A 2FFQA 1W1UA 3DMGA 1NXTA 3VKWA 1GPAA 4BEJA 1I7SB 1WL8A 2XKKA 2Z1MA 4JT2A 4FU0A 1K3FA 4CLRA 3E5HA 2XUOA 1H8EA 3PHBE 4G25A 3FPJA 1PFKA 1DINA 1UT8A 3PHCA 4N4AA 4QECA 1Z6QA 2I80A 1PYOA 2PMWB 4WT7A 2L0XA 2P3QA 4V0NA 2ZEJA 3L5KA 2DPMA 3MA0A 4QAQA 1OQAA 2VJAA 3IL2A 1WUTA 1ETUA 2BPOA 3PRHA 2BEUB 2ZJ7A 4LWPA 5FRDA 4BLPA 1K5PA 2CNKA 4JQOA 2ZKIA 4JSYA 1A5SB 1U28A 2GUGA 2GFQA 4EDHA 4I0WB 4M60A 2Y1GA 3ONFA 2EVWX 3AHHA 3HNRA 2A35A 2BMAA 2QM8A 3JQ8A 4DQKA 4M0MA 4E88A 4V24A 4RVNA 3SJZA 1R4NB 5CVDA 4B7CA 3VU3A 4OB6A 5K6RA 1YF3A 1A8IA 3FOWA 4FB5A 4PS0A 1EGAA 3CR3C 2FE1A 2R48A 5K3CA 3PC6A 4PGHA 1DAKA 1YB6A 1L5WA 2XKAA 3BGDA 3HM2A 1L7DA 2IPAB 1ZHOA 2NO5A 4QD3A 2P27A 3BJRA 3PHLA 4ZAFA 1CNEA 3JYLA 1UKBA 1F2DA 1A2BA 4AXXA 1JEQA 1JIJA 4QYIA 1C7RA 2VFAA 3GRAA 4UJ5A 3AJDA 3KHKA 4C01A 2BFBA 5KYUB 1UH5A 4C0BA 1OFTA 1PK7A 4H9GA 3MRTA 2Z5LA 3SY8A 4QO7A 4LQCA 1ID1A 1LBTA 5DNCA 1X9IA 1Y0BA 2FB9A 1GWNA 1EWYA 2KX7A 2UZ0A 3N70A 2W2TA 4MP3A 1WPRA 3RRZA 4D1YA 3ZY5A 2R6HA 2F1RA 2OCPA 1FX0A 2I7VA 3HA3A 1ADJA 4S1VA 3NBQA 3RSOA 4CT4B 1NXXA 2GJ9A 3PUJA 3D6NB 2C00A 1FFXA 4Q7MB 1EUYA 2WWVD 2QTAA 3OWHA 4WK6A 3U3KA 4BQQA 4NG4A 4RA6B 4RZUA 1KJJA 4ESEA 4XX0B 1IG0A 3HCPA 1EX1A 5LQCA 1XMXA 3CVXA 4BVGA 5EWJA 1FYVA 4G63A 1XHFA 2I22A 3P4XA 2XQKA 1NX6A 5K8LA 1IBCA 2GKGA 1KXZA 3UAVA 1K7YA 1BA2A 2B0CA 1WE2A 1M2KA 1B8PA 3JATB 1SIOA 1RQ2A 2BM1A 5L3SB 1ODSA 1SKQA 1T9KA 3GFPA 1G0OA 3IMGA 4M54A 5DTRA 4MWTA 3VR6A 1Q2UA 2FG5A 4HWSA 5IDVA 5JXHA 4Z3OA 1LD3A 1FVOA 2IXBA 3VOSA 4B46A 2JH3A 3Q3EA 3ZD8A 3TLJA 2ERCA 5AI6A 4KX5A 3WK9A 5CVJA 1ZK4A 1A98A 1R8XA 2CDBA 4Q9NA 4QYSA 1ECGA 2VQFB 1KPHA 3JQ7B 4OBEA 1JALA 1M7BA 1X7WB 4PZ9A 2PA0A 3Q5EA 4L78A 2PX5A 3IQHX 4A73A 3IBSA 2IHTA 3VHXA 3KQKA 1F7VA 1TCAA 1A2QA 3R7NA 1ODCA 1JXMA 3IKTA 3L0SA 3BWXA 1OVMA 3X43A 3HKEA 1JEOA 1VB5A 1NVAA 2R7KA 4RDXA 5KYWA 1C3JA 4ZP1A 1LPSA 4W6QA 1TIBA 4XWGA 5IMBA 3VO1A 2F1KA 1A8HA 2WNHA 2YWRA 2I2FA 1Q0ZA 4YRZA 5GJCA 5ALUA 3P4UA 4PG8A 3NR2A 3QBJA 1Q7BA 1U8AA 4JVOA 3TSWA 5C7OO 3D7KA 1CLEA 3K0SA 3ZNPA 3AUJB 1KY2A 2XIJA 3AERA 4IINA 3U3JA 2AI2A 3TR5A 4TL6A 5CM8B 2X5KO 1FS6A 5B4UA 2Z0MA 1QMPA 1U63A 3IAHA 5C8YA 1PTJC 1DADA 2O3JA 2ZI9A 1MN6A 4LV8B 4LGCA 5K01A 4DCCA 1D2HA 3E5RA 2OBXA 2DUNA 4K6KA 2A4MA 4G0OA 4Z7JA 1L8XA 3K9BA 1JFSA 4B3XA 2F55A 4YJGB 1WIWA 2VZLA 4F2HA 4TYPA 1QRUA 1QB7A 2VAMA 2VLBA 3DNMA 4JJKA 3LWBA 4RULA 3ZWVA 3UGQA 3QF4A 3CCBA 1YRAA 1QIGA 1GUDA 1Z0AA 4WGGA 2B6NA 2FU5C 2JFZA 4TS9A 2PBRA 2M6KA 3KQMA 4YAUA 3OFVA 4GVXA 3ANLA 4DXDA 3GJQA 3LVQE 2ZAIA 1YQEA 3QJYA 2EGUA 3B6IA 3TD6A 3ZZUA 3JQFC 5JS7A 1TU3A 1NU6A 2G1AA 2O1XA 4NZZA 2WIBA 1NASA 2FPLA 3AEZA 4WA8A 2O5CA 2REOA 3B53X 5JAQA 2AOTA 5ALOA 4KO8A 3THXA 3OWOA 4PYIA 1NT4A 1NFRA 1TECE 3DFFA 3GAAA 2GVNA 3MS2A 3C3EA 1DV2A 3WGIA 3SE0A 3STTA 1PWYE 1W5TA 4RX1A 4LS3A 3A36A 1Z6GA 1E1CA 1I5RA 2BKLA 1KP3A 4RV9A 2JK0A 4CL8A 1GQ2A 4HEA1 1LH0A 4UAVA 2HCRA 5AXCA 3UJDA 5ALIA 1AA9A 4FIDA 4LZOA 4WSOA 2XBMA 3CKYA 4Z54A 1VCIA 3LO5A 4D6PA 4RDCA 3ZDQA 2I8LA 2OQ2A 3DL7A 3GG2A 4OUKX 4JC0A 2IZ6A 3FCEA 1V41E 4LN1A 4MVJA 3SPXA 4OOFA 1S9HA 3S2UA 3WG9A 1YFJA 1RKVA 2X8LA 1PEYA 4IIBA 4NH0A 1FB5A 5DIFA 4Z7NB 2LXNA 1VL1A 2EERA 1KNQA 3DLIA 3R6GA 4GXTA 4O63O 3BCUA 4YUZA 1CF9A 4YUAA 3L7AA 2JKZA 2HWWA 1COWD 3NIFB 3WSTA 1TZCA 2EFCB 2YX1A 2CLOB 1L5HB 1JFLA 2J3EA 1I33A 3FPEA 1MEOA 1T2AA 1SZPA 1NSYA 1VIMA 1XX6A 2OC9A 4QU5A 3G8AA 3OJLA 4XD2A 2W2PA 5IYZF 3ZG6A 2TMKA 3HY4A 3UB2A 4L95C 4BQOA 2WQZA 1TUBB 5J4YA 2JASA 2XSZD 3ISJA 2B92A 4FTWA 4JLOA 4DQLA 2IS2A 2Z95A 5I9TA 2FSSA 3W78A 5TMBA 2PKCA 1BYIA 1TLLA 1YONA 1ZR2A 2Q6OA 4S2EA 1Z35A 3MEQA 2JLAA 4L72A 1NTRA 4MTLA 4L7VA 4XGRA 1B26A 5JECA 4PRZA 5JBIA 1Y7HA 3QUBA 2YDYA 3BF8A 3NTQA 2O0JA 3RODA 4YV0A 2WWTA 3FTPA 4FCTA 1RKBA 3ZXYA 3T5DA 3VSAA 1EK6A 1JR6A 3ENNA 3VDNB 1QYVA 4FD2A 4Q9LA 3UG6A 4KQEA 5FL7D 3CH6A 3FDXA 3ER8A 3GZNA 3VU1A 3NHFA 3HJAA 2W22A 5BN1A 3I4CA 1P0PA 5HZGA 3IKVA 1GA1A 1JNXX 4OAQA 2XUFA 3NTRA 3B5JA 5CK5A 1FYWA 5DLDA 1QE5A 1YJAA 2NXWA 1GTVA 3HN2A 3O1LA 4RMJA 5CX1B 3UAYA 1P1RA 4B4VA 4E14A 1WWKA 2RGUA 1X7XA 3CLRC 1FRQA 1FDRA 1I4DD 1N1DA 1PE0A 2OZVA 1E4OA 3KT0A 1QZUA 2VBIA 3N3AC 1II8B 3NATA 4RSHA 2HQOA 3FWPA 1SCUA 3TDKA 2HA0A 4GUAA 1YR9A 4KE6A 1C8VB 2EL9A 3O38A 2PWZA 2PDAA 4QGAA 5IUJC 5DBHX 4D8TA 4XQGA 1M5RA 5HYVA 5KNBA 2IEAA 1LLFA 3B1YA 2HPVA 4YJ2A 4DAEA 4GLFA 4F60A 3PWZA 4NYJQ 3A6EA 2YJ5A 1YB2A 4WTOA 4ER7A 2GXQA 3BHJA 2IYLD 3KCNA 1RWBA 4J0FA 4OQLA 2VKTA 4QT0A 4PX3A 4IDQA 3TMAA 1DDGA 1L8LA 2F62A 1XVTA 3HU3A 3H9JA 3CBGA 1CZUA 4M1MA 3ZD7A 1NUQA 3H1TA 2NXJA 1Y4AE 4FW9A 3UJ3X 4LDAA 4XQ9A 2H29A 3BZBA 3VPFA 4MRPA 2BGGA 3K1YA 4BXOB 4HEHA 2CZQA 1CY4A 3MCAA 5BUZA 2PS1A 3WMXA 2H4HA 1MX3A 4HZIA 1AZLA 1JVSA 3W7BA 1AS2A 4DYHA 4Q6WA 3IPXA 3UH0A 1L7VC 4YRMA 3MGGA 3KKQA 3LPMA 2HB6A 3D2AA 1H0KA 2IYAA 2Y0BA 3OOJA 1JAIA 3GF4A 5LUBA 3MOIA 5CD1A 3B6JA 1W7AA 1XEAA 1Y37A 3LQ2A 2ROQA 4N12A 2VXCA 4UM9D 4KR6A 3EUEA 3QX9A 1J20A 3FAZA 4E09A 3C8UA 9LDTA 1IQUA 2AWNA 3ZHUA 1DIAA 3JR7A 5CVEA 3TCXB 1ZKMA 3J7AC 1Z4OA 1Z13A 5J4KA 2G04A 4GGMX 4MR7A 1E4VA 3OLZA 4LE1A 1XMIA 3H3FA 4U7FA 4BLRA 1UFKA 1CQJA 2Q5JA 1FUIA 1NZFA 4IJKA 5LBIA 3IEXA 5EG5A 3IOMA 1VLJA 2GILA 4X0EA 4G2TA 2LDXA 2RKWA 1C9NA 2ID4A 3HCWA 3TI7A 3HWWA 1XNJA 4O1IA 4W82A 3T4EA 2WJ3A 1WZIA 4MRAA 4RPIA 3GJRA 1O9HA 2RCNA 2V3WA 1C0KA 2V8BA 4H7FA 5KOHB 2GN1A 3G2LA 2PQ2A 4FVTA 1IQ0A 3OEHA 3UYLA 4U3JB 2HC9A 3WO1A 5A5FA 5B4TA 2WW8A 1G19A 2F7SA 2Z8YA 4DG8A 4D9KA 2ZS9A 3ZOKA 3DQQA 3NQ41 3O3OB 2RKBA 3RYFB 4XIFA 3T38A 1HYGA 1WMBA 4J0HA 7MDHA 3OFJA 4EPRA 3D8SA 1PNVA 1YR8A 3O94A 3PPVA 3LKBA 1I6KA 5AJXA 1L8QA 4WAUA 5EY5B 3SX0A 3TLMA 4DEYA 4YUYA 2CJYA 3DDSA 1L5LA 3KEGA 4TQGA 3USZA 2X4LA 3MSXA 5EHZA 2JLXA 2ZRAA 3R5XA 4FQ7A 3HNOA 1TO6A 4RQBA 5FJIA 3RJTA 4UOZA 3MYRA 1G8KA 4M8NE 4CM9A 1AV7A 2BBOA 3EVDA 4NECA 5FBWB 1OX5A 1F8FA 1OJ7A 4QASA 3R3UA 4HOYA 5JPIA 1EI9A 5LOVB 1W8DA 4NFLA 3FHCB 4FM9A 1I3KA 2JVIA 4R2IA 3X2EA 2O23A 1UBEA 4I9HA 2GDZA 4N5HX 5E4JA 3ZS9A 2PUFA 4R6WA 2ZCJA 3AVWA 4EHIA 3DVQX 4K9SA 4DMUB 4NL4H 5BV2P 3FVRA 4YRKA 1BROA 5IT0A 3O8OB 4YA6A 2CLMB 3G7SA 4HF7A 1GQOA 2GM4A 4D0RA 3GLIE 1O96B 4L0CA 4NX2A 1G42A 1T0BA 1CV2A 3T0IA 5L6LB 4YAJA 1FDWA 1RAAA 3R3YA 3H0CA 1JA0A 2FMIA 3ED1A 3G0GA 5GMOA 3ZGYA 5AW6A 2F8TA 2X40A 3C8ZA 3GJ4A 1USIA 1K7XB 2JRLA 4KR0A 2XDQA 1I3CA 4ENWA 2G28A 3SHTA 3Q8XB 1GYQA 1Q1BA 1EM6A 3ZCXA 1YZHA 3UMJA 2C8KA 4W9RA 3GRCA 3DGFC 4FJ2A 4MAAA 2I2CA 4N3CA 4O29A 4CJXA 2H18A 2HW8A 5EIOA 1PQWA 1QCCA 2Y0PA 3EVZA 5F7ZA 4P4SB 4BWVA 3C6QA 5CB4F 5DF1A 4F2GA 4YMGA 2ZR9A 1I2AA 4L27A 2KWIA 5DN6D 1EJ6A 2R0QC 4JUDX 2CLDX 2ZYIA 1S1MA 3I04M 1PR0A 2EBUA 3GQBB 3H9QA 1M10A 4RZXA 4X7RA 1KE1A 3RVDA 2FFBA 3F67A 4BJ6A 1V16B 4IDNA 4MH0R 3A6FA 4A9AA 1C2TA 3PUZA 2C3MA 1A04A 2QGZA 1KGSA 2D0IA 3MJVA 3VPCA 4X44A 1RCUA 5JC8A 3T9DA 4P0PB 3TK1A 3VVCA 3RBXA 1IPHA 1XDGA 3ILXA 2XCLA 4FYXA 3GRVA 4RY2A 1JHDA 3OQ6A 4CIDA 2C2KA 1UBTS 4M7OA 4L3WA 3ZQ6A 1TT5B 5EMJA 1SJ9A 1XP5A 2YJ6A 3V1MA 4BJ1A 1EEHA 4M86A 5F33A 5JZMA 4QXQA 1QYXA 3W90A 2UUPA 3K96A 4CG2A 2BCJQ 4PWZA 5DWQA 2Q4OA 1G7TA 3F6SA 3RK0A 4I1SA 1PL8A 3VJMA 4INOA 4ZOEA 3DDCA 4U02A 3P2JA 3FCAA 1V8OA 3H0KA 2CK3A 2YMPA 4OK3A 5LQRA 3NZEA 4QXOA 1QGED 1BJKA 3LMKA 2WABA 3BRWD 4IGAA 5JYEA 4DR4B 3VSCA 4TVSA 3VC1A 1Y3AA 3DD5A 1DEAA 1YB1A 2FRDC 3HCBA 3M3PA 2J30A 4MLZA 4EYEA 4P08A 1X2BA 2G63A 4AUKA 3SG0A 3K4HA 3DLHA 3LZDA 4RLSA 4NU8X 4RORA 1X2EA 1ULZA 1RRCA 3A3NA 1WZEA 4Q4JB 2OENG 2V6FA 1T3SA 2WAMA 3EIUA 3VR2A 1GSOA 1A27A 4GOOD 3L6DA 1XD9A 5T4BA 2WINI 3O95A 2HO5A 4OY3A 3MB8A 1Z73A 3AT1A 4K81B 3IEMA 2JFQA 4O4HA 1XLTC 2XUZA 2YZNA 4GWGA 4PIPA 2ZIZA 3KQUA 2J9GA 1GQSA 2PH7A 3HCEA 2ZT8A 1EDBA 4Q3CA 1CHNA 1IZ0A 1NUHA 1JKIA 3GRKA 4DDMA 5E1BA 1Z5ZA 2HT6A 2OP0A 3LUDA 4QQRA 1LPNA 4V0MA 4K6MA 5ITSA 2BGWA 4CIBA 4NBSA 2AUNA 1KDRA 5P21A 1V1JA 2ODPA 3LQQA 4ALMA 5JEDA 2NU6A 2BM0A 3MHPA 3UB3A 4C3ZA 3RYHA 4WBNB 1G8SA 4Y6GB 5BQXA 4CN9A 1NVTA 2R6R1 4JT9A 5CFOA 3FVVA 1C2YA 3P9PA 1WV1A 2OGSA 2PZEA 3SHWA 3TZQA 1MG5A 2PU5A 5EZYB 5FOVA 1THZA 1ZW6A 2OV1A 3SJUA 2P1DA 1G3QA 3QBTA 3HCOA 1T43A 1HZZA 1ORIA 3LUAA 2CXPA 2VUHB 3MJSA 1Z83A 2XRFA 5F78A 4YN3A 3RV3A 5E6RA 3AUKA 2WOJA 1Z0FA 4DC9A 4Y1RA 2OLKA 1RYFA 4O33A 5BV1A 2DTEA 3PGVA 4AMGA 3PDUA 3PU6A 3OJFA 1ZGAA 3DMTA 3QE4A 1EFVB 3CUTA 5KYXA 4IS3A 4E15A 1YNOA 2IGBA 2CF5A 4CM7A 5G40A 4XA8A 4CEHB 3GRRA 1N2OA 3IXLA 1SA0A 1TPZA 4PC1A 1K66A 4RVCA 2YS6A 4QHTA 2WTMA 5BPFA 4K5QA 1JJ7A 1N2HA 3HB9A 1IZ9A 1JLSA 4ZALA 5FNVF 4DXHA 1RBQA 3PRJA 3W5BA 1DKQA 4BX8A 4OD0A 4KR3A 3AUSA 1KC3A 4KLZA 3RFTA 4URVR 5AT1A 3MTIA 1W5BA 3DV0B 3V4SA 1NVWQ 2XTAA 3AY7A 3CZ4A 2P0AA 3GLQA 4ND3A 3UT6A 1ZP6A 5BOVA 1NW6A 2IW1A 2YCLA 1YK0A 1SVIA 3LRTA 4HPWA 1DCKA 2OV6A 1R9GA 2ANCA 4HAZA 5M7EA 3RFXA 1MC4A 2C9MA 2RH9B 5E7IA 4EHDA 3DTVB 2CVOA 4TUYA 4R1OA 2X15A 3IX7A 2EQ5A 1NW8A 3JPWA 3VPGA 4I4CA 4Z7OB 5L45A 3WMGA 5I4CA 3W2TA 1SD5A 3U1VA 3ZNOA 4ZDJA 2DSNA 1Z29A 3DAHA 3IHWA 5TQ2A 3BSYA 3VDXA 4INAA 3W4IA 5CBKA 3AKEA 1KMHA 1ZUNA 3IP1A 4DNOA 1A9SA 1P9NA 4KNYA 4ENSA 3OZBA 2KE5A 2RI6A 5CDSA 3ZCTA 5JMOA 2JW5A 4CR7A 1X1EA 2XYQA 2ZWPA 3FHJA 3U7QB 1AC5A 3TLBA 3PC3A 4BLSA 5HW0A 3HZHA 3GUYA 3M9WA 3NHBA 3MZ0A 3TSZA 4O4LA 2V7GA 1TJPB 4NZYA 1UINA 3O75A 1U3FA 2O3QA 4FQ5A 2GVZC 1NXPA 1ACLA 5F77A 4PTLA 3FUWA 1USKA 5IAEA 3TGWA 5EIFA 2VPTA 3ANTA 2EJWA 3JQCA 4Q7JB 3TPZA 3R5JA 4XFKA 1I1HA 3H9UA 2P9JA 5K0FA 1JEJA 2PUTA 3OSZA 1D6SA 1ONOA 3B6EA 5FPSA 1FBTA 4L9WA 4U2BA 2Q28A 2XUGA 3V1NA 4OB8A 1GKLA 1QXSA 4NYMQ 5KU1A 1VL2A 2RB5A 2BAGA 5EQDA 2FPPB 4D3FA 4RFVA 5BVGA 1IY8A 2X8AA 3HV2A 5HIKA 4RV5A 1R0CA 1T1RA 1U9IC 3E6AA 2BFNA 3F8TA 3EXIB 1RYYA 1QHNA 2L17A 3CPEA 3E53A 1GT6A 1WF3A 2C4UA 3E2MA 1YOVB 1AKTA 2RMKA 2ZAYA 5JSQA 3TTSA 4ACAA 4B3GA 2QTVA 2XZLA 2BM9A 3M6UA 1X8LA 4GOMD 3WLAA 2RDMA 5AVRA 3ROGA 3HCRA 2AVDA 4OLHA 4ZCPA 4X3CA 3WP0A 2DUMA 3GDFA 3IKJA 3NLLA 3HG7A 5I3ZA 1K08A 4KXXA 1C0EA 1H93A 1BGXT 1V1MA 3P5BA 4MAMA 5K51A 3UJBA 3KVRA 4RF4A 1XRPA 3V8RA 4CQLB 4ZCQA 3FR7A 3NUQA 1KSHA 3X1ZA 5KNDH 1X15A 1T9BA 5BWLA 3W2IA 2VF7A 3ZWKA 2V3VA 1UL1X 2GZDA 1EXWA 2NUTB 2RH5A 3LYUA 4S35A 3TZKA 5K3AA 2PIDA 2I76A 3UAOA 2V4UA 3ZCRA 4E7PA 3UANA 2JI4A 1CYEA 3DFKA 2AEJA 1U2DC 1FDTA 3HHPA 4IQ8A 4MQFA 1D1SA 3DHVA 4YMTA 2QVZX 2XH8A 3L0YA 4AO6A 4LTNA 3ZUGA 4QWMA 3R3VA 4EFKA 3MFQA 3ZZ1A 1UPFA 2D0OB 3EAQA 1G5QA 2UV8A 4QTXA 2CXSA 2V54A 2Q2NA 3OPMA 2Y66A 4BB0A 3E58A 1BW9A 1UC5B 5BYBA 1LBIA 1Q0UA 2G88A 5GJVC 1Q20A 2GPAA 2NGRA 2VP4A 4QG7A 1ST2A 4KJXA 4CM1A 2O0HA 3D02A 4LTMA 1SMKA 3UA3A 3EZFA 3M0EA 5CCEA 1E6CA 2A67A 4MUIA 5TRTA 3GLGE 4RABA 4PZLA 3EYWA 5FUWA 3GR6A 4KJZA 2BVNA 1OWLA 2CVHA 5DH9A 1HLPA 3JR3A 3HLKA 5LXTA 3KE9A 3OE1A 3HEAA 3EIXA 3FX2A 4R51A 2WSLA 2ZBPA 3L7CA 3ANXA 2J45A 4UBOA 4DTCA 1CVLA 4M8SA 4TLDA 4UU8A 1B14A 1W8IA 3VR6D 3U39A 2R68A 4DOMA 1JEYA 4LNHA 3UJCA 1UOQA 3K8ZA 3ZHXA 1Z7BA 3OZAA 4BNIA 1HE5A 2GJKA 2AN9A 4UM9B 1YZYA 4GXRA 4CMEC 4LYAA 1MNQA 1TD1A 4C0XA 2P9BA 3WWOA 2FEWB 5LJLA 1Y8CA 5H70A 4FHGA 3CXUA 2P35A 4GRIA 4KPFC 1QO0D 3MGCA 5F4BA 1VL5A 1N2CE 5IP5A 4AMZA 5KO2A 3AI2A 5JEEA 3CF6R 1N1GA 3GPIA 2JGAA 3BM5A 3IILA 3KXKA 3PNMA 3CJTA 5TE9A 5I9MA 1LQTA 3VJKA 1JIKA 3CRZA 2V97A 3A26A 3F2VA 4HAYA 3UT5B 3AEYA 1Y1TA 3FNGA 3IESA 4IMRA 4A1FA 1A77A 2EP8A 4BRSA 4IJMA 2WMYA 3GARA 4NEQA 2ZITA 4XKJA 1W47A 1X8KA 5DW3A 5JALA 2B1QA 5JMWA 5L95A 4L9AA 1KWGA 2A9VA 2IF2A 1OKKD 2OCDA 2UUOA 3DTTA 2Z6UA 3OU7A 3ODGA 1XQXA 3BJEA 4D8XA 1SURA 2CT8A 5IKMA 2PH3A 5B1SA 4ESHA 4ERXA 4QPNA 1J8VA 4EIWA 2PWBA 2VDWA 5JE8A 4CV1A 1RWKA 2YZ7A 1OVGA 1KI7A 2YH2A 4KACA 1L9KA 2VOJA 2VF2A 5HMLA 2BZ1A 4Q6BA 2FWBA 2OPBA 4PQFA 5L4SA 1R88A 4RK6A 4UM7A 2R8ZA 1Z5WA 2X9NA 1XLWA 5EP3A 5TQ0B 1US8B 3EPLA 4JWKA 3TIGA 3TBKA 1ECFA 2YWJA 4KKVA 3QHPA 3KUXA 2ZSUA 1B6TA 1V25A 1PLLA 5JSFA 3LG2A 1WKVA 3URKA 3MMNA 1Z47A 1M1NA 3JD1A 1TRKA 3AJEA 1GNRA 4NMHA 2Q07A 1QPGA 5CYOA 5KVVA 4ZYLA 5HKOA 1EQUA 1WHTB 3D7MA 3H1GA 3IAEA 4GD3Q 4JROA 3SHFA 3EVNA 5AOAA 4Z4HA 3CJRA 1PEKE 1DZIA 1HEYA 3B1JA 1HTTA 2ZGVA 3H1EA 4FNOA 4CW7A 2H08A 3Q6NA 5CCDA 1QGOA 2YN2A 3BJIC 1YHNA 3T1HB 3LP5A 3R7DA 1FNSA 3GWGA 1CEQA 1T1JA 2JZOA 4GEGA 4NYIQ 4YIKA 5BOSB 5C7YA 1E1RA 4BOYA 1OU4A 5AO9A 2OR3A 4ENPA 1AQJA 3T9BA 1FP7A 1NVFA 1YQGA 3O4HA 5EJ5A 3S27A 1KQFA 4UUAA 4X1KA 5AI4A 2WF5A 2JH8A 5E2AA 2H6EA 2QTFA 1I4TD 5A3QA 5DP1A 2P7IA 3AC0A 1X9HA 2V74B 4BNVA 3PJDA 1O5IA 1ZNYA 3D6HA 3EMVA 3GLKA 1M72A 3AR5A 1MAWA 3OOSA 3C6ZA 5HZKA 4OA8A 3WBKA 4CM4B 5M04A 3TVTA 3O21A 2XW6A 4QE3A 2B69A 3RVRA 4RTLA 3NAGA 3A9UA 3NDJA 4LZPA 4RLHA 4C30A 2RAVA 1V26A 1Z0IA 3FJ1A 4PZUA 1E62A 2ZBQA 2XWJI 3QYPA 3TNJA 3FPLA 3Q11A 4BO8A 3IMEA 2ZJ3A