4IA8A

Crystal structure of a y37a mutant of the restriction-modification controller protein c.esp1396i
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
77
structure length
77
Chain Sequence
SFLLSKVSFVIKKIRLEKGMTQEDLAYKSNLDRTAISGIERNSRNLTIKSLELIMKGLEVSDVVFFEMLIKEILKHD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Mutagenic Analysis of the RM Controller Protein C.Esp1396I.
pubmed doi rcsb
source organism Enterobacter sp.
molecule tags Transcription
molecule keywords Regulatory protein
total genus 32
structure length 77
sequence length 77
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 4ia8A00
2PUBA 1ZZ7A 2LYRA 2H8RA 2IVQA 3FYMA 2XJ3A 4JCYA 1JWLA 2KEKA 4NDWA 2AUWA 1R63A 1LCDA 1JFTA 2AXVA 2BNNA 1NERA 2MQKA 4YG4A 4J1WA 2OFYA 3KJXA 1L1MA 4X4HA 1JFSA 1PERL 1RPEL 1PRVA 3ZHMA 1DWKA 4YG7B 5A7LA 2WIUB 4FN3A 2R63A 3KXAA 1LMB3 4PU3C 1ZZ9A 3OQNA 4JQDA 1BDIA 1ZAYA 1XWRA 2KPJA 1O4XA 1POUA 4GQMA 1X57A 1EFAA 1ZZ8A 3S8QA 3GN5B 2R1JL 2O4AA 2FJRA 2EF8A 2LYJA 4X4EA 1X2LA 2LYLA 1CQTA 2AWIA 4F8DA 4X4FA 1YSEA 1R69A 3F6WA 4YBAA 3OQMA 2OR1L 4J1XA 2AXZA 2BNMA 4Z5DA 4Z5CA 3JXDL 2PUDA 1QQAA 3O9XA 1B0NA 1ZZBA 3HZIB 1RIOA 1QPZA 1UTXA 3EUSA 3QF3A 3SCGA 5K98B 1OCTC 3IVPA 4Y42A 2B5AA 4X4CA 4OB4A 3QWGA 1BDHA 1IC8A 3CLCA 2AW6A 2HSGA 1GT0C 2WUSR 3JXBC 2L49A 1VPWA 3F52A 2O49A 2PUEA 1LLIA 4O8BA 2IU7A 3FYAA 3OMTA 4X4GA 3BD1A 4GHJA 1UXCA 3G5GA 1SQ8A 3GBFA 2BJCA 2O38A 1UXDA 4Z59A 4MCXA 1E3OC 3DNVB 1QP0A 2ICPA 1ZZ6A 3JXCL 2GZUA 4YG1A 2PUCA 2LYSA 3ZKCA 3RZZA 2XI8A 3SCHA 3BDNA 2PE5A 1QP7A 2XIUA 2GRLA 2CROA 1QQBA 1ZPQA 2EWTA 3G7DA 4I6TA 2XCJA 3D1NI 2PPXA 2IVBA 3LFPA 1ZUGA 3L1PA 3UFDA 4IA8A 3GN5A 3CECA 3LISA 3SCFA 3ZHIA 2PIJA 1JH9A 4IWRA 2MEZA 2IUOA 1WETA 1LCCA 2LYKA 1ZVVA 3CROL 2D5VA 3F51A 2LYPA 4YARA 4X4IA 4I6RA 1ADRA 3MLFA 1RZSA 4PU8A 3QYXA 1RZRD 2ICTA 3KZ3A 2KZ8A 4IVZA 3VK0A 2LCVA 4PU4C 4PU7A 4MCTA 2IVGA 3FMYA 1QP4A 4I8TA 1S7EA 1LQCA 1OSLA 2PUGA 2HINA 4X4DA 3U3WA 3B7HA 1Y7YA 2GRMA 2IV1A 3OQOA 1ZS4A 1HF0A 1PNRA 2LYQA 2KEJA 4Z58A 2BNOA 3QQ6A 2L8NA 3BS3A 2EBYA 1Y9QA 1DW9A 3H5TA 2AXUA 1CJGA 4JCXA 4X4BA 1PRAA 1WH8A 1ZZCA 3OP9A 4FBIA 2PUAA 2A6CA 3TRBA 2XSDC 2PUFA 2CSFA 2JCGA 3R1FA 2JVLA 1RZRA 1AU7A 1WIZA 1PRUA 1WH6A 4I6UA 2KEIA 4Z5HA 1NEQA 3PXPA
chains in the Genus database with same CATH superfamily
4Q2JA 4JCYA 2AUWA 1R63A 2AXVA 4YG4A 3KJXA 4X4HA 1PERL 1RPEL 3GZDA 5DTQA 1ZAYA 1HQ1A 1O4XA 3S8QA 1R69A 3F6WA 2BNMA 5JUWA 2PXPA 2PUDA 3GZCA 1RIOA 3GUUA 3ZPXA 1IC8A 3NZLA 2AW6A 2L49A 3F52A 4O8BA 3QFIA 3OMTA 1UXCA 3GBFA 1QZXA 4Z59A 1ZZ6A 2GZUA 3ZKCA 5DTRA 2XI8A 1QQBA 3VWSA 2IVBA 3LFPA 3UFDA 4IA8A 2HFZA 2HCSA 3ZHIA 1ZVVA 2LYPA 4X4IA 4IVZA 2IVGA 2LLWA 4ER5A 3MEJA 3H5TA 1CJGA 3A9ZA 1WH8A 2JVLA 5GAGi 2LYRA 2H8RA 2J7WA 4NDWA 3ZHMA 4ER0A 2WIUB 3TFLA 2JQEA 4JQDA 1BDIA 2KPJA 1EFAA 5GAHi 2LYJA 1QB2A 2AWIA 4F8DA 1CQTA 3OQMA 4YBAA 4Z5CA 1QQAA 3O9XA 1NW3A 3SCGA 4DE9A 2B5AA 4X4CA 3QWGA 4EK9A 3DM5A 1LLIA 4EQZA 2IU7A 3FYAA 3A9XA 1SQ8A 2LLVA 2O38A 1UXDA 4HRAA 1QP0A 3SX0A 2PXKA 3RZZA 3BDNA 2PE5A 2XIUA 2GRLA 2CROA 1ZPQA 3D1NI 2PPXA 3M9LA 2PIJA 1JH9A 2D5VA 3NXHA 4ER7A 3VK0A 4MCTA 2L1PA 2FFHA 2PUGA 1LQCA 4X4DA 1MFQC 2J7UA 3B7HA 1Y7YA 2GRMA 2EBYA 2PXEA 1U2ZA 4JCXA 3OP9A 1ZZCA 3TEPA 2PXTA 2JCGA 1AU7A 1WH6A 5DRYA 4Z5HA 2PXDA 3PXPA 2PUBA 3FYMA 2KEKA 3OWQA 1JFTA 2BNNA 1L1MA 4J1WA 2OFYA 1JFSA 1PRVA 2PXFA 3KXAA 1LMB3 4PU3C 2PXVA 1XWRA 4GQMA 3A9YA 4X4FA 1YSEA 4J1XA 2AXZA 1QPZA 2XXAA 1UTXA 3QF3A 4EZIA 3IVPA 4Y42A 5DSXA 3KL4A 3CLCA 2HSGA 2WUSR 3JXBC 5DRTA 1VPWA 2PUEA 3SR4A 4X4GA 3BD1A 2XXQA 4WVLA 4MCXA 1E3OC 3DNVB 2ICPA 4YG1A 2LYSA 3GZDC 3SCHA 1QP7A 4I6TA 2LNMA 3L1PA 3LISA 3SCFA 3UWPA 4IWRA 1LCCA 2LYKA 3CROL 4I6RA 5DTMA 3QYXA 1ADRA 1RZRD 2ICTA 3KZ3A 2KZ8A 3NDBB 4PU7A 3G0TA 3FMYA 4I8TA 1S7EA 1OSLA 2HINA 3OQOA 2LYQA 3QOWA 4Z58A 2BNOA 3QQ6A 3BS3A 2ODRD 1Y9QA 1DW9A 2YBDA 4X4BA 2PUAA 3OKZA 2A6CA 2XSDC 2CSFA 3QOXA 1PRUA 4I6UA 1ZZ7A 2IVQA 2XJ3A 1JWLA 4EKGA 1LCDA 1NERA 2MQKA 5DT2A 4DE8A 1DWKA 2HCNA 4YG7B 5A7LA 4FN3A 2R63A 1ZZ9A 3OQNA 3NROA 4ER6A 3LQXA 1POUA 1X57A 1ZZ8A 3GN5B 2R1JL 2O4AA 2FJRA 2EF8A 4X4EA 2PXQA 2V3CC 1X2LA 2LYLA 2OR1L 4Z5DA 3JXDL 2VEOA 1B0NA 1ZZBA 3HZIB 2PXBA 3PE5A 2M4HA 3EUSA 5K98B 1OCTC 2XXPA 4OB4A 1BDHA 1GT0C 2O49A 4GHJA 4ER3A 3G5GA 2BJCA 1DULA 3JXCL 2PUCA 2MXDA 2EWTA 3G7DA 2XCJA 3TELA 1ZUGA 3GN5A 3CECA 2MEZA 2IUOA 1WETA 3ME5A 3F51A 4YARA 3MLFA 1RZSA 4PU8A 2LCVA 2PXUA 4PU4C 1QP4A 3U3WA 1HF0A 2IV1A 1ZS4A 1PNRA 2KEJA 2L8NA 2AXUA 1PRAA 4FBIA 3TRBA 2PUFA 3R1FA 1RZRA 1WIZA 2KEIA 4EKIA 1NEQA 3R09A 2PXLA 4OBMA
chains in the Genus database with same CATH topology
2PUBA 1ZZ7A 2LYRA 2H8RA 2IVQA 3FYMA 2XJ3A 4JCYA 1JWLA 2KEKA 4NDWA 2AUWA 1R63A 1LCDA 1JFTA 2AXVA 2BNNA 1NERA 2MQKA 4YG4A 4J1WA 2OFYA 3KJXA 1L1MA 4X4HA 1JFSA 1PERL 1RPEL 1PRVA 3ZHMA 1DWKA 4YG7B 5A7LA 2WIUB 4FN3A 2R63A 3KXAA 1LMB3 4PU3C 1ZZ9A 3OQNA 4JQDA 1BDIA 1ZAYA 1XWRA 2KPJA 1O4XA 1POUA 4GQMA 1X57A 1EFAA 1ZZ8A 3S8QA 3GN5B 2R1JL 2O4AA 2FJRA 2EF8A 2LYJA 4X4EA 1X2LA 2LYLA 1CQTA 2AWIA 4F8DA 4X4FA 1YSEA 1R69A 3F6WA 4YBAA 3OQMA 2OR1L 4J1XA 2AXZA 2BNMA 4Z5DA 4Z5CA 3JXDL 2PUDA 1QQAA 3O9XA 1B0NA 1ZZBA 3HZIB 1RIOA 1QPZA 1UTXA 3EUSA 3QF3A 3SCGA 5K98B 1OCTC 3IVPA 4Y42A 2B5AA 4X4CA 4OB4A 3QWGA 1BDHA 1IC8A 3CLCA 2AW6A 2HSGA 1GT0C 2WUSR 3JXBC 2L49A 1VPWA 3F52A 2O49A 2PUEA 1LLIA 4O8BA 2IU7A 3FYAA 3OMTA 4X4GA 3BD1A 4GHJA 1UXCA 3G5GA 1SQ8A 3GBFA 2BJCA 2O38A 1UXDA 4Z59A 4MCXA 1E3OC 3DNVB 1QP0A 2ICPA 1ZZ6A 3JXCL 2GZUA 4YG1A 2PUCA 2LYSA 3ZKCA 3RZZA 2XI8A 3SCHA 3BDNA 2PE5A 1QP7A 2XIUA 2GRLA 2CROA 1QQBA 1ZPQA 2EWTA 3G7DA 4I6TA 2XCJA 3D1NI 2PPXA 2IVBA 3LFPA 1ZUGA 3L1PA 3UFDA 4IA8A 3GN5A 3CECA 3LISA 3SCFA 3ZHIA 2PIJA 1JH9A 4IWRA 2MEZA 2IUOA 1WETA 1LCCA 2LYKA 1ZVVA 3CROL 2D5VA 3F51A 2LYPA 4YARA 4X4IA 4I6RA 1ADRA 3MLFA 1RZSA 4PU8A 3QYXA 1RZRD 2ICTA 3KZ3A 2KZ8A 4IVZA 3VK0A 2LCVA 4PU4C 4PU7A 4MCTA 2IVGA 3FMYA 1QP4A 4I8TA 1S7EA 1LQCA 1OSLA 2PUGA 2HINA 4X4DA 3U3WA 3B7HA 1Y7YA 2GRMA 2IV1A 3OQOA 1ZS4A 1HF0A 1PNRA 2LYQA 2KEJA 4Z58A 2BNOA 3QQ6A 2L8NA 3BS3A 2EBYA 1Y9QA 1DW9A 3H5TA 2AXUA 1CJGA 4JCXA 4X4BA 1PRAA 1WH8A 1ZZCA 3OP9A 4FBIA 2PUAA 2A6CA 3TRBA 2XSDC 2PUFA 2CSFA 2JCGA 3R1FA 2JVLA 1RZRA 1AU7A 1WIZA 1PRUA 1WH6A 4I6UA 2KEIA 4Z5HA 1NEQA 3PXPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PUB A;  1ZZ7 A;  2LYR A;  2H8R A;  2IVQ A;  3FYM A;  2XJ3 A;  4JCY A;  1JWL A;  2KEK A;  4NDW A;  2AUW A;  1R63 A;  1LCD A;  1JFT A;  2AXV A;  2BNN A;  1NER A;  2MQK A;  4YG4 A;  4J1W A;  2OFY A;  3KJX A;  1L1M A;  4X4H A;  1JFS A;  1PER L;  1RPE L;  1PRV A;  3ZHM A;  1DWK A;  4YG7 B;  5A7L A;  2WIU B;  4FN3 A;  2R63 A;  3KXA A;  1LMB 3;  4PU3 C;  1ZZ9 A;  3OQN A;  4JQD A;  1BDI A;  1ZAY A;  1XWR A;  2KPJ A;  1O4X A;  1POU A;  4GQM A;  1X57 A;  1EFA A;  1ZZ8 A;  3S8Q A;  3GN5 B;  2R1J L;  2O4A A;  2FJR A;  2EF8 A;  2LYJ A;  4X4E A;  1X2L A;  2LYL A;  1CQT A;  2AWI A;  4F8D A;  4X4F A;  1YSE A;  1R69 A;  3F6W A;  4YBA A;  3OQM A;  2OR1 L;  4J1X A;  2AXZ A;  2BNM A;  4Z5D A;  4Z5C A;  3JXD L;  2PUD A;  1QQA A;  3O9X A;  1B0N A;  1ZZB A;  3HZI B;  1RIO A;  1QPZ A;  1UTX A;  3EUS A;  3QF3 A;  3SCG A;  5K98 B;  1OCT C;  3IVP A;  4Y42 A;  2B5A A;  4X4C A;  4OB4 A;  3QWG A;  1BDH A;  1IC8 A;  3CLC A;  2AW6 A;  2HSG A;  1GT0 C;  2WUS R;  3JXB C;  2L49 A;  1VPW A;  3F52 A;  2O49 A;  2PUE A;  1LLI A;  4O8B A;  2IU7 A;  3FYA A;  3OMT A;  4X4G A;  3BD1 A;  4GHJ A;  1UXC A;  3G5G A;  1SQ8 A;  3GBF A;  2BJC A;  2O38 A;  1UXD A;  4Z59 A;  4MCX A;  1E3O C;  3DNV B;  1QP0 A;  2ICP A;  1ZZ6 A;  3JXC L;  2GZU A;  4YG1 A;  2PUC A;  2LYS A;  3ZKC A;  3RZZ A;  2XI8 A;  3SCH A;  3BDN A;  2PE5 A;  1QP7 A;  2XIU A;  2GRL A;  2CRO A;  1QQB A;  1ZPQ A;  2EWT A;  3G7D A;  4I6T A;  2XCJ A;  3D1N I;  2PPX A;  2IVB A;  3LFP A;  1ZUG A;  3L1P A;  3UFD A;  4IA8 A;  3GN5 A;  3CEC A;  3LIS A;  3SCF A;  3ZHI A;  2PIJ A;  1JH9 A;  4IWR A;  2MEZ A;  2IUO A;  1WET A;  1LCC A;  2LYK A;  1ZVV A;  3CRO L;  2D5V A;  3F51 A;  2LYP A;  4YAR A;  4X4I A;  4I6R A;  1ADR A;  3MLF A;  1RZS A;  4PU8 A;  3QYX A;  1RZR D;  2ICT A;  3KZ3 A;  2KZ8 A;  4IVZ A;  3VK0 A;  2LCV A;  4PU4 C;  4PU7 A;  4MCT A;  2IVG A;  3FMY A;  1QP4 A;  4I8T A;  1S7E A;  1LQC A;  1OSL A;  2PUG A;  2HIN A;  4X4D A;  3U3W A;  3B7H A;  1Y7Y A;  2GRM A;  2IV1 A;  3OQO A;  1ZS4 A;  1HF0 A;  1PNR A;  2LYQ A;  2KEJ A;  4Z58 A;  2BNO A;  3QQ6 A;  2L8N A;  3BS3 A;  2EBY A;  1Y9Q A;  1DW9 A;  3H5T A;  2AXU A;  1CJG A;  4JCX A;  4X4B A;  1PRA A;  1WH8 A;  1ZZC A;  3OP9 A;  4FBI A;  2PUA A;  2A6C A;  3TRB A;  2XSD C;  2PUF A;  2CSF A;  2JCG A;  3R1F A;  2JVL A;  1RZR A;  1AU7 A;  1WIZ A;  1PRU A;  1WH6 A;  4I6U A;  2KEI A;  4Z5H A;  1NEQ A;  3PXP A; 
#chains in the Genus database with same CATH topology
 4Q2J A;  4JCY A;  2AUW A;  1R63 A;  2AXV A;  4YG4 A;  3KJX A;  4X4H A;  1PER L;  1RPE L;  3GZD A;  5DTQ A;  1ZAY A;  1HQ1 A;  1O4X A;  3S8Q A;  1R69 A;  3F6W A;  2BNM A;  5JUW A;  2PXP A;  2PUD A;  3GZC A;  1RIO A;  3GUU A;  3ZPX A;  1IC8 A;  3NZL A;  2AW6 A;  2L49 A;  3F52 A;  4O8B A;  3QFI A;  3OMT A;  1UXC A;  3GBF A;  1QZX A;  4Z59 A;  1ZZ6 A;  2GZU A;  3ZKC A;  5DTR A;  2XI8 A;  1QQB A;  3VWS A;  2IVB A;  3LFP A;  3UFD A;  4IA8 A;  2HFZ A;  2HCS A;  3ZHI A;  1ZVV A;  2LYP A;  4X4I A;  4IVZ A;  2IVG A;  2LLW A;  4ER5 A;  3MEJ A;  3H5T A;  1CJG A;  3A9Z A;  1WH8 A;  2JVL A;  5GAG i;  2LYR A;  2H8R A;  2J7W A;  4NDW A;  3ZHM A;  4ER0 A;  2WIU B;  3TFL A;  2JQE A;  4JQD A;  1BDI A;  2KPJ A;  1EFA A;  5GAH i;  2LYJ A;  1QB2 A;  2AWI A;  4F8D A;  1CQT A;  3OQM A;  4YBA A;  4Z5C A;  1QQA A;  3O9X A;  1NW3 A;  3SCG A;  4DE9 A;  2B5A A;  4X4C A;  3QWG A;  4EK9 A;  3DM5 A;  1LLI A;  4EQZ A;  2IU7 A;  3FYA A;  3A9X A;  1SQ8 A;  2LLV A;  2O38 A;  1UXD A;  4HRA A;  1QP0 A;  3SX0 A;  2PXK A;  3RZZ A;  3BDN A;  2PE5 A;  2XIU A;  2GRL A;  2CRO A;  1ZPQ A;  3D1N I;  2PPX A;  3M9L A;  2PIJ A;  1JH9 A;  2D5V A;  3NXH A;  4ER7 A;  3VK0 A;  4MCT A;  2L1P A;  2FFH A;  2PUG A;  1LQC A;  4X4D A;  1MFQ C;  2J7U A;  3B7H A;  1Y7Y A;  2GRM A;  2EBY A;  2PXE A;  1U2Z A;  4JCX A;  3OP9 A;  1ZZC A;  3TEP A;  2PXT A;  2JCG A;  1AU7 A;  1WH6 A;  5DRY A;  4Z5H A;  2PXD A;  3PXP A;  2PUB A;  3FYM A;  2KEK A;  3OWQ A;  1JFT A;  2BNN A;  1L1M A;  4J1W A;  2OFY A;  1JFS A;  1PRV A;  2PXF A;  3KXA A;  1LMB 3;  4PU3 C;  2PXV A;  1XWR A;  4GQM A;  3A9Y A;  4X4F A;  1YSE A;  4J1X A;  2AXZ A;  1QPZ A;  2XXA A;  1UTX A;  3QF3 A;  4EZI A;  3IVP A;  4Y42 A;  5DSX A;  3KL4 A;  3CLC A;  2HSG A;  2WUS R;  3JXB C;  5DRT A;  1VPW A;  2PUE A;  3SR4 A;  4X4G A;  3BD1 A;  2XXQ A;  4WVL A;  4MCX A;  1E3O C;  3DNV B;  2ICP A;  4YG1 A;  2LYS A;  3GZD C;  3SCH A;  1QP7 A;  4I6T A;  2LNM A;  3L1P A;  3LIS A;  3SCF A;  3UWP A;  4IWR A;  1LCC A;  2LYK A;  3CRO L;  4I6R A;  5DTM A;  3QYX A;  1ADR A;  1RZR D;  2ICT A;  3KZ3 A;  2KZ8 A;  3NDB B;  4PU7 A;  3G0T A;  3FMY A;  4I8T A;  1S7E A;  1OSL A;  2HIN A;  3OQO A;  2LYQ A;  3QOW A;  4Z58 A;  2BNO A;  3QQ6 A;  3BS3 A;  2ODR D;  1Y9Q A;  1DW9 A;  2YBD A;  4X4B A;  2PUA A;  3OKZ A;  2A6C A;  2XSD C;  2CSF A;  3QOX A;  1PRU A;  4I6U A;  1ZZ7 A;  2IVQ A;  2XJ3 A;  1JWL A;  4EKG A;  1LCD A;  1NER A;  2MQK A;  5DT2 A;  4DE8 A;  1DWK A;  2HCN A;  4YG7 B;  5A7L A;  4FN3 A;  2R63 A;  1ZZ9 A;  3OQN A;  3NRO A;  4ER6 A;  3LQX A;  1POU A;  1X57 A;  1ZZ8 A;  3GN5 B;  2R1J L;  2O4A A;  2FJR A;  2EF8 A;  4X4E A;  2PXQ A;  2V3C C;  1X2L A;  2LYL A;  2OR1 L;  4Z5D A;  3JXD L;  2VEO A;  1B0N A;  1ZZB A;  3HZI B;  2PXB A;  3PE5 A;  2M4H A;  3EUS A;  5K98 B;  1OCT C;  2XXP A;  4OB4 A;  1BDH A;  1GT0 C;  2O49 A;  4GHJ A;  4ER3 A;  3G5G A;  2BJC A;  1DUL A;  3JXC L;  2PUC A;  2MXD A;  2EWT A;  3G7D A;  2XCJ A;  3TEL A;  1ZUG A;  3GN5 A;  3CEC A;  2MEZ A;  2IUO A;  1WET A;  3ME5 A;  3F51 A;  4YAR A;  3MLF A;  1RZS A;  4PU8 A;  2LCV A;  2PXU A;  4PU4 C;  1QP4 A;  3U3W A;  1HF0 A;  2IV1 A;  1ZS4 A;  1PNR A;  2KEJ A;  2L8N A;  2AXU A;  1PRA A;  4FBI A;  3TRB A;  2PUF A;  3R1F A;  1RZR A;  1WIZ A;  2KEI A;  4EKI A;  1NEQ A;  3R09 A;  2PXL A;  4OBM A; 
#chains in the Genus database with same CATH homology
 2PUB A;  1ZZ7 A;  2LYR A;  2H8R A;  2IVQ A;  3FYM A;  2XJ3 A;  4JCY A;  1JWL A;  2KEK A;  4NDW A;  2AUW A;  1R63 A;  1LCD A;  1JFT A;  2AXV A;  2BNN A;  1NER A;  2MQK A;  4YG4 A;  4J1W A;  2OFY A;  3KJX A;  1L1M A;  4X4H A;  1JFS A;  1PER L;  1RPE L;  1PRV A;  3ZHM A;  1DWK A;  4YG7 B;  5A7L A;  2WIU B;  4FN3 A;  2R63 A;  3KXA A;  1LMB 3;  4PU3 C;  1ZZ9 A;  3OQN A;  4JQD A;  1BDI A;  1ZAY A;  1XWR A;  2KPJ A;  1O4X A;  1POU A;  4GQM A;  1X57 A;  1EFA A;  1ZZ8 A;  3S8Q A;  3GN5 B;  2R1J L;  2O4A A;  2FJR A;  2EF8 A;  2LYJ A;  4X4E A;  1X2L A;  2LYL A;  1CQT A;  2AWI A;  4F8D A;  4X4F A;  1YSE A;  1R69 A;  3F6W A;  4YBA A;  3OQM A;  2OR1 L;  4J1X A;  2AXZ A;  2BNM A;  4Z5D A;  4Z5C A;  3JXD L;  2PUD A;  1QQA A;  3O9X A;  1B0N A;  1ZZB A;  3HZI B;  1RIO A;  1QPZ A;  1UTX A;  3EUS A;  3QF3 A;  3SCG A;  5K98 B;  1OCT C;  3IVP A;  4Y42 A;  2B5A A;  4X4C A;  4OB4 A;  3QWG A;  1BDH A;  1IC8 A;  3CLC A;  2AW6 A;  2HSG A;  1GT0 C;  2WUS R;  3JXB C;  2L49 A;  1VPW A;  3F52 A;  2O49 A;  2PUE A;  1LLI A;  4O8B A;  2IU7 A;  3FYA A;  3OMT A;  4X4G A;  3BD1 A;  4GHJ A;  1UXC A;  3G5G A;  1SQ8 A;  3GBF A;  2BJC A;  2O38 A;  1UXD A;  4Z59 A;  4MCX A;  1E3O C;  3DNV B;  1QP0 A;  2ICP A;  1ZZ6 A;  3JXC L;  2GZU A;  4YG1 A;  2PUC A;  2LYS A;  3ZKC A;  3RZZ A;  2XI8 A;  3SCH A;  3BDN A;  2PE5 A;  1QP7 A;  2XIU A;  2GRL A;  2CRO A;  1QQB A;  1ZPQ A;  2EWT A;  3G7D A;  4I6T A;  2XCJ A;  3D1N I;  2PPX A;  2IVB A;  3LFP A;  1ZUG A;  3L1P A;  3UFD A;  4IA8 A;  3GN5 A;  3CEC A;  3LIS A;  3SCF A;  3ZHI A;  2PIJ A;  1JH9 A;  4IWR A;  2MEZ A;  2IUO A;  1WET A;  1LCC A;  2LYK A;  1ZVV A;  3CRO L;  2D5V A;  3F51 A;  2LYP A;  4YAR A;  4X4I A;  4I6R A;  1ADR A;  3MLF A;  1RZS A;  4PU8 A;  3QYX A;  1RZR D;  2ICT A;  3KZ3 A;  2KZ8 A;  4IVZ A;  3VK0 A;  2LCV A;  4PU4 C;  4PU7 A;  4MCT A;  2IVG A;  3FMY A;  1QP4 A;  4I8T A;  1S7E A;  1LQC A;  1OSL A;  2PUG A;  2HIN A;  4X4D A;  3U3W A;  3B7H A;  1Y7Y A;  2GRM A;  2IV1 A;  3OQO A;  1ZS4 A;  1HF0 A;  1PNR A;  2LYQ A;  2KEJ A;  4Z58 A;  2BNO A;  3QQ6 A;  2L8N A;  3BS3 A;  2EBY A;  1Y9Q A;  1DW9 A;  3H5T A;  2AXU A;  1CJG A;  4JCX A;  4X4B A;  1PRA A;  1WH8 A;  1ZZC A;  3OP9 A;  4FBI A;  2PUA A;  2A6C A;  3TRB A;  2XSD C;  2PUF A;  2CSF A;  2JCG A;  3R1F A;  2JVL A;  1RZR A;  1AU7 A;  1WIZ A;  1PRU A;  1WH6 A;  4I6U A;  2KEI A;  4Z5H A;  1NEQ A;  3PXP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...