4IA8A

Crystal structure of a y37a mutant of the restriction-modification controller protein c.esp1396i
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
77
structure length
77
Chain Sequence
SFLLSKVSFVIKKIRLEKGMTQEDLAYKSNLDRTAISGIERNSRNLTIKSLELIMKGLEVSDVVFFEMLIKEILKHD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Mutagenic Analysis of the RM Controller Protein C.Esp1396I.
pubmed doi rcsb
source organism Enterobacter sp.
molecule tags Transcription
molecule keywords Regulatory protein
total genus 32
structure length 77
sequence length 77
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 4ia8A00
5A7LA 4Y42A 3ZHIA 1PNRA 4FN3A 2KEIA 2AW6A 1SQ8A 4J1XA 3OQNA 4I6TA 3CLCA 1XWRA 2BNMA 4Z58A 4Z59A 1UXCA 4Z5DA 2XCJA 1HF0A 1UXDA 2LYJA 3F6WA 2XSDC 4IA8A 5K98B 2AXUA 1LMB3 1LLIA 3BDNA 1NEQA 4I6UA 3PXPA 2EBYA 4PU8A 1AU7A 2A6CA 3UFDA 2B5AA 1ZZBA 3CROL 2KEKA 2L49A 3QYXA 2LYRA 3HZIB 4IWRA 3EUSA 1PERL 1DW9A 1S7EA 2WIUB 2BNNA 2JVLA 2AUWA 1BDIA 1EFAA 3GN5A 1QP0A 3RZZA 3QQ6A 3L1PA 2O38A 3MLFA 3FYAA 3G7DA 1L1MA 1VPWA 1RZRD 4MCXA 2R1JL 2PE5A 1ZAYA 2PUFA 4GQMA 4F8DA 1PRVA 2PUBA 2GRMA 3CECA 1LQCA 1Y9QA 3OQOA 3S8QA 3F51A 1CJGA 1RPEL 1RZSA 4PU4C 3IVPA 1R63A 3OQMA 3VK0A 1OSLA 2ICTA 3SCGA 4Z5CA 1LCCA 1WETA 1GT0C 4NDWA 4YG4A 3JXBC 3F52A 2O4AA 1ADRA 2MEZA 4YG1A 3SCHA 1QP7A 2IVBA 3OP9A 3BD1A 4PU3C 2PUAA 2CROA 1X57A 1QQBA 1IC8A 3KXAA 1UTXA 2IU7A 1JFTA 2HINA 2KZ8A 2EF8A 1WH8A 2AXVA 2LYKA 1ZZ9A 2O49A 3KZ3A 2LYSA 1R69A 2XJ3A 4X4EA 4YBAA 2GRLA 1NERA 2CSFA 3QF3A 2FJRA 4O8BA 1ZVVA 1B0NA 1RZRA 4MCTA 1CQTA 1O4XA 4GHJA 2R63A 3D1NI 3G5GA 4I8TA 3FMYA 1WIZA 4FBIA 3ZHMA 3ZKCA 4JQDA 1ZZ7A 4YG7B 3O9XA 2IUOA 2L8NA 4X4CA 1QPZA 3JXCL 1JWLA 1ZZ8A 2AWIA 2XIUA 1ZS4A 2PUGA 4X4BA 2LYPA 3KJXA 2D5VA 2XI8A 1ZPQA 1QQAA 4PU7A 3U3WA 4X4HA 3JXDL 4X4IA 3DNVB 1QP4A 2JCGA 3BS3A 1DWKA 1PRUA 3LISA 1BDHA 3GBFA 1RIOA 1ZZCA 3H5TA 2EWTA 2PIJA 1OCTC 3TRBA 2PUEA 4I6RA 2MQKA 1POUA 2BNOA 4J1WA 4X4DA 2LCVA 2LYLA 1PRAA 2KEJA 2PUDA 3GN5B 3SCFA 4YARA 1JH9A 2GZUA 2OR1L 2BJCA 2H8RA 2PUCA 1Y7YA 3R1FA 2IVQA 1YSEA 2ICPA 3B7HA 2KPJA 3QWGA 1LCDA 3FYMA 4X4GA 2AXZA 4OB4A 1ZUGA 1JFSA 2IV1A 2OFYA 4IVZA 4JCXA 2IVGA 2HSGA 1E3OC 2LYQA 3LFPA 4X4FA 1X2LA 1WH6A 1ZZ6A 2PPXA 3OMTA 2WUSR 4JCYA 4Z5HA
chains in the Genus database with same CATH superfamily
2PXBA 3ZHIA 1PNRA 3LQXA 4J1XA 3OQNA 3CLCA 4Z58A 1UXCA 3GZDC 4Z5DA 1HF0A 4IA8A 1LLIA 3BDNA 1NEQA 2PXFA 4I6UA 2EBYA 3A9ZA 2B5AA 2PXEA 3HZIB 3EUSA 5DTMA 2O38A 3FYAA 3G7DA 2PUFA 4HRAA 2PE5A 1PRVA 2HFZA 1CJGA 4PU4C 3IVPA 3VK0A 1LCCA 4Z5CA 1GT0C 2PXTA 3SCHA 2CROA 3GUUA 1IC8A 1MFQC 2PXVA 1JFTA 2HINA 2EF8A 3QFIA 1DULA 2AXVA 2LYKA 4EK9A 3SX0A 2FJRA 3G0TA 5DT2A 4X4CA 1QPZA 3JXCL 2XIUA 1ZS4A 5DTQA 1HQ1A 2D5VA 1ZPQA 1QQAA 4PU7A 1U2ZA 3U3WA 2PXQA 4X4IA 3BS3A 1DWKA 1BDHA 3H5TA 2PUEA 2MXDA 2KEJA 4ER3A 2PXLA 2PUCA 4ER0A 1YSEA 4OB4A 3TEPA 2IV1A 2OFYA 4X4FA 1WH6A 1NW3A 2WUSR 4Z5HA 3A9YA 4FN3A 3ME5A 4WVLA 4I6TA 3F6WA 2XSDC 1LMB3 4DE9A 4PU8A 1AU7A 2A6CA 1ZZBA 3CROL 2PXPA 4IWRA 3R09A 4EZIA 2BNNA 1QP0A 3RZZA 3L1PA 1L1MA 1RZRD 2R1JL 4ER6A 2PUBA 3OQOA 1QZXA 1RZSA 3OWQA 4EQZA 2PXKA 2O4AA 3F52A 1ADRA 1QP7A 2IVBA 2PUAA 1X57A 2KZ8A 1WH8A 1R69A 4YBAA 2GRLA 3QF3A 1CQTA 2R63A 3G5GA 4I8TA 3KL4A 4ER7A 5DTRA 3ZKCA 2XXPA 1JWLA 2AWIA 2PUGA 4EKIA 2HCNA 2XI8A 3DNVB 1PRUA 1RIOA 3DM5A 2EWTA 2PIJA 4I6RA 4J1WA 2PUDA 3GN5B 5DRTA 2ICPA 3B7HA 3OKZA 3FYMA 2M4HA 4JCXA 2IVGA 3QOXA 2LYQA 3LFPA 2PPXA 1QB2A 4Y42A 4Z59A 2XCJA 1UXDA 2LYJA 2PXDA 3A9XA 2PXUA 3PXPA 3UFDA 3SR4A 2KEKA 2L49A 3QYXA 2LLWA 1PERL 2YBDA 2AUWA 1BDIA 3GN5A 3QQ6A 1ZAYA 4GQMA 4F8DA 2GRMA 3CECA 2LNMA 1Y9QA 3S8QA 3F51A 1RPEL 2XXQA 1R63A 1OSLA 2ICTA 4YG4A 3JXBC 2V3CC 1UTXA 2IU7A 1ZZ9A 2O49A 4X4EA 1NERA 2CSFA 4O8BA 1RZRA 1O4XA 4GHJA 5JUWA 3FMYA 1WIZA 4FBIA 2JQEA 3ZHMA 4JQDA 3O9XA 2J7WA 1ZZ8A 3KJXA 4X4HA 3JXDL 3LISA 3GBFA 1ZZCA 3TRBA 2MQKA 1POUA 2L1PA 2LYLA 3SCFA 4YARA 2GZUA 2OR1L 2H8RA 3R1FA 2IVQA 2KPJA 2ODRD 5GAHi 1LCDA 4X4GA 5GAGi 4IVZA 3GZCA 1E3OC 1ZZ6A 5A7LA 4DE8A 2AW6A 2KEIA 1SQ8A 2FFHA 1XWRA 2BNMA 5K98B 3QOWA 2AXUA 2J7UA 3ZPXA 2HCSA 2LYRA 5DSXA 1DW9A 1S7EA 3MEJA 3VWSA 2WIUB 2JVLA 1EFAA 4ER5A 3MLFA 4OBMA 1VPWA 2VEOA 4MCXA 1LQCA 3NDBB 3OQMA 3SCGA 1WETA 4NDWA 2MEZA 4YG1A 3OP9A 3BD1A 4PU3C 1QQBA 2LLVA 3KXAA 3M9LA 3TELA 3KZ3A 2LYSA 2XJ3A 1ZVVA 1B0NA 4MCTA 5DRYA 3D1NI 3NROA 3NZLA 4Q2JA 1ZZ7A 4YG7B 2IUOA 2L8NA 4X4BA 2LYPA 1QP4A 2JCGA 3PE5A 1OCTC 2BNOA 4X4DA 2LCVA 1PRAA 3GZDA 1JH9A 2BJCA 2XXAA 3UWPA 1Y7YA 4EKGA 3QWGA 3NXHA 2AXZA 1ZUGA 1JFSA 2HSGA 1X2LA 3TFLA 3OMTA 4JCYA
chains in the Genus database with same CATH topology
5A7LA 4Y42A 3ZHIA 1PNRA 4FN3A 2KEIA 2AW6A 1SQ8A 4J1XA 3OQNA 4I6TA 3CLCA 1XWRA 2BNMA 4Z58A 4Z59A 1UXCA 4Z5DA 2XCJA 1HF0A 1UXDA 2LYJA 3F6WA 2XSDC 4IA8A 5K98B 2AXUA 1LMB3 1LLIA 3BDNA 1NEQA 4I6UA 3PXPA 2EBYA 4PU8A 1AU7A 2A6CA 3UFDA 2B5AA 1ZZBA 3CROL 2KEKA 2L49A 3QYXA 2LYRA 3HZIB 4IWRA 3EUSA 1PERL 1DW9A 1S7EA 2WIUB 2BNNA 2JVLA 2AUWA 1BDIA 1EFAA 3GN5A 1QP0A 3RZZA 3QQ6A 3L1PA 2O38A 3MLFA 3FYAA 3G7DA 1L1MA 1VPWA 1RZRD 4MCXA 2R1JL 2PE5A 1ZAYA 2PUFA 4GQMA 4F8DA 1PRVA 2PUBA 2GRMA 3CECA 1LQCA 1Y9QA 3OQOA 3S8QA 3F51A 1CJGA 1RPEL 1RZSA 4PU4C 3IVPA 1R63A 3OQMA 3VK0A 1OSLA 2ICTA 3SCGA 4Z5CA 1LCCA 1WETA 1GT0C 4NDWA 4YG4A 3JXBC 3F52A 2O4AA 1ADRA 2MEZA 4YG1A 3SCHA 1QP7A 2IVBA 3OP9A 3BD1A 4PU3C 2PUAA 2CROA 1X57A 1QQBA 1IC8A 3KXAA 1UTXA 2IU7A 1JFTA 2HINA 2KZ8A 2EF8A 1WH8A 2AXVA 2LYKA 1ZZ9A 2O49A 3KZ3A 2LYSA 1R69A 2XJ3A 4X4EA 4YBAA 2GRLA 1NERA 2CSFA 3QF3A 2FJRA 4O8BA 1ZVVA 1B0NA 1RZRA 4MCTA 1CQTA 1O4XA 4GHJA 2R63A 3D1NI 3G5GA 4I8TA 3FMYA 1WIZA 4FBIA 3ZHMA 3ZKCA 4JQDA 1ZZ7A 4YG7B 3O9XA 2IUOA 2L8NA 4X4CA 1QPZA 3JXCL 1JWLA 1ZZ8A 2AWIA 2XIUA 1ZS4A 2PUGA 4X4BA 2LYPA 3KJXA 2D5VA 2XI8A 1ZPQA 1QQAA 4PU7A 3U3WA 4X4HA 3JXDL 4X4IA 3DNVB 1QP4A 2JCGA 3BS3A 1DWKA 1PRUA 3LISA 1BDHA 3GBFA 1RIOA 1ZZCA 3H5TA 2EWTA 2PIJA 1OCTC 3TRBA 2PUEA 4I6RA 2MQKA 1POUA 2BNOA 4J1WA 4X4DA 2LCVA 2LYLA 1PRAA 2KEJA 2PUDA 3GN5B 3SCFA 4YARA 1JH9A 2GZUA 2OR1L 2BJCA 2H8RA 2PUCA 1Y7YA 3R1FA 2IVQA 1YSEA 2ICPA 3B7HA 2KPJA 3QWGA 1LCDA 3FYMA 4X4GA 2AXZA 4OB4A 1ZUGA 1JFSA 2IV1A 2OFYA 4IVZA 4JCXA 2IVGA 2HSGA 1E3OC 2LYQA 3LFPA 4X4FA 1X2LA 1WH6A 1ZZ6A 2PPXA 3OMTA 2WUSR 4JCYA 4Z5HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A7L A;  4Y42 A;  3ZHI A;  1PNR A;  4FN3 A;  2KEI A;  2AW6 A;  1SQ8 A;  4J1X A;  3OQN A;  4I6T A;  3CLC A;  1XWR A;  2BNM A;  4Z58 A;  4Z59 A;  1UXC A;  4Z5D A;  2XCJ A;  1HF0 A;  1UXD A;  2LYJ A;  3F6W A;  2XSD C;  4IA8 A;  5K98 B;  2AXU A;  1LMB 3;  1LLI A;  3BDN A;  1NEQ A;  4I6U A;  3PXP A;  2EBY A;  4PU8 A;  1AU7 A;  2A6C A;  3UFD A;  2B5A A;  1ZZB A;  3CRO L;  2KEK A;  2L49 A;  3QYX A;  2LYR A;  3HZI B;  4IWR A;  3EUS A;  1PER L;  1DW9 A;  1S7E A;  2WIU B;  2BNN A;  2JVL A;  2AUW A;  1BDI A;  1EFA A;  3GN5 A;  1QP0 A;  3RZZ A;  3QQ6 A;  3L1P A;  2O38 A;  3MLF A;  3FYA A;  3G7D A;  1L1M A;  1VPW A;  1RZR D;  4MCX A;  2R1J L;  2PE5 A;  1ZAY A;  2PUF A;  4GQM A;  4F8D A;  1PRV A;  2PUB A;  2GRM A;  3CEC A;  1LQC A;  1Y9Q A;  3OQO A;  3S8Q A;  3F51 A;  1CJG A;  1RPE L;  1RZS A;  4PU4 C;  3IVP A;  1R63 A;  3OQM A;  3VK0 A;  1OSL A;  2ICT A;  3SCG A;  4Z5C A;  1LCC A;  1WET A;  1GT0 C;  4NDW A;  4YG4 A;  3JXB C;  3F52 A;  2O4A A;  1ADR A;  2MEZ A;  4YG1 A;  3SCH A;  1QP7 A;  2IVB A;  3OP9 A;  3BD1 A;  4PU3 C;  2PUA A;  2CRO A;  1X57 A;  1QQB A;  1IC8 A;  3KXA A;  1UTX A;  2IU7 A;  1JFT A;  2HIN A;  2KZ8 A;  2EF8 A;  1WH8 A;  2AXV A;  2LYK A;  1ZZ9 A;  2O49 A;  3KZ3 A;  2LYS A;  1R69 A;  2XJ3 A;  4X4E A;  4YBA A;  2GRL A;  1NER A;  2CSF A;  3QF3 A;  2FJR A;  4O8B A;  1ZVV A;  1B0N A;  1RZR A;  4MCT A;  1CQT A;  1O4X A;  4GHJ A;  2R63 A;  3D1N I;  3G5G A;  4I8T A;  3FMY A;  1WIZ A;  4FBI A;  3ZHM A;  3ZKC A;  4JQD A;  1ZZ7 A;  4YG7 B;  3O9X A;  2IUO A;  2L8N A;  4X4C A;  1QPZ A;  3JXC L;  1JWL A;  1ZZ8 A;  2AWI A;  2XIU A;  1ZS4 A;  2PUG A;  4X4B A;  2LYP A;  3KJX A;  2D5V A;  2XI8 A;  1ZPQ A;  1QQA A;  4PU7 A;  3U3W A;  4X4H A;  3JXD L;  4X4I A;  3DNV B;  1QP4 A;  2JCG A;  3BS3 A;  1DWK A;  1PRU A;  3LIS A;  1BDH A;  3GBF A;  1RIO A;  1ZZC A;  3H5T A;  2EWT A;  2PIJ A;  1OCT C;  3TRB A;  2PUE A;  4I6R A;  2MQK A;  1POU A;  2BNO A;  4J1W A;  4X4D A;  2LCV A;  2LYL A;  1PRA A;  2KEJ A;  2PUD A;  3GN5 B;  3SCF A;  4YAR A;  1JH9 A;  2GZU A;  2OR1 L;  2BJC A;  2H8R A;  2PUC A;  1Y7Y A;  3R1F A;  2IVQ A;  1YSE A;  2ICP A;  3B7H A;  2KPJ A;  3QWG A;  1LCD A;  3FYM A;  4X4G A;  2AXZ A;  4OB4 A;  1ZUG A;  1JFS A;  2IV1 A;  2OFY A;  4IVZ A;  4JCX A;  2IVG A;  2HSG A;  1E3O C;  2LYQ A;  3LFP A;  4X4F A;  1X2L A;  1WH6 A;  1ZZ6 A;  2PPX A;  3OMT A;  2WUS R;  4JCY A;  4Z5H A; 
#chains in the Genus database with same CATH topology
 2PXB A;  3ZHI A;  1PNR A;  3LQX A;  4J1X A;  3OQN A;  3CLC A;  4Z58 A;  1UXC A;  3GZD C;  4Z5D A;  1HF0 A;  4IA8 A;  1LLI A;  3BDN A;  1NEQ A;  2PXF A;  4I6U A;  2EBY A;  3A9Z A;  2B5A A;  2PXE A;  3HZI B;  3EUS A;  5DTM A;  2O38 A;  3FYA A;  3G7D A;  2PUF A;  4HRA A;  2PE5 A;  1PRV A;  2HFZ A;  1CJG A;  4PU4 C;  3IVP A;  3VK0 A;  1LCC A;  4Z5C A;  1GT0 C;  2PXT A;  3SCH A;  2CRO A;  3GUU A;  1IC8 A;  1MFQ C;  2PXV A;  1JFT A;  2HIN A;  2EF8 A;  3QFI A;  1DUL A;  2AXV A;  2LYK A;  4EK9 A;  3SX0 A;  2FJR A;  3G0T A;  5DT2 A;  4X4C A;  1QPZ A;  3JXC L;  2XIU A;  1ZS4 A;  5DTQ A;  1HQ1 A;  2D5V A;  1ZPQ A;  1QQA A;  4PU7 A;  1U2Z A;  3U3W A;  2PXQ A;  4X4I A;  3BS3 A;  1DWK A;  1BDH A;  3H5T A;  2PUE A;  2MXD A;  2KEJ A;  4ER3 A;  2PXL A;  2PUC A;  4ER0 A;  1YSE A;  4OB4 A;  3TEP A;  2IV1 A;  2OFY A;  4X4F A;  1WH6 A;  1NW3 A;  2WUS R;  4Z5H A;  3A9Y A;  4FN3 A;  3ME5 A;  4WVL A;  4I6T A;  3F6W A;  2XSD C;  1LMB 3;  4DE9 A;  4PU8 A;  1AU7 A;  2A6C A;  1ZZB A;  3CRO L;  2PXP A;  4IWR A;  3R09 A;  4EZI A;  2BNN A;  1QP0 A;  3RZZ A;  3L1P A;  1L1M A;  1RZR D;  2R1J L;  4ER6 A;  2PUB A;  3OQO A;  1QZX A;  1RZS A;  3OWQ A;  4EQZ A;  2PXK A;  2O4A A;  3F52 A;  1ADR A;  1QP7 A;  2IVB A;  2PUA A;  1X57 A;  2KZ8 A;  1WH8 A;  1R69 A;  4YBA A;  2GRL A;  3QF3 A;  1CQT A;  2R63 A;  3G5G A;  4I8T A;  3KL4 A;  4ER7 A;  5DTR A;  3ZKC A;  2XXP A;  1JWL A;  2AWI A;  2PUG A;  4EKI A;  2HCN A;  2XI8 A;  3DNV B;  1PRU A;  1RIO A;  3DM5 A;  2EWT A;  2PIJ A;  4I6R A;  4J1W A;  2PUD A;  3GN5 B;  5DRT A;  2ICP A;  3B7H A;  3OKZ A;  3FYM A;  2M4H A;  4JCX A;  2IVG A;  3QOX A;  2LYQ A;  3LFP A;  2PPX A;  1QB2 A;  4Y42 A;  4Z59 A;  2XCJ A;  1UXD A;  2LYJ A;  2PXD A;  3A9X A;  2PXU A;  3PXP A;  3UFD A;  3SR4 A;  2KEK A;  2L49 A;  3QYX A;  2LLW A;  1PER L;  2YBD A;  2AUW A;  1BDI A;  3GN5 A;  3QQ6 A;  1ZAY A;  4GQM A;  4F8D A;  2GRM A;  3CEC A;  2LNM A;  1Y9Q A;  3S8Q A;  3F51 A;  1RPE L;  2XXQ A;  1R63 A;  1OSL A;  2ICT A;  4YG4 A;  3JXB C;  2V3C C;  1UTX A;  2IU7 A;  1ZZ9 A;  2O49 A;  4X4E A;  1NER A;  2CSF A;  4O8B A;  1RZR A;  1O4X A;  4GHJ A;  5JUW A;  3FMY A;  1WIZ A;  4FBI A;  2JQE A;  3ZHM A;  4JQD A;  3O9X A;  2J7W A;  1ZZ8 A;  3KJX A;  4X4H A;  3JXD L;  3LIS A;  3GBF A;  1ZZC A;  3TRB A;  2MQK A;  1POU A;  2L1P A;  2LYL A;  3SCF A;  4YAR A;  2GZU A;  2OR1 L;  2H8R A;  3R1F A;  2IVQ A;  2KPJ A;  2ODR D;  5GAH i;  1LCD A;  4X4G A;  5GAG i;  4IVZ A;  3GZC A;  1E3O C;  1ZZ6 A;  5A7L A;  4DE8 A;  2AW6 A;  2KEI A;  1SQ8 A;  2FFH A;  1XWR A;  2BNM A;  5K98 B;  3QOW A;  2AXU A;  2J7U A;  3ZPX A;  2HCS A;  2LYR A;  5DSX A;  1DW9 A;  1S7E A;  3MEJ A;  3VWS A;  2WIU B;  2JVL A;  1EFA A;  4ER5 A;  3MLF A;  4OBM A;  1VPW A;  2VEO A;  4MCX A;  1LQC A;  3NDB B;  3OQM A;  3SCG A;  1WET A;  4NDW A;  2MEZ A;  4YG1 A;  3OP9 A;  3BD1 A;  4PU3 C;  1QQB A;  2LLV A;  3KXA A;  3M9L A;  3TEL A;  3KZ3 A;  2LYS A;  2XJ3 A;  1ZVV A;  1B0N A;  4MCT A;  5DRY A;  3D1N I;  3NRO A;  3NZL A;  4Q2J A;  1ZZ7 A;  4YG7 B;  2IUO A;  2L8N A;  4X4B A;  2LYP A;  1QP4 A;  2JCG A;  3PE5 A;  1OCT C;  2BNO A;  4X4D A;  2LCV A;  1PRA A;  3GZD A;  1JH9 A;  2BJC A;  2XXA A;  3UWP A;  1Y7Y A;  4EKG A;  3QWG A;  3NXH A;  2AXZ A;  1ZUG A;  1JFS A;  2HSG A;  1X2L A;  3TFL A;  3OMT A;  4JCY A; 
#chains in the Genus database with same CATH homology
 5A7L A;  4Y42 A;  3ZHI A;  1PNR A;  4FN3 A;  2KEI A;  2AW6 A;  1SQ8 A;  4J1X A;  3OQN A;  4I6T A;  3CLC A;  1XWR A;  2BNM A;  4Z58 A;  4Z59 A;  1UXC A;  4Z5D A;  2XCJ A;  1HF0 A;  1UXD A;  2LYJ A;  3F6W A;  2XSD C;  4IA8 A;  5K98 B;  2AXU A;  1LMB 3;  1LLI A;  3BDN A;  1NEQ A;  4I6U A;  3PXP A;  2EBY A;  4PU8 A;  1AU7 A;  2A6C A;  3UFD A;  2B5A A;  1ZZB A;  3CRO L;  2KEK A;  2L49 A;  3QYX A;  2LYR A;  3HZI B;  4IWR A;  3EUS A;  1PER L;  1DW9 A;  1S7E A;  2WIU B;  2BNN A;  2JVL A;  2AUW A;  1BDI A;  1EFA A;  3GN5 A;  1QP0 A;  3RZZ A;  3QQ6 A;  3L1P A;  2O38 A;  3MLF A;  3FYA A;  3G7D A;  1L1M A;  1VPW A;  1RZR D;  4MCX A;  2R1J L;  2PE5 A;  1ZAY A;  2PUF A;  4GQM A;  4F8D A;  1PRV A;  2PUB A;  2GRM A;  3CEC A;  1LQC A;  1Y9Q A;  3OQO A;  3S8Q A;  3F51 A;  1CJG A;  1RPE L;  1RZS A;  4PU4 C;  3IVP A;  1R63 A;  3OQM A;  3VK0 A;  1OSL A;  2ICT A;  3SCG A;  4Z5C A;  1LCC A;  1WET A;  1GT0 C;  4NDW A;  4YG4 A;  3JXB C;  3F52 A;  2O4A A;  1ADR A;  2MEZ A;  4YG1 A;  3SCH A;  1QP7 A;  2IVB A;  3OP9 A;  3BD1 A;  4PU3 C;  2PUA A;  2CRO A;  1X57 A;  1QQB A;  1IC8 A;  3KXA A;  1UTX A;  2IU7 A;  1JFT A;  2HIN A;  2KZ8 A;  2EF8 A;  1WH8 A;  2AXV A;  2LYK A;  1ZZ9 A;  2O49 A;  3KZ3 A;  2LYS A;  1R69 A;  2XJ3 A;  4X4E A;  4YBA A;  2GRL A;  1NER A;  2CSF A;  3QF3 A;  2FJR A;  4O8B A;  1ZVV A;  1B0N A;  1RZR A;  4MCT A;  1CQT A;  1O4X A;  4GHJ A;  2R63 A;  3D1N I;  3G5G A;  4I8T A;  3FMY A;  1WIZ A;  4FBI A;  3ZHM A;  3ZKC A;  4JQD A;  1ZZ7 A;  4YG7 B;  3O9X A;  2IUO A;  2L8N A;  4X4C A;  1QPZ A;  3JXC L;  1JWL A;  1ZZ8 A;  2AWI A;  2XIU A;  1ZS4 A;  2PUG A;  4X4B A;  2LYP A;  3KJX A;  2D5V A;  2XI8 A;  1ZPQ A;  1QQA A;  4PU7 A;  3U3W A;  4X4H A;  3JXD L;  4X4I A;  3DNV B;  1QP4 A;  2JCG A;  3BS3 A;  1DWK A;  1PRU A;  3LIS A;  1BDH A;  3GBF A;  1RIO A;  1ZZC A;  3H5T A;  2EWT A;  2PIJ A;  1OCT C;  3TRB A;  2PUE A;  4I6R A;  2MQK A;  1POU A;  2BNO A;  4J1W A;  4X4D A;  2LCV A;  2LYL A;  1PRA A;  2KEJ A;  2PUD A;  3GN5 B;  3SCF A;  4YAR A;  1JH9 A;  2GZU A;  2OR1 L;  2BJC A;  2H8R A;  2PUC A;  1Y7Y A;  3R1F A;  2IVQ A;  1YSE A;  2ICP A;  3B7H A;  2KPJ A;  3QWG A;  1LCD A;  3FYM A;  4X4G A;  2AXZ A;  4OB4 A;  1ZUG A;  1JFS A;  2IV1 A;  2OFY A;  4IVZ A;  4JCX A;  2IVG A;  2HSG A;  1E3O C;  2LYQ A;  3LFP A;  4X4F A;  1X2L A;  1WH6 A;  1ZZ6 A;  2PPX A;  3OMT A;  2WUS R;  4JCY A;  4Z5H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...