4IADA

Low temperature x-ray structure of camp dependent protein kinase a in complex with high mg2+ concentration, adp and phosphorylated peptide psp20
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
337
structure length
334
Chain Sequence
SVKEFLAKAKEDFLKKWETPSQNTAQLDQFDRIKTLGTGSFGRVMLVKHKESGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVAGGEMFSHLRRIGRFEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFTEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cAMP-dependent protein kinase catalytic subunit alpha
publication title Insights into the Phosphoryl Transfer Catalyzed by cAMP-Dependent Protein Kinase: An X-ray Crystallographic Study of Complexes with Various Metals and Peptide Substrate SP20.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase/peptide
total genus 108
structure length 334
sequence length 337
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2012-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4iadA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4iadA02
4QPAA 4KIQA 5K0KA 3D7ZA 4DBNA 4C4EA 3POOA 3VS0A 5FXRA 3WF9A 3G15A 5FGKA 1M52A 5CU3A 1Y91A 4O96A 3KXZA 5E8ZA 4YC3A 2I40A 5EOBA 3R9RA 2WELA 4YLKA 3R1QA 4S31A 4HJOA 1Q3WA 3QTSA 1DAYA 4U7ZA 1KWPA 4ZEGA 1M17A 3EN7A 4IVDA 4QP8A 2JDOA 3S4QA 5IG1A 3O50A 4KKGA 3IDPA 2YDJA 1HCKA 4YGAA 4GKHA 2WO6A 3EMGA 3MIYA 4I92A 5GJDA 1XH6A 1H0VA 2WTVA 4RX7A 3Q5ZA 4TKSA 4XP3A 4O7LA 2OJFE 5K5NA 2W1CA 3LXPA 4IWQA 3U54A 4YZCA 1NVSA 3ACJA 4O84A 3MVMA 4AN9A 3TTIA 2IW6A 5F95A 4IVBA 3F9NA 3AG9A 3QCQA 3QUDA 5IKWA 3NMUF 5ANDA 5AUYA 4Y8DA 1H1RA 4OTHA 4I1ZA 2Z7SA 4JS8A 2XK6A 4A9SA 5IMXA 3MDYA 4GSBA 4IHPA 3MJ2A 3FQSA 2BMCA 4I6BA 4QQ5A 4BN1A 5K4IA 3TDVA 2YITA 3DLZA 1YRPA 5HG9A 3JR1A 2XIYA 2W1ZA 4BKJA 3THBA 5IU2A 2EXEA 2CKPA 2V22A 2J0KA 1OZ1A 5KNJA 5F20A 2GS6A 4UMPA 2BR1A 2BPMA 4ZTSA 5TOZA 3F82A 3BELA 4FKWA 4MWIA 4RFMA 4DITA 3C13A 3WZEA 4X6RA 5FP5A 2J0LA 3PTGA 2CHLA 4Q5HA 4QP2A 4C2VA 3G6HA 5CU6A 2PU8A 2P2IA 2YCQA 2YM7A 4HYUA 3FHIA 4UXLA 3SXSA 4C61A 5LOHA 3BX5A 4IQ6A 3ULIA 2XK9A 3REPA 5IQBA 3CJGA 1H27A 1WBVA 1UKIA 1I44A 4RMZA 1IA8A 3EFJA 3SXRA 4MD8E 4EH7A 5EH0A 3E88A 1O9UA 4NSTA 4YTCA 4F65A 4FEVA 2VTMA 4ZZMA 1PXIA 4BDCA 3MPMA 4BIDA 4CGAA 4CV8A 3EKKA 2C30A 3D7TA 2YABA 1M2QA 3DXNA 2EVAA 4O0SA 4WNPA 3LFFA 3R73A 4WG3A 2A4LA 3Q60A 3LIJA 2BRNA 3I4BA 4EWHA 2NRUA 3DKFA 3FI4A 2GNGA 4FV3A 4DCEA 5IQGA 2W1EA 3Q4CA 4JX7A 5AEPA 1PXPA 4USDA 4PY1A 1KE9A 3VW6A 3WYXA 4DFBA 2YLEA 3DK6A 4C4FA 4YURA 3U6JA 3WILA 4BTFA 2YHVA 4NM3A 3CKWA 3VHEA 4BBFA 5IDNA 1K3AA 3KRJA 4CFMA 3MFSA 3PIXA 3V8SA 3VWAA 1VYZA 4L3JA 4QMTA 2QODA 3HLLA 4G5JA 3KK9A 3W10A 5JK3A 1Q62A 4MF0A 2Y8OA 4EOKA 4UYNA 4NWMA 3Q6WA 5AADA 1Q8WA 3C4EA 1YDRE 3DNDA 4FC0A 5E1SA 3TG1A 4HVHA 3DU8A 5BX0A 4O27B 3CPBA 4DH1A 5HLWA 3QAME 4LGGA 5L6PA 3UNZA 3ZZEA 4BB4A 3LKMA 4AT4A 5EYKA 4AT5A 1H1PA 3QXOA 3C7QA 3OUNB 2DWBA 4XG9A 5AV0A 4YP8A 4IZ5A 3NW6A 4CTCA 2YDIA 2QC6A 2YM4A 4L3PA 5DT4A 5K0XA 2QG7A 2JDSA 4RVMA 3ZFXA 5IQAA 5EM7A 2OICA 4AACA 2GQRA 1YHVA 2YIXA 3FQEA 1HCLA 5AMNA 4F9CA 1ZZLA 3QD0A 4B8MA 3OXIA 4FEQA 2GPHA 4X0MA 2WOTA 3HA6A 5L6OA 2EB2A 3FLZA 2XRWA 2HY81 3FZPA 3W1FA 4JL9A 5EQYA 2FYSA 3I5ZA 3QTZA 2ITNA 2A0CX 3KKVA 3QTXA 4HCVA 3B8RA 4K18A 3KL8A 4WUNA 3Q04A 2V5QA 2WNTA 3A7IA 1UU3A 4Z9LA 1H07A 4XG6A 4ZIMA 3MY0A 3QHRA 4U40A 4RJ4A 3R7EA 4ANBA 4IJPA 4EZ3A 3E8DA 5CZHA 4ERWA 5AR2A 5HO6A 4GH2A 4FL2A 3IW7A 4GU6A 1H4LA 4IJ9A 3I0QA 4E73A 4EL9A 4UXQA 5FDPA 4ANMA 2IZRA 4P5QA 1Y6BA 4EJNA 2W99B 4L8MA 2XNOA 3QD4A 2WTWA 4LI5A 4QQJA 4I93A 3HVCA 3R1SA 3BBTB 3FBVA 4O83A 3UZTA 3PPZA 5IUHA 5BMMA 4H1JA 5T3QA 2WEIA 1OIYA 5CEIA 3UQGA 2NPQA 2YIQA 4ZSJA 4AT3A 4LRJA 5ANEA 3OTUA 3BHHA 2IVTA 4D2RA 1YOJA 2ESMA 4AFEA 3HKOA 5JFSA 4YUQA 2PPQA 4KSQA 3U4UA 2GNIA 4NM0A 3SX9A 4FG9A 5AP0A 2IG7A 5CVFA 3OC1A 3O96A 2DYLA 3AMBA 2JLDA 4L53A 2B9HA 3TEIA 5AA9A 4CQGA 5CF8A 3QBNA 4I3ZA 2XNNA 2CNQA 3EWHA 4D2WA 2WMTA 3Q53A 4FUXA 3ZEPA 4FZAB 1IR3A 4OR5A 4PP9A 3DJ7A 3PVGA 3FY0A 3SW4A 1DS5A 4LMUA 4XLVA 3UODA 3GQLA 3V6SA 3GUBA 4U3YA 1PKDA 2QO9A 3R8LA 4YU2A 3CJFA 4RFZA 4TYJA 5EI8A 2UW8A 1YWNA 3TIYA 5KMOA 3RPSA 4IM3A 5G1XA 3RK5A 2CCIA 2WIPA 3H30A 4O21A 4UWYA 3D7TB 2E9NA 4FBXA 2BTSA 3NS9A 5M44A 3EH9A 1H1QA 2YM8A 1OIQA 2QR7A 3NUAA 2GMXA 2OJGA 1YI3A 3PY1A 2DUVA 3ROYA 4G6NA 5HE2A 3ZFMA 1OBGA 2WTKB 3BLRA 4WG4A 5AX3A 5LMKC 3KK8A 2WQEA 4CQEA 5HE1A 4F7SA 1BLXA 2C5NA 2ITOA 3GC0A 1OUYA 5LCJA 3E8CA 3F5GA 4OBPA 4F99A 4WRGA 4RWKA 4N4SA 3PY3A 4ACGA 5BQ0A 3RAIA 2HIWA 3QD2B 2PULA 4IZAA 2VTLA 2RFNA 5AX9A 1U54A 5KZIA 5DVRA 2VZ6A 2BKZA 3RMFA 4E6CA 2W1DA 2F49A 3MPTA 5EI6A 4PDYA 4NUSA 1VZOA 3FYJX 3EN4A 2EXMA 3L9MA 3A7HA 3U87A 3V3VA 4BF2A 5LMBA 4H05A 2PVMA 3O8TA 1RW8A 1XO2B 2CNUA 5L2SA 1FBNA 1WBOA 3O71A 4OBQA 5KO1A 5DEWA 4NW6A 2UZEA 3CS9A 3V5QA 1XJDA 3F3VA 1WVXA 2C6DA 5HVYA 5IQFA 1JQHA 3RINA 5LVLA 3FKNA 4NFMA 3TNQB 4ANQA 4ENXA 4FK3A 3UNJA 5I3OA 3VRZA 4E8AA 4EK5A 4F1OA 4MNFA 4BDHA 4MEDA 4PNKA 2IZTA 3FDNA 4A06A 3FMJA 2FGIA 1Z57A 3I5NA 4BR3A 2GHGA 4EOIA 4QP3A 5EQEA 3EHAA 4O0VA 3EQGA 4W8EA 4WD5A 4CCUA 4DGGA 1YQJA 5TF9A 4AG8A 3BKBA 4S2ZA 3C0GA 3H9OA 3KEXA 2F7XE 4FNXA 4G3DA 5BYYA 2C6MA 4BTJA 1VJYA 1JKTA 1XH4A 4B4LA 5E8TA 5EKNA 3F5PA 5LQFA 2PMNX 2EWAA 3KMMA 2PTKA 3DFAA 5CENA 3UPXA 2I7QA 3PVUA 4JOAA 1FMOE 1ZYCA 2BALA 2OBJA 5C27A 3ZM9A 2W9ZB 4K2RA 2QKRA 4QMYA 3MB6A 4U3ZA 3ZUTA 3BV2A 4EH6A 3KA0A 5FTGA 1REJA 3MFUA 4FKSA 4FV0A 4FV8A 4GJ3A 3DZQA 1O6KA 5JRQA 4Q9ZA 3UTOA 3MVJA 4PL3A 4IANA 4JBOA 4BDBA 3FI8A 3R9NA 3OWLA 5DG5A 3ZDIA 2WTIA 3GU8A 2YERA 4O7RA 4EKKA 4C36A 4E5BA 4XEYA 5LVMA 4L00A 4AX8A 3WARA 3MFTA 4AXAA 2I0HA 3DQWA 3AXWA 4U5JA 3UOKA 4IM2A 5M57A 4QO9A 3R2BA 1ZWSA 4MBLA 3D5VA 4D9TA 1ZMUA 2UZWE 4QD6A 4JIAA 5J95A 3ZRMA 3VJOA 3H9FA 2QONA 3C1XA 4O2ZA 3F61A 4UEUA 4HZSA 3EZVA 5IDPA 3AC8A 2QO7A 5FBNC 1OGUA 3ORLA 3UO5A 3ZONA 5CU2A 1BKXA 5M55A 2C6OA 3BEGA 4NCTC 4AN3A 2KTYA 4LUEA 5IH6A 4FT9A 4BGQA 4IC7A 2JFLA 4JG8A 4MAOA 2BAKA 3RPYA 3PSDA 4FZFB 2BUJA 3NX8A 4F6SA 3KN6A 1UWJA 4P5ZA 5CVHA 3EQDA 2XH5A 5AV3A 5HNBA 5DIAA 3ZRKA 4B9DA 3LJ1A 4GV1A 4NFNA 4CRLA 1CKJA 4J1RA 5CAOA 2C3IB 2XEYA 3CIKA 3HV4A 3F3ZA 4S34A 4OTPA 2B9FA 4IACA 2C5YA 3MS9A 4R5YA 4FL3A 3FAAA 3ORPA 3PA5A 3R2YA 2RL5A 4X7QA 4XOYA 5A4TA 1O6YA 4OTIA 5HBEA 2WQMA 3VBXA 4O7NA 2G01A 4BWXA 4UMUA 2F7EE 3RAKA 1ZYLA 5FEDA 4Z7HA 2AC3A 3FMKA 1V0OA 3R6XA 5AUZA 1CDKA 4L68A 5ANIA 2CKOA 1PHKA 3TM0A 4C4HA 2YZAA 4IIRA 4HVIA 3V51A 4AZEA 2VTTA 1U54B 3W2CA 4GT4A 3EFKA 3VW8A 1NW1A 2HZNA 5AIKA 1OKWA 4QQCA 1LUFA 2BRHA 3RM7A 2O64A 5AAGA 4ZZOA 4I41A 4LV8A 4JQEA 4U97A 2JAVA 4IDVA 3D14A 5DN3A 3CSVA 5LWMA 1WAKA 2PSQA 4YSJA 1WZYA 2QCSA 4RZVA 2GHLA 1XKKA 3PJ8A 4E6DA 3HAVA 2XS0A 1JLUE 4M0YA 1NY3A 4U44A 2R9SA 3TV6A 3R28A 1BMKA 5AR7A 3QU0A 4U42A 3HUBA 1J91A 3QZHA 4DEBA 2XBAA 3F2AA 1XWSA 5I9UA 5L3AA 4WO5A 2R3QA 1F3MC 4BDFA 3ZTXA 2AUHA 1SYKA 4BVUA 4DC2A 4HW7A 5AUVA 3A8WA 5A6OA 3F2RA 3SLSA 5HU3A 4TW9A 5FRIA 3CD3A 3TDWA 3H4JA 3RM6A 5C4KA 3O8UA 4ZOGA 1XH9A 2PZ5A 5HVKA 4RC4A 3IPHA 4X21A 4ZS0A 5HBHA 4ZJIA 4APPA 4YMJA 3G6GA 5CSHA 3EQCA 3GBZA 3IDBA 3NPCA 1OPLA 1K9AA 1LPUA 2VO3A 3DKOA 3GVUA 4KIOA 5ETAA 3ZEWA 1WBWA 4M67A 1OPJA 4FKOA 1Q8ZA 3O8PA 5ETIA 4UB7A 1XH8A 2OZOA 3FMEA 3VQHA 2CNVA 3BGPA 3UC4A 2ZYBA 4O86A 1SZMA 2VTNA 3QTQA 5HNGA 4FTTA 2B52A 4O81A 1PJKA 4QTCA 4D2TA 4KABA 4TL0A 1AQ1A 4DTAA 1PXKA 2B55A 2OW3A 4TNBA 2ETKA 2J50A 2XB7A 3NNWA 4IAZA 2C1BA 2YJRA 3WF8A 3QKKA 3I7BA 4DE4A 4DTKA 4O22A 2BZJA 2VNYA 1MRUA 3PXFA 3L8VA 3IQ7A 3F3WA 4RC3A 3R1NA 3FLNC 3PG1A 4GRBA 3G0FA 2Z7QA 3QCYA 4JVGA 3A62A 3L8XA 3V6RA 3VUMA 5DRBA 4MTAA 2QNJA 3RNIA 3W2PA 5E8YA 4DH5A 4M68A 3BYOA 4E4NA 3E5AA 3OBJA 5DA3A 4DFLA 4BBMA 4UY9A 2YAAA 1R39A 4TT7A 2WGJA 3EL7A 5TT7A 5I9XA 2DS1A 3PSCA 4KINA 3CR0A 5FEEA 2C0OA 2XK4A 3DLSA 4BIEA 4F7LA 3CY2A 3AC4A 2IZUA 5C8KA 1LEZA 3HYHA 4LOPA 4C4JA 4FKIA 2CCHA 2A27A 2RFEA 3D5XA 2ZM1A 4E93A 4BC6A 1V0PA 3UOJA 2WPAA 4AW5A 4OLIA 1CSNA 3UIXA 4I0RA 4BDJA 4ASZA 3Q4TA 3W33A 5E1EA 3Q9YA 5M56A 4FSQA 4CLJA 2ITZA 4QP6A 2RFSA 3PJ1A 4QYHA 4FTUA 3CTJA 2C6LA 4JBPA 4FF8A 5CNOA 1PY5A 3FSKA 3UMWA 2PMLX 4FSYA 2R2PA 4U80A 5AUXA 1SVEA 4GG7A 3KRXA 2PZYA 4NT4A 4FT7A 4OT5A 4DA5A 2VRXA 3TNIA 5F94A 1G8SA 4L46A 3ITZA 2QO2A 4I22A 2JBOA 2WQNA 5BVDA 3QFVA 2EB3A 4DFUA 1RE8A 4PMSA 3WZJA 4RWJA 3WIKA 4NM7A 1GZ8A 4AFJA 3UIMA 2R3LA 3BGZA 2J0JA 5T68A 4O82A 3BYUA 3KGAA 5IH5A 3DTCA 1FVRA 3HMMA 3OHTA 5F1ZA 4G31A 4GG5A 5E8SA 2F9GA 4MQ2A 4IXPA 2P3GX 4JDKA 5J8IA 2NP8A 2KULA 4QMUA 2X4FA 4O0TA 3MTFA 1ERKA 3QC4A 4P7EA 2W1FA 5E8VA 5JT2A 3MTLA 2JDVA 1OL2A 1WMKA 3VQUA 2R3NA 4A9UA 3MB7A 4B8LA 4MYGA 3TL8A 4TYGA 3TV7A 3ZBFA 3O7LD 3BHUA 2BFXA 3E7VA 3QX4A 4KA3A 5GHVA 5IQEA 3SW7A 4EYJA 3A99A 3E63A 4O1PA 2OFUA 3R8VA 4C4GA 1H8FA 4BFMA 4FTKA 3TN8A 3WI6A 5EHYA 3C4XA 3TJCA 5B2KA 4MXXA 5E91A 4ACDA 4CMTA 3VJNA 1ZZ2A 1FGKA 2QLQA 2C6EA 3SGCA 3O0GA 2VWYA 4J97A 5J9YA 1GY3A 4TWOA 3VBVA 1O6LA 2W9FB 3DQXA 2QKWB 3DCVA 2H96A 2QHNA 3MJ1A 3RAHA 5A54A 3KXXA 4CKRA 5IA0A 1Y6AA 4K11A 2G2HA 4O6LA 3TNWA 2AC5A 4FKQA 4FKJA 4H3QA 5CANA 2JFMA 3LMGA 4ZY6A 1JAMA 2IZSA 2JDTA 3LZBA 1MQBA 3K5UA 3IW8A 4GK4A 2RG6A 2X2KA 3TKHA 3CGOA 3CEKA 2R3PA 3FC1X 2XIRA 3D15A 3II5A 5EHLA 5DHJA 5GINE 3NAYA 3P86A 4WRSA 4CZUA 2BHEA 4OTGA 3I1AA 5IQDA 5AR3A 2X7GA 5IUIA 1CMKE 4K33A 4IADA 3QQGA 4EOQA 2OO8X 5BMSA 3CQEA 3GI3A 3ZUVA 2XNPA 1B6CB 3B2TA 2PMOX 4Y95A 4JBQA 4FKRA 4E6AA 2W5BA 2ZMDA 5CAQA 2PVKA 4WG5A 4PL5A 3A7JA 4G3EA 4UBAA 3PJ3A 2Z2WA 3QTUA 4YJNA 3ERKA 1YXXA 3R8UA 4OBOA 4JJRA 4LV5A 4W4WA 2C6TA 5DR2A 2ACXA 5E8UA 1U4DA 2BFYA 3BU3A 3NWWA 4GYIA 2XMYA 2GHMA 4LG4A 4MD7E 4AA5A 5CAPA 1IAHA 4KBAA 4YSMA 3ZLWA 5CZIA 5EHOA 1H26A 2B0QA 3AC1A 3LFQA 3GOKA 3PA4A 4F9WA 4AZVA 1VEBA 1UWHA 3PG3A 2R7IA 2QOCA 3VVHA 4AE9A 5BYLA 4MBJA 2XYNA 3VS3A 4BL1A 5CTPA 4DH3A 4ENYA 4QQTA 2EXCX 2XM9A 3ZSHA 2PHKA 4BYIA 4DGLC 3R7OA 3COMA 3JVRA 4IZ7A 3S1HA 4KRDA 2BHHA 4EH4A 1FGIA 4CG9A 4XRJA 3TCPA 3EKNA 2WD1A 4EI4A 4YLJA 3PSBA 3SC1A 3CQUA 1PYEA 2GNHA 4EOOA 3BI6A 2Y6OA 2YM6A 4IVAA 1W84A 1R0PA 1TQMA 4JDHA 4QP1A 5LARA 4GT3A 4IEBA 1YXTA 1Q61A 4FV4A 4IB1A 4D0XA 3VRYA 1MQ4A 4I21A 4LGDA 3DY7A 4QMXA 4EH3A 3UZRA 3P23A 3FSFA 4PDSA 3MI9A 5C01A 5FQDC 4TXCA 4F0IA 4L3LA 3P7AA 4ZK5A 4AS0A 4FMQA 2XA4A 3GXLA 4BICA 3KCFA 3I6UA 4QYEA 3NVKI 2OZAA 3Q9WA 4F70A 3G0EA 4I4FA 5EFQA 5DGZA 3B8QA 5FTQA 5CEMA 4IAIA 5AP7A 2C47A 4D4SA 3L9NA 2R7BA 4KBKA 4I0SA 2VTOA 2VX1A 4RJ8A 3GQIA 5IF1A 4PPAA 4YO4A 3MVLA 2C3KA 4MKCA 4F9AA 4YJQA 5DOSA 3QRIA 3R7UA 5D10A 1OL6A 4CTBA 4ASXA 4O2PA 1NVRA 1PXOA 4D2PA 3BGQA 4F6WA 2Z7RA 4M3QA 4U8ZA 3HV6A 3IDCA 3FXZA 3ZM4A 1J1BA 2BRGA 5M53A 3RPVA 4QMPA 4XMOA 2G15A 3GC7A 2HAKA 4DINA 2DQ7X 5CF5A 2R3IA 2YIYA 1Q5KA 1W82A 5BVOA 3U4WA 5HO7A 2HXLA 4U79A 3WZUA 4R77A 4U41A 1XBBA 5H9BA 4TYHB 2HZ4A 3UYSA 3DBDA 2FB8A 3PY0A 5LXMA 5IQCA 1ZAOA 4IAKA 5M4IA 1WVYA 3DBEA 4MXAA 3PLSA 3AT3A 3TIZA 3SG8A 2R3GA 5HZNA 4EH5A 4ZSLA 4F09A 1UNHA 4LQMA 4M15A 5HG7A 4LYNA 3S0OA 2HWOA 3LCOA 3C0HA 4PDPA 5HD4A 5HTCA 2O5KA 3WZDA 3C5IA 2B9JA 3VUIA 2YAKA 2PVLA 1A9UA 5ICPA 5KBRA 2ITQA 4Q2AA 2P2HA 3PDTA 3S00A 4RX9A 2F7ZE 3DB6A 1YOLA 3DA6A 4DGOA 5D7AA 3ATTA 3NIEA 4D9UA 5CT7A 4RFYA 2BCJA 3UIBA 2VX3A 3PPKA 4XOZA 4ZTQA 2QVSE 3OT8A 4IBMA 2Q0BA 4WT6A 4FSWA 1UKHA 2CKEA 3NYOA 5CSXA 4QTEA 2RSVA 3NYNA 1UU7A 5ANJA 3QA8A 2UW9A 4YZDA 2PE2A 4KS8A 3I7CA 1WBTA 3KB7A 4W4YA 2HZIA 1BUHA 3KMUA 3FC2A 4R5SA 4RA5A 4RIOA 2UVZA 4BTMA 2X2MA 3UBDA 1OI9A 4FKUA 3OVVA 3PUPA 1XBAA 2H8HA 5FG8A 2YEXA 1KE5A 4WHZA 5EM8A 4GU9A 5DBXA 1GJOA 3IOKA 4DLJA 5F4NA 2QOLA 4IWPA 4EK4A 1E1VA 4FKGA 4FVRA 4K8AA 4QMZA 3SD0A 3OEFX 5KMIA 2WMUA 4ZJJA 4L52A 1OKVA 1GIIA 3LFAA 3BE2A 1R78A 3AGMA 3DBCA 5JKGA 3ZSIA 4LRMA 1APME 2PE0A 3OWKA 2UW5A 4AUAA 3VS7A 3GT8A 2B9IA 3SOAA 4FV6A 4R1VA 3HP2A 4CFWA 5G6VA 4O7ZA 1Q97A 4TYEA 4JRVA 4AZTA 3GNIB 4EHVA 1YWVA 3QZIA 2JITA 3VS4A 4PDOA 5L2QA 1DI8A 1OPKA 4HPTE 2ETRA 4EH2A 3KN5A 4LRKA 3V5TA 3Q2JA 2QD9A 4Y46A 3CXWA 3ORNA 1H0WA 2OIDA 4ALUA 4YJRA 3PE1A 2WMWA 3QQUA 4D5HA 4E4MA 3WE8A 4O0XA 3PE2A 3RK7A 3DBFA 3PWDA 1AD5A 2WMSA 1TKIA 5E8XA 4J7BA 2X8IA 4IWOA 4EQCA 3BPRA 4PF4A 3H3CA 4FTJA 2IN6A 3DPKA 2WTDA 3P7CA 3ZFYA 2PYWA 4AA4A 2P33A 3CTHA 3F7WA 5M06A 3A4OX 4C2WA 3QWJA 4HCTA 1FPUA 1Q3DA 1SVHA 3BYMA 2E9PA 3VO3A 3ZCLA 4OUCA 4F9YA 2CGUA 4RSSA 5DT0A 2W1HA 3POZA 3R9OA 5HQ0A 2ZAZA 1BI8A 4TYIA 3MIAA 4BZOA 2VWXA 5B7VA 3MV5A 1OM1A 3G9LX 3PJCA 1H24A 5D12A 5J1VA 3W18A 5TKDA 5CWZA 2GU8A 3R7IA 4C02A 3NNXA 3QTRA 4EH8A 4E20A 3CTQA 2R3HA 3MYGA 3NAXA 3Q6UA 2HELA 4IMYA 4ITHA 2O3PA 1MRVA 4IB5A 2ZB1A 3SG9A 4D4RA 5CI6A 5TO8A 3QRUA 1WCCA 5AP4A 2OXDA 4MWHA 5AIRA 3U51A 1DM2A 3COHA 1REKA 5HVJA 1T46A 2YISA 3C0IA 3PWYA 3BHTA 4G3CA 4G6LA 4P90A 2J6MA 5CNNA 2O65A 5M4FA 2CLQA 2QURA 4R7HA 5HG5A 2JIUA 4GIIA 2V55A 3MWUA 5CXHA 3EQBA 3DAEA 5CALA 3LE6A 4JAIA 2HYYA 3DXPA 3ANQA 2ZOQA 1GIHA 1VR2A 2G1TA 2C68A 3GCVA 2UZDA 2CPKE 2B1PA 4OTFA 2OH0E 3V8TA 5A4QA 1A48A 2BRBA 3EYGA 5D9HA 1Z5MA 5FXSA 4ZTLA 5BUEA 2E9OA 2XIZA 4X6QC 4RVKA 4EBVA 1XQZA 3R04A 4DEEA 3LFSA 1I09A 5HD7A 2WTJA 2YDKA 4M66A 4JG7A 5IQIA 1BL7A 3IK3A 3RPOA 3R9HA 3EB0A 5CX9A 4F7JA 2JAMA 2RG5A 2Y4IC 1GOLA 1IRKA 5FUTA 2J0IA 5EI2A 3VS6A 5AWMA 3MH0A 3OEZA 4WUAA 5HCXA 2QOHA 4F64A 5BUIA 4R7BA 5KE0A 4HVSA 4KNBA 5DEYA 3VF8A 2QOKA 4DEDA 1IAJA 1H1WA 3PXRA 5EW8A 4AN2A 4I6HA 5CEPA 3LCDA 3SXFA 4BGGA 4I20A 2Q0NA 4RRVA 3G90X 4PMMA 2GSFA 5IA4A 4BDEA 1DAWA 3QUEA 3C51A 2C6IA 2RKUA 3EIDA 2XNBA 4O38A 4QTDA 5E7RA 5LVOA 4EZ5A 4DT8A 4I5CA 2CKQA 4BWPA 3NW5A 5J87A 5HOAA 5C03A 3KF4A 3OCSA 3CLYA 2C5VA 3QLFA 3Q5IA 5ETFA 4FV2A 2JGZA 4O7TA 1KSWA 4RJ5A 2X39A 4JAJA 3NUXA 2CGWA 2WQOA 3QQHA 3FXWA 5HI2A 4AP7A 4D0WA 2NRYA 3FHRA 4GJ2A 4DHFA 5FM2A 2IO6A 2I0YA 2VX0A 4QP4A 3U6IA 2PUUA 1YVJA 4TN6A 5CEOA 4FIFA 3EQRA 3H0ZA 4O6EA 4ANSA 4BGHA 5AM7A 5AA8A 3HMPA 4Y85A 2O0UA 1L3RE 2XIXA 4RIYA 4G6OA 4GK2A 4L7FA 4PTCA 4FK6A 3UYTA 1WBNA 4ZTHA 3MH1A 4IAYA 1ZYSA 2HOGA 2VO0A 3BU6A 2W06A 2VTIA 4BKZA 1R3CA 4J53A 1E9HA 3RALA 4C35A 3FI3A 5HX8A 3O7LB 4UZDA 4QMQA 2XNGA 1GZKA 2OXYA 2V62A 4NTTA 3CY3A 3ORZA 4JX3A 3TUCA 2G9XA 5M09A 3KVXA 3HMIA 4FNYA 3QUPA 5CI7A 2FVDA 3PPJA 4AW2A 4ZY5A 2FSOX 4XRLA 4AZFA 5IEYA 5DR9A 3VUGA 1PMUA 4KKHA 3D2KA 4YBJA 3Q9ZA 3R00A 4FT0A 4H36A 2QOIA 3ZHPC 4FSZA 1OBDA 4IC8A 4DAWA 4G1WA 3OCGA 2A1AB 2PE1A 1KE6A 5C1QB 1Z9XA 3V8WA 4OT6A 3R22A 4YZMA 1JWHA 3ZZWA 1KV2A 1QCFA 2X81A 4GVAA 5BVFA 4QMLA 3PZHA 4YTIA 2FH9A 3E3BX 2JBPA 1GZOA 1NVQA 3KC3A 2W17A 3QQFA 2PL0A 1WBPA 1CKIA 2J0MB 2VAGA 3K5VA 4G3FA 3LLAA 4BCQA 3T9IA 2BKKA 4UALA 3LCTA 4APCA 2QQ7A 4NH1A 4GFOA 5JZNA 3FLSA 4EKLA 4Y5HA 5AV4A 2ITVA 4D55A 1VYWA 3MY1A 5KMMA 2XYUA 3GU7A 4YJTA 1ZY4A 2VWVA 4MH7A 2E9UA 1ZMWA 4FTMA 5HLPA 4CV9A 4F4PA 5L6WL 2UW4A 2P4IA 4EC8A 3U6HA 2PUPA 1J7LA 5DE2A 3I60A 4EHGA 2BROA 3OY1A 3VIDA 3BEAA 3NW7A 4GFMA 3TI1A 3WOWA 4C58A 3IG7A 4IVCA 3OD6X 3F7ZA 3VBQA 3B2WA 4YNEA 2JEDA 4FGBA 1J7IA 2ERKA 3SRVA 4FTCA 4Q5EA 1BX6A 1RDQE 5FP6A 1IA9A 2JIVA 1R1WA 4TZRA 3A7GA 5JGBA 5BVKA 3LXKA 4DH7A 2NNWB 4U6RA 5CSPA 2VD5A 2XKCA 2GQGA 4OTQA 5HX6A 3HV3A 1PYXA 2HENA 3NZ0A 5EYCA 3BBWA 4V0GA 3A8XA 3FLYA 3OWPA 1Q8TA 3ZO4A 3SVVA 4GK3A 5L2IA 2PVNA 3O51A 1W83A 2PVJA 5IZFA 3COKA 4J71A 5EG3A 1OECA 4FNZA 4KUJA 4JQ7A 4AOJA 3LCKA 4YJVA 3IOPA 3QLGA 2OLCA 4MHAA 4FTNA 5T6KA 3MVHA 3EJ1A 3RWQA 3DTWA 4RA4A 3IW5A 3KF7A 2YA9A 3LCSA 1S9JA 4R3RA 4O0UA 3QCSA 3EFLA 3R21A 5HCZA 5D41A 4ZMFA 4XG2A 3ZU7A 5L4QA 3KXNA 1URWA 3F3TA 4Q9SA 1YKRA 3ZYAA 3ZH8A 2HCKA 4DEAA 4PMTA 4X3FA 3Q4ZA 4EORA 4C34A 2CJMA 3QL8A 3FMHA 2ZM3A 2BZIB 5KMKA 3S2PA 2BIKB 4PNIA 2OK1A 3LFCA 4X2GA 5AJQA 3FQHA 1QPCA 3OFMA 4J8MA 4EH9A 5M4UA 3BU5A 4PP7A 3VBTA 5CQWA 4G9RA 3OBGA 5KMLA 4FSNA 2YN8A 3CGFA 4ANOA 2ITYA 4G34A 4H58A 4RIYB 5JH6A 4BYJA 2UZVA 1TQPA 3BLQA 3GCQA 4Y5QA 3TV4A 2CMWA 2VTSA 3BQCA 4ACHA 4BI0A 4D5KA 1G8AA 3LM5A 3E8EA 3F69A 3L9PA 2C6KA 2O63A 2XP2A 3D83A 3P0MA 3PJ2A 3TUBA 1JBPE 4JNWA 3C4ZA 4NU1A 3TZ7A 4DT9A 5JFWA 3GCUA 2GFCA 2VTPA 4RJ7A 4C3PA 4NJDA 3FZ1A 2BTRA 2YACA 4HCUA 4FG8A 4P4CA 1OMWA 3KRWA 3PXYA 2CDZA 3OY3A 3P1AA 3QTWA 4GW8A 4RIWA 4ACCA 1SNXA 4AOIA 3QKMA 4UMTA 1FINA 1XH7A 3DBQA 1Q24A 3KXHA 2J90A 5FXQA 4RT7A 1UVRA 1YDTE 2XJ2A 2Y0AA 3OZ6A 2RGPA 4CFXA 1JPAA 4HZRA 2X6EA 4R1YA 3FMMA 4A7CA 2GNFA 1L8TA 5IA3A 1SM2A 5IA5A 3BHYA 4I5PA 5A14A 3D94A 4GL9A 4IX4A 4D2VA 4DEGA 4FEWA 2OKRA 3U55A 3E3PA 4BCKA 5GZ8A 2UW7A 4QMSA 4DN5A 4R3CA 4KWPA 3NCZA 5LJJA 2PVFA 2QHMA 3L8PA 3TWJA 3E64A 2QI8A 3BWFA 4CFFA 3Q4UA 3NCGA 3FI2A 4QPMA 1M2PA 4YTFA 2QOOA 5EDRA 4O1OA 4PMPA 2PVRA 2OF4A 4ZJVA 3QA0A 4BKYA 3H10A 2O8YA 4RBLA 3PVBA 1OB3A 4CYIA 4MNEA 4GKIA 4A4LA 1P14A 1XR1A 2X4ZA 3PRIA 2Y4IB 4JT3A 4NJ3A 1X8BA 2ZV9A 3NIZA 4QP9A 3SRVB 5C9CA 4AU8A 3UMXA 4AE6A 2ONLC 1HOWA 3AD4A 3D2IA 2WMVA 3DK3A 3F5UA 4S33A 4XNEA 3ZOSA 4EHEA 4N57A 4FSUA 2JD5A 3ZUUA 2BAJA 3PA3A 5HO8A 3GFEA 2WMQA 4G3GA 3TNHA 3EFWA 3IW6A 4EOLA 2YWPA 4V0GB 2JKOA 4M84A 3D4QA 4OGRA 1DI9A 1YI6A 4FV1A 4PRJA 4YJSA 4BHNA 1E1XA 2ITXA 4J52A 3ET7A 5L2WA 4RQKA 3N4VA 4ZSEA 3QQLA 5KHXA 1BI7A 2WMBA 5HTIA 4Y73A 4BCOA 2XK8A 1FVVA 1NXKA 3NR9A 2ITPA 3DT1A 2CSNA 4FZ7A 4Y83A 4I94A 3Q3BA 4CEGA 1PF8A 4RQVA 5IPJA 4DTBA 3RZFA 4V05A 5HIDA 5DWRA 5J7HA 3CCNA 3H9RA 4XH6A 4CFNA 3COIA 1P4FA 4YPSA 5DPVA 3AGLA 4YO6A 5AV1A 5HGIA 4C33A 1MP8A 2B54A 4ZXTA 4ITIA 2OH4A 3KY2A 4AQCA 3BV3A 1J7UA 3E62A 2W5AA 2X7OA 4I5MA 5CSVA 1KUTA 4J8NA 3RVGA 3KXMA 3DFCB 3P08A 3S95A 4FT5A 4DFNA 2GCDA 5A3XA 1EH4A 4YZBA 3IKAA 4CD0A 5JGDA 3CQWA 4OAVB 3NYVA 3ETAA 1YI4A 2R3MA 3GP0A 3R0TA 4L01A 5E8WA 2B7AA 2OXXA 3W8LA 2R5TA 4FA2A 4XP2A 4Z7GA 4FTRA 3CKXA 4RC2A 1GZNA 1PXJA 5GJGA 1U5QA 4RX8A 2H34A 4C3FA 3NGAA 2OF2A 3QKLA 5JGAA 3LJ0A 4JXFA 4EYMA 2BZKB 2VGPA 3G33A 5JFVA 3R63A 4M97A 3GCPA 5EYMA 4PQNA 3RPRA 5DRDA 4Z16A 4ZP5A 4KD1A 4FUYA 3IGGA 4RIWB 4ONAA 4EK6A 4CYJA 2XJ0A 3UE4A 4KKEA 2XIKA 2OIBA 3UQFA 4W9WA 3ZMMA 2PUNA 1QPEA 1SVGA 2R4BA 4UWCA 4ZLOA 3FMLA 4IFCA 4NTSA 4QYFA 1H25A 3HUCA 3DDPA 3GENA 4B0GA 1UNGA 2XJ1A 4C3RA 4DEIA 5E92A 2VO6A 3DGKA 4XX9A 3TJDA 3OUKA 4B7TA 4ERKA 5AUTA 2XM8A 3DJ5A 3E93A 4FR4A 5KBQA 3I6WA 4JIKA 2ZJWA 2HZ0A 4PTEA 4CZTA 4PL4A 1XH5A 3TT0A 4ZZNA 5CT0A 4O0RA 3DOGA 3PFQA 1H01A 1J3HA 3CE3A 3SV0A 4FSMA 4D28A 2JC6A 4I6FA 3OG7A 2Y4PA 4K6ZA 4II5A 4FTIA 3QZGA 2J5EA 3HNGA 1JKKA 2J4ZA 3HMNA 2GQSA 4RWLA 5CLPA 4A9TA 5C26A 4YC8A 4RPVA 4A9RA 2F57A 5J9ZA 2R3KA 3WE4A 4FT3A 3RGFA 4RZWA 3ZLSA 1G3NA 1JOWB 1OKZA 5JEBA 3PP1A 4XS2A 3VUDA 1GNGA 4AGUA 5IA1A 2FSMX 2VO7A 3QF9A 3T3UA 4M12A 5KX8A 3OXTA 4RG0A 3KFAA 1SMHA 2LGCA 3JS2A 2ONLA 4JLCA 4AGCA 3HDMA 4EQMA 2OSCA 4ANNA 2UVYA 4AW1A 2VNWA 4C0TA 5GZAA 3HA8A 4WNOA 4BDDA 1AGWA 5AFVA 5HNIX 4XLIA 3AD5A 4EJ7A 2P0CA 4EWQA 3DK7A 3AC2A 4CKIA 4OTRA 4WA9A 5CXZA 4PPBA 2WOUA 3BRBA 2QOFA 2VWIA 3OOGA 2CN8A 1IG1A 1KOAA 1OUKA 1W7HA 3NUPA 4XJ0A 2W1IA 5FLFA 3U9NA 4WNKA 3BYVA 3BYSA 4QMWA 2WTCA 3R7YA 2YCSA 5FBOA 4R3PA 5ACBC 4C62A 3DB8A 1ZOHA 4L67A 2UW3A 5H8EA 5AAEA 2YIWA 4MF1A 5KUPA 3QYWA 4TNDA 4DG0E 3P78A 4FYNA 4YJOA 3W8QA 2W4KA 3HP5A 5A4CA 3UZPA 3EQHA 4BRXA 5HICA 1LR4A 2GS2A 4LGHA 4IX3A 4EQUA 4FODA 3GGFA 3AT4A 3UOLA 4QTBA 4CKJA 2ZB0A 5DI1A 3MA3A 5B0XA 3ACKA 1GIJA 2WKMA 3AMYA 5L2TA 3KQ7A 3LJ2A 3OW3A 4G17A 2P55A 4XG8A 5AP5A 2JDRA 2IW8A 4BCPA 5CF4A 3P79A 4IM0A 5CF6A 2IW9A 4YZNA 1ZOEA 4ZTRA 3VUTA 4NL0A 5DMZA 3OMVA 3P4KA 4IAFA 3LFBA 3LVPA 4XBUA 3M2WA 5KCVA 2VU3A 3GOPA 3VHKA 1MRYA 5L8JA 5I4NA 2YLFA 2ZDUA 2I0EA 3ROCA 2I1MA 3V5JA 4UMQA 1ZYDA 3FZRA 4CFUA 2W0JA 1B39A 3OROA 1H00A 3SHEA 4NM5A 3AC5A 4A4XA 3Q2MA 4XV1A 2PVHA 4B99A 4NYEA 3NNUA 5AR5A 1YHWA 4KIKA 2OJJA 3R02A 2C3JA 4BI1A 3ATSA 3K2LA 3C9WA 4AF3A 1TVOA 2G2FA 2QU6A 3PLAE 2C4GA 5IISA 1RQQA 5KMJA 2R3OA 3C4CA 3FLQA 1P5EA 3PXZA 3N4UA 4Z3VA 3LMIA 2OI4X 3JXWA 1YW2A 4HYIA 3D5UA 3K54A 3KULA 4D4YA 4DYMA 4GUEA 4FIIA 4I6QA 4YTHA 1OKYA 3HZTA 4HGTA 1ZXEA 3NUUA 1B38A 3V5WA 3M1SA 4X2JA 4G5PA 4LOQA 4PV0A 4BDKA 4DFZE 3UO6A 3W2QA 4F0FA 1CM8A 2W4JA 4L44A 4IH8A 5H2UA 4DEHA 2R3RA 2BDFA 3ODZX 4DFYA 4OAUC 2J5FA 2XKFA 3GB2A 4KS7A 3O17A 3JUHA 3TUDA 4YHFA 2CLXA 5HKMA 2QOBA 3F2NA 4E6QA 2W96B 3AMAA 3OWJA 3QHWA 4D1XA 2GTNA 2AYPA 5CU4A 5B2LA 3QXPA 3D0EA 5J7BA 4K77A 4WKQA 5KKRC 3ALOA 3OOMA 4YNOA 3DV3A 3NRMA 4GT5A 4HGEA 4I5HA 4RVTA 3R01A 5EM6A 3HMOA 4C8BA 2HXQA 4LM5A 4D1ZA 4EHZA 4MXZA 4C4IA 1ATPE 1R0EA 3ORIA 3FL5A 4ACMA 3T8OA 5F9EA 4E4LA 2PVYA 3OCTA 3CP9A 1U46A 4JDIA 3P7BA 1PXLA 2XEZA 1WBSA 3AQVA 2JIIA 1GAGA 2XK3A 2WU7A 2C0TA 4MVFA 2VGOA 5GIPE 3NUSA 2A2AA 4FSTA 4FVPA 4IDTA 5EW9A 3S3IA 2XBJA 4BCJA 2ERZE 4DBXA 2PZPA 4YHJA 1OIUA 3HRCA 4U43A 2BRMA 3QCXA 4G2FA 4I4EA 5FM3A 3UVRA 3ZO1A 4FEXA 5A4LA 4W9XA 4XYFA 2OU7A 5CEQA 3DAJA 5D11A 3UG1A 5J9LA 2BDWA 3FZSA 4ZSGA 1NT2A 2W1GA 2OFVA 2Q83A 4YBKA 3LW0A 3VUHA 4M7IA 4TPTA 3U9CA 3FMNA 3UP2A 4C37A 4TWPA 3ZO2A 4GIHA 2HW7A 4FI1A 3R8PA 4ORKA 4BDAA 2PY3A 4RVLA 5JRSA 1MUOA 1YXVA 5GNKA 1A06A 5A9UA 4R7IA 4BBEA 2VTAA 3PRFA 2C1AA 3LFDA 2UW6A 3JY9A 3FUPA 3UVPA 2VV9A 3G51A 4RWIA 4FL1A 3UP7A 3BWJA 3A4PA 2J7TA 3C50A 3NUNA 3RK9A 2OZAB 5HU9A 2G2IA 4E3CA 3UOHA 3FY2A 2HWPA 3G5DA 4J96A 2PZRA 3HECA 4QT1A 5HIBA 4MD9E 3SDJA 3JVSA 3UDBA 3I81A 3EOCA 1J1CA 3ALNA 4R78A 2VWBA 2R0IA 4O7WA 3EQIA 3C4WA 3QALE 3NYXA 4FTOA 4U0IA 4EUUA 4ITJA 2B4SB 4IW0A 4DH8A 4GUBA 4F1MA 2WU6A 3SA0A 3W32A 4KB8A 4FZDB 1YXSA 4WOVA 3MBLA 1BYGA 1OVEA 3LQ5A 4IWDA 2VWWA 1ZARA 4DG2E 4EOMA 1OL5A 4CRSA 3DXQA 3NDMA 4D1SA 5EK7A 4BDGA 2UV2A 3EN6A 3FKOA 4FOCA 5I0BA 5IMEA 2F2CB 1JSVA 3KRLA 4FKVA 4GMYA 2R64A 4FKPA 5ANKA 4D4VA 4KIKB 3KXGA 4JI9A 3KREA 3R7VA 3UC3A 3ENMA 5KMNA 2BDJA 1Q4LA 4C57A 2XNMA 3VBYA 3A60A 4HNFA 4PUZA 5A46A 3RCJA 2FA2A 1OL7A 2H9VA 2W4OA 3R30A 3A2CA 4F6UA 3DDQA 4L9IA 3I79A 3KULB 3DAKA 2ZV7A 4WBBB 3EN5A 4GEOA 5ACKA 2LAVA 4PX6A 3JPVA 3MPAA 5D7VA 1PXNA 3T3VA 4PPCA 3BIZA 3C5UA 1Q8YA 3EN9A 3ZO3A 4MX9A 5LWNA 4AZWA 4GYGA 4KSPA 4YHTA 2RFDA 2YM5A 4U9AA 3VNTA 1Y8GA 5H3QA 3ZC5A 4FKTA 3F6XA 3RCDA 5GIOE 4JG6A 3LLTA 4BY9E 4L7SA 2J9MA 4W4VA 3RHXA 4L42A 4A4OA 5AR4A 5EKOA 5EOLA 5BVEA 5FWKK 2IVVA 2W05A 4K9YA 4BCHA 4ARKA 2XUUA 4DGNA 2XRUA 3O23A 5CQUA 4KBCA 4WIHA 4CMOA 5HTBA 4NZWB 4FTQA 4N6ZA 3FLWA 4QOXA 3V01A 1IEPA 4EC9A 4DG3E 3M11A 1UV5A 3SOCA 4EOPA 3P5KA 2JKMA 2FUMA 4HNIA 3F88A 3N51A 4H3PA 3TKUA 3BE9A 4QMNA 4MK0A 4XUFA 3W2RA 4P2KA 2X7FA 4FIJA 1LP4A 3G9NA 2WEVA 4CFVA 4Z55A 3UIUA 3LQ3A 4W4XA 5JZJA 2UZLA 3DKCA 3UO4A 3LOKA 5AP3A 3VUKA 4IB3A 3E87A 1FOTA 2Y6MA 3NSZA 2V0DA 2QG5A 3ZRLA 5IQHA 4I23A 2WXVA 1P2AA 2BVAA 2YM3A 4YJUA 1KE7A 2ZMCA 1QPDA 3IO7A 3ZXTA 4N6YA 3QX2A 4XBRA 3RHKA 3ZLYA 4F08A 2PK9A 4M8TA 4E5AX 5DR6A 4J98A 3UNKA 4X3FC 4U45A 4C7TA 3VAPA 3EL8A 2R3JA 1IASA 2GDOA 4FIHA 1K2PA 4R8QA 5E90A 1W8CA 3KMWA 2YCFA 4E5WA 2Z60A 3F5XA 2BIYA 4FICA 5IEVA 2C5OA 3E92A 4TRLA 4UWBA 5DYJA 4RJ3A 3CC6A 4O0YA 2PWLA 3HEGA 2YJSA 5K9IA 3WF7A 3V04A 5I9VA 2F2UA 3K3IA 3IECA 5EM5A 1U59A 3H0YA 3L8SA 4XV3A 2WIHA 2A19B 1V1KA 2WMXA 3NLBA 5DH3A 4BI2A 3MH3A 4JR7A 4YJPA 3ID6C 4JR3A 2C3LA 5I9WA 4ASEA 4M69A 2VTQA 4F1TA 3WYYA 4O91A 4FV9A 4QNYA 5ETCA 4FE2A 1ZOGA 1Y8YA 3TZ8A 4ZLZA 3IW4A 4X3JA 4ZTMA 1QPJA 4FNWA 2GFSA 4EBWA 3OP5A 3Q52A 4QMVA 3VS1A 4M14A 3LFEA 2UW0A 1UU9A 2F4JA 4S30A 1XHAA 4J95A 3WF6A 3HGKA 4CT1A 4F7NA 4RIXA 4YR8A 4CT2A 2GNJA 2IJMA 5HBJA 4AAAA 2SRCA 2C0IA 3GU4A 1ND4A 4FZ6A 4BCMA 1W0XC 1ZLTA 3F3UA 3ORTA 4QPSA 4N70A 3NVMB 2X1NA 4MXYA 3QTIA 3M42A 1JVPP 5AM6A 2FO0A 5ITAA 5HESA 2CN5A 5M08A 3FE3A 3KRRA 4XV2A 5HE0A 5J5SA 2BZHB 5BPYA 1JSTA 1M2RA 1UU8A 4YZ9A 4PWNA 4LL0A 1KV1A 4UV0A 5HG8A 2J51A 3OF0A 5ANGA 1Q41A 3QRKA 5AP1A 4CCBA 4HVDA 5H8GA 1WFCA 4JQ8A 3RNYA 3PP0A 2XK7A 3PYYA 4MXOA 1Q8UA 2X8DA 2X9FA 2Z02A 5AUWA 2WQBA 5AR8A 5JSMA 5LMAA 3RZBA 3W55A 3BHVA 3ULZA 4CMUA 3ZBXA 4ZLYA 3PIYA 4F0GA 4K0YA 1UNLA 5JQ8A 3BZ3A 3OW4A 5EDQA 4TTHB 4BHZA 2PMIA 4AZSA 4MCVA 5AAFA 4X2FA 4V01A 4MBIA 3UPZA 3TZMA 5J5TA 3BQRA 3PZEA 4FTAA 3MA6A 3TXOA 4IAAA 5BYZA 2YCRA 3QC9A 2J2IB 4AGWA 5I9ZA 5KKRB 4FG7A 3TKIA 4I0TA 3TTJA 3BCEA 2X0GA 4AA0A 2ZM4A 1KOBA 5FDXA 5K3YA 3LXNA 3ELJA 2O2UA 5L8KA 4ZAUA 3ZLXA 3HAMA 1Y57A 1PW2A 5LMKA 3OXZA 5LCKA 4O7SA 3GEQA 4TWCA 3QRJA 3HDNA 2QU5A 4KIPA 4A07A 4AW0A 5M51A 3HRBA 3WIGA 3VS2A 4HOKA 2HK5A 2XKDA 1UA2A 2QOQA 3VC4A 3WF5A 2RIOA 2WAJA 3ZDUA 5CYIA 2UUEA 2XCHA 5EQPA 3LAUA 4HGSA 5IH4A 4DGMA 3QD3A 4CSVA 3OTVA 3ENHA 4FX3A 1V0BA 2I6LA 5CU0A 3Q32A 2HW6A 4WBOA 5GJFA 5H8BA 5KZ0A 2YZLA 1SNUA 2ITWA 2I0VA 2WFYA 4EK8A 3UGCA 5AP2A 5C4LA 2UZUE 3R1YA 4E26A 3ZS5A 3HL7A 3GFWA 3SAYA 4WSQA 4HVGA 4FVQA 2FSTX 5J79A 5DT3A 3E8NA 3AT2A 1PXMA 3R8MA 4E4XA 5M07A 2B53A 4XHKB 2VTHA 4EZ7A 3GCSA 4USEA 4XG7A 2VWUA 3QQJA 2JKKA 3V5LA 4CVAA 4GVJA 2WHBA 1FQ1B 5CEKA 4B6LA 4R6VA 4TY1A 4RLLA 5HE3A 4E1ZA 2FSLX 3QRTA 1M7NA 1QL6A 5C8MA 3FPQA 4ZY4A 1M7QA 1ZRZA 1XBCA 3FWQA 4GS6A 4G9CA 4S32A 4KRCA 4BCFA 5C8NA 5IA2A 1ZY5A 4M69B 3FZOA 4QP7A 5AV2A 5JMSA 2VWZA 4F9BA 5D1JA 4L45A 4FV7A 1ZYJA 2EU9A 4AWIA 2GS7A 2W7XA 3HV7A 3KVWA 1PKGA 3MFRA 3FV8A 2WMAA 3PVWA 5AUUA 4PTGA 3OCBA 1YHSA 1QMZA 2ZV2A 1FVTA 4H1MA 4NKAA 4RIXB 3F66A 3QGWA 4FKLA 4QYYA 1WVWA 5HHWA 4IX6A 2UVXA 2BILB 5KHWA 4YC6A 4A9YA 2EUFB 4D2SA 1F0QA 4RLKA 2Y9QA 3QZFA 3ORMA 3TZ9A 3ZXZA 5TR6A 3LHJA 5I5ZA 3L9LA 3MGYA 5CY3A 3LMHA 2H6DA 4ZMEA 5CAVA 4L43A 1YWRA 4YPDA 3SQQA 3CBLA 4EONA 4JDJA 3QQKA 4XG3A 4E7WA 4F63A 1H08A 2XZSA 2YFXA 3OT3A 5A4EA 2IPXA 1CKPA 5IUGA 4EK3A 4C59A 2OG8A 3CD8A 4IFGA 3RTPA 3UG2A 3Q9XA 4OTWA 4ZS4A 4ZSAA 4BZNA 1S9IA 3JYAA 3LFNA 3TACA 2RF9A 1YDSE 2UZTA 4NW5A 2Z7LA 5DNRA 4ALVA 4O0WA 3FEGA 5B2MA 4NCTA 3IGOA 5HCYA 5FTOA 1STCE 4QRCA 4Y72A 3RBWA 4FEUA 5ANOA 3OS3A 3RKBA 4QMOA 4BCGA 2V7OA 5HIEA 3FXXA 2YIRA 4QMMA 4IB0A 4FIGA 2ZVAA 5A6NA 4NKSA 4DFXE 2ITTA 3NUYA 2C69A 3NNVA 3GC9A 4H3BA 4JBVA 3FZTA 3VN9A 3ZSGA 4AOTA 4FOBA 3P9JA 5CAUA 4FIEA 2V7AA 4FGRA 2HY0A 4DLIA 5FD2A 4ASDA 3R8ZA 4M13A 2E9VA 4NIFA 4J99A 1KE8A 5LVPA 3N9XA 1FMKA 3HRFA 4HGLA 2VTJA 2GTMA 3W2OA 2JKQA 4QNAA 1PMEA 3N4TA 4XV9A 5JN2A 1PMNA 3MN3A 5E9EA 3Q96A 2CGVA 4QYGA 2PZIA 4G16A 2VTRA 3RAWA 2Y7JA 4FYOA 5HORA 4C38A 3FL4A 4L6QA 3EQFA 4H39A 4WNMA 5EYDA 4BIBA 5E4HA 5BVNA 3R9DA 2REIA 2ZV8A 5CVGA 4KAOA 4XP0A 3KU2A 3FYKX 3QGYA 2OJ9A 2XF0A 5DLSA 1BL6A 3E7OA 4LFIA 3LQ8A 5CS6A 3JY0A 4BWKA 4CLIA 4V04A 4EOSA 3ORKA 1PRYA 4X2KA 4O7YA 2OWBA 2IWIA 2QR8A 2XNEA 4X3FB 2ZDTA 3VF9A 3W16A 4GCJA 3L1SA 1JKSA 1OIRA 2NO3A 2X6DA 4IX5A 3T9TA 4RGJA 1H28A 2C5XA 3KCKA 3GC8A 1G5SA 3K3JA 4NEUA 4CXAA 3GU6A 5CSWA 3AOXA 4HYHA 2CGXA 1U5RA 4NK9A 4U81A 4AGDA 5DFPA 2BAQA 1F5QA 3C4FA 5HEZA 4WSYA 2R0UA 2W5HA 3ANRA 4RX5A 2UZOA 4FV5A 3RI1A 3DS6A 4ANLA 4QTAA 3RP9A 4OTDA 5K5XA 2XVDA 5EW3A 4CZYB 4LOOA 4RJ6A 4BCNA 4D58A 2IVUA 5I9YA 3LXLA 5EDPA 4EUTA 5I3RA 3MSSA 3PXQA 5GZ9A 3W2SA 4UN0C 4YLLA 3LPBA 2XCKA 1M14A 3HV5A 3SKCA 1NA7A 4DCAA 1T45A 2WMRA 3MH2A 2IVSA 2Z8CA 5L8LA 3PIZA 3AD6A 3FPMA 3WBLA 1JKLA 4BZDA 4EEVA 4FTLA 2YWVA 2OIQA 2X8EA 2OGVA 2WB8A 3RWPA 3IONA 4BTKA 2VUWA 4GFGA 5JQ5A 3QWKA 1YOMA 5IEXA 3UQCA 4M0ZA 5K4JA 3IS5A 4LUDA 2XKEA 4TYHA 1P4OA 2QLUA 3DNEA 3G2FA 5HLNA 2ETMA 1RJBA 3O2MA 3TNPC 4BCIA 2UZNA 3A7FA 4UZHA 1TQIA 3HX4A 4I24A 3MY5A 3EYHA 5M4CA 4LL5A 4XCUA 3DZOA 4W8DA 4ID7A 4ALWA 4MQ1A 3A61A 4EOJA 3UJGA 4TWNA 5J1WA 3NEWA 1ZMVA 2GNLA 3DKGA 4CNHA 1LEWA 3DJ6A 5BVWA 4FSRA 4N0SA 1PMVA 3D5WA 3ODYX 4BDIA 2UZBA 4UMRA 3PXKA 3V5PA 4K1BA 5TE0A 3I0OA 2WTKC 2X9EA 4UYAA 2ITUA 3BLHA 1W98A 4IZYA 4X2NA 3FMDA 3VBWA 4ZTNA 5LVNA 4XG4A 4HPUE 3RJCA 3U8WA 4USFA 4MNEB 5JFXA 5BUJA 3CPCA 3LM0A 1JNKA 4DF3A 2VN9A 1URCA 3R71A 1CTPE 1H1SA 1Q99A 4MXCA 3EQPA 3WZKA 4JRNA 3ORXA 5FEQA 3R83A 3VS5A 3AC3A 5BNJA 3MESA 4O7VA 3FJQE 3D9VA 4NIFB 3QYZA 2WZJA 2PUIA 4UX9A 3R7GA 3EZRA 4HYSA 5AP6A 3MW1A 3UVQA 1OL1A 3GU5A 4OW8A 3FKLA 4IE9A 1YXUA 4CG8A 2E2BA 1OITA 2OJIA 2R3FA 3VULA 3ZC6A 1JSUA 4LMNA 5CASA 2X2LA
chains in the Genus database with same CATH superfamily
4QPAA 4KIQA 5K0KA 3D7ZA 4DBNA 4C4EA 3POOA 3VS0A 5FXRA 3WF9A 3G15A 5FGKA 1M52A 5CU3A 1Y91A 4O96A 3KXZA 5E8ZA 4YC3A 2I40A 5EOBA 3R9RA 2WELA 4YLKA 3R1QA 4S31A 4HJOA 1Q3WA 3QTSA 1DAYA 4U7ZA 1KWPA 4ZEGA 1M17A 3EN7A 4IVDA 4QP8A 2JDOA 2AEGA 3S4QA 5IG1A 3O50A 4KKGA 3IDPA 2YDJA 1HCKA 4YGAA 4GKHA 2WO6A 3EMGA 3MIYA 4I92A 5GJDA 1XH6A 1H0VA 2WTVA 4RX7A 3Q5ZA 4TKSA 4XP3A 4O7LA 2OJFE 5K5NA 2W1CA 3LXPA 4IWQA 3U54A 4YZCA 3W0NA 1NVSA 3ACJA 3VONA 4O84A 3MVMA 4AN9A 3TTIA 2IW6A 5F95A 4IVBA 3F9NA 3AG9A 3QCQA 3QUDA 5IKWA 3NMUF 5ANDA 5AUYA 4Y8DA 1H1RA 4OTHA 4I1ZA 2Z7SA 4JS8A 2XK6A 4A9SA 5IMXA 3MDYA 4GSBA 4IHPA 3MJ2A 3FQSA 2BMCA 4I6BA 4QQ5A 4BN1A 5K4IA 3TDVA 2YITA 4F78A 3DLZA 1YRPA 5HG9A 3JR1A 2XIYA 2W1ZA 4BKJA 3THBA 5IU2A 2EXEA 2CKPA 2V22A 2J0KA 1OZ1A 5KNJA 5F20A 2GS6A 4UMPA 2BR1A 2BPMA 4ZTSA 5TOZA 3F82A 3BELA 4FKWA 4MWIA 4RFMA 4DITA 3C13A 3WZEA 4X6RA 5FP5A 2J0LA 3PTGA 2CHLA 4Q5HA 4QP2A 4C2VA 3G6HA 5CU6A 2PU8A 2P2IA 2YCQA 2YM7A 4HYUA 3FHIA 4UXLA 3SXSA 4C61A 5LOHA 3BX5A 4IQ6A 3ULIA 2XK9A 3REPA 5IQBA 3CJGA 1H27A 1WBVA 1UKIA 1I44A 4RMZA 1IA8A 3EFJA 3SXRA 4MD8E 4EH7A 5EH0A 3E88A 1O9UA 4NSTA 4YTCA 4F65A 4FEVA 2VTMA 4ZZMA 1PXIA 4BDCA 3MPMA 4BIDA 4CGAA 4CV8A 3EKKA 2C30A 3D7TA 2YABA 1M2QA 3DXNA 2EVAA 4O0SA 4WNPA 3LFFA 3R73A 4WG3A 2A4LA 3Q60A 3LIJA 2BRNA 3I4BA 4EWHA 2NRUA 4LDTA 3DKFA 3FI4A 2GNGA 4FV3A 4DCEA 5IQGA 2W1EA 3Q4CA 4JX7A 5AEPA 1PXPA 4USDA 4PY1A 1KE9A 3VW6A 3WYXA 4DFBA 2YLEA 3DK6A 4C4FA 4YURA 3U6JA 3WILA 4BTFA 2YHVA 4NM3A 3CKWA 3VHEA 4BBFA 5IDNA 1K3AA 3KRJA 4CFMA 3MFSA 3PIXA 3V8SA 3VWAA 1VYZA 4L3JA 4QMTA 2QODA 3HLLA 4G5JA 3KK9A 3W10A 5JK3A 1Q62A 4MF0A 2Y8OA 4EOKA 4UYNA 4NWMA 3Q6WA 5AADA 1Q8WA 3C4EA 1YDRE 3DNDA 4FC0A 5E1SA 3TG1A 4HVHA 3DU8A 5BX0A 4O27B 3CPBA 4DH1A 5HLWA 3QAME 4LGGA 5L6PA 3UNZA 3ZZEA 4BB4A 3LKMA 4AT4A 5EYKA 4AT5A 1H1PA 3QXOA 3C7QA 3OUNB 2DWBA 4XG9A 5AV0A 4YP8A 4IZ5A 3NW6A 4CTCA 2YDIA 2QC6A 2YM4A 4L3PA 5DT4A 5K0XA 2QG7A 2JDSA 4RVMA 3ZFXA 5IQAA 5EM7A 2OICA 4AACA 2GQRA 1YHVA 2YIXA 3FQEA 1HCLA 5AMNA 4F9CA 1ZZLA 3QD0A 4B8MA 3OXIA 4FEQA 2GPHA 4X0MA 2WOTA 3HA6A 5L6OA 2EB2A 3FLZA 2XRWA 2HY81 3FZPA 3W1FA 4JL9A 3BL7A 5EQYA 2FYSA 3I5ZA 3QTZA 2ITNA 2A0CX 3KKVA 3QTXA 4HCVA 3B8RA 4K18A 3KL8A 4WUNA 3Q04A 2V5QA 2WNTA 3A7IA 1UU3A 4Z9LA 1H07A 4XG6A 4ZIMA 3MY0A 3QHRA 4U40A 4RJ4A 3R7EA 4ANBA 4IJPA 4EZ3A 3E8DA 5CZHA 4ERWA 5AR2A 5HO6A 4GH2A 4FL2A 3IW7A 4GU6A 1H4LA 4IJ9A 3I0QA 4E73A 4EL9A 4UXQA 5FDPA 4ANMA 2IZRA 4P5QA 1Y6BA 4EJNA 2W99B 4L8MA 2XNOA 3QD4A 2WTWA 4LI5A 4QQJA 4I93A 3HVCA 3R1SA 3BBTB 3FBVA 4O83A 3UZTA 3PPZA 5IUHA 5BMMA 4H1JA 5T3QA 2WEIA 1OIYA 5CEIA 3UQGA 2NPQA 2YIQA 4ZSJA 4AT3A 4LRJA 5ANEA 3OTUA 3BHHA 2IVTA 4D2RA 1YOJA 2ESMA 4AFEA 3HKOA 1XMLA 5JFSA 4YUQA 2PPQA 3NFFB 4KSQA 3U4UA 2GNIA 4NM0A 3SX9A 4FG9A 5AP0A 2IG7A 5CVFA 3OC1A 3O96A 2DYLA 3AMBA 2JLDA 4L53A 2B9HA 3TEIA 5AA9A 4CQGA 5CF8A 3QBNA 4I3ZA 2XNNA 2CNQA 3EWHA 4D2WA 2WMTA 3Q53A 4FUXA 3ZEPA 4FZAB 1IR3A 4OR5A 4PP9A 3BL9A 3DJ7A 3PVGA 3FY0A 3SW4A 1DS5A 4LMUA 4XLVA 3UODA 3GQLA 3V6SA 3GUBA 4U3YA 1PKDA 1XMMA 2QO9A 3R8LA 4YU2A 3CJFA 4RFZA 4TYJA 5EI8A 2UW8A 1YWNA 3TIYA 5KMOA 3RPSA 4IM3A 5G1XA 3RK5A 2CCIA 2WIPA 3H30A 4O21A 4UWYA 3D7TB 2E9NA 4FBXA 2BTSA 3NS9A 5M44A 3EH9A 1H1QA 2YM8A 1OIQA 2QR7A 3NUAA 2GMXA 2OJGA 1YI3A 3PY1A 2DUVA 3ROYA 4G6NA 5HE2A 3ZFMA 1OBGA 2WTKB 3BLRA 4WG4A 5AX3A 5LMKC 3KK8A 2WQEA 4CQEA 5HE1A 4F7SA 1BLXA 2C5NA 2ITOA 3GC0A 1OUYA 5LCJA 3E8CA 3F5GA 4OBPA 4F99A 4WRGA 4RWKA 4N4SA 3PY3A 4ACGA 5BQ0A 3RAIA 2HIWA 3QD2B 2PULA 4IZAA 2VTLA 2RFNA 5AX9A 1U54A 5KZIA 5DVRA 2VZ6A 2BKZA 3RMFA 4E6CA 2W1DA 2F49A 3MPTA 5EI6A 4PDYA 4NUSA 1VZOA 2IF8A 3FYJX 3EN4A 2EXMA 3L9MA 3A7HA 3U87A 3V3VA 4BF2A 5LMBA 4O4CA 4H05A 2PVMA 3O8TA 1RW8A 1XO2B 2CNUA 5L2SA 1FBNA 1WBOA 3O71A 4OBQA 5KO1A 5DEWA 4NW6A 2UZEA 3CS9A 3V5QA 1XJDA 3F3VA 1WVXA 2C6DA 5HVYA 5IQFA 1JQHA 3RINA 5LVLA 3FKNA 4NFMA 3TNQB 4ANQA 4ENXA 4FK3A 3UNJA 5I3OA 3VRZA 4E8AA 4EK5A 4F1OA 4MNFA 4BDHA 4MEDA 4PNKA 2IZTA 3FDNA 4A06A 3FMJA 2FGIA 1Z57A 3I5NA 4BR3A 2GHGA 4EOIA 4QP3A 5EQEA 3EHAA 4O0VA 3EQGA 4W8EA 4WD5A 4CCUA 4DGGA 1YQJA 5TF9A 4AG8A 3BKBA 4S2ZA 3C0GA 3H9OA 3KEXA 2F7XE 4FNXA 4G3DA 5BYYA 2C6MA 4BTJA 1VJYA 1JKTA 1XH4A 4B4LA 5E8TA 5EKNA 3F5PA 5LQFA 2PMNX 2EWAA 3KMMA 2PTKA 3DFAA 5CENA 3UPXA 2I7QA 3PVUA 4JOAA 1FMOE 1ZYCA 2BALA 2OBJA 5C27A 3ZM9A 2W9ZB 4K2RA 2QKRA 4QMYA 3MB6A 4U3ZA 3ZUTA 3BV2A 4EH6A 3KA0A 5FTGA 1REJA 3MFUA 4FKSA 4FV0A 4FV8A 4GJ3A 3DZQA 1O6KA 5JRQA 4Q9ZA 3UTOA 3MVJA 4PL3A 4IANA 4JBOA 4BDBA 3FI8A 3R9NA 3OWLA 5DG5A 3ZDIA 2WTIA 3GU8A 2YERA 4O7RA 4EKKA 4C36A 4E5BA 4XEYA 5LVMA 4L00A 4AX8A 3WARA 3MFTA 4AXAA 2I0HA 3DQWA 3AXWA 4U5JA 3UOKA 4IM2A 5M57A 4QO9A 3R2BA 1ZWSA 4MBLA 3D5VA 4D9TA 1ZMUA 2UZWE 1W2CA 4QD6A 4JIAA 5J95A 3ZRMA 3VJOA 3H9FA 2QONA 3C1XA 4O2ZA 3F61A 4UEUA 4HZSA 3EZVA 5IDPA 3AC8A 2QO7A 5FBNC 1OGUA 3ORLA 3UO5A 3ZONA 5CU2A 1BKXA 5M55A 2C6OA 3BEGA 4NCTC 4AN3A 2KTYA 4LUEA 5IH6A 4FT9A 4BGQA 4IC7A 2JFLA 4JG8A 4MAOA 2BAKA 3RPYA 3PSDA 4FZFB 2BUJA 3NX8A 4F6SA 3KN6A 1UWJA 4P5ZA 5CVHA 3EQDA 2XH5A 5AV3A 5HNBA 5DIAA 3ZRKA 4B9DA 3LJ1A 4GV1A 4NFNA 4CRLA 1CKJA 4J1RA 5CAOA 2C3IB 2XEYA 3CIKA 3HV4A 3F3ZA 4S34A 4OTPA 2B9FA 4IACA 2C5YA 3MS9A 4R5YA 4FL3A 3FAAA 3ORPA 3PA5A 3R2YA 2RL5A 4X7QA 4XOYA 5A4TA 1O6YA 4OTIA 5HBEA 2WQMA 3VBXA 4O7NA 2G01A 4BWXA 4UMUA 2F7EE 3RAKA 1ZYLA 5FEDA 4Z7HA 2AC3A 3FMKA 1V0OA 3R6XA 5AUZA 1CDKA 4L68A 5ANIA 2CKOA 1PHKA 3TM0A 4C4HA 2YZAA 4IIRA 4HVIA 3V51A 4AZEA 2VTTA 1U54B 3W2CA 4GT4A 3EFKA 3VW8A 1NW1A 2HZNA 5AIKA 1OKWA 4MUQA 4QQCA 1LUFA 2BRHA 3RM7A 2O64A 2NYAA 5AAGA 4ZZOA 4I41A 4LV8A 4JQEA 4U97A 2JAVA 4IDVA 3D14A 5DN3A 3CSVA 5LWMA 1WAKA 2PSQA 4YSJA 1WZYA 2QCSA 4RZVA 2GHLA 1XKKA 3PJ8A 4E6DA 3HAVA 2XS0A 1JLUE 4M0YA 1NY3A 4U44A 2R9SA 3TV6A 3R28A 1BMKA 5AR7A 3QU0A 4U42A 3HUBA 1J91A 3QZHA 4DEBA 2XBAA 3F2AA 1XWSA 5I9UA 5L3AA 4WO5A 2R3QA 1F3MC 4BDFA 3ZTXA 2AUHA 1SYKA 4BVUA 4DC2A 4HW7A 5AUVA 3A8WA 5A6OA 3F2RA 3SLSA 5HU3A 4TW9A 5FRIA 3CD3A 3TDWA 3H4JA 3RM6A 5C4KA 3O8UA 4ZOGA 1XH9A 2PZ5A 5HVKA 4RC4A 3IPHA 4X21A 4ZS0A 5HBHA 4ZJIA 4APPA 4YMJA 3G6GA 5CSHA 3EQCA 3GBZA 3IDBA 3NPCA 1OPLA 1K9AA 1LPUA 2VO3A 3DKOA 3GVUA 4KIOA 5ETAA 3ZEWA 1WBWA 4M67A 1OPJA 4FKOA 1Q8ZA 3O8PA 5ETIA 4UB7A 1XH8A 2OZOA 3FMEA 3VQHA 2CNVA 3BGPA 3UC4A 2ZYBA 4O86A 1SZMA 2VTNA 3QTQA 5HNGA 4FTTA 2B52A 4O81A 1PJKA 4QTCA 4D2TA 4KABA 4TL0A 1AQ1A 4DTAA 1PXKA 4QDEA 2B55A 2OW3A 4TNBA 2ETKA 2J50A 2XB7A 3NNWA 4IAZA 2C1BA 1W2FA 2YJRA 3WF8A 3QKKA 3I7BA 4DE4A 4DTKA 4O22A 2BZJA 2VNYA 1MRUA 3PXFA 3L8VA 3IQ7A 3F3WA 4RC3A 3R1NA 3FLNC 3PG1A 4GRBA 3G0FA 2Z7QA 3QCYA 4JVGA 3A62A 3L8XA 3V6RA 3VUMA 5DRBA 4MTAA 2QNJA 3RNIA 3W2PA 5E8YA 4DH5A 4M68A 3BYOA 4E4NA 3E5AA 3OBJA 5DA3A 4DFLA 4BBMA 4UY9A 2YAAA 1R39A 4TT7A 2WGJA 3EL7A 5TT7A 5I9XA 2DS1A 3PSCA 4KINA 3CR0A 5FEEA 2C0OA 2XK4A 3DLSA 4BIEA 4F7LA 3CY2A 3AC4A 2IZUA 5C8KA 1LEZA 3HYHA 4LOPA 4C4JA 4FKIA 2CCHA 2A27A 2RFEA 3D5XA 2ZM1A 4E93A 4BC6A 1V0PA 3UOJA 2WPAA 4AW5A 4OLIA 1CSNA 3UIXA 4I0RA 4BDJA 4ASZA 3Q4TA 3W33A 5E1EA 3Q9YA 5M56A 4FSQA 4CLJA 2ITZA 4QP6A 2RFSA 3PJ1A 4QYHA 4FTUA 3CTJA 2C6LA 4JBPA 4FF8A 5CNOA 1PY5A 3FSKA 3UMWA 2PMLX 4FSYA 2R2PA 4U80A 5AUXA 1SVEA 4GG7A 3KRXA 2PZYA 4NT4A 4FT7A 4OT5A 4DA5A 2VRXA 3TNIA 5F94A 1G8SA 3W0RA 4L46A 3ITZA 2QO2A 4I22A 2JBOA 2WQNA 5BVDA 3QFVA 2EB3A 4DFUA 1RE8A 4PMSA 3WZJA 2X0QA 4RWJA 3WIKA 4NM7A 1GZ8A 4AFJA 3UIMA 2R3LA 3BGZA 2J0JA 5T68A 4O82A 3BYUA 3KGAA 5IH5A 3DTCA 1FVRA 3HMMA 3OHTA 5F1ZA 4G31A 4GG5A 5E8SA 2F9GA 4MQ2A 4IXPA 2P3GX 4JDKA 5J8IA 2NP8A 2KULA 4QMUA 2X4FA 4O0TA 3MTFA 1ERKA 3QC4A 4P7EA 2W1FA 5E8VA 5JT2A 3MTLA 2JDVA 1OL2A 1WMKA 3VQUA 2R3NA 4A9UA 3MB7A 4B8LA 4MYGA 3TL8A 4TYGA 3TV7A 3ZBFA 3O7LD 3BHUA 2BFXA 3PUFC 3E7VA 3QX4A 4KA3A 5GHVA 5IQEA 3SW7A 4EYJA 3A99A 3E63A 4O1PA 2OFUA 3R8VA 4C4GA 1H8FA 4BFMA 4FTKA 3TN8A 3WI6A 5EHYA 3C4XA 3TJCA 5B2KA 4MXXA 5E91A 4ACDA 4CMTA 3VJNA 1ZZ2A 1FGKA 2QLQA 2C6EA 3SGCA 3O0GA 2VWYA 4J97A 5J9YA 1GY3A 4TWOA 3VBVA 1O6LA 2W9FB 3DQXA 2QKWB 3DCVA 2H96A 2QHNA 3MJ1A 3RAHA 5A54A 3KXXA 4CKRA 5IA0A 1Y6AA 4K11A 2G2HA 4O6LA 3TNWA 4DHZA 2AC5A 4FKQA 4FKJA 4H3QA 5CANA 2JFMA 3LMGA 4ZY6A 1JAMA 2IZSA 2JDTA 3LZBA 1MQBA 3K5UA 3UDZA 3IW8A 4GK4A 2RG6A 2X2KA 3TKHA 3CGOA 3CEKA 2R3PA 3FC1X 2XIRA 3D15A 3II5A 5EHLA 5DHJA 5GINE 3NAYA 3P86A 4WRSA 4CZUA 2BHEA 4OTGA 3I1AA 5IQDA 5AR3A 2X7GA 5IUIA 1CMKE 4K33A 4IADA 3QQGA 4EOQA 2OO8X 5BMSA 3CQEA 3GI3A 3ZUVA 2XNPA 1B6CB 3B2TA 2PMOX 4Y95A 4JBQA 4FKRA 4E6AA 2W5BA 2ZMDA 5CAQA 2PVKA 4WG5A 4PL5A 3A7JA 4G3EA 4UBAA 3PJ3A 2Z2WA 3QTUA 4YJNA 3ERKA 1YXXA 3R8UA 4OBOA 4JJRA 4LV5A 4W4WA 2C6TA 5DR2A 2ACXA 5E8UA 1U4DA 2BFYA 3BU3A 3NWWA 4GYIA 2XMYA 2GHMA 4LG4A 4MD7E 4AA5A 5CAPA 1IAHA 4KBAA 4YSMA 3ZLWA 5CZIA 5EHOA 1H26A 2B0QA 3AC1A 3LFQA 3GOKA 3PA4A 4F9WA 4AZVA 1VEBA 1UWHA 3PG3A 2R7IA 2QOCA 3VVHA 4AE9A 5BYLA 4MBJA 2XYNA 3VS3A 4BL1A 5CTPA 4DH3A 4ENYA 4QQTA 2EXCX 2XM9A 3ZSHA 2PHKA 4BYIA 4DGLC 3R7OA 3COMA 3JVRA 4IZ7A 3S1HA 4KRDA 3AKKA 2BHHA 4EH4A 1FGIA 4CG9A 4XRJA 3TCPA 3EKNA 2WD1A 4EI4A 4YLJA 3PSBA 3SC1A 3CQUA 1PYEA 2GNHA 4EOOA 3BI6A 2Y6OA 2YM6A 4IVAA 1W84A 1R0PA 1TQMA 4JDHA 4QP1A 5LARA 4GT3A 4IEBA 1YXTA 1Q61A 4FV4A 4IB1A 4D0XA 3VRYA 1MQ4A 4I21A 4LGDA 3DY7A 4QMXA 4EH3A 3UZRA 3P23A 3FSFA 4PDSA 3MI9A 5C01A 5FQDC 4TXCA 4F0IA 4L3LA 3P7AA 4ZK5A 4AS0A 4FMQA 2XA4A 3GXLA 4BICA 3KCFA 3I6UA 4QYEA 3NVKI 2OZAA 3Q9WA 4F70A 3G0EA 4I4FA 5EFQA 5DGZA 3B8QA 5FTQA 5CEMA 4IAIA 5AP7A 2C47A 4D4SA 3L9NA 2R7BA 4KBKA 4I0SA 2VTOA 2VX1A 4RJ8A 3GQIA 5IF1A 4PPAA 4YO4A 3MVLA 2C3KA 4MKCA 4F9AA 4YJQA 5DOSA 3QRIA 3R7UA 5D10A 1OL6A 4CTBA 4ASXA 4O2PA 1NVRA 1PXOA 4D2PA 3BGQA 4F6WA 2Z7RA 4M3QA 4U8ZA 3HV6A 3IDCA 3FXZA 3ZM4A 1J1BA 2BRGA 5M53A 3RPVA 4QMPA 4XMOA 2G15A 3GC7A 2HAKA 4DINA 2DQ7X 5CF5A 2R3IA 1G8KA 2YIYA 1Q5KA 1W82A 5BVOA 3U4WA 5HO7A 2HXLA 4U79A 3WZUA 4R77A 4U41A 1XBBA 5H9BA 4TYHB 2HZ4A 3UYSA 3DBDA 2FB8A 3PY0A 5LXMA 5IQCA 1ZAOA 4IAKA 5M4IA 1WVYA 3DBEA 4MXAA 3PLSA 3AT3A 3TIZA 3SG8A 2R3GA 5HZNA 4EH5A 4ZSLA 4F09A 1UNHA 4LQMA 4M15A 5HG7A 4LYNA 3S0OA 2HWOA 3LCOA 3C0HA 4PDPA 5HD4A 5HTCA 2O5KA 3WZDA 3C5IA 2B9JA 3VUIA 2YAKA 2PVLA 1A9UA 5ICPA 5KBRA 2ITQA 4Q2AA 2P2HA 3PDTA 3S00A 4RX9A 2F7ZE 3DB6A 1YOLA 3DA6A 4DGOA 5D7AA 3ATTA 3NIEA 4FJVA 4D9UA 5CT7A 4RFYA 2BCJA 3UIBA 2VX3A 3PPKA 4XOZA 4ZTQA 2QVSE 4JMQA 3OT8A 4IBMA 2Q0BA 4WT6A 4FSWA 1UKHA 2CKEA 3NYOA 5CSXA 4QTEA 2RSVA 3NYNA 1UU7A 5ANJA 3QA8A 2UW9A 4YZDA 2PE2A 4KS8A 3I7CA 1WBTA 3KB7A 4W4YA 2HZIA 1BUHA 3KMUA 3FC2A 4R5SA 4RA5A 4RIOA 2UVZA 4BTMA 2X2MA 3UBDA 1OI9A 4FKUA 3OVVA 3PUPA 1XBAA 2H8HA 5FG8A 2YEXA 1KE5A 4WHZA 5EM8A 4GU9A 5DBXA 1GJOA 3IOKA 4DLJA 5F4NA 2QOLA 4IWPA 4EK4A 1E1VA 4FKGA 4FVRA 4K8AA 4QMZA 3SD0A 1TFFA 3OEFX 5KMIA 2WMUA 4ZJJA 4L52A 1OKVA 1GIIA 3LFAA 3BE2A 1R78A 3AGMA 3DBCA 5JKGA 3ZSIA 4LRMA 1APME 2PE0A 3OWKA 2UW5A 4AUAA 3VS7A 3GT8A 2B9IA 3SOAA 4FV6A 4R1VA 3HP2A 4CFWA 5G6VA 4O7ZA 1Q97A 4TYEA 4JRVA 4AZTA 3GNIB 4EHVA 1YWVA 3QZIA 2JITA 3VS4A 4PDOA 5L2QA 1DI8A 1OPKA 4HPTE 2ETRA 4EH2A 3KN5A 4LRKA 3V5TA 3Q2JA 2QD9A 4Y46A 3CXWA 3W0QA 3ORNA 1H0WA 2OIDA 4ALUA 4YJRA 3PE1A 2WMWA 3QQUA 4D5HA 4E4MA 3WE8A 4O0XA 3PE2A 3RK7A 3DBFA 3PWDA 1AD5A 2WMSA 1TKIA 5E8XA 4J7BA 4AXEA 2X8IA 4IWOA 4EQCA 3BPRA 4PF4A 3H3CA 4FTJA 2IN6A 3DPKA 2WTDA 3P7CA 3ZFYA 2PYWA 4AA4A 2P33A 3CTHA 3F7WA 5M06A 3A4OX 4C2WA 3QWJA 4HCTA 1FPUA 1Q3DA 1SVHA 3BYMA 4AXCA 2E9PA 3VO3A 3ZCLA 4OUCA 4F9YA 2CGUA 4RSSA 5DT0A 2W1HA 3POZA 3R9OA 5HQ0A 2ZAZA 1BI8A 4TYIA 3MIAA 4BZOA 2VWXA 5B7VA 3MV5A 1OM1A 3G9LX 3PJCA 1H24A 5D12A 5J1VA 3W18A 5TKDA 5CWZA 2GU8A 3R7IA 4C02A 3NNXA 3QTRA 4EH8A 4E20A 3CTQA 2R3HA 3MYGA 3NAXA 3Q6UA 2HELA 4IMYA 4ITHA 2O3PA 1MRVA 4IB5A 2ZB1A 3SG9A 4D4RA 5CI6A 5TO8A 3QRUA 1WCCA 5AP4A 2OXDA 4MWHA 5AIRA 3U51A 1DM2A 3COHA 1REKA 5HVJA 1T46A 2YISA 3C0IA 3PWYA 3BHTA 4G3CA 4G6LA 4P90A 2J6MA 5CNNA 2O65A 5M4FA 2CLQA 2QURA 4R7HA 5HG5A 1ST4A 2JIUA 4GIIA 2V55A 3MWUA 5CXHA 3EQBA 3DAEA 5CALA 3LE6A 4JAIA 2HYYA 3DXPA 3ANQA 2ZOQA 1GIHA 1VR2A 2G1TA 4BJJA 2C68A 3GCVA 2UZDA 2CPKE 2B1PA 4OTFA 2OH0E 3V8TA 5A4QA 1A48A 2BRBA 3EYGA 4QDVA 5D9HA 1Z5MA 5FXSA 4ZTLA 5BUEA 2E9OA 2XIZA 4X6QC 4RVKA 4EBVA 1XQZA 3R04A 4DEEA 3LFSA 1I09A 5HD7A 3W0MA 2WTJA 2YDKA 3UDTA 4M66A 4JG7A 5IQIA 1BL7A 3IK3A 4AAYA 3RPOA 3R9HA 3EB0A 5CX9A 4F7JA 2JAMA 2RG5A 2Y4IC 1GOLA 1IRKA 5FUTA 2J0IA 5EI2A 3VS6A 5AWMA 3MH0A 3OEZA 4WUAA 5HCXA 2QOHA 4F64A 5BUIA 4R7BA 5KE0A 4HVSA 4KNBA 5DEYA 3VF8A 2QOKA 4DEDA 1IAJA 1H1WA 3PXRA 5EW8A 4AN2A 4I6HA 5CEPA 3LCDA 3SXFA 4BGGA 4I20A 2Q0NA 4RRVA 3G90X 4PMMA 2GSFA 5IA4A 4BDEA 1DAWA 3QUEA 3C51A 2C6IA 2RKUA 3EIDA 2XNBA 4O38A 4QTDA 5E7RA 5LVOA 4EZ5A 4DT8A 4I5CA 2CKQA 4BWPA 3NW5A 5J87A 5HOAA 3ML1A 5C03A 3KF4A 3OCSA 3CLYA 2C5VA 3QLFA 3Q5IA 3TYKA 5ETFA 4FV2A 2JGZA 4O7TA 1KSWA 4RJ5A 2X39A 4JAJA 3NUXA 2CGWA 2WQOA 3QQHA 3FXWA 5HI2A 4AP7A 4D0WA 2NRYA 3FHRA 4GJ2A 4DHFA 5FM2A 2IO6A 2I0YA 2VX0A 4QP4A 3U6IA 2PUUA 1YVJA 4TN6A 5CEOA 4FIFA 3EQRA 3H0ZA 4O6EA 4ANSA 4BGHA 5AM7A 5AA8A 3W0OA 2XALA 3HMPA 4Y85A 2O0UA 1L3RE 2XIXA 4RIYA 4G6OA 4GK2A 4L7FA 4PTCA 4FK6A 3UYTA 1WBNA 4ZTHA 3MH1A 4IAYA 1ZYSA 2HOGA 2VO0A 3BU6A 2W06A 2VTIA 4BKZA 1R3CA 4J53A 1E9HA 3RALA 4C35A 3FI3A 5HX8A 3O7LB 4UZDA 4QMQA 2XNGA 1GZKA 2OXYA 2V62A 4NTTA 3CY3A 3ORZA 4JX3A 3TUCA 2G9XA 5M09A 3KVXA 3HMIA 4FNYA 3QUPA 5CI7A 2FVDA 3PPJA 4AW2A 4ZY5A 2FSOX 4XRLA 4AZFA 5IEYA 5DR9A 3VUGA 1PMUA 4KKHA 3D2KA 4YBJA 3Q9ZA 3R00A 4FT0A 4H36A 2QOIA 3ZHPC 4FSZA 1OBDA 4IC8A 4DAWA 4G1WA 3OCGA 2A1AB 2PE1A 1KE6A 5C1QB 1Z9XA 3V8WA 4OT6A 3R22A 4YZMA 1JWHA 3ZZWA 4DHJA 1KV2A 1QCFA 2X81A 4GVAA 5BVFA 4QMLA 3PZHA 4YTIA 2FH9A 3E3BX 2JBPA 1GZOA 1NVQA 3KC3A 2W17A 3QQFA 2PL0A 1WBPA 1CKIA 2J0MB 2VAGA 3K5VA 4G3FA 3LLAA 4BCQA 3T9IA 2BKKA 4UALA 3LCTA 4APCA 2QQ7A 4NH1A 4GFOA 4BJJB 5JZNA 3FLSA 4EKLA 4Y5HA 5AV4A 2ITVA