4IAJA

Crystal structure of a conserved domain protein (sp_1775) from streptococcus pneumoniae tigr4 at 1.91 a resolution
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
76
structure length
76
Chain Sequence
VLNMIEITYIDASKNERTVTFESYEDFERSQQACLIGVADYYPVQKLTYKGHNLDYHGTYGDIFFYLMKQDLSQYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a conserved domain protein (SP_1775) from Streptococcus pneumoniae TIGR4 at 1.91 A resolution
rcsb
source organism Streptococcus pneumoniae
molecule tags Structural genomics, unknown function
molecule keywords Conserved domain protein
total genus 19
structure length 76
sequence length 76
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2012-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF15507 DUF4649 Domain of unknown function (DUF4649)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.390 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4iajA00
4IAJA
chains in the Genus database with same CATH superfamily
5FLMG 5KT6A 4RB2C 4GC7A 4ECTA 3J7AK 3GTOA 1AN7A 4PWQA 3WNZA 3RB4A 4WBNF 3GLKA 5DQHA 3EYYA 2R82A 5LOVF 4A3GG 3JSLA 1Z2OX 3Q2OA 4TUYF 2ZDGA 4ECQA 1GSOA 3SE7A 1BGWA 2C28A 2BR0A 3K3VA 5L1JA 1N33H 2I80A 5KFXA 4C2MA 4A3IG 2W6NA 2R92A 1AUVA 3RBDA 3L4KA 3L4JA 4QW9A 4U7CA 5F9LA 3M9NB 3GTKA 1JLLB 1WCMA 4NLGA 3GV8B 4DV0H 1Y1WA 4BY1G 5KFIA 3PR5B 4A3KG 3H4DA 3VMMA 1KBLA 2W9AA 2R7LA 5IP9G 2HVQA 4JUZA 5KFCA 1RK6A 4LSAA 1GGOA 4DL7A 3R5HA 3TQ1A 1FKAH 1WR2A 2CW8A 5K2MA 2FPIB 1I7NA 3PW2A 3PN1A 4DL4A 1W93A 3OUZA 4JV2A 5IWAH 4KHPH 4IRKA 2YZNA 1K1QA 2W9BB 2C2RA 4F50A 1S97A 1V4YA 3R23A 4FS1A 3V4SA 1RYSA 1RJPA 3V4ZA 2XCPA 2JEIA 4LF4H 3HB9A 1E4GT 4DR1H 2JEJA 4A3CG 2ASJA 4YAKB 1EUDB 4A3EG 1GYFA 4Q43A 5DG8A 2DWCA 2DIKA 4BY7G 4ECRA 4IHJF 3LMLA 4JYAH 3H40A 2FLLA 1IBMH 1SFOA 3N6XA 4UCTA 3BG5A 4I50F 4EYHB 4JV1A 4MAMA 3BJYA 3RGZA 4JI5H 1IOWA 1DIKA 4UCOA 4ECWA 5D1OA 3IN5A 3M9OB 4ZQIA 1GSHA 5LMUH 1KJQA 4J9QA 4DV1H 2W6OA 2V58A 3H3VH 5D1OB 4R8UA 3HKZA 1T36A 4MV4A 3WO0A 1O75A 4RUCA 3BQ0A 1N56A 3UFXB 4EEYA 2W8KA 1M0WA 4O2BF 4IZOA 4TQRA 3FMAA 3R5XA 5DLGA 4ECYA 2YZGA 1S9FA 2Q2TA 1IBKH 4J9SA 4Q0YA 4FS2A 4HR7A 4F4ZA 2E5LH 1JIHA 3BA8A 4UCRA 2AU0A 2HVSA 1HR0H 2W6ZA 2ZM6H 5C1OA 4RZQA 2WAQE 4A2AA 4MA0A 1CQJB 3RTXA 2UXDH 3RFCA 3MWMA 2PVPA 5DQIA 3LWBA 4JI1H 1IOVA 4WD3A 2VQFH 4ETSA 3KHLA 2C2DA 3OUUA 4JV0A 4B3SH 2WB1E 2NUAB 2R87A 4X65H 4ECZA 3PW7A 2HJWA 5CA0F 2VQDA 1ZETA 3HOWG 3JRWA 4B3MH 5IP7G 2YU9A 2YS7A 2Y0SE 4O3PA 4FU0A 2IP4A 1J5EH 4O4IF 4YR2A 2FJZA 5J2TF 5KFJA 1TAEA 4YJ3F 1Y1WG 3CVZA 4DR5H 4I7HA 1V9PA 2JA5A 5EOYA 2XC9A 2NVYA 5KFSA 4DL2A 4R7RA 4DV2H 1RJRA 1JDEA 3MR3A 2CZGA 3T1HH 4A3BG 2E2IA 4LF9H 4DV4H 3PW4A 4ME6A 2FKLA 3KHHA 2UU9H 5KFOA 3PR4A 2JA8G 3G6XA 3GTQA 2XGPA 1I50A 4DV6H 4JI4H 5C3EG 4Q45A 5KT4A 2FE3A 3OHAA 2KSWA 3N40P 4RNMA 1SYXB 1KJ8A 3KTMA 3MR6A 5FD6A 3BQ1A 5KG3A 4BWSC 3V6KA 3V6JA 4OX9H 4XYMB 5L9XA 2JA6A 1OWTA 5H80A 4HNTA 3TINA 1M0TA 5KFGA 3PW0A 4A3DG 4YJ2F 3PO2G 3GV5B 1IBLH 1GSAA 4QJFA 4EFBA 2YYAA 4MA5A 1S03G 5LP6F 1CQIB 3GIDA 3I12A 2FK2A 2DZDA 4DLKA 3HBLA 2W71A 3BABA 5KFUA 5I47A 1RYRA 4NXMH 2NVXA 2OWOA 1E4EB 4LF7H 1EUCB 1DGSA 3C0FB 3MWDA 4RU9A 5FPOA 4XX0B 4A3MG 4EGJA 5FD5A 1KJIA 3Q8QB 2UVRA 1TWAA 3RIZA 4RNOA 5KFZA 4I4TF 2VUGA 2FPPB 4UCSA 1M7JA 2YW2A 2R84A 4RAYA 3TQTA 1FVIA 1JXLA 1V51A 4AYBA 5BPHA 4IRDA 4FM9A 1JKJB 4NXNH 4X66H 3KAKA 2R7KA 3Q1KA 3MR2A 3ORQA 1BXRA 3RBEA 2AGPA 3J81W 3ETHA 2UUAH 4LH7A 5DGBA 1RK5A 1KC7A 4MTEA 3H0GA 2W8LA 2R8JA 3PO3G 3TIIA 3OHBA 1TWHA 5D1PA 4EEQA 2XCAA 4J9OA 4ED3A 5L1LA 5KG2A 3M9MB 2UXBH 3Q8PB 2YRXA 5KKNB 3JSNA 1N48A 4RB1A 3QZ8A 1WH2A 2DPIA 3OSPA 2JA6G 1I7LA 2YL2A 5BR8H 1HNWH 4QWAA 2RDJA 2Q2UA 2HGSA 2V4QA 5KFNA 5FJ8G 4DR2H 2NU6B 2VPQA 4O3NA 4BXXG 3G6YA 1I6UA 2B63A 1E4FT 4ECVA 2R7MA 3H20A 2ALZA 4YBZB 3GTPA 1B6RA 5KG5A 2P0AA 3HOVG 4EGQA 4RUAA 2JA5G 1I94H 3CQZA 4RZRA 3DF7A 1GO3E 4ZOLF 3OTOH 4A3FG 3MFIA 3VPBA 1EZ1A 2ASDA 1AUXA 3RUPA 4R8UB 1FJGH 3I4MG 4A3LG 3HOXG 3G6VA 3TIGA 4DV7H 4HYKA 2C00A 2SCUB 1JDBB 3GIPA 5JQWA 4Q8EA 4RB3C 4GLXA 2ZDHA 1S10A 4IRCA 5EWGA 4Q8FA 3BQ2A 1PK8A 3KAJA 3JAMW 1VAJA 2R7NA 5KFRA 2W9CB 5JUMA 4YQWA 3K3PA 4YR3A 4A2BA 4J9MA 4HQ6A 2R8KA 2JEFA 1B04A 2J9GA 2BQRA 2J6SA 4U6PA 2R93A 1E4EA 3BAAA 4DR6H 3K5HA 4UCVA 2R7ZG 2FLNA 3RV4A 3GIIA 2YRWA 3GV7B 3KHRA 4ED6A 2UUBH 3AYHB 2M05A 4I55F 5IYDG 3GQCA 3FDSA 5FLXW 5LXTF 4E4TA 2FB9A 3MJFA 4IR9A 3L2PA 1WSCA 3N43B 3GIMA 1XDNA 4QIWA 5KFBA 5KFHA 2B63G 3GTJA 2NU7B 2V59A 1N34H 2GLTA 4IAJA 2ASLA 5CA1F 4EFEA 2RDIA 2QYZA 4C5BA 2JEGA 4A93G 2QK4A 2WYOA 3HKZE 2OLSA 4TV9F 4F4YA 4L1KA 5JVDF 2IMWP 2ZJTA 5A2QW 5KFQA 4HNUA 5EWEA 1HNZH 5KFLA 4A3JG 4MTDA 3ETJA 1BJTA 1DV1A 2IA6A 2CQYA 3M4IA 4JI0H 5C1PA 4DR4H 5LMNH 2CW7A 3MR5A 2GPWA 2VUMG 5KFYA 3U9SA 4UCUA 2UVUA 5KFKA 3MFHA 5EWFA 2IBKA 4G3IA 3ORRA 2R8GA 2JA7A 2DPJA 2HHHH 3JRXA 2V4RA 4IWXA 5KFPA 3EPIA 2PMZE 2RGVA 3H0GG 2BQ3A 4DL6A 4ZI7F 2RF4A 5IYBG 2UXCH 1I3QA 4CC6A 1ULZA 1TWGA 4GC6A 4LF6H 2O03A 5FPRA 3IG0A 1TA8A 2DLNA 3J80W 5KFVA 4CC5A 4J9PA 2MCTA 4EG0A 3SI8A 1W96A 2J6TA 1KJ9A 5C44G 3Q8RB 5BPFA 2OH2A 1ZHQA 2AGQA 3T5LA 1TWFA 5IYZF 2W9BA 5KG6A 2WAQA 4YAJB 4DR7H 3K5IA 5CAEB 2W7PA 4LFCH 5EDWA 1XMQH 2R8IA 3MWEA 4ZHQF 2XGQA 2C22A 4O4HF 4DR3H 1MZBA 4DV3H 1C30A 4AQYH 4FBUA 2W70A 4YB8B 4BBSG 1UC8A 1XNQH 4EBCA 5EZYF 5GONF 3I4NG 4XYLB 5HV6A 5KFDA 1P8LA 3GTGA 2YCHA 5KT7A 4O3OA 1EYZA 2E2HA 3OSNA 1Y14B 2RGRA 5KG0A 3U9TA 4BBRG 4B3RH 5CB4F 4LMYA 4DUZH 4JI6H 4JI8H 1S68A 2R85A 1T94A 5KT5A 5C5JA 3RAXA 4GKJH 2R8HA 3F8NA 2R93G 3R5FA 1GLVA 5LL6b 3E5NA 1PX2A 2R7ZA 2UVVA 2W6QA 1C3OA 4QWDA 3GIKA 3HXLA 3KALA 2VQEH 1VBHA 3RF2A 3T5KA 4JI7H 4K0KH 2W7OA 1KJJA 5IYCG 4LH6A 3RB6A 1N32H 1UC9A 1Y1VA 5T14A 4M7EA 4F4WA 3FKIG 3GILA 2R6FA 2F4VH 1K1SA 4ECUA 3BA9A 4C5AA 4GKKH 5KFTA 2PBZA 1HNXH 3RB3A 1DV2A 2PMZA 4MV7A 5DG9A 5DQGA 4LFBH 1A0IA 1T3NA 4DUYH 2VOBA 2YZMA 4XZ3B 4LF5H 3PZPA 2WB1A 1ZQ7A 4ECSA 4DL5A 2BQUA 2VA3A 2CKZB 4J9KA 1L2ZA 4MV6A 5KG4A 4QW8A 2ATLA 2C35B 1VBGA 4C5CA 3PVXA 2C2EA 2GPSA 3T5JA 3RAQA 4EYIB 2VUMA 4MV8A 3N41B 4YY3H 5C8YF 5DGAA 4RAZA 2JA7G 4ED7A 4IWYA 3T1YH 4LFAH 4ED2A 3KHGA 3GIQA 4EBEA 3UQ8A 4O4LF 4J9NA 1KEEA 4Y8VB 3JZIA 4QIWE 2FLPA 4JI3H 2W6PA 2X0SA 5DLFA 2FP4B 1XNRH 2VR1A 4ED1A 5KFAA 2I8CA 3GTLA 2PN1A 4YP3A 5DG7A 5KT2A 5KFFA 4ECXA 2I87A 5KX5F 4QWCA 3NGDA 4X62H 5KT3A 2WTFA 1S0OA 4IR1A 4PDBA 5KFEA 3QZ7A 1Y1VG 3RJ0A 4JV5H 2W9CA 2R92G 4YHHH 4AYBE 3QFFA 1N36H 3GIJA 3N42B 5JH7F 1UNNC 3V6HA 1WCMG 1BNCA 3WO1A 3N8DA 5LA6F 1SEIA 4F4XA 4LSXA 1ZHSA 3H4BA 2W6MA 4J0MA 2Y0SA 2XIGA 3T5HA 2FK1A 4O2AF 4FBTA 4O3QA 4APMA 4MV3A 4MV1A 1A9XA 1S0MA 1RJQA 2AGOA 1EHIA 5LYJF 2UUCH 4M9UA 3HOYG 5D8DA 3LP8A 1S0NA 5L1KA 4O3RA 2W57A 5KG1A 2R86A 2WDTA 3RGXA 4Q44A 2VPSA 3G8CA 4EBDA 1R9TA 3RV3A 5BMVF 5IT9W 2FK3A 1VKZA 2YS6A 4QWEA 4DL3A 3RB0A 4TQSA 1CS0A 2V5AA 2AQ4A 1JX4A 1Z2PX 3Q8SB 2NU9B 1X9NA 4J9LA 2FMAA 3EPGA 2XCLA 4LF8H 3HOZG 2WE6A 3FKIA 4B3TH 1VS0A 1B33N 5JVLA 3PW5A 2HVRA 1SCUB 4MV9A 1K83A 3GTMA 2XD4A 2UVWA 5C4XG 4ED0A 3HOUG 3N44B 4ED8A 3KXYT 4X64H 5HBRB 4JI2H 3VPCA 4J9RA 1Z2NX 4UFZA 3VPDA 5KG7A 5F9NA 5J2UF 1CE8A 2NU8B 1TWCA 4QWBA 5L1IA 2V9WA 4YR0A 4O3SA 1M6VA 4TV8F 5KFWA 1B6SA 1XMOH 2ZDQA 4HNVA 4RNNA 2FPGB 5KFMA 4RB0A 4DV5H 2VA2A 2J6UA
chains in the Genus database with same CATH topology
4MV7A 1B04A 4RB2C 1TAEA 4LFBH 1A0IA 4DUYH 2VOBA 3J7AK 3CVZA 3BAAA 4DR5H 1AN7A 4I7HA 1V9PA 4LF5H 4DR6H 5EOYA 3EYYA 4UCVA 4R7RA 4DV2H 2UUBH 3T1HH 3JSLA 1L2ZA 1Z2OX 4LF9H 4DV4H 2UU9H 1BGWA 5FLXW 3K3VA 3N41B 4YY3H 3L2PA 1N33H 3N43B 1XDNA 4RAZA 4DV6H 4JI4H 3T1YH 4LFAH 3L4KA 2FE3A 1N34H 4IAJA 2KSWA 3N40P 3L4JA 4EFEA 3UQ8A 1SYXB 4DV0H 5FD6A 2WYOA 4BWSC 4OX9H 2ZJTA 5A2QW 1HNZH 1XNRH 1M0TA 2HVQA 4MTDA 4LSAA 1BJTA 3M4IA 4X62H 1FKAH 1IBLH 5LMNH 4JI0H 4EFBA 2CW8A 2CW7A 4DR4H 4PDBA 4UCUA 1S03G 3PN1A 3RJ0A 5IWAH 4JV5H 4KHPH 4YHHH 2HHHH 1N36H 3BABA 2RGVA 4NXMH 3N42B 2UXCH 2OWOA 4CC6A 4LF4H 4DR1H 1E4GT 4LF7H 3C0FB 1DGSA 4LF6H 2O03A 1SEIA 5FPOA 5FPRA 3IG0A 1TA8A 3J80W 5FD5A 4CC5A 4LSXA 2MCTA 1ZHSA 3RIZA 1GYFA 4J0MA 2VUGA 4UCSA 4RAYA 2XIGA 1FVIA 1ZHQA 3LMLA 4APMA 4FM9A 4NXNH 4JYAH 4X66H 3KAKA 2UUCH 4DR7H 1IBMH 3N6XA 3J81W 2UUAH 4LH7A 4UCTA 4LFCH 1XMQH 4MTEA 2W57A 3RGZA 5D1PA 4EEQA 4JI5H 4UCOA 5D1OA 2WDTA 3RGXA 4DV1H 1MZBA 2VPSA 5LMUH 4DV3H 4DR3H 4AQYH 2UXBH 3JSNA 5D1OB 5IT9W 4RB1A 1XNQH 1WH2A 1O75A 1P8LA 5BR8H 1HNWH 1Z2PX 2Q2UA 1M0WA 2HGSA 2YCHA 1X9NA 4DR2H 4LF8H 1I6UA 2WE6A 3FMAA 1E4FT 4B3TH 2Q2TA 1VS0A 1IBKH 4Q0YA 3H20A 2HVRA 4MV9A 2E5LH 2RGRA 4B3RH 4LMYA 4DUZH 4JI6H 3BA8A 1S68A 3N44B 4UCRA 4JI8H 2HVSA 4GKJH 1HR0H 3F8NA 3KXYT 4X64H 4JI2H 2ZM6H 1Z2NX 4UFZA 4RZQA 4A2AA 5LL6b 3RTXA 1I94H 2UXDH 3DF7A 3MWMA 3OTOH 4JI3H 2VQEH 3HXLA 3KALA 4JI7H 3RF2A 4K0KH 1FJGH 4JI1H 2VQFH 4LH6A 4ETSA 4DV7H 4B3SH 4X65H 4RB3C 4GLXA 1N32H 4M7EA 2F4VH 3KAJA 3JAMW 1XMOH 4B3MH 3BA9A 4RB0A 4A2BA 4DV5H 4GKKH 1HNXH 1J5EH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IAJ A; 
#chains in the Genus database with same CATH topology
 5FLM G;  5KT6 A;  4RB2 C;  4GC7 A;  4ECT A;  3J7A K;  3GTO A;  1AN7 A;  4PWQ A;  3WNZ A;  3RB4 A;  4WBN F;  3GLK A;  5DQH A;  3EYY A;  2R82 A;  5LOV F;  4A3G G;  3JSL A;  1Z2O X;  3Q2O A;  4TUY F;  2ZDG A;  4ECQ A;  1GSO A;  3SE7 A;  1BGW A;  2C28 A;  2BR0 A;  3K3V A;  5L1J A;  1N33 H;  2I80 A;  5KFX A;  4C2M A;  4A3I G;  2W6N A;  2R92 A;  1AUV A;  3RBD A;  3L4K A;  3L4J A;  4QW9 A;  4U7C A;  5F9L A;  3M9N B;  3GTK A;  1JLL B;  1WCM A;  4NLG A;  3GV8 B;  4DV0 H;  1Y1W A;  4BY1 G;  5KFI A;  3PR5 B;  4A3K G;  3H4D A;  3VMM A;  1KBL A;  2W9A A;  2R7L A;  5IP9 G;  2HVQ A;  4JUZ A;  5KFC A;  1RK6 A;  4LSA A;  1GGO A;  4DL7 A;  3R5H A;  3TQ1 A;  1FKA H;  1WR2 A;  2CW8 A;  5K2M A;  2FPI B;  1I7N A;  3PW2 A;  3PN1 A;  4DL4 A;  1W93 A;  3OUZ A;  4JV2 A;  5IWA H;  4KHP H;  4IRK A;  2YZN A;  1K1Q A;  2W9B B;  2C2R A;  4F50 A;  1S97 A;  1V4Y A;  3R23 A;  4FS1 A;  3V4S A;  1RYS A;  1RJP A;  3V4Z A;  2XCP A;  2JEI A;  4LF4 H;  3HB9 A;  1E4G T;  4DR1 H;  2JEJ A;  4A3C G;  2ASJ A;  4YAK B;  1EUD B;  4A3E G;  1GYF A;  4Q43 A;  5DG8 A;  2DWC A;  2DIK A;  4BY7 G;  4ECR A;  4IHJ F;  3LML A;  4JYA H;  3H40 A;  2FLL A;  1IBM H;  1SFO A;  3N6X A;  4UCT A;  3BG5 A;  4I50 F;  4EYH B;  4JV1 A;  4MAM A;  3BJY A;  3RGZ A;  4JI5 H;  1IOW A;  1DIK A;  4UCO A;  4ECW A;  5D1O A;  3IN5 A;  3M9O B;  4ZQI A;  1GSH A;  5LMU H;  1KJQ A;  4J9Q A;  4DV1 H;  2W6O A;  2V58 A;  3H3V H;  5D1O B;  4R8U A;  3HKZ A;  1T36 A;  4MV4 A;  3WO0 A;  1O75 A;  4RUC A;  3BQ0 A;  1N56 A;  3UFX B;  4EEY A;  2W8K A;  1M0W A;  4O2B F;  4IZO A;  4TQR A;  3FMA A;  3R5X A;  5DLG A;  4ECY A;  2YZG A;  1S9F A;  2Q2T A;  1IBK H;  4J9S A;  4Q0Y A;  4FS2 A;  4HR7 A;  4F4Z A;  2E5L H;  1JIH A;  3BA8 A;  4UCR A;  2AU0 A;  2HVS A;  1HR0 H;  2W6Z A;  2ZM6 H;  5C1O A;  4RZQ A;  2WAQ E;  4A2A A;  4MA0 A;  1CQJ B;  3RTX A;  2UXD H;  3RFC A;  3MWM A;  2PVP A;  5DQI A;  3LWB A;  4JI1 H;  1IOV A;  4WD3 A;  2VQF H;  4ETS A;  3KHL A;  2C2D A;  3OUU A;  4JV0 A;  4B3S H;  2WB1 E;  2NUA B;  2R87 A;  4X65 H;  4ECZ A;  3PW7 A;  2HJW A;  5CA0 F;  2VQD A;  1ZET A;  3HOW G;  3JRW A;  4B3M H;  5IP7 G;  2YU9 A;  2YS7 A;  2Y0S E;  4O3P A;  4FU0 A;  2IP4 A;  1J5E H;  4O4I F;  4YR2 A;  2FJZ A;  5J2T F;  5KFJ A;  1TAE A;  4YJ3 F;  1Y1W G;  3CVZ A;  4DR5 H;  4I7H A;  1V9P A;  2JA5 A;  5EOY A;  2XC9 A;  2NVY A;  5KFS A;  4DL2 A;  4R7R A;  4DV2 H;  1RJR A;  1JDE A;  3MR3 A;  2CZG A;  3T1H H;  4A3B G;  2E2I A;  4LF9 H;  4DV4 H;  3PW4 A;  4ME6 A;  2FKL A;  3KHH A;  2UU9 H;  5KFO A;  3PR4 A;  2JA8 G;  3G6X A;  3GTQ A;  2XGP A;  1I50 A;  4DV6 H;  4JI4 H;  5C3E G;  4Q45 A;  5KT4 A;  2FE3 A;  3OHA A;  2KSW A;  3N40 P;  4RNM A;  1SYX B;  1KJ8 A;  3KTM A;  3MR6 A;  5FD6 A;  3BQ1 A;  5KG3 A;  4BWS C;  3V6K A;  3V6J A;  4OX9 H;  4XYM B;  5L9X A;  2JA6 A;  1OWT A;  5H80 A;  4HNT A;  3TIN A;  1M0T A;  5KFG A;  3PW0 A;  4A3D G;  4YJ2 F;  3PO2 G;  3GV5 B;  1IBL H;  1GSA A;  4QJF A;  4EFB A;  2YYA A;  4MA5 A;  1S03 G;  5LP6 F;  1CQI B;  3GID A;  3I12 A;  2FK2 A;  2DZD A;  4DLK A;  3HBL A;  2W71 A;  3BAB A;  5KFU A;  5I47 A;  1RYR A;  4NXM H;  2NVX A;  2OWO A;  1E4E B;  4LF7 H;  1EUC B;  1DGS A;  3C0F B;  3MWD A;  4RU9 A;  5FPO A;  4XX0 B;  4A3M G;  4EGJ A;  5FD5 A;  1KJI A;  3Q8Q B;  2UVR A;  1TWA A;  3RIZ A;  4RNO A;  5KFZ A;  4I4T F;  2VUG A;  2FPP B;  4UCS A;  1M7J A;  2YW2 A;  2R84 A;  4RAY A;  3TQT A;  1FVI A;  1JXL A;  1V51 A;  4AYB A;  5BPH A;  4IRD A;  4FM9 A;  1JKJ B;  4NXN H;  4X66 H;  3KAK A;  2R7K A;  3Q1K A;  3MR2 A;  3ORQ A;  1BXR A;  3RBE A;  2AGP A;  3J81 W;  3ETH A;  2UUA H;  4LH7 A;  5DGB A;  1RK5 A;  1KC7 A;  4MTE A;  3H0G A;  2W8L A;  2R8J A;  3PO3 G;  3TII A;  3OHB A;  1TWH A;  5D1P A;  4EEQ A;  2XCA A;  4J9O A;  4ED3 A;  5L1L A;  5KG2 A;  3M9M B;  2UXB H;  3Q8P B;  2YRX A;  5KKN B;  3JSN A;  1N48 A;  4RB1 A;  3QZ8 A;  1WH2 A;  2DPI A;  3OSP A;  2JA6 G;  1I7L A;  2YL2 A;  5BR8 H;  1HNW H;  4QWA A;  2RDJ A;  2Q2U A;  2HGS A;  2V4Q A;  5KFN A;  5FJ8 G;  4DR2 H;  2NU6 B;  2VPQ A;  4O3N A;  4BXX G;  3G6Y A;  1I6U A;  2B63 A;  1E4F T;  4ECV A;  2R7M A;  3H20 A;  2ALZ A;  4YBZ B;  3GTP A;  1B6R A;  5KG5 A;  2P0A A;  3HOV G;  4EGQ A;  4RUA A;  2JA5 G;  1I94 H;  3CQZ A;  4RZR A;  3DF7 A;  1GO3 E;  4ZOL F;  3OTO H;  4A3F G;  3MFI A;  3VPB A;  1EZ1 A;  2ASD A;  1AUX A;  3RUP A;  4R8U B;  1FJG H;  3I4M G;  4A3L G;  3HOX G;  3G6V A;  3TIG A;  4DV7 H;  4HYK A;  2C00 A;  2SCU B;  1JDB B;  3GIP A;  5JQW A;  4Q8E A;  4RB3 C;  4GLX A;  2ZDH A;  1S10 A;  4IRC A;  5EWG A;  4Q8F A;  3BQ2 A;  1PK8 A;  3KAJ A;  3JAM W;  1VAJ A;  2R7N A;  5KFR A;  2W9C B;  5JUM A;  4YQW A;  3K3P A;  4YR3 A;  4A2B A;  4J9M A;  4HQ6 A;  2R8K A;  2JEF A;  1B04 A;  2J9G A;  2BQR A;  2J6S A;  4U6P A;  2R93 A;  1E4E A;  3BAA A;  4DR6 H;  3K5H A;  4UCV A;  2R7Z G;  2FLN A;  3RV4 A;  3GII A;  2YRW A;  3GV7 B;  3KHR A;  4ED6 A;  2UUB H;  3AYH B;  2M05 A;  4I55 F;  5IYD G;  3GQC A;  3FDS A;  5FLX W;  5LXT F;  4E4T A;  2FB9 A;  3MJF A;  4IR9 A;  3L2P A;  1WSC A;  3N43 B;  3GIM A;  1XDN A;  4QIW A;  5KFB A;  5KFH A;  2B63 G;  3GTJ A;  2NU7 B;  2V59 A;  1N34 H;  2GLT A;  4IAJ A;  2ASL A;  5CA1 F;  4EFE A;  2RDI A;  2QYZ A;  4C5B A;  2JEG A;  4A93 G;  2QK4 A;  2WYO A;  3HKZ E;  2OLS A;  4TV9 F;  4F4Y A;  4L1K A;  5JVD F;  2IMW P;  2ZJT A;  5A2Q W;  5KFQ A;  4HNU A;  5EWE A;  1HNZ H;  5KFL A;  4A3J G;  4MTD A;  3ETJ A;  1BJT A;  1DV1 A;  2IA6 A;  2CQY A;  3M4I A;  4JI0 H;  5C1P A;  4DR4 H;  5LMN H;  2CW7 A;  3MR5 A;  2GPW A;  2VUM G;  5KFY A;  3U9S A;  4UCU A;  2UVU A;  5KFK A;  3MFH A;  5EWF A;  2IBK A;  4G3I A;  3ORR A;  2R8G A;  2JA7 A;  2DPJ A;  2HHH H;  3JRX A;  2V4R A;  4IWX A;  5KFP A;  3EPI A;  2PMZ E;  2RGV A;  3H0G G;  2BQ3 A;  4DL6 A;  4ZI7 F;  2RF4 A;  5IYB G;  2UXC H;  1I3Q A;  4CC6 A;  1ULZ A;  1TWG A;  4GC6 A;  4LF6 H;  2O03 A;  5FPR A;  3IG0 A;  1TA8 A;  2DLN A;  3J80 W;  5KFV A;  4CC5 A;  4J9P A;  2MCT A;  4EG0 A;  3SI8 A;  1W96 A;  2J6T A;  1KJ9 A;  5C44 G;  3Q8R B;  5BPF A;  2OH2 A;  1ZHQ A;  2AGQ A;  3T5L A;  1TWF A;  5IYZ F;  2W9B A;  5KG6 A;  2WAQ A;  4YAJ B;  4DR7 H;  3K5I A;  5CAE B;  2W7P A;  4LFC H;  5EDW A;  1XMQ H;  2R8I A;  3MWE A;  4ZHQ F;  2XGQ A;  2C22 A;  4O4H F;  4DR3 H;  1MZB A;  4DV3 H;  1C30 A;  4AQY H;  4FBU A;  2W70 A;  4YB8 B;  4BBS G;  1UC8 A;  1XNQ H;  4EBC A;  5EZY F;  5GON F;  3I4N G;  4XYL B;  5HV6 A;  5KFD A;  1P8L A;  3GTG A;  2YCH A;  5KT7 A;  4O3O A;  1EYZ A;  2E2H A;  3OSN A;  1Y14 B;  2RGR A;  5KG0 A;  3U9T A;  4BBR G;  4B3R H;  5CB4 F;  4LMY A;  4DUZ H;  4JI6 H;  4JI8 H;  1S68 A;  2R85 A;  1T94 A;  5KT5 A;  5C5J A;  3RAX A;  4GKJ H;  2R8H A;  3F8N A;  2R93 G;  3R5F A;  1GLV A;  5LL6 b;  3E5N A;  1PX2 A;  2R7Z A;  2UVV A;  2W6Q A;  1C3O A;  4QWD A;  3GIK A;  3HXL A;  3KAL A;  2VQE H;  1VBH A;  3RF2 A;  3T5K A;  4JI7 H;  4K0K H;  2W7O A;  1KJJ A;  5IYC G;  4LH6 A;  3RB6 A;  1N32 H;  1UC9 A;  1Y1V A;  5T14 A;  4M7E A;  4F4W A;  3FKI G;  3GIL A;  2R6F A;  2F4V H;  1K1S A;  4ECU A;  3BA9 A;  4C5A A;  4GKK H;  5KFT A;  2PBZ A;  1HNX H;  3RB3 A;  1DV2 A;  2PMZ A;  4MV7 A;  5DG9 A;  5DQG A;  4LFB H;  1A0I A;  1T3N A;  4DUY H;  2VOB A;  2YZM A;  4XZ3 B;  4LF5 H;  3PZP A;  2WB1 A;  1ZQ7 A;  4ECS A;  4DL5 A;  2BQU A;  2VA3 A;  2CKZ B;  4J9K A;  1L2Z A;  4MV6 A;  5KG4 A;  4QW8 A;  2ATL A;  2C35 B;  1VBG A;  4C5C A;  3PVX A;  2C2E A;  2GPS A;  3T5J A;  3RAQ A;  4EYI B;  2VUM A;  4MV8 A;  3N41 B;  4YY3 H;  5C8Y F;  5DGA A;  4RAZ A;  2JA7 G;  4ED7 A;  4IWY A;  3T1Y H;  4LFA H;  4ED2 A;  3KHG A;  3GIQ A;  4EBE A;  3UQ8 A;  4O4L F;  4J9N A;  1KEE A;  4Y8V B;  3JZI A;  4QIW E;  2FLP A;  4JI3 H;  2W6P A;  2X0S A;  5DLF A;  2FP4 B;  1XNR H;  2VR1 A;  4ED1 A;  5KFA A;  2I8C A;  3GTL A;  2PN1 A;  4YP3 A;  5DG7 A;  5KT2 A;  5KFF A;  4ECX A;  2I87 A;  5KX5 F;  4QWC A;  3NGD A;  4X62 H;  5KT3 A;  2WTF A;  1S0O A;  4IR1 A;  4PDB A;  5KFE A;  3QZ7 A;  1Y1V G;  3RJ0 A;  4JV5 H;  2W9C A;  2R92 G;  4YHH H;  4AYB E;  3QFF A;  1N36 H;  3GIJ A;  3N42 B;  5JH7 F;  1UNN C;  3V6H A;  1WCM G;  1BNC A;  3WO1 A;  3N8D A;  5LA6 F;  1SEI A;  4F4X A;  4LSX A;  1ZHS A;  3H4B A;  2W6M A;  4J0M A;  2Y0S A;  2XIG A;  3T5H A;  2FK1 A;  4O2A F;  4FBT A;  4O3Q A;  4APM A;  4MV3 A;  4MV1 A;  1A9X A;  1S0M A;  1RJQ A;  2AGO A;  1EHI A;  5LYJ F;  2UUC H;  4M9U A;  3HOY G;  5D8D A;  3LP8 A;  1S0N A;  5L1K A;  4O3R A;  2W57 A;  5KG1 A;  2R86 A;  2WDT A;  3RGX A;  4Q44 A;  2VPS A;  3G8C A;  4EBD A;  1R9T A;  3RV3 A;  5BMV F;  5IT9 W;  2FK3 A;  1VKZ A;  2YS6 A;  4QWE A;  4DL3 A;  3RB0 A;  4TQS A;  1CS0 A;  2V5A A;  2AQ4 A;  1JX4 A;  1Z2P X;  3Q8S B;  2NU9 B;  1X9N A;  4J9L A;  2FMA A;  3EPG A;  2XCL A;  4LF8 H;  3HOZ G;  2WE6 A;  3FKI A;  4B3T H;  1VS0 A;  1B33 N;  5JVL A;  3PW5 A;  2HVR A;  1SCU B;  4MV9 A;  1K83 A;  3GTM A;  2XD4 A;  2UVW A;  5C4X G;  4ED0 A;  3HOU G;  3N44 B;  4ED8 A;  3KXY T;  4X64 H;  5HBR B;  4JI2 H;  3VPC A;  4J9R A;  1Z2N X;  4UFZ A;  3VPD A;  5KG7 A;  5F9N A;  5J2U F;  1CE8 A;  2NU8 B;  1TWC A;  4QWB A;  5L1I A;  2V9W A;  4YR0 A;  4O3S A;  1M6V A;  4TV8 F;  5KFW A;  1B6S A;  1XMO H;  2ZDQ A;  4HNV A;  4RNN A;  2FPG B;  5KFM A;  4RB0 A;  4DV5 H;  2VA2 A;  2J6U A; 
#chains in the Genus database with same CATH homology
 4MV7 A;  1B04 A;  4RB2 C;  1TAE A;  4LFB H;  1A0I A;  4DUY H;  2VOB A;  3J7A K;  3CVZ A;  3BAA A;  4DR5 H;  1AN7 A;  4I7H A;  1V9P A;  4LF5 H;  4DR6 H;  5EOY A;  3EYY A;  4UCV A;  4R7R A;  4DV2 H;  2UUB H;  3T1H H;  3JSL A;  1L2Z A;  1Z2O X;  4LF9 H;  4DV4 H;  2UU9 H;  1BGW A;  5FLX W;  3K3V A;  3N41 B;  4YY3 H;  3L2P A;  1N33 H;  3N43 B;  1XDN A;  4RAZ A;  4DV6 H;  4JI4 H;  3T1Y H;  4LFA H;  3L4K A;  2FE3 A;  1N34 H;  4IAJ A;  2KSW A;  3N40 P;  3L4J A;  4EFE A;  3UQ8 A;  1SYX B;  4DV0 H;  5FD6 A;  2WYO A;  4BWS C;  4OX9 H;  2ZJT A;  5A2Q W;  1HNZ H;  1XNR H;  1M0T A;  2HVQ A;  4MTD A;  4LSA A;  1BJT A;  3M4I A;  4X62 H;  1FKA H;  1IBL H;  5LMN H;  4JI0 H;  4EFB A;  2CW8 A;  2CW7 A;  4DR4 H;  4PDB A;  4UCU A;  1S03 G;  3PN1 A;  3RJ0 A;  5IWA H;  4JV5 H;  4KHP H;  4YHH H;  2HHH H;  1N36 H;  3BAB A;  2RGV A;  4NXM H;  3N42 B;  2UXC H;  2OWO A;  4CC6 A;  4LF4 H;  4DR1 H;  1E4G T;  4LF7 H;  3C0F B;  1DGS A;  4LF6 H;  2O03 A;  1SEI A;  5FPO A;  5FPR A;  3IG0 A;  1TA8 A;  3J80 W;  5FD5 A;  4CC5 A;  4LSX A;  2MCT A;  1ZHS A;  3RIZ A;  1GYF A;  4J0M A;  2VUG A;  4UCS A;  4RAY A;  2XIG A;  1FVI A;  1ZHQ A;  3LML A;  4APM A;  4FM9 A;  4NXN H;  4JYA H;  4X66 H;  3KAK A;  2UUC H;  4DR7 H;  1IBM H;  3N6X A;  3J81 W;  2UUA H;  4LH7 A;  4UCT A;  4LFC H;  1XMQ H;  4MTE A;  2W57 A;  3RGZ A;  5D1P A;  4EEQ A;  4JI5 H;  4UCO A;  5D1O A;  2WDT A;  3RGX A;  4DV1 H;  1MZB A;  2VPS A;  5LMU H;  4DV3 H;  4DR3 H;  4AQY H;  2UXB H;  3JSN A;  5D1O B;  5IT9 W;  4RB1 A;  1XNQ H;  1WH2 A;  1O75 A;  1P8L A;  5BR8 H;  1HNW H;  1Z2P X;  2Q2U A;  1M0W A;  2HGS A;  2YCH A;  1X9N A;  4DR2 H;  4LF8 H;  1I6U A;  2WE6 A;  3FMA A;  1E4F T;  4B3T H;  2Q2T A;  1VS0 A;  1IBK H;  4Q0Y A;  3H20 A;  2HVR A;  4MV9 A;  2E5L H;  2RGR A;  4B3R H;  4LMY A;  4DUZ H;  4JI6 H;  3BA8 A;  1S68 A;  3N44 B;  4UCR A;  4JI8 H;  2HVS A;  4GKJ H;  1HR0 H;  3F8N A;  3KXY T;  4X64 H;  4JI2 H;  2ZM6 H;  1Z2N X;  4UFZ A;  4RZQ A;  4A2A A;  5LL6 b;  3RTX A;  1I94 H;  2UXD H;  3DF7 A;  3MWM A;  3OTO H;  4JI3 H;  2VQE H;  3HXL A;  3KAL A;  4JI7 H;  3RF2 A;  4K0K H;  1FJG H;  4JI1 H;  2VQF H;  4LH6 A;  4ETS A;  4DV7 H;  4B3S H;  4X65 H;  4RB3 C;  4GLX A;  1N32 H;  4M7E A;  2F4V H;  3KAJ A;  3JAM W;  1XMO H;  4B3M H;  3BA9 A;  4RB0 A;  4A2B A;  4DV5 H;  4GKK H;  1HNX H;  1J5E H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...