4IAJA

Crystal structure of a conserved domain protein (sp_1775) from streptococcus pneumoniae tigr4 at 1.91 a resolution
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
76
structure length
76
Chain Sequence
b'VLNMIEITYIDASKNERTVTFESYEDFERSQQACLIGVADYYPVQKLTYKGHNLDYHGTYGDIFFYLMKQDLSQYN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Conserved domain protein
publication title Crystal structure of a conserved domain protein (SP_1775) from Streptococcus pneumoniae TIGR4 at 1.91 A resolution
rcsb
source organism Streptococcus pneumoniae
molecule tags Structural genomics, unknown function
total genus 19
structure length 76
sequence length 76
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2012-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF15507 DUF4649 Domain of unknown function (DUF4649)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.390 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4iajA00
4IAJA
chains in the Genus database with same CATH superfamily
3Q8RB 4HNTA 2CZGA 1S68A 1KJIA 2UXCH 4IAJA 2ASJA 2Y0SA 1Y1WA 1M0WA 4QWDA 5KG4A 3GIDA 2XD4A 3N40P 3GQCA 4ECVA 4EFBA 5I47A 2AGPA 1JLLB 2R85A 3QZ7A 4DR5H 3OSPA 3H4DA 5KFQA 2R92G 2JEJA 4JI2H 3MR3A 2E5LH 5DLGA 1K1QA 5IP7G 1IOVA 1AUVA 5KFYA 4RUAA 3GIPA 5LOVF 2C28A 4IR1A 3EYYA 5KFUA 3MWDA 1V4YA 3JSNA 1FKAH 2HJWA 4Q44A 4RB0A 4JV0A 1R9TA 4G3IA 5BPFA 3K3VA 1FJGH 2YRWA 4EBDA 4DL2A 1KJ8A 4WD3A 2FE3A 3M9MB 3FKIA 4JI7H 2RF4A 2UU9H 2YZMA 5KFZA 2GLTA 3VPCA 3RGXA 4RNMA 3RGZA 4IZOA 1JKJB 5IP9G 3CVZA 4MV4A 1KEEA 1T3NA 1SFOA 3Q8PB 3KHLA 3HOWG 4DR6H 1IOWA 2W6PA 3T5HA 3N6XA 5KFVA 4U6PA 2XCPA 1VBGA 5KG3A 3GV5B 1IBLH 4ED1A 4MV9A 5KFKA 3LWBA 2VPQA 3J81W 4C5CA 3PO3G 1E4EA 4A2BA 3R5HA 2VOBA 2UVWA 5DQGA 3BA8A 4EEYA 2F4VH 1O75A 1TAEA 3PW0A 3VPDA 4LH6A 3GIKA 1JXLA 1DIKA 3GTMA 3KALA 3KTMA 5KX5F 5LYJF 3G8CA 5DG8A 1N56A 1KC7A 1GGOA 5H80A 4U7CA 4J9QA 3IN5A 4EBCA 3RBDA 3L2PA 1BXRA 5CAEB 2OLSA 4AYBA 3LMLA 4M7EA 4JI8H 1BNCA 5HBRB 3EPIA 3TQ1A 1N36H 1I94H 4B3SH 5KFLA 5KFAA 1HR0H 2FB9A 5KT6A 2YS7A 4YHHH 4CC6A 5C1OA 1M0TA 4WBNF 1UC9A 4TV9F 4EYIB 2FP4B 1FVIA 1CQJB 2YRXA 2MCTA 4I4TF 4JI5H 4DL4A 2W9CA 5KT3A 2YS6A 2R7ZG 3TIGA 3PW7A 4ECTA 2R87A 2HVSA 2R7LA 5FPRA 3V4SA 1S0MA 5DLFA 4BBSG 1I7NA 1JDBB 4J9RA 4A2AA 1Z2NX 3PR4A 4ECYA 4ECQA 4M9UA 5L1JA 4GKJH 4C2MA 1S0NA 4ED2A 1UNNC 5EOYA 4J9NA 2CW8A 3V6KA 3Q2OA 1B6RA 4UCSA 3MWMA 4Q45A 3MR6A 5JH7F 4ECXA 4IRKA 4A3GG 4QJFA 5DGBA 2P0AA 3K3PA 4ECWA 1RYRA 2QK4A 2WAQE 4JYAH 5KFWA 4QWAA 2BR0A 4DV0H 3WNZA 4A3MG 4K0KH 5EWEA 1E4FT 1RJQA 1WCMG 4IHJF 2AQ4A 2XIGA 2J6SA 3RIZA 4J9PA 3R5XA 2JEFA 4A93G 4F4ZA 3ETJA 2ASLA 4LH7A 4RAYA 2XCLA 4IR9A 2FK1A 3VPBA 4ECZA 4MA5A 5CB4F 2W7PA 4ECSA 3T5JA 5D1OB 2YCHA 5IWAH 3HOXG 5C3EG 2IMWP 1RJRA 4X65H 1N33H 3GILA 5EDWA 5KG7A 3OHBA 3GIJA 4ED0A 1S10A 4TV8F 4DV3H 3T1YH 2OH2A 4LF6H 4LF8H 4HYKA 2VA3A 2UUAH 2IA6A 2JA5A 3HOZG 1L2ZA 3RUPA 1V9PA 1Y1WG 2ZM6H 3PZPA 5KFHA 4UCRA 4RNOA 3OSNA 3SE7A 2I87A 5C8YF 4Q8FA 4HNUA 4UCTA 1SEIA 5KT2A 1VS0A 5KFXA 4XYLB 4YY3H 2ALZA 4EFEA 5EZYF 3CQZA 3UFXB 5KG5A 2JA6G 1MZBA 4E4TA 4ED6A 5KG6A 2J6UA 2W7OA 5L1IA 4LSAA 4ZI7F 1SCUB 3K5HA 3KAKA 5C5JA 5LP6F 4LMYA 3RTXA 2VQEH 2DLNA 2HVRA 3JZIA 3GIIA 3QZ8A 2JA6A 1RJPA 2W70A 3KHHA 3PO2G 4RAZA 1N32H 5D1PA 2PVPA 5A2QW 1BJTA 1XNRH 1I6UA 3JRXA 1ULZA 5KFMA 3R23A 1EYZA 2KSWA 1JIHA 3FKIG 4GKKH 4DR2H 2R7NA 2HHHH 3I4NG 3IG0A 4X64H 3MFHA 3I4MG 2R86A 2WAQA 3OTOH 1EUDB 3L4JA 4F50A 4MA0A 3AYHB 3G6VA 2WTFA 4DL6A 3BQ1A 2HGSA 2SCUB 4X62H 3J80W 2W8LA 1RYSA 3C0FB 4RZQA 1T36A 1UC8A 3HXLA 4MTEA 3JAMW 2BQUA 3G6YA 5IT9W 2I8CA 2R8HA 2NU7B 4ED7A 5IYBG 4RU9A 3WO0A 2CKZB 5KFJA 1CE8A 3GTQA 4IRDA 1KJQA 4YJ3F 4A3BG 1KJ9A 3DF7A 2R7KA 4JI3H 5L9XA 2FPPB 1Y14B 1GLVA 3WO1A 2R7MA 3RV4A 1TWCA 4UFZA 5KFCA 2UVRA 4JI4H 4J9SA 1W96A 3RBEA 2BQ3A 3FDSA 3H3VH 4DV5H 2UUBH 2WYOA 4XZ3B 2DPIA 1S03G 2R8KA 2WE6A 4ETSA 4LSXA 3I12A 1GSOA 5FD6A 4RB1A 2BQRA 2UVUA 2NU6B 4O3OA 4YQWA 3RB3A 4O4IF 3KHGA 1CS0A 2C35B 1I50A 5EWGA 4MV3A 1N48A 1Z2OX 2PN1A 3GLKA 3PW2A 2C2RA 1EUCB 2J9GA 3HKZE 3BA9A 2R6FA 3PVXA 3RAQA 4R7RA 4LF7H 4O3SA 4YP3A 1A9XA 2ZJTA 4HR7A 3T1HH 2O03A 3SI8A 2UVVA 2C00A 2W9BB 3N8DA 4RNNA 4IWYA 4GLXA 5LMNH 2C2DA 5JUMA 1AUXA 1W93A 1ZQ7A 3RFCA 3N42B 1K83A 3JSLA 3PN1A 3EPGA 2DWCA 2V4RA 5KT5A 1PX2A 2IP4A 2YZNA 2W8KA 2PBZA 3H0GG 5F9NA 5IYCG 4RZRA 4DUYH 2W71A 1TWFA 4R8UB 4BWSC 4C5AA 5CA1F 3V4ZA 2FPIB 1WSCA 3KHRA 3TINA 3HOVG 2VUGA 3T5KA 2XGPA 3PW5A 4JV5H 4YR0A 4ZQIA 4O2BF 3U9TA 2JA8G 3H0GA 3J7AK 2VQDA 1HNWH 3RAXA 3K5IA 4MV6A 5KFEA 3MR5A 2W6ZA 4JI0H 4KHPH 2B63A 1WH2A 2FKLA 5DG9A 2JA7A 1EHIA 3OUZA 5C4XG 2W6NA 4EBEA 3RF2A 4F4WA 2AU0A 4LFCH 5IYZF 4I55F 4A3FG 5KT7A 5KFNA 3G6XA 4ZOLF 2FJZA 5KFSA 5J2UF 1TWAA 2NU9B 2JA5G 4NXMH 1AN7A 2PMZE 3OHAA 3GTOA 4DV2H 2NVYA 2CW7A 3T5LA 4F4XA 4NXNH 4TUYF 3GV7B 2XCAA 1XNQH 5EWFA 5KG2A 3RB0A 3E5NA 5JVLA 1J5EH 4ECRA 4DLKA 2Q2TA 1C30A 3HKZA 4RB2C 4A3IG 1S0OA 1HNXH 5C1PA 4QW9A 1HNZH 3LP8A 4B3RH 4J0MA 1B33N 3MR2A 2W6MA 5JVDF 5DG7A 4O3RA 1Y1VA 1GSHA 1C3OA 4JV1A 3MJFA 4FBUA 3FMAA 1GO3E 5CA0F 3V6HA 5J2TF 2C2EA 4A3JG 4EEQA 4B3MH 1DV2A 1I3QA 3MFIA 2CQYA 4QW8A 1IBMH 4BBRG 2NUAB 4FS1A 2YU9A 5IYDG 4APMA 4CC5A 4MV1A 4HNVA 3RB4A 1E4EB 1SYXB 4QIWA 5KFOA 4JI6H 4FS2A 2I80A 5BPHA 5C44G 2W57A 5KG1A 3V6JA 3BABA 5T14A 1BGWA 4O3QA 2IBKA 3Q8QB 4QWCA 4Q0YA 2V9WA 3HOYG 2VA2A 3HBLA 2NU8B 3U9SA 4YAKB 2R8JA 3GTKA 2V58A 2VR1A 2FPGB 5L1KA 4ZHQF 5D1OA 5LL6b 4YR3A 1EZ1A 2RDJA 3MWEA 4A3EG 1S9FA 2DZDA 3N43B 1B6SA 5KFIA 3H4BA 4F4YA 4DR3H 4A3LG 2JEIA 2YL2A 2M05A 4A3DG 4A3KG 4ED8A 2FLPA 2UXBH 4YB8B 2ZDHA 2V4QA 1TWHA 5FD5A 4J9OA 1M7JA 5KFRA 3F8NA 1S97A 2R92A 4BXXG 5K2MA 3BQ2A 2QYZA 2PMZA 5KFFA 2W9CB 4YR2A 4A3CG 4J9KA 1DV1A 4HQ6A 1DGSA 1OWTA 4DL3A 3L4KA 4PWQA 4RB3C 2OWOA 2W6QA 3OUUA 1P8LA 4EGQA 4BY7G 4Q8EA 4IWXA 4MAMA 1ZHSA 3H40A 4DV4H 2UXDH 1XMOH 1E4GT 4UCUA 2ATLA 2GPWA 4YBZB 4JV2A 1TA8A 3GV8B 5FLXW 4RUCA 2ASDA 1XMQH 5KT4A 4O2AF 5D8DA 4EG0A 4MTDA 4FU0A 2WB1E 2DIKA 4J9LA 2VUMG 2E2HA 4X66H 3NGDA 4ED3A 3GTJA 5LXTF 2NVXA 4O3PA 4TQRA 1RK6A 3M9OB 3RJ0A 2R84A 2AGQA 2FK3A 3TIIA 4C5BA 2R8IA 5KFPA 4FBTA 4QWBA 2VUMA 1I7LA 5BR8H 3HB9A 2R8GA 4OX9H 4DUZH 4TQSA 5KG0A 5DQIA 4JUZA 3RV3A 1GYFA 1Z2PX 4QIWE 4EGJA 2YZGA 4L1KA 2B63G 5F9LA 5DQHA 1M6VA 4O4HF 4LF4H 4NLGA 1GSAA 1RK5A 2FLNA 2GPSA 2AGOA 1IBKH 2YW2A 3ORRA 2Y0SE 3ORQA 1X9NA 2JA7G 5KFBA 2DPJA 2ZDGA 2ZDQA 3GTGA 1CQIB 3N44B 2FMAA 2WDTA 5KFDA 3BQ0A 4DL7A 4XYMB 3Q1KA 3GTLA 1XDNA 1PK8A 3TQTA 1KJJA 3BG5A 5KFGA 4DV6H 3N41B 2UUCH 4LF9H 3GIQA 4YAJB 4GC7A 3RB6A 1KBLA 2R7ZA 1VAJA 4DV7H 4I50F 2VPSA 2Q2UA 2W9AA 3Q8SB 3ETHA 4IRCA 4ECUA 3GIMA 4I7HA 5LA6F 1N34H 3KAJA 4Y8VB 5FLMG 3UQ8A 2R93G 5LMUH 4PDBA 1WR2A 2W9BA 5FPOA 5JQWA 2XC9A 3HOUG 1B04A 4LFBH 4ME6A 4MV8A 4AQYH 4Q43A 5KKNB 2RDIA 3PW4A 2JEGA 4DR7H 4MV7A 2XGQA 2R93A 1Y1VG 1VKZA 5L1LA 1T94A 4DR1H 4EYHB 1VBHA 1ZETA 4B3TH 4O4LF 2FK2A 4XX0B 4UCOA 1JDEA 1K1SA 4QWEA 3BJYA 4DL5A 4DR4H 1ZHQA 5DGAA 2V59A 2R82A 4R8UA 3VMMA 3M9NB 1TWGA 2V5AA 4YJ2F 3H20A 3KXYT 4GC6A 4BY1G 5BMVF 2VQFH 4JI1H 1WCMA 5FJ8G 2WB1A 4J9MA 2RGRA 1A0IA 1V51A 5HV6A 5GONF 4FM9A 3GTPA 2FLLA 4DV1H 2C22A 3PR5B 5KFTA 2HVQA 2YYAA 3M4IA 2W6OA 4UCVA 3R5FA 1JX4A 2J6TA 4LFAH 3BAAA 3JRWA 2E2IA 4AYBE 2X0SA 4LF5H 4O3NA 2RGVA 3QFFA
chains in the Genus database with same CATH topology
1E4FT 3N42B 1S68A 2XIGA 3JSLA 2UXCH 3PN1A 4IAJA 3RIZA 1DGSA 1M0WA 4DUYH 3N40P 4RB3C 3L4KA 4BWSC 4LH7A 4RAYA 2OWOA 4EFBA 1P8LA 4K0KH 4DR5H 5D1OB 2VUGA 2YCHA 5IWAH 1ZHSA 4JV5H 4X65H 4JI2H 4DV4H 2E5LH 1N33H 2UXDH 1XMOH 1E4GT 3J7AK 4UCUA 4DV3H 3T1YH 4LF6H 4LF8H 1HNWH 1TA8A 2UUAH 4KHPH 5FLXW 3EYYA 1XMQH 4JI0H 1L2ZA 1V9PA 4MTDA 1WH2A 3JSNA 1FKAH 2ZM6H 4RB0A 4UCRA 4X66H 4UCTA 1SEIA 3K3VA 1VS0A 3RJ0A 4YY3H 1FJGH 4EFEA 3RF2A 4LFCH 2FE3A 4JI7H 2UU9H 1MZBA 3RGXA 5BR8H 3RGZA 4OX9H 4DUZH 3CVZA 4LSAA 3KAKA 4DR6H 4LMYA 4NXMH 1GYFA 1AN7A 1Z2PX 3N6XA 3RTXA 2VQEH 4DV2H 2HVRA 2CW7A 1IBLH 4LF4H 4MV9A 3J81W 4RAZA 1IBKH 4NXNH 4A2BA 1N32H 5D1PA 5A2QW 1X9NA 2VOBA 1BJTA 1XNQH 1XNRH 1I6UA 3N44B 3BA8A 2F4VH 1J5EH 1O75A 1TAEA 2WDTA 2KSWA 4GKKH 4DR2H 4LH6A 2Q2TA 4RB2C 1HNXH 3KALA 2HHHH 3IG0A 1HNZH 4X64H 4B3RH 1XDNA 4J0MA 2UUCH 4DV6H 4LF9H 3N41B 3L2PA 3OTOH 3LMLA 3L4JA 4M7EA 4JI8H 4DV7H 3FMAA 2VPSA 1N36H 1I94H 2Q2UA 4B3SH 4JI1H 2HGSA 4X62H 3J80W 1HR0H 3C0FB 4I7HA 3HXLA 4RZQA 3KAJA 4MTEA 4EEQA 3JAMW 3UQ8A 4YHHH 1N34H 4B3MH 4CC6A 1M0TA 5LMUH 4PDBA 1IBMH 5IT9W 5FPOA 1B04A 4LFBH 4AQYH 4APMA 4CC5A 4DR7H 1FVIA 2MCTA 1SYXB 4MV7A 4JI5H 4JI6H 2W57A 4DR1H 2HVSA 4B3TH 3BABA 3DF7A 1BGWA 4UCOA 4JI3H 5FPRA 4Q0YA 4DR4H 1ZHQA 4JI4H 4UFZA 4A2AA 1Z2NX 3H20A 3KXYT 4DV5H 2VQFH 2WYOA 5D1OA 5LL6b 2UUBH 2RGRA 2WE6A 4ETSA 1A0IA 4LSXA 5FD6A 4RB1A 4DV0H 4FM9A 3N43B 1S03G 5EOYA 2CW8A 4DV1H 4DR3H 1Z2OX 4UCSA 2HVQA 3MWMA 4GKJH 3M4IA 3BA9A 4UCVA 4LF7H 4R7RA 3T1HH 2ZJTA 2UXBH 2O03A 4LFAH 3BAAA 5FD5A 4JYAH 3F8NA 4GLXA 4LF5H 2RGVA 5LMNH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IAJ A; 
#chains in the Genus database with same CATH topology
 3Q8R B;  4HNT A;  2CZG A;  1S68 A;  1KJI A;  2UXC H;  4IAJ A;  2ASJ A;  2Y0S A;  1Y1W A;  1M0W A;  4QWD A;  5KG4 A;  3GID A;  2XD4 A;  3N40 P;  3GQC A;  4ECV A;  4EFB A;  5I47 A;  2AGP A;  1JLL B;  2R85 A;  3QZ7 A;  4DR5 H;  3OSP A;  3H4D A;  5KFQ A;  2R92 G;  2JEJ A;  4JI2 H;  3MR3 A;  2E5L H;  5DLG A;  1K1Q A;  5IP7 G;  1IOV A;  1AUV A;  5KFY A;  4RUA A;  3GIP A;  5LOV F;  2C28 A;  4IR1 A;  3EYY A;  5KFU A;  3MWD A;  1V4Y A;  3JSN A;  1FKA H;  2HJW A;  4Q44 A;  4RB0 A;  4JV0 A;  1R9T A;  4G3I A;  5BPF A;  3K3V A;  1FJG H;  2YRW A;  4EBD A;  4DL2 A;  1KJ8 A;  4WD3 A;  2FE3 A;  3M9M B;  3FKI A;  4JI7 H;  2RF4 A;  2UU9 H;  2YZM A;  5KFZ A;  2GLT A;  3VPC A;  3RGX A;  4RNM A;  3RGZ A;  4IZO A;  1JKJ B;  5IP9 G;  3CVZ A;  4MV4 A;  1KEE A;  1T3N A;  1SFO A;  3Q8P B;  3KHL A;  3HOW G;  4DR6 H;  1IOW A;  2W6P A;  3T5H A;  3N6X A;  5KFV A;  4U6P A;  2XCP A;  1VBG A;  5KG3 A;  3GV5 B;  1IBL H;  4ED1 A;  4MV9 A;  5KFK A;  3LWB A;  2VPQ A;  3J81 W;  4C5C A;  3PO3 G;  1E4E A;  4A2B A;  3R5H A;  2VOB A;  2UVW A;  5DQG A;  3BA8 A;  4EEY A;  2F4V H;  1O75 A;  1TAE A;  3PW0 A;  3VPD A;  4LH6 A;  3GIK A;  1JXL A;  1DIK A;  3GTM A;  3KAL A;  3KTM A;  5KX5 F;  5LYJ F;  3G8C A;  5DG8 A;  1N56 A;  1KC7 A;  1GGO A;  5H80 A;  4U7C A;  4J9Q A;  3IN5 A;  4EBC A;  3RBD A;  3L2P A;  1BXR A;  5CAE B;  2OLS A;  4AYB A;  3LML A;  4M7E A;  4JI8 H;  1BNC A;  5HBR B;  3EPI A;  3TQ1 A;  1N36 H;  1I94 H;  4B3S H;  5KFL A;  5KFA A;  1HR0 H;  2FB9 A;  5KT6 A;  2YS7 A;  4YHH H;  4CC6 A;  5C1O A;  1M0T A;  4WBN F;  1UC9 A;  4TV9 F;  4EYI B;  2FP4 B;  1FVI A;  1CQJ B;  2YRX A;  2MCT A;  4I4T F;  4JI5 H;  4DL4 A;  2W9C A;  5KT3 A;  2YS6 A;  2R7Z G;  3TIG A;  3PW7 A;  4ECT A;  2R87 A;  2HVS A;  2R7L A;  5FPR A;  3V4S A;  1S0M A;  5DLF A;  4BBS G;  1I7N A;  1JDB B;  4J9R A;  4A2A A;  1Z2N X;  3PR4 A;  4ECY A;  4ECQ A;  4M9U A;  5L1J A;  4GKJ H;  4C2M A;  1S0N A;  4ED2 A;  1UNN C;  5EOY A;  4J9N A;  2CW8 A;  3V6K A;  3Q2O A;  1B6R A;  4UCS A;  3MWM A;  4Q45 A;  3MR6 A;  5JH7 F;  4ECX A;  4IRK A;  4A3G G;  4QJF A;  5DGB A;  2P0A A;  3K3P A;  4ECW A;  1RYR A;  2QK4 A;  2WAQ E;  4JYA H;  5KFW A;  4QWA A;  2BR0 A;  4DV0 H;  3WNZ A;  4A3M G;  4K0K H;  5EWE A;  1E4F T;  1RJQ A;  1WCM G;  4IHJ F;  2AQ4 A;  2XIG A;  2J6S A;  3RIZ A;  4J9P A;  3R5X A;  2JEF A;  4A93 G;  4F4Z A;  3ETJ A;  2ASL A;  4LH7 A;  4RAY A;  2XCL A;  4IR9 A;  2FK1 A;  3VPB A;  4ECZ A;  4MA5 A;  5CB4 F;  2W7P A;  4ECS A;  3T5J A;  5D1O B;  2YCH A;  5IWA H;  3HOX G;  5C3E G;  2IMW P;  1RJR A;  4X65 H;  1N33 H;  3GIL A;  5EDW A;  5KG7 A;  3OHB A;  3GIJ A;  4ED0 A;  1S10 A;  4TV8 F;  4DV3 H;  3T1Y H;  2OH2 A;  4LF6 H;  4LF8 H;  4HYK A;  2VA3 A;  2UUA H;  2IA6 A;  2JA5 A;  3HOZ G;  1L2Z A;  3RUP A;  1V9P A;  1Y1W G;  2ZM6 H;  3PZP A;  5KFH A;  4UCR A;  4RNO A;  3OSN A;  3SE7 A;  2I87 A;  5C8Y F;  4Q8F A;  4HNU A;  4UCT A;  1SEI A;  5KT2 A;  1VS0 A;  5KFX A;  4XYL B;  4YY3 H;  2ALZ A;  4EFE A;  5EZY F;  3CQZ A;  3UFX B;  5KG5 A;  2JA6 G;  1MZB A;  4E4T A;  4ED6 A;  5KG6 A;  2J6U A;  2W7O A;  5L1I A;  4LSA A;  4ZI7 F;  1SCU B;  3K5H A;  3KAK A;  5C5J A;  5LP6 F;  4LMY A;  3RTX A;  2VQE H;  2DLN A;  2HVR A;  3JZI A;  3GII A;  3QZ8 A;  2JA6 A;  1RJP A;  2W70 A;  3KHH A;  3PO2 G;  4RAZ A;  1N32 H;  5D1P A;  2PVP A;  5A2Q W;  1BJT A;  1XNR H;  1I6U A;  3JRX A;  1ULZ A;  5KFM A;  3R23 A;  1EYZ A;  2KSW A;  1JIH A;  3FKI G;  4GKK H;  4DR2 H;  2R7N A;  2HHH H;  3I4N G;  3IG0 A;  4X64 H;  3MFH A;  3I4M G;  2R86 A;  2WAQ A;  3OTO H;  1EUD B;  3L4J A;  4F50 A;  4MA0 A;  3AYH B;  3G6V A;  2WTF A;  4DL6 A;  3BQ1 A;  2HGS A;  2SCU B;  4X62 H;  3J80 W;  2W8L A;  1RYS A;  3C0F B;  4RZQ A;  1T36 A;  1UC8 A;  3HXL A;  4MTE A;  3JAM W;  2BQU A;  3G6Y A;  5IT9 W;  2I8C A;  2R8H A;  2NU7 B;  4ED7 A;  5IYB G;  4RU9 A;  3WO0 A;  2CKZ B;  5KFJ A;  1CE8 A;  3GTQ A;  4IRD A;  1KJQ A;  4YJ3 F;  4A3B G;  1KJ9 A;  3DF7 A;  2R7K A;  4JI3 H;  5L9X A;  2FPP B;  1Y14 B;  1GLV A;  3WO1 A;  2R7M A;  3RV4 A;  1TWC A;  4UFZ A;  5KFC A;  2UVR A;  4JI4 H;  4J9S A;  1W96 A;  3RBE A;  2BQ3 A;  3FDS A;  3H3V H;  4DV5 H;  2UUB H;  2WYO A;  4XZ3 B;  2DPI A;  1S03 G;  2R8K A;  2WE6 A;  4ETS A;  4LSX A;  3I12 A;  1GSO A;  5FD6 A;  4RB1 A;  2BQR A;  2UVU A;  2NU6 B;  4O3O A;  4YQW A;  3RB3 A;  4O4I F;  3KHG A;  1CS0 A;  2C35 B;  1I50 A;  5EWG A;  4MV3 A;  1N48 A;  1Z2O X;  2PN1 A;  3GLK A;  3PW2 A;  2C2R A;  1EUC B;  2J9G A;  3HKZ E;  3BA9 A;  2R6F A;  3PVX A;  3RAQ A;  4R7R A;  4LF7 H;  4O3S A;  4YP3 A;  1A9X A;  2ZJT A;  4HR7 A;  3T1H H;  2O03 A;  3SI8 A;  2UVV A;  2C00 A;  2W9B B;  3N8D A;  4RNN A;  4IWY A;  4GLX A;  5LMN H;  2C2D A;  5JUM A;  1AUX A;  1W93 A;  1ZQ7 A;  3RFC A;  3N42 B;  1K83 A;  3JSL A;  3PN1 A;  3EPG A;  2DWC A;  2V4R A;  5KT5 A;  1PX2 A;  2IP4 A;  2YZN A;  2W8K A;  2PBZ A;  3H0G G;  5F9N A;  5IYC G;  4RZR A;  4DUY H;  2W71 A;  1TWF A;  4R8U B;  4BWS C;  4C5A A;  5CA1 F;  3V4Z A;  2FPI B;  1WSC A;  3KHR A;  3TIN A;  3HOV G;  2VUG A;  3T5K A;  2XGP A;  3PW5 A;  4JV5 H;  4YR0 A;  4ZQI A;  4O2B F;  3U9T A;  2JA8 G;  3H0G A;  3J7A K;  2VQD A;  1HNW H;  3RAX A;  3K5I A;  4MV6 A;  5KFE A;  3MR5 A;  2W6Z A;  4JI0 H;  4KHP H;  2B63 A;  1WH2 A;  2FKL A;  5DG9 A;  2JA7 A;  1EHI A;  3OUZ A;  5C4X G;  2W6N A;  4EBE A;  3RF2 A;  4F4W A;  2AU0 A;  4LFC H;  5IYZ F;  4I55 F;  4A3F G;  5KT7 A;  5KFN A;  3G6X A;  4ZOL F;  2FJZ A;  5KFS A;  5J2U F;  1TWA A;  2NU9 B;  2JA5 G;  4NXM H;  1AN7 A;  2PMZ E;  3OHA A;  3GTO A;  4DV2 H;  2NVY A;  2CW7 A;  3T5L A;  4F4X A;  4NXN H;  4TUY F;  3GV7 B;  2XCA A;  1XNQ H;  5EWF A;  5KG2 A;  3RB0 A;  3E5N A;  5JVL A;  1J5E H;  4ECR A;  4DLK A;  2Q2T A;  1C30 A;  3HKZ A;  4RB2 C;  4A3I G;  1S0O A;  1HNX H;  5C1P A;  4QW9 A;  1HNZ H;  3LP8 A;  4B3R H;  4J0M A;  1B33 N;  3MR2 A;  2W6M A;  5JVD F;  5DG7 A;  4O3R A;  1Y1V A;  1GSH A;  1C3O A;  4JV1 A;  3MJF A;  4FBU A;  3FMA A;  1GO3 E;  5CA0 F;  3V6H A;  5J2T F;  2C2E A;  4A3J G;  4EEQ A;  4B3M H;  1DV2 A;  1I3Q A;  3MFI A;  2CQY A;  4QW8 A;  1IBM H;  4BBR G;  2NUA B;  4FS1 A;  2YU9 A;  5IYD G;  4APM A;  4CC5 A;  4MV1 A;  4HNV A;  3RB4 A;  1E4E B;  1SYX B;  4QIW A;  5KFO A;  4JI6 H;  4FS2 A;  2I80 A;  5BPH A;  5C44 G;  2W57 A;  5KG1 A;  3V6J A;  3BAB A;  5T14 A;  1BGW A;  4O3Q A;  2IBK A;  3Q8Q B;  4QWC A;  4Q0Y A;  2V9W A;  3HOY G;  2VA2 A;  3HBL A;  2NU8 B;  3U9S A;  4YAK B;  2R8J A;  3GTK A;  2V58 A;  2VR1 A;  2FPG B;  5L1K A;  4ZHQ F;  5D1O A;  5LL6 b;  4YR3 A;  1EZ1 A;  2RDJ A;  3MWE A;  4A3E G;  1S9F A;  2DZD A;  3N43 B;  1B6S A;  5KFI A;  3H4B A;  4F4Y A;  4DR3 H;  4A3L G;  2JEI A;  2YL2 A;  2M05 A;  4A3D G;  4A3K G;  4ED8 A;  2FLP A;  2UXB H;  4YB8 B;  2ZDH A;  2V4Q A;  1TWH A;  5FD5 A;  4J9O A;  1M7J A;  5KFR A;  3F8N A;  1S97 A;  2R92 A;  4BXX G;  5K2M A;  3BQ2 A;  2QYZ A;  2PMZ A;  5KFF A;  2W9C B;  4YR2 A;  4A3C G;  4J9K A;  1DV1 A;  4HQ6 A;  1DGS A;  1OWT A;  4DL3 A;  3L4K A;  4PWQ A;  4RB3 C;  2OWO A;  2W6Q A;  3OUU A;  1P8L A;  4EGQ A;  4BY7 G;  4Q8E A;  4IWX A;  4MAM A;  1ZHS A;  3H40 A;  4DV4 H;  2UXD H;  1XMO H;  1E4G T;  4UCU A;  2ATL A;  2GPW A;  4YBZ B;  4JV2 A;  1TA8 A;  3GV8 B;  5FLX W;  4RUC A;  2ASD A;  1XMQ H;  5KT4 A;  4O2A F;  5D8D A;  4EG0 A;  4MTD A;  4FU0 A;  2WB1 E;  2DIK A;  4J9L A;  2VUM G;  2E2H A;  4X66 H;  3NGD A;  4ED3 A;  3GTJ A;  5LXT F;  2NVX A;  4O3P A;  4TQR A;  1RK6 A;  3M9O B;  3RJ0 A;  2R84 A;  2AGQ A;  2FK3 A;  3TII A;  4C5B A;  2R8I A;  5KFP A;  4FBT A;  4QWB A;  2VUM A;  1I7L A;  5BR8 H;  3HB9 A;  2R8G A;  4OX9 H;  4DUZ H;  4TQS A;  5KG0 A;  5DQI A;  4JUZ A;  3RV3 A;  1GYF A;  1Z2P X;  4QIW E;  4EGJ A;  2YZG A;  4L1K A;  2B63 G;  5F9L A;  5DQH A;  1M6V A;  4O4H F;  4LF4 H;  4NLG A;  1GSA A;  1RK5 A;  2FLN A;  2GPS A;  2AGO A;  1IBK H;  2YW2 A;  3ORR A;  2Y0S E;  3ORQ A;  1X9N A;  2JA7 G;  5KFB A;  2DPJ A;  2ZDG A;  2ZDQ A;  3GTG A;  1CQI B;  3N44 B;  2FMA A;  2WDT A;  5KFD A;  3BQ0 A;  4DL7 A;  4XYM B;  3Q1K A;  3GTL A;  1XDN A;  1PK8 A;  3TQT A;  1KJJ A;  3BG5 A;  5KFG A;  4DV6 H;  3N41 B;  2UUC H;  4LF9 H;  3GIQ A;  4YAJ B;  4GC7 A;  3RB6 A;  1KBL A;  2R7Z A;  1VAJ A;  4DV7 H;  4I50 F;  2VPS A;  2Q2U A;  2W9A A;  3Q8S B;  3ETH A;  4IRC A;  4ECU A;  3GIM A;  4I7H A;  5LA6 F;  1N34 H;  3KAJ A;  4Y8V B;  5FLM G;  3UQ8 A;  2R93 G;  5LMU H;  4PDB A;  1WR2 A;  2W9B A;  5FPO A;  5JQW A;  2XC9 A;  3HOU G;  1B04 A;  4LFB H;  4ME6 A;  4MV8 A;  4AQY H;  4Q43 A;  5KKN B;  2RDI A;  3PW4 A;  2JEG A;  4DR7 H;  4MV7 A;  2XGQ A;  2R93 A;  1Y1V G;  1VKZ A;  5L1L A;  1T94 A;  4DR1 H;  4EYH B;  1VBH A;  1ZET A;  4B3T H;  4O4L F;  2FK2 A;  4XX0 B;  4UCO A;  1JDE A;  1K1S A;  4QWE A;  3BJY A;  4DL5 A;  4DR4 H;  1ZHQ A;  5DGA A;  2V59 A;  2R82 A;  4R8U A;  3VMM A;  3M9N B;  1TWG A;  2V5A A;  4YJ2 F;  3H20 A;  3KXY T;  4GC6 A;  4BY1 G;  5BMV F;  2VQF H;  4JI1 H;  1WCM A;  5FJ8 G;  2WB1 A;  4J9M A;  2RGR A;  1A0I A;  1V51 A;  5HV6 A;  5GON F;  4FM9 A;  3GTP A;  2FLL A;  4DV1 H;  2C22 A;  3PR5 B;  5KFT A;  2HVQ A;  2YYA A;  3M4I A;  2W6O A;  4UCV A;  3R5F A;  1JX4 A;  2J6T A;  4LFA H;  3BAA A;  3JRW A;  2E2I A;  4AYB E;  2X0S A;  4LF5 H;  4O3N A;  2RGV A;  3QFF A; 
#chains in the Genus database with same CATH homology
 1E4F T;  3N42 B;  1S68 A;  2XIG A;  3JSL A;  2UXC H;  3PN1 A;  4IAJ A;  3RIZ A;  1DGS A;  1M0W A;  4DUY H;  3N40 P;  4RB3 C;  3L4K A;  4BWS C;  4LH7 A;  4RAY A;  2OWO A;  4EFB A;  1P8L A;  4K0K H;  4DR5 H;  5D1O B;  2VUG A;  2YCH A;  5IWA H;  1ZHS A;  4JV5 H;  4X65 H;  4JI2 H;  4DV4 H;  2E5L H;  1N33 H;  2UXD H;  1XMO H;  1E4G T;  3J7A K;  4UCU A;  4DV3 H;  3T1Y H;  4LF6 H;  4LF8 H;  1HNW H;  1TA8 A;  2UUA H;  4KHP H;  5FLX W;  3EYY A;  1XMQ H;  4JI0 H;  1L2Z A;  1V9P A;  4MTD A;  1WH2 A;  3JSN A;  1FKA H;  2ZM6 H;  4RB0 A;  4UCR A;  4X66 H;  4UCT A;  1SEI A;  3K3V A;  1VS0 A;  3RJ0 A;  4YY3 H;  1FJG H;  4EFE A;  3RF2 A;  4LFC H;  2FE3 A;  4JI7 H;  2UU9 H;  1MZB A;  3RGX A;  5BR8 H;  3RGZ A;  4OX9 H;  4DUZ H;  3CVZ A;  4LSA A;  3KAK A;  4DR6 H;  4LMY A;  4NXM H;  1GYF A;  1AN7 A;  1Z2P X;  3N6X A;  3RTX A;  2VQE H;  4DV2 H;  2HVR A;  2CW7 A;  1IBL H;  4LF4 H;  4MV9 A;  3J81 W;  4RAZ A;  1IBK H;  4NXN H;  4A2B A;  1N32 H;  5D1P A;  5A2Q W;  1X9N A;  2VOB A;  1BJT A;  1XNQ H;  1XNR H;  1I6U A;  3N44 B;  3BA8 A;  2F4V H;  1J5E H;  1O75 A;  1TAE A;  2WDT A;  2KSW A;  4GKK H;  4DR2 H;  4LH6 A;  2Q2T A;  4RB2 C;  1HNX H;  3KAL A;  2HHH H;  3IG0 A;  1HNZ H;  4X64 H;  4B3R H;  1XDN A;  4J0M A;  2UUC H;  4DV6 H;  4LF9 H;  3N41 B;  3L2P A;  3OTO H;  3LML A;  3L4J A;  4M7E A;  4JI8 H;  4DV7 H;  3FMA A;  2VPS A;  1N36 H;  1I94 H;  2Q2U A;  4B3S H;  4JI1 H;  2HGS A;  4X62 H;  3J80 W;  1HR0 H;  3C0F B;  4I7H A;  3HXL A;  4RZQ A;  3KAJ A;  4MTE A;  4EEQ A;  3JAM W;  3UQ8 A;  4YHH H;  1N34 H;  4B3M H;  4CC6 A;  1M0T A;  5LMU H;  4PDB A;  1IBM H;  5IT9 W;  5FPO A;  1B04 A;  4LFB H;  4AQY H;  4APM A;  4CC5 A;  4DR7 H;  1FVI A;  2MCT A;  1SYX B;  4MV7 A;  4JI5 H;  4JI6 H;  2W57 A;  4DR1 H;  2HVS A;  4B3T H;  3BAB A;  3DF7 A;  1BGW A;  4UCO A;  4JI3 H;  5FPR A;  4Q0Y A;  4DR4 H;  1ZHQ A;  4JI4 H;  4UFZ A;  4A2A A;  1Z2N X;  3H20 A;  3KXY T;  4DV5 H;  2VQF H;  2WYO A;  5D1O A;  5LL6 b;  2UUB H;  2RGR A;  2WE6 A;  4ETS A;  1A0I A;  4LSX A;  5FD6 A;  4RB1 A;  4DV0 H;  4FM9 A;  3N43 B;  1S03 G;  5EOY A;  2CW8 A;  4DV1 H;  4DR3 H;  1Z2O X;  4UCS A;  2HVQ A;  3MWM A;  4GKJ H;  3M4I A;  3BA9 A;  4UCV A;  4LF7 H;  4R7R A;  3T1H H;  2ZJT A;  2UXB H;  2O03 A;  4LFA H;  3BAA A;  5FD5 A;  4JYA H;  3F8N A;  4GLX A;  4LF5 H;  2RGV A;  5LMN H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...