4IAJA

Crystal structure of a conserved domain protein (sp_1775) from streptococcus pneumoniae tigr4 at 1.91 a resolution
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
76
structure length
76
Chain Sequence
VLNMIEITYIDASKNERTVTFESYEDFERSQQACLIGVADYYPVQKLTYKGHNLDYHGTYGDIFFYLMKQDLSQYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Conserved domain protein
publication title Crystal structure of a conserved domain protein (SP_1775) from Streptococcus pneumoniae TIGR4 at 1.91 A resolution
rcsb
source organism Streptococcus pneumoniae
molecule tags Structural genomics, unknown function
total genus 19
structure length 76
sequence length 76
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2012-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF15507 DUF4649 Domain of unknown function (DUF4649)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.390 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4iajA00
4IAJA
chains in the Genus database with same CATH superfamily
3PO2G 4O3SA 1KJJA 1GGOA 5KFFA 3GIKA 5KG2A 3OUUA 4LFAH 3K5IA 4A3BG 4QJFA 3J80W 1SYXB 3GV7B 3BAAA 2R7ZA 3RB3A 2FMAA 4A2AA 3ORQA 3M9NB 4FBUA 2XGQA 4ECXA 4ECVA 3M4IA 1ULZA 1GSOA 1N48A 2HHHH 3HKZA 2W9CB 1Z2NX 4LH7A 5L1JA 3V6HA 2R7LA 1JX4A 5JUMA 1GLVA 2ZDHA 4DUZH 1W96A 4RUCA 1S0MA 4JV1A 4A3MG 4O3QA 3TIGA 1TWGA 2YZNA 3GTPA 3MFHA 4UFZA 4JI1H 1Y14B 2FB9A 3BA9A 5KFBA 3AYHB 3GTLA 4GKKH 4NLGA 3GTGA 1JLLB 2IP4A 4YHHH 3RTXA 3KTMA 4K0KH 2R93G 2FJZA 5DG9A 2E2HA 4ED1A 4YB8B 5H80A 4RB0A 3FKIA 3PW7A 1RYRA 4QIWA 3H4DA 2I87A 3VPBA 3GTMA 3Q8PB 4JV2A 4BWSC 3GV5B 1XMOH 3GIPA 4YQWA 3OUZA 4JYAH 2C00A 3N44B 1UNNC 4DL6A 3G8CA 5LOVF 3WO1A 1KBLA 2VUMA 4U7CA 1E4EB 4JI0H 4IWYA 4J9RA 2FPPB 3MR3A 4AQYH 3R5FA 4EBDA 4JI4H 3KHHA 4LH6A 4I4TF 1FVIA 4IWXA 4Q45A 3V6JA 2FLNA 3UFXB 3N8DA 1AUVA 4UCSA 2R84A 4B3SH 4TQRA 4DV6H 4YJ2F 1N34H 2UUCH 3GTOA 2XC9A 2ZDGA 4EBEA 3HBLA 2DIKA 2FPGB 3HB9A 3PW0A 2IA6A 4Q8FA 2UXCH 2FK1A 4YR3A 5DLFA 2RF4A 4LF9H 5F9LA 3H0GG 1GSAA 2R82A 5D1PA 4DR4H 4MTEA 3M9MB 4L1KA 2PMZA 5BR8H 4JI2H 4JUZA 5EDWA 4A3IG 3RB4A 3MWMA 4UCUA 1N36H 2Q2TA 1EUCB 2R92A 2Y0SA 1RJRA 5JVDF 4J9SA 5KFOA 3SE7A 1L2ZA 1Z2PX 5KG5A 3H40A 5IWAH 2BR0A 5T14A 3LMLA 2AGPA 4U6PA 4A3KG 3I4MG 4AYBA 1TAEA 1UC8A 5FPOA 1OWTA 4QW8A 4J9LA 2C2DA 2JEFA 5LMUH 1RYSA 2RDIA 4LF8H 5IYDG 2VUMG 4XX0B 1HR0H 5KFVA 2C2RA 1CQIB 3RGXA 5CB4F 1RJPA 3G6YA 2FP4B 3PVXA 2AU0A 4C5AA 4O4HF 4A93G 4JI3H 3HOWG 4IR1A 2AQ4A 2ZM6H 2W57A 3N6XA 2I8CA 3GTQA 5BMVF 5L1KA 4RB1A 2UUAH 2YU9A 4F4YA 4FS2A 2NU9B 2V58A 5BPHA 4DL4A 3GLKA 1K1QA 4DR7H 5KT3A 2FK2A 1RK6A 4EYIB 4Q43A 1C3OA 2HVQA 5KFDA 1T94A 2R92G 1TWFA 1T36A 5JQWA 4APMA 4EFBA 3HOXG 4DL7A 2P0AA 3CQZA 1V9PA 1TWAA 4M9UA 5FPRA 2NUAB 3EPGA 4GC6A 2W71A 4DR5H 3RJ0A 3HKZE 3T5LA 5KG3A 1I50A 5L1IA 2IMWP 4ECRA 1A0IA 2W6ZA 5HBRB 5JVLA 4WBNF 4DV0H 2WB1E 4EEQA 4ECWA 5C5JA 3GIMA 5IYCG 1JIHA 2YCHA 2XCLA 4LMYA 4ECSA 4IRKA 4GC7A 2WAQA 2VA3A 3JRXA 2KSWA 2V4QA 2R8JA 1Z2OX 5KT2A 4RNNA 2CZGA 4DV4H 2C2EA 2BQUA 1HNWH 4ECQA 4FU0A 1WR2A 3FDSA 3MWEA 2UXDH 3N43B 5CA1F 3M9OB 5K2MA 4O3PA 1BJTA 2W9CA 3H0GA 2HVRA 4JI6H 1KEEA 2UVVA 2C35B 2PN1A 5EZYF 4DV1H 3N41B 4IHJF 5CAEB 5F9NA 3TQ1A 4A3GG 4F50A 5DGBA 5KFIA 3N42B 2CKZB 5JH7F 5A2QW 4J9KA 4ED3A 4QWEA 5KX5F 1ZHSA 3K5HA 3E5NA 4FM9A 1M6VA 1ZHQA 4A3JG 2W6NA 2J6UA 3ORRA 2JA5A 2XCAA 2JEGA 1DV1A 4LF5H 1Y1VA 1M7JA 4DV5H 4HNTA 2UU9H 1J5EH 1VBGA 2HJWA 3OSPA 4OX9H 3I4NG 4LFBH 2YL2A 3HXLA 2VUGA 5CA0F 2FPIB 2R7KA 4CC5A 3GILA 4IZOA 1MZBA 4YY3H 2SCUB 1E4EA 3V4ZA 1RJQA 4BBSG 3ETJA 5KFHA 3R5HA 2R6FA 3L4KA 3CVZA 1KJ9A 3SI8A 3RAXA 2YS6A 3RUPA 3GTKA 4A3DG 1EUDB 5KFPA 3RB0A 2BQRA 2V59A 3BJYA 1KJIA 5KFMA 2R8HA 2WTFA 5IYZF 2DZDA 1HNXH 4DUYH 2RGRA 4BXXG 1M0WA 5KFLA 2R7NA 4AYBE 2C22A 2GLTA 3TQTA 4FBTA 2ZJTA 1JDEA 5KFWA 3GIIA 1S10A 4O2AF 1XDNA 1TWHA 3TIIA 4NXMH 3J7AK 2JA7A 2W7PA 5KFTA 3JAMW 4MA5A 1S97A 4MAMA 4QWAA 5IP9G 2R8KA 2FLLA 1VBHA 1CS0A 3K3PA 1CE8A 2R8IA 5LMNH 4J9NA 5KG6A 2NVYA 3T5HA 3GTJA 1C30A 4A3EG 1EHIA 4DV3H 4J9QA 4EGQA 4Q44A 2Q2UA 1B6SA 4X66H 2ASJA 2JA5G 3BABA 2W9AA 4MA0A 4RB2C 3G6VA 2E2IA 1EYZA 1Y1VG 4O3NA 3R5XA 2W6PA 3KHGA 3KHLA 3VMMA 3BQ0A 5KFEA 2FE3A 1B33N 4Q0YA 2VQFH 4EBCA 1RK5A 3HOVG 5FLMG 1CQJB 2ATLA 5EWFA 4R8UB 2C28A 3U9TA 1S9FA 5L9XA 3KALA 4ZHQF 2W8LA 1ZETA 2YYAA 4ED2A 2YZGA 4ED6A 2OLSA 2V9WA 5D8DA 4X62H 4XYLB 2JA6A 3GV8B 2M05A 5LXTF 4LSAA 5KKNB 1BXRA 5KFSA 3PR4A 2R85A 3GQCA 5KFAA 1XMQH 4EGJA 4YBZB 3EPIA 5HV6A 5C1OA 2R7MA 2AGQA 4DL2A 3RAQA 2RGVA 4F4WA 2UVUA 2JA7G 2CW7A 2OH2A 5J2TF 2CQYA 4ECTA 5KFNA 4LF4H 4DR6H 3MJFA 4TQSA 4MV3A 4RNMA 5IYBG 2MCTA 4A2BA 2ZDQA 3BA8A 1SCUB 4ECYA 1I6UA 3DF7A 4UCRA 4J0MA 4LF7H 3I12A 4A3FG 2R87A 5FD6A 2UVRA 4O4LF 5D1OA 4TV8F 2VQDA 2GPWA 2DWCA 3GIQA 4Y8VB 3VPCA 1R9TA 5DG7A 3QZ8A 4LSXA 3EYYA 5EWGA 1IOWA 2XCPA 3G6XA 2ASLA 5C8YF 1WSCA 1N32H 1E4GT 3MR2A 4RB3C 2W8KA 2W9BB 1S03G 3IN5A 4MTDA 4MV1A 3OHAA 3KXYT 4YR0A 4EYHB 4F4ZA 4C5CA 5J2UF 4YJ3F 4HYKA 3PZPA 2W7OA 2YZMA 1BNCA 5FD5A 1PK8A 2V5AA 3WO0A 2VA2A 2YW2A 2JA6G 3TINA 1GYFA 2UUBH 1B6RA 3JRWA 4M7EA 1BGWA 3LP8A 4RAYA 4DLKA 4QIWE 1KC7A 4J9MA 2QYZA 2HGSA 4IRDA 4DR1H 3RBEA 2WE6A 2UXBH 4BY1G 2W70A 4YAKB 1VKZA 1PX2A 1FKAH 5KT6A 5FJ8G 5KFYA 2VQEH 2W6MA 1SFOA 5BPFA 3LWBA 1Y1WA 2J6SA 1UC9A 3T1HH 4FS1A 4BY7G 4UCOA 1AN7A 4HNVA 3H3VH 3FMAA 3V4SA 4IAJA 4RZRA 4LF6H 1B04A 2JEJA 3PO3G 1GSHA 4DV2H 5DLGA 4ECUA 2YRXA 2XGPA 2O03A 4MV9A 5GONF 4JI5H 2WYOA 3ETHA 1N33H 3RB6A 2YS7A 4ED8A 1TA8A 3NGDA 2NU7B 2PMZE 5KFZA 2J9GA 4MV8A 4YAJB 4DR3H 4RUAA 2WB1A 3L2PA 4X64H 4J9PA 2Y0SE 2B63A 4B3TH 1O75A 3QZ7A 2XD4A 3JSLA 4PDBA 4O3RA 1M0TA 4B3RH 3HOYG 3T5JA 3V6KA 1HNZH 4JV5H 3MWDA 4O4IF 3Q8RB 4I7HA 5KG1A 3QFFA 5KT7A 4DL3A 1V51A 1P8LA 4B3MH 3BG5A 5LA6F 2I80A 5I47A 4I55F 4ZI7F 4MV4A 5DG8A 3Q1KA 5C1PA 1A9XA 1GO3E 4JV0A 3T1YH 5C4XG 4PWQA 1DV2A 1XNRH 4WD3A 1Y1WG 4A3LG 4DV7H 5KFQA 4XZ3B 4X65H 4DR2H 5KG0A 1DIKA 4BBRG 1K1SA 2JA8G 1I94H 3HOUG 4EEYA 5KFXA 4ED0A 4IR9A 2R7ZG 5KT4A 1WCMA 3H4BA 5C44G 1ZQ7A 3N40P 2R86A 5KT5A 5DGAA 5LYJF 2V4RA 2RDJA 3PW5A 3GIDA 2ASDA 4HQ6A 1V4YA 4ZQIA 1S0OA 2CW8A 3H20A 3BQ2A 3BQ1A 4R7RA 4TV9F 3T5KA 4GKJH 5KFRA 4Q8EA 3RV3A 2J6TA 4R8UA 5L1LA 3K3VA 3WNZA 2F4VH 3R23A 3MFIA 5DQHA 4DL5A 4MV6A 4ED7A 2B63G 1EZ1A 1IBKH 3RF2A 2XIGA 2AGOA 3OTOH 1JKJB 2WDTA 2DPIA 2PBZA 2QK4A 1E4FT 1AUXA 4EG0A 5DQGA 5FLXW 4QWCA 3IG0A 3RBDA 2X0SA 1K83A 2E5LH 4MV7A 2HVSA 4TUYF 5EWEA 3FKIG 3RGZA 3Q8SB 2FLPA 5KFKA 4E4TA 5C3EG 4EFEA 1JXLA 2OWOA 4QW9A 3Q8QB 2IBKA 2VOBA 1S0NA 3KHRA 5KFJA 4KHPH 4C2MA 1N56A 5LP6F 4ME6A 1W93A 3RV4A 4LFCH 2GPSA 2NU6B 3PN1A 4CC6A 1JDBB 3C0FB 2FK3A 4UCVA 2NVXA 4RAZA 4UCTA 4JI8H 3L4JA 2WAQE 4NXNH 1VAJA 1DGSA 4HR7A 1KJQA 3F8NA 1XNQH 3MR5A 1I7NA 4I50F 1WCMG 2VR1A 5KG7A 4C5BA 5KFCA 4JI7H 3KAJA 3OSNA 2R8GA 1TWCA 5KFGA 1IOVA 3MR6A 2YRWA 1WH2A 3JZIA 5EOYA 3PW4A 1IBLH 1IBMH 2FKLA 4GLXA 5IP7G 1S68A 2DPJA 4ETSA 3GIJA 2W9BA 1T3NA 2PVPA 4ZOLF 4RNOA 5IT9W 2JEIA 5DQIA 4F4XA 4O2BF 4XYMB 2DLNA 3U9SA 4RU9A 1I7LA 4J9OA 4QWBA 5KG4A 3VPDA 3JSNA 3KAKA 3OHBA 4G3IA 5KFUA 3UQ8A 2R93A 2VPQA 3J81W 4YR2A 3HOZG 4HNUA 1FJGH 1KJ8A 4RZQA 3RFCA 1VS0A 2VPSA 4QWDA 1I3QA 3PR5B 4A3CG 5D1OB 5LL6b 2W6OA 2W6QA 1SEIA 2BQ3A 2NU8B 4O3OA 3RIZA 4IRCA 4YP3A 4ECZA 3PW2A 1X9NA 2ALZA 3Q2OA 2UVWA
chains in the Genus database with same CATH topology
4B3TH 1O75A 4X66H 3BABA 3JSLA 4PDBA 4RB2C 1M0TA 4LFAH 4B3RH 1HNZH 4JV5H 4DR7H 4I7HA 3J80W 1SYXB 1P8LA 4B3MH 3BAAA 2FE3A 4Q0YA 4A2AA 2HVQA 2VQFH 3T1YH 3KALA 3M4IA 4APMA 4EFBA 1XNRH 1V9PA 2HHHH 5FPRA 4DV7H 4X62H 1Z2NX 4LH7A 4DR5H 3RJ0A 4X65H 4DUZH 4DR2H 4LSAA 1A0IA 1I94H 2UUAH 1XMQH 4UFZA 4DV0H 4JI1H 3BA9A 4EEQA 3N40P 4GKKH 2RGVA 4YHHH 3RTXA 2CW7A 4K0KH 2CW8A 2YCHA 3H20A 4R7RA 4LMYA 4RB0A 4LF4H 4DR6H 4RB1A 2KSWA 3K3VA 1Z2OX 2F4VH 4DV4H 2MCTA 4A2BA 4BWSC 1XMOH 1HNWH 3BA8A 4JYAH 3N44B 1I6UA 2UXDH 3N43B 3DF7A 4UCRA 1BJTA 4J0MA 1IBKH 4LF7H 5FD6A 3RF2A 2XIGA 5D1OA 3OTOH 4JI0H 2WDTA 4JI4H 4AQYH 2HVRA 1E4FT 4JI6H 5FLXW 4LSXA 3IG0A 3EYYA 4DV1H 4LH6A 3N41B 2E5LH 4MV7A 2HVSA 3RGZA 1N32H 1E4GT 1FVIA 4EFEA 4RB3C 2OWOA 3N42B 4UCSA 1S03G 5A2QW 4MTDA 4B3SH 2VOBA 4DV6H 2UUCH 1N34H 4KHPH 3KXYT 1ZHSA 4FM9A 2UXCH 1ZHQA 5FD5A 4LFCH 4LF5H 4CC6A 3PN1A 2UU9H 4DV5H 4LF9H 1GYFA 3C0FB 1J5EH 4LFBH 2UUBH 4UCVA 4OX9H 4M7EA 5D1PA 4RAZA 4UCTA 1BGWA 3HXLA 4RAYA 4MTEA 3L4JA 2VUGA 4JI8H 4NXNH 4DR4H 2HGSA 1DGSA 5BR8H 1XNQH 3F8NA 4CC5A 2WE6A 4JI2H 4DR1H 2UXBH 1MZBA 3MWMA 4UCUA 4YY3H 1N36H 2Q2TA 4JI7H 1FKAH 3KAJA 3L4KA 1L2ZA 1Z2PX 3CVZA 2VQEH 5IWAH 1WH2A 3LMLA 5EOYA 3T1HH 1IBLH 1IBMH 4UCOA 4GLXA 1AN7A 1S68A 4ETSA 1HNXH 3FMAA 1TAEA 4DUYH 4IAJA 2RGRA 1M0WA 5IT9W 5FPOA 4LF6H 1B04A 2ZJTA 5LMUH 4DV2H 4LF8H 4NXMH 1XDNA 3JSNA 3J7AK 1HR0H 3KAKA 2O03A 4MV9A 3JAMW 3RGXA 3UQ8A 4GKJH 3J81W 4JI5H 1FJGH 2WYOA 4RZQA 1VS0A 2VPSA 1N33H 5D1OB 1TA8A 5LMNH 5LL6b 4JI3H 1SEIA 2ZM6H 2W57A 3N6XA 3RIZA 1X9NA 4DR3H 4DV3H 3L2PA 4X64H 2Q2UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IAJ A; 
#chains in the Genus database with same CATH topology
 3PO2 G;  4O3S A;  1KJJ A;  1GGO A;  5KFF A;  3GIK A;  5KG2 A;  3OUU A;  4LFA H;  3K5I A;  4A3B G;  4QJF A;  3J80 W;  1SYX B;  3GV7 B;  3BAA A;  2R7Z A;  3RB3 A;  2FMA A;  4A2A A;  3ORQ A;  3M9N B;  4FBU A;  2XGQ A;  4ECX A;  4ECV A;  3M4I A;  1ULZ A;  1GSO A;  1N48 A;  2HHH H;  3HKZ A;  2W9C B;  1Z2N X;  4LH7 A;  5L1J A;  3V6H A;  2R7L A;  1JX4 A;  5JUM A;  1GLV A;  2ZDH A;  4DUZ H;  1W96 A;  4RUC A;  1S0M A;  4JV1 A;  4A3M G;  4O3Q A;  3TIG A;  1TWG A;  2YZN A;  3GTP A;  3MFH A;  4UFZ A;  4JI1 H;  1Y14 B;  2FB9 A;  3BA9 A;  5KFB A;  3AYH B;  3GTL A;  4GKK H;  4NLG A;  3GTG A;  1JLL B;  2IP4 A;  4YHH H;  3RTX A;  3KTM A;  4K0K H;  2R93 G;  2FJZ A;  5DG9 A;  2E2H A;  4ED1 A;  4YB8 B;  5H80 A;  4RB0 A;  3FKI A;  3PW7 A;  1RYR A;  4QIW A;  3H4D A;  2I87 A;  3VPB A;  3GTM A;  3Q8P B;  4JV2 A;  4BWS C;  3GV5 B;  1XMO H;  3GIP A;  4YQW A;  3OUZ A;  4JYA H;  2C00 A;  3N44 B;  1UNN C;  4DL6 A;  3G8C A;  5LOV F;  3WO1 A;  1KBL A;  2VUM A;  4U7C A;  1E4E B;  4JI0 H;  4IWY A;  4J9R A;  2FPP B;  3MR3 A;  4AQY H;  3R5F A;  4EBD A;  4JI4 H;  3KHH A;  4LH6 A;  4I4T F;  1FVI A;  4IWX A;  4Q45 A;  3V6J A;  2FLN A;  3UFX B;  3N8D A;  1AUV A;  4UCS A;  2R84 A;  4B3S H;  4TQR A;  4DV6 H;  4YJ2 F;  1N34 H;  2UUC H;  3GTO A;  2XC9 A;  2ZDG A;  4EBE A;  3HBL A;  2DIK A;  2FPG B;  3HB9 A;  3PW0 A;  2IA6 A;  4Q8F A;  2UXC H;  2FK1 A;  4YR3 A;  5DLF A;  2RF4 A;  4LF9 H;  5F9L A;  3H0G G;  1GSA A;  2R82 A;  5D1P A;  4DR4 H;  4MTE A;  3M9M B;  4L1K A;  2PMZ A;  5BR8 H;  4JI2 H;  4JUZ A;  5EDW A;  4A3I G;  3RB4 A;  3MWM A;  4UCU A;  1N36 H;  2Q2T A;  1EUC B;  2R92 A;  2Y0S A;  1RJR A;  5JVD F;  4J9S A;  5KFO A;  3SE7 A;  1L2Z A;  1Z2P X;  5KG5 A;  3H40 A;  5IWA H;  2BR0 A;  5T14 A;  3LML A;  2AGP A;  4U6P A;  4A3K G;  3I4M G;  4AYB A;  1TAE A;  1UC8 A;  5FPO A;  1OWT A;  4QW8 A;  4J9L A;  2C2D A;  2JEF A;  5LMU H;  1RYS A;  2RDI A;  4LF8 H;  5IYD G;  2VUM G;  4XX0 B;  1HR0 H;  5KFV A;  2C2R A;  1CQI B;  3RGX A;  5CB4 F;  1RJP A;  3G6Y A;  2FP4 B;  3PVX A;  2AU0 A;  4C5A A;  4O4H F;  4A93 G;  4JI3 H;  3HOW G;  4IR1 A;  2AQ4 A;  2ZM6 H;  2W57 A;  3N6X A;  2I8C A;  3GTQ A;  5BMV F;  5L1K A;  4RB1 A;  2UUA H;  2YU9 A;  4F4Y A;  4FS2 A;  2NU9 B;  2V58 A;  5BPH A;  4DL4 A;  3GLK A;  1K1Q A;  4DR7 H;  5KT3 A;  2FK2 A;  1RK6 A;  4EYI B;  4Q43 A;  1C3O A;  2HVQ A;  5KFD A;  1T94 A;  2R92 G;  1TWF A;  1T36 A;  5JQW A;  4APM A;  4EFB A;  3HOX G;  4DL7 A;  2P0A A;  3CQZ A;  1V9P A;  1TWA A;  4M9U A;  5FPR A;  2NUA B;  3EPG A;  4GC6 A;  2W71 A;  4DR5 H;  3RJ0 A;  3HKZ E;  3T5L A;  5KG3 A;  1I50 A;  5L1I A;  2IMW P;  4ECR A;  1A0I A;  2W6Z A;  5HBR B;  5JVL A;  4WBN F;  4DV0 H;  2WB1 E;  4EEQ A;  4ECW A;  5C5J A;  3GIM A;  5IYC G;  1JIH A;  2YCH A;  2XCL A;  4LMY A;  4ECS A;  4IRK A;  4GC7 A;  2WAQ A;  2VA3 A;  3JRX A;  2KSW A;  2V4Q A;  2R8J A;  1Z2O X;  5KT2 A;  4RNN A;  2CZG A;  4DV4 H;  2C2E A;  2BQU A;  1HNW H;  4ECQ A;  4FU0 A;  1WR2 A;  3FDS A;  3MWE A;  2UXD H;  3N43 B;  5CA1 F;  3M9O B;  5K2M A;  4O3P A;  1BJT A;  2W9C A;  3H0G A;  2HVR A;  4JI6 H;  1KEE A;  2UVV A;  2C35 B;  2PN1 A;  5EZY F;  4DV1 H;  3N41 B;  4IHJ F;  5CAE B;  5F9N A;  3TQ1 A;  4A3G G;  4F50 A;  5DGB A;  5KFI A;  3N42 B;  2CKZ B;  5JH7 F;  5A2Q W;  4J9K A;  4ED3 A;  4QWE A;  5KX5 F;  1ZHS A;  3K5H A;  3E5N A;  4FM9 A;  1M6V A;  1ZHQ A;  4A3J G;  2W6N A;  2J6U A;  3ORR A;  2JA5 A;  2XCA A;  2JEG A;  1DV1 A;  4LF5 H;  1Y1V A;  1M7J A;  4DV5 H;  4HNT A;  2UU9 H;  1J5E H;  1VBG A;  2HJW A;  3OSP A;  4OX9 H;  3I4N G;  4LFB H;  2YL2 A;  3HXL A;  2VUG A;  5CA0 F;  2FPI B;  2R7K A;  4CC5 A;  3GIL A;  4IZO A;  1MZB A;  4YY3 H;  2SCU B;  1E4E A;  3V4Z A;  1RJQ A;  4BBS G;  3ETJ A;  5KFH A;  3R5H A;  2R6F A;  3L4K A;  3CVZ A;  1KJ9 A;  3SI8 A;  3RAX A;  2YS6 A;  3RUP A;  3GTK A;  4A3D G;  1EUD B;  5KFP A;  3RB0 A;  2BQR A;  2V59 A;  3BJY A;  1KJI A;  5KFM A;  2R8H A;  2WTF A;  5IYZ F;  2DZD A;  1HNX H;  4DUY H;  2RGR A;  4BXX G;  1M0W A;  5KFL A;  2R7N A;  4AYB E;  2C22 A;  2GLT A;  3TQT A;  4FBT A;  2ZJT A;  1JDE A;  5KFW A;  3GII A;  1S10 A;  4O2A F;  1XDN A;  1TWH A;  3TII A;  4NXM H;  3J7A K;  2JA7 A;  2W7P A;  5KFT A;  3JAM W;  4MA5 A;  1S97 A;  4MAM A;  4QWA A;  5IP9 G;  2R8K A;  2FLL A;  1VBH A;  1CS0 A;  3K3P A;  1CE8 A;  2R8I A;  5LMN H;  4J9N A;  5KG6 A;  2NVY A;  3T5H A;  3GTJ A;  1C30 A;  4A3E G;  1EHI A;  4DV3 H;  4J9Q A;  4EGQ A;  4Q44 A;  2Q2U A;  1B6S A;  4X66 H;  2ASJ A;  2JA5 G;  3BAB A;  2W9A A;  4MA0 A;  4RB2 C;  3G6V A;  2E2I A;  1EYZ A;  1Y1V G;  4O3N A;  3R5X A;  2W6P A;  3KHG A;  3KHL A;  3VMM A;  3BQ0 A;  5KFE A;  2FE3 A;  1B33 N;  4Q0Y A;  2VQF H;  4EBC A;  1RK5 A;  3HOV G;  5FLM G;  1CQJ B;  2ATL A;  5EWF A;  4R8U B;  2C28 A;  3U9T A;  1S9F A;  5L9X A;  3KAL A;  4ZHQ F;  2W8L A;  1ZET A;  2YYA A;  4ED2 A;  2YZG A;  4ED6 A;  2OLS A;  2V9W A;  5D8D A;  4X62 H;  4XYL B;  2JA6 A;  3GV8 B;  2M05 A;  5LXT F;  4LSA A;  5KKN B;  1BXR A;  5KFS A;  3PR4 A;  2R85 A;  3GQC A;  5KFA A;  1XMQ H;  4EGJ A;  4YBZ B;  3EPI A;  5HV6 A;  5C1O A;  2R7M A;  2AGQ A;  4DL2 A;  3RAQ A;  2RGV A;  4F4W A;  2UVU A;  2JA7 G;  2CW7 A;  2OH2 A;  5J2T F;  2CQY A;  4ECT A;  5KFN A;  4LF4 H;  4DR6 H;  3MJF A;  4TQS A;  4MV3 A;  4RNM A;  5IYB G;  2MCT A;  4A2B A;  2ZDQ A;  3BA8 A;  1SCU B;  4ECY A;  1I6U A;  3DF7 A;  4UCR A;  4J0M A;  4LF7 H;  3I12 A;  4A3F G;  2R87 A;  5FD6 A;  2UVR A;  4O4L F;  5D1O A;  4TV8 F;  2VQD A;  2GPW A;  2DWC A;  3GIQ A;  4Y8V B;  3VPC A;  1R9T A;  5DG7 A;  3QZ8 A;  4LSX A;  3EYY A;  5EWG A;  1IOW A;  2XCP A;  3G6X A;  2ASL A;  5C8Y F;  1WSC A;  1N32 H;  1E4G T;  3MR2 A;  4RB3 C;  2W8K A;  2W9B B;  1S03 G;  3IN5 A;  4MTD A;  4MV1 A;  3OHA A;  3KXY T;  4YR0 A;  4EYH B;  4F4Z A;  4C5C A;  5J2U F;  4YJ3 F;  4HYK A;  3PZP A;  2W7O A;  2YZM A;  1BNC A;  5FD5 A;  1PK8 A;  2V5A A;  3WO0 A;  2VA2 A;  2YW2 A;  2JA6 G;  3TIN A;  1GYF A;  2UUB H;  1B6R A;  3JRW A;  4M7E A;  1BGW A;  3LP8 A;  4RAY A;  4DLK A;  4QIW E;  1KC7 A;  4J9M A;  2QYZ A;  2HGS A;  4IRD A;  4DR1 H;  3RBE A;  2WE6 A;  2UXB H;  4BY1 G;  2W70 A;  4YAK B;  1VKZ A;  1PX2 A;  1FKA H;  5KT6 A;  5FJ8 G;  5KFY A;  2VQE H;  2W6M A;  1SFO A;  5BPF A;  3LWB A;  1Y1W A;  2J6S A;  1UC9 A;  3T1H H;  4FS1 A;  4BY7 G;  4UCO A;  1AN7 A;  4HNV A;  3H3V H;  3FMA A;  3V4S A;  4IAJ A;  4RZR A;  4LF6 H;  1B04 A;  2JEJ A;  3PO3 G;  1GSH A;  4DV2 H;  5DLG A;  4ECU A;  2YRX A;  2XGP A;  2O03 A;  4MV9 A;  5GON F;  4JI5 H;  2WYO A;  3ETH A;  1N33 H;  3RB6 A;  2YS7 A;  4ED8 A;  1TA8 A;  3NGD A;  2NU7 B;  2PMZ E;  5KFZ A;  2J9G A;  4MV8 A;  4YAJ B;  4DR3 H;  4RUA A;  2WB1 A;  3L2P A;  4X64 H;  4J9P A;  2Y0S E;  2B63 A;  4B3T H;  1O75 A;  3QZ7 A;  2XD4 A;  3JSL A;  4PDB A;  4O3R A;  1M0T A;  4B3R H;  3HOY G;  3T5J A;  3V6K A;  1HNZ H;  4JV5 H;  3MWD A;  4O4I F;  3Q8R B;  4I7H A;  5KG1 A;  3QFF A;  5KT7 A;  4DL3 A;  1V51 A;  1P8L A;  4B3M H;  3BG5 A;  5LA6 F;  2I80 A;  5I47 A;  4I55 F;  4ZI7 F;  4MV4 A;  5DG8 A;  3Q1K A;  5C1P A;  1A9X A;  1GO3 E;  4JV0 A;  3T1Y H;  5C4X G;  4PWQ A;  1DV2 A;  1XNR H;  4WD3 A;  1Y1W G;  4A3L G;  4DV7 H;  5KFQ A;  4XZ3 B;  4X65 H;  4DR2 H;  5KG0 A;  1DIK A;  4BBR G;  1K1S A;  2JA8 G;  1I94 H;  3HOU G;  4EEY A;  5KFX A;  4ED0 A;  4IR9 A;  2R7Z G;  5KT4 A;  1WCM A;  3H4B A;  5C44 G;  1ZQ7 A;  3N40 P;  2R86 A;  5KT5 A;  5DGA A;  5LYJ F;  2V4R A;  2RDJ A;  3PW5 A;  3GID A;  2ASD A;  4HQ6 A;  1V4Y A;  4ZQI A;  1S0O A;  2CW8 A;  3H20 A;  3BQ2 A;  3BQ1 A;  4R7R A;  4TV9 F;  3T5K A;  4GKJ H;  5KFR A;  4Q8E A;  3RV3 A;  2J6T A;  4R8U A;  5L1L A;  3K3V A;  3WNZ A;  2F4V H;  3R23 A;  3MFI A;  5DQH A;  4DL5 A;  4MV6 A;  4ED7 A;  2B63 G;  1EZ1 A;  1IBK H;  3RF2 A;  2XIG A;  2AGO A;  3OTO H;  1JKJ B;  2WDT A;  2DPI A;  2PBZ A;  2QK4 A;  1E4F T;  1AUX A;  4EG0 A;  5DQG A;  5FLX W;  4QWC A;  3IG0 A;  3RBD A;  2X0S A;  1K83 A;  2E5L H;  4MV7 A;  2HVS A;  4TUY F;  5EWE A;  3FKI G;  3RGZ A;  3Q8S B;  2FLP A;  5KFK A;  4E4T A;  5C3E G;  4EFE A;  1JXL A;  2OWO A;  4QW9 A;  3Q8Q B;  2IBK A;  2VOB A;  1S0N A;  3KHR A;  5KFJ A;  4KHP H;  4C2M A;  1N56 A;  5LP6 F;  4ME6 A;  1W93 A;  3RV4 A;  4LFC H;  2GPS A;  2NU6 B;  3PN1 A;  4CC6 A;  1JDB B;  3C0F B;  2FK3 A;  4UCV A;  2NVX A;  4RAZ A;  4UCT A;  4JI8 H;  3L4J A;  2WAQ E;  4NXN H;  1VAJ A;  1DGS A;  4HR7 A;  1KJQ A;  3F8N A;  1XNQ H;  3MR5 A;  1I7N A;  4I50 F;  1WCM G;  2VR1 A;  5KG7 A;  4C5B A;  5KFC A;  4JI7 H;  3KAJ A;  3OSN A;  2R8G A;  1TWC A;  5KFG A;  1IOV A;  3MR6 A;  2YRW A;  1WH2 A;  3JZI A;  5EOY A;  3PW4 A;  1IBL H;  1IBM H;  2FKL A;  4GLX A;  5IP7 G;  1S68 A;  2DPJ A;  4ETS A;  3GIJ A;  2W9B A;  1T3N A;  2PVP A;  4ZOL F;  4RNO A;  5IT9 W;  2JEI A;  5DQI A;  4F4X A;  4O2B F;  4XYM B;  2DLN A;  3U9S A;  4RU9 A;  1I7L A;  4J9O A;  4QWB A;  5KG4 A;  3VPD A;  3JSN A;  3KAK A;  3OHB A;  4G3I A;  5KFU A;  3UQ8 A;  2R93 A;  2VPQ A;  3J81 W;  4YR2 A;  3HOZ G;  4HNU A;  1FJG H;  1KJ8 A;  4RZQ A;  3RFC A;  1VS0 A;  2VPS A;  4QWD A;  1I3Q A;  3PR5 B;  4A3C G;  5D1O B;  5LL6 b;  2W6O A;  2W6Q A;  1SEI A;  2BQ3 A;  2NU8 B;  4O3O A;  3RIZ A;  4IRC A;  4YP3 A;  4ECZ A;  3PW2 A;  1X9N A;  2ALZ A;  3Q2O A;  2UVW A; 
#chains in the Genus database with same CATH homology
 4B3T H;  1O75 A;  4X66 H;  3BAB A;  3JSL A;  4PDB A;  4RB2 C;  1M0T A;  4LFA H;  4B3R H;  1HNZ H;  4JV5 H;  4DR7 H;  4I7H A;  3J80 W;  1SYX B;  1P8L A;  4B3M H;  3BAA A;  2FE3 A;  4Q0Y A;  4A2A A;  2HVQ A;  2VQF H;  3T1Y H;  3KAL A;  3M4I A;  4APM A;  4EFB A;  1XNR H;  1V9P A;  2HHH H;  5FPR A;  4DV7 H;  4X62 H;  1Z2N X;  4LH7 A;  4DR5 H;  3RJ0 A;  4X65 H;  4DUZ H;  4DR2 H;  4LSA A;  1A0I A;  1I94 H;  2UUA H;  1XMQ H;  4UFZ A;  4DV0 H;  4JI1 H;  3BA9 A;  4EEQ A;  3N40 P;  4GKK H;  2RGV A;  4YHH H;  3RTX A;  2CW7 A;  4K0K H;  2CW8 A;  2YCH A;  3H20 A;  4R7R A;  4LMY A;  4RB0 A;  4LF4 H;  4DR6 H;  4RB1 A;  2KSW A;  3K3V A;  1Z2O X;  2F4V H;  4DV4 H;  2MCT A;  4A2B A;  4BWS C;  1XMO H;  1HNW H;  3BA8 A;  4JYA H;  3N44 B;  1I6U A;  2UXD H;  3N43 B;  3DF7 A;  4UCR A;  1BJT A;  4J0M A;  1IBK H;  4LF7 H;  5FD6 A;  3RF2 A;  2XIG A;  5D1O A;  3OTO H;  4JI0 H;  2WDT A;  4JI4 H;  4AQY H;  2HVR A;  1E4F T;  4JI6 H;  5FLX W;  4LSX A;  3IG0 A;  3EYY A;  4DV1 H;  4LH6 A;  3N41 B;  2E5L H;  4MV7 A;  2HVS A;  3RGZ A;  1N32 H;  1E4G T;  1FVI A;  4EFE A;  4RB3 C;  2OWO A;  3N42 B;  4UCS A;  1S03 G;  5A2Q W;  4MTD A;  4B3S H;  2VOB A;  4DV6 H;  2UUC H;  1N34 H;  4KHP H;  3KXY T;  1ZHS A;  4FM9 A;  2UXC H;  1ZHQ A;  5FD5 A;  4LFC H;  4LF5 H;  4CC6 A;  3PN1 A;  2UU9 H;  4DV5 H;  4LF9 H;  1GYF A;  3C0F B;  1J5E H;  4LFB H;  2UUB H;  4UCV A;  4OX9 H;  4M7E A;  5D1P A;  4RAZ A;  4UCT A;  1BGW A;  3HXL A;  4RAY A;  4MTE A;  3L4J A;  2VUG A;  4JI8 H;  4NXN H;  4DR4 H;  2HGS A;  1DGS A;  5BR8 H;  1XNQ H;  3F8N A;  4CC5 A;  2WE6 A;  4JI2 H;  4DR1 H;  2UXB H;  1MZB A;  3MWM A;  4UCU A;  4YY3 H;  1N36 H;  2Q2T A;  4JI7 H;  1FKA H;  3KAJ A;  3L4K A;  1L2Z A;  1Z2P X;  3CVZ A;  2VQE H;  5IWA H;  1WH2 A;  3LML A;  5EOY A;  3T1H H;  1IBL H;  1IBM H;  4UCO A;  4GLX A;  1AN7 A;  1S68 A;  4ETS A;  1HNX H;  3FMA A;  1TAE A;  4DUY H;  4IAJ A;  2RGR A;  1M0W A;  5IT9 W;  5FPO A;  4LF6 H;  1B04 A;  2ZJT A;  5LMU H;  4DV2 H;  4LF8 H;  4NXM H;  1XDN A;  3JSN A;  3J7A K;  1HR0 H;  3KAK A;  2O03 A;  4MV9 A;  3JAM W;  3RGX A;  3UQ8 A;  4GKJ H;  3J81 W;  4JI5 H;  1FJG H;  2WYO A;  4RZQ A;  1VS0 A;  2VPS A;  1N33 H;  5D1O B;  1TA8 A;  5LMN H;  5LL6 b;  4JI3 H;  1SEI A;  2ZM6 H;  2W57 A;  3N6X A;  3RIZ A;  1X9N A;  4DR3 H;  4DV3 H;  3L2P A;  4X64 H;  2Q2U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...