4IALA

Crystal structure of staphylococcal nuclease variant delta+phs h121e at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTEEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS H121E at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2012-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4ialA00
3D4WA 5CGKA 3OSOA 5C4HA 1ENAA 2EY1A 3HEJA 1EY5A 5C3XA 5JAVA 1EY8A 5KEEA 5KIXA 2F0JA 1F2ZA 2EY5A 2RBMA 4NP5A 1ENCA 2EXZA 3NUCA 5C5LA 1A3TA 1F2MA 2F0UA 4PMBA 4ZQ3A 2QDBA 5NUCA 1EY0A 5IODA 4B9XA 2OEOA 3NK9A 3OMGA 4K5XA 2F0WA 4I65A 4ZUJA 3SK5A 2SNSA 2EYLA 2EYOA 3MHBA 4WORA 4K14A 2F0TA 5J1ZA 4MIUA 3MVVA 2F3WA 2PZWA 4QMGA 1NSNS 3ITPA 3U9OA 3TP8A 1SNPA 2KQ3A 2F0SA 5EGTA 2F0MA 2PZUA 4KY7A 4EVOA 5IIFA 5DAUA 2EY2A 2F0QA 3D8GA 3P1HA 5IGEA 4F7XA 1EY7A 4PMCA 5C4ZA 1EYCA 5CV5A 4J6HA 4K8JA 2F0DA 2PYKA 3OMCA 4LAAA 2F0FA 4J1MA 5C5MA 5CV4A 4DU9A 4TRDA 1EZ8A 3VA5A 3TP7A 3S9WA 4HTHA 5IGFA 1JOOA 3C1EA 1KDAA 1EY6A 2EYPA 3SK4A 5IGDA 2RDFA 2F0EA 4KJOA 4KD3A 3DMUA 2WACA 4NMZA 5HURA 3NHHA 2F0HA 4QB4A 4R8NA 5I9PA 5IGGA 5IGBA 2F0KA 3HZXA 1A3UA 3MZ5A 4K2KA 4K6DA 4ODGA 1EZ6A 5DEHA 5C3WA 5C6AA 4PNYA 1TR5A 3D6CA 1A3VA 3DHQA 4KJNA 3EROA 5M9OA 1JORA 1SNCA 4KHVA 3SK6A 1SYBA 1RKNA 5IOCA 3EJIA 4ME5A 4OL7A 1EY9A 5KRUA 5J39A 2F0LA 2F0PA 4EQPA 1SNDA 3BDCA 1SNMA 2PZTA 2EYJA 1STBA 5KYLA 3SXHA 3E5SA 3LX0A 3QOLA 3T13A 3MXPA 1II3A 4ID6A 1JOKA 4N9TA 1TQOA 2M00A 4DF7A 4K5WA 1STYA 2SOBA 1SYDA 5KYIA 3MEHA 5KGUA 1KABA 4K8IA 2HQEA 4RKBA 2F0OA 3R3OA 3C1FA 3D4DA 3PMFA 4N9PA 1STNA 1A2UA 1SYGA 3V2TA 4IALA 3NP8A 1TT2A 5EKKA 1SNQA 2ENBA 2PW5A 5E3FA 2F0NA 3EVQA 3NXWA 2PQEA 4YIJA 4EQNA 2LKVA 2RKSA 1SYCA 5I6WA 3H6MA 4KY6A 5I9OA 5CV6A 4DGZA 3TMEA 4IZ8A 5CV7A 1SYFA 5EKLA 3SK8A 2F0VA 4HMIA 5I6YA 3SHLA 4NKLA 5E1FA 4K2LA 1SYEA 2O4XA 3RUZA 5CR3A 2EYFA 1F2YA 1EYDA 4F8MA 3ERQA 1EY4A 2OXPA 4G57A 4DFAA 5ISRA 5K5PA 3TP6A 1STHA 3NQTA 4IUNA 4NDXA 5CV9A 1STAA 4QF4A 4WRDA 5JOBA 3SR1A 5IGCA 2F3VA 1IHZA 1AEXA 1U9RA 1EQVA 4HMJA 4KTAA 3QOJA 2PW7A 4KD4A 4B9WA 3T16A 5CV8A 1JOQA 1STGA 4K5VA 1KAAA 1KDCA 3QB3A 4ZUIA 3OWFA 5HGTA 2OF1A 4EQOA 4S3SA 1A2TA 2EY6A 4E6IA 4RKLA 3BDLA 1EYAA 1NUCA 5J22A 2KHSA 2NUCA 2SNMA 5CC4A 3TP5A 4KY5A 4KV6A 4H7BA 2F0GA 5F2DA 1SNOA 2F0IA 2EYMA 3P75A 2EYHA 1KDBA
chains in the Genus database with same CATH superfamily
2EIFA 2B29A 3BYTB 2K32A 4DXFA 2R93G 2L15A 2BH8A 2ALYB 1K8OA 2EY5A 1E1TA 1XXGA 3F2CA 5NUCA 1EY0A 2C9OA 1EIHA 3HOZB 1X3QA 4A3BH 1EQTA 4A3LH 3M9BA 3F8TA 4A3GG 1YEZA 4GOPA 3HKZB 4DR3Q 4X64L 1Q8IA 3NBIA 2UXBQ 3H3VI 1ILPA 5FJ8H 5IGEA 1RD9D 4C3JH 3GTKH 2XWJB 3UE0A 3WOFA 3T56B 3A8JE 1C8CA 1AH9A 3EQLC 2JA5B 4DU9A 4TRDA 4B3TQ 2E2IB 4KHZA 5ELFA 1HHVA 3KDFB 1N32L 2RDFA 5EAYA 4CKEA 5KNBA 3HOYB 2A5HA 3J81E 3CCJA 3VR6A 1K0SA 4PNYA 4FXGC 1SNCA 2B2TA 1UWVA 1KRTA 3K5NA 4ZKCB 3H0GG 2MQHA 2Y0SB 4C2MH 2A6EC 5KRUA 4IPCA 5BN3A 1UE5A 4JBJA 4HIDA 3S17H 5FLXL 1M1KC 3E5SA 1OO9B 5L37A 1LM0A 2IJ0A 2I0QA 1VQ6A 3F2UA 2JYOA 3UDXA 1Y69U 4RKBA 3MFGA 3J7YW 1EU3A 2F0OA 3C1FA 4OIKA 4BA1I 4ULLA 4G7HC 1VQIA 1KQSA 1PA6A 1PTOF 2F0NA 3KYHC 4Z9CB 1QILA 2OTLA 4ZRZA 2PMZE 1D5ZC 3WWVA 4DKAC 1M8AA 5D14A 2QEJC 3K8AA 4WJ4A 3I8ZA 2EYFA 4F8MA 1GO3E 1EY4A 1PMRA 1XX8A 4C3HB 4GN3B 1L0WA 3DM1A 3GTPB 2DUDA 3Q8DA 4DR3L 5EPJA 4OO1I 1SBBB 1TWGB 3OWFA 1C4QA 1WTOA 4OXPA 5IYDG 2CH4A 3HOWG 4R9WA 1C0AA 1PRTC 1AFPA 1UE6A 2Q2UA 1EY8A 4DN4M 5IT9E 2RBMA 2CCZA 3MEFA 3S2HB 3I4LA 4PMBA 2B63B 2A6HD 2VQEQ 1VQ4A 3S1MH 1E0BA 2ZXRA 1HXYD 1QVCA 1YHBA 3HOUH 3BG3A 4GNXB 3AEVA 4O2DA 3J80E 5CBEE 5FLMH 2UUBQ 4G7OC 4IURA 1BCPD 4XQQA 5IWAQ 3DEOA 4Y7NH 3MAQA 5LMNQ 4GLXA 1G2TA 3J80c 1PZID 5EPKA 2B8FA 2RQXA 3OYYA 5M3FH 3VR2A 2H5XA 5COYA 2JA7H 1CTMA 1F77A 3J7A5 2Z8LA 2QW7A 1A3UA 4DUYQ 2JSOA 2KA7A 2F1MA 4FVMA 4RHRA 4HIKA 2E2JH 4ME5A 2A6HC 3CCMA 4UHVA 4EQPA 1I6HH 2JA8H 1Y1VB 2JA6B 2UU9L 3EIVA 3MXPA 4F87A 4BS9A 1ZYRD 2L12A 2NN6H 4R4TA 1Z6HA 4OHJA 1XPOA 1CKNA 3QO2A 3GDEA 1BCPC 2WB1E 2K05A 3PIOA 3OW2A 2EPBA 2ASBA 2IY5B 3BDOA 1GUTA 2ZM6Q 4IALA 3G6EA 1FJGL 3FKIG 4RCOA 2VS1A 4LUOA 3NXWA 1JMCA 4IO9A 1WTQA 4RG1A 1EIYB 4KI0A 1S5CD 2Q8TA 4DAYA 4A3MG 1PYSB 2D0OA 3ER0A 1EYDA 4PQXA 1QJOA 2DNCA 2IL8A 3ERQA 4CDDC 1MBYA 2YTYA 5CV9A 2RSOA 5IGCA 1WCMH 1XNQL 2VQEL 4KTAA 3G71A 3D31A 5JEAG 5DM73 3T4AC 1KHIA 2EOTA 1ZYRC 2K5HA 1LTBD 1FD7D 1W2BA 1CUKA 1X65A 4MN3A 4XYQA 2UUBL 2Z9HA 3J81L 1NUCA 3E3XA 5IWAL 1D5XC 2KJXA 5CC4A 5LMNL 1NE3A 4CHTB 2NVXH 3CC2A 2B2VC 5IP7G 2ZXOA 3HKSA 5CGKA 4B3SQ 1S4ZA 2X69A 4QL5A 4GZYC 3OIPA 1Y1WG 5C44B 1ENCA 4DK6C 4IFDH 1HQRD 4K0KL 3HRZC 3RN5A 5LL6S 3CPWA 2PPBC 3VR5A 2N8NA 2MFIA 1ZEQX 4MZ9A 4QIWB 1LT6D 3RN2A 3E9HA 4BY1G 4DAPA 1PRTF 1HCZA 4KY7A 4LJZC 2YTVA 2EY2A 1HA6A 3CCUA 1PZKD 3NSWA 2Q2TA 3FEWX 4HEDA 2Q8IB 3GTKB 3VA5A 1UE7A 1ESFA 3NE5B 2UUCL 4IUPA 2B3GA 1U4MA 3HOVH 4DAMA 1X9NA 1HTLD 2JN4A 1XPUA 4C56C 3W5OA 3NTKA 4JYAL 2Z6KC 1HZCA 1HNZQ 3F1ZA 4X3TA 5ELDA 5J39A 2CW0D 4P2CB 2PI2E 3AYHB 1SDFA 4C2MB 1QWYA 3SXHA 1HR0Q 1U5KA 1II3A 4BBSH 1HFGA 3S17B 1A8VA 1SYDA 4A3BG 1D1KA 1AZPA 3V2TA 3KK7A 1F9PA 1EQRA 3JAMi 2JJQA 1X55A 5IT9L 1GUGA 1M4VA 2HDLA 4C3JG 4R4QA 3TMEA 2BDOA 3OHXC 5CV7A 3PIPA 5FKAC 2WKDA 1J5EQ 1PH2A 1QOHA 5E1FA 4K2LA 1BCPF 3A74A 3EA6A 4BXXG 5ISRA 2KCNA 1X32A 3J80L 3S1NH 1QNUA 1X3GA 3K7AB 3SR1A 1KD1C 3W3AA 1IHZA 1U9RA 5JPMC 3BJUA 1VQFA 2R3ZA 1QVFA 3Q22A 4A93G 3GTJH 1VQBA 4ZUIA 4QQBX 2NTSA 4IUVA 3FDTA 2YU9B 4J8QA 4KV6A 2K4KA 3RLFA 1VS0A 2NVQB 1KL9A 1ENAA 1DD2A 3W1GA 4NP5A 1LLRD 2P5ZX 3NENA 3GV6A 4QY7A 3NK9A 3NWSA 2EYLA 4MTNA 4YY3L 3PO2G 3PO3B 1E1OA 3S1MB 2PZUA 1ESRA 1HR0L 1JWUD 3T1HQ 4F7XA 5CV5A 4HCSA 4J6HA 3BZCA 2CFMA 4YCWA 4AYBB 3OMCA 1VQ7A 5GROA 4IOAA 3H0GH 1WFQA 1YITA 1UE1A 1VQ8A 1HNXQ 3GTOB 1TWCH 3R93A 1GOZA 4P71A 1GKHA 1J9OA 2F0EA 3NHHA 4R8NA 3TSSA 2NVTB 1AZQA 2JA7B 4TSSA 2DJFC 3D6CA 1HUNA 3BZKA 4HIMA 2JXMB 4CDEC 1VQCA 4Y52H 5CBAE 2C5CA 3RLOA 3JC66 2E2JB 3LX0A 4R4CA 4IUUA 4X3SA 1Q81C 2IX3A 3DWPA 1PTOH 4RHSA 4IPHA 3PUWA 3M3YB 3KF8A 1WI5A 1I4RA 4LF6Q 5LL6X 4DV7L 4R4OA 1WTXA 1KRSA 4ILWA 4X65L 5D3DA 3IRBA 1K0RA 1DOMA 3RUZA 2G9HD 3ND9A 4QUCA 2CWPA 1F2YA 1WTRA 5M3FG 5K5PA 3TP6A 4YHHQ 4G7ZC 3RZOB 1CA6A 2K14A 2MNAA 1DOLA 4DV3Q 2A69C 4LFCQ 4GS3A 1DCZA 4P75A 1YBYA 3SDZA 2LXJA 3T16A 4B9WA 3GTLH 1CT1D 4JI2Q 2DGYA 1KDCA 5C4JH 2KCMA 2WAQG 4M1UB 2JA8G 1E7ZA 1VQJA 2OF1A 3T1HL 3ERSX 1AN8A 3G4SA 2B2WA 1QNKA 1KLUD 3GTGB 3CAMA 3VR4A 2DN8A 3CC4A 3QG1A 5ELCA 4GKJL 2EYHA 1LACA 1HNXL 1TWFH 1DJRD 3HOXG 3PGZA 1O7LA 4ZKBB 1F2ZA 2KBNA 1CKMA 3LNNA 4LUVA 2A68D 2BOSA 5IODA 4UP7A 2KEDA 2JA9A 3L9AX 3VR3A 1OXXK 1YJ9A 4A3DH 4OWWB 4WORA 2I5LX 2R92B 4DUZQ 5FLXE 2HCIA 4U68A 2H4OA 2DJGC 2ZTDA 1Y8NB 3D8GA 3DXJC 1VMPA 3P1HA 5ELNA 1B4OA 1WCMG 3E6ZX 1RJTA 3W2DA 3QR8A 4DK1A 4BBRG 2C35B 1K3BC 2Q8RE 2EYPA 1PH1A 4LF6L 4J15A 1IBLQ 4HSPA 3KF6B 1B50A 1HUMA 5C3WA 4DPGA 1A3VA 2J0TD 4C1NK 4KHVA 2LS01 4AH6A 1YHQA 5M3MH 2A68C 1EY9A 2D0PA 2F0LA 3FKIH 4IPDA 1SNDA 3CQZH 5IYBH 2FXQA 2QCPX 4XXEA 4JBMA 3C2PA 1Q86C 4DV3L 4CJ0B 3HKZE 1CK1A 2EQSA 1JB3A 1N36Q 1TS3A 1L1OB 2ENBA 3T53B 3TDQA 1WJJA 1B53A 2R7ZG 1TWAH 1H9RA 3SVMA 3CU7A 1I6VC 5JEAH 2E2HH 2Z6BA 4HMIA 1IL8A 3PCOB 3O13A 4DR4L 3OWEB 5CR3A 1U4RA 2JEAI 2X6LA 1TVXA 1LTID 4BY7B 4DFAA 3HOVG 1P8LA 4HJ5A 3OOCA 4IUNA 4DNRB 4WRDA 1F9QA 4RWSC 3T1YQ 2RHQB 1QCBD 3BVGA 1AEXA 4DR1Q 2Y0SE 5IP7H 3QOJA 1X54A 4NB3A 4ZK9B 3R8BA 2K01A 1JQYD 1KC8C 5M5WH 2LFNA 1DOKA 1W3SA 2V4DA 4X66Q 4NXNQ 2VUMG 2R93B 1G2SA 2F03A 4BBSG 2NUCA 3VDYA 2A74C 1Q8KA 1K8GA 4EGVA 3TREA 3D6WA 5FOBB 4RGTA 5IY0A 4KN7C 3CF5A 3OSOA 1EUJA 4A3GB 3H3VC 3K58A 2F0JA 5I2YA 4JI8Q 5C4XH 2AQ3B 4K5XA 2I5HA 4X62L 1IBKQ 2EYOA 1SJED 4PZ6A 2F0TA 3M4YA 5EKIA 5J1ZA 3ITPA 3U9OA 3DWAA 1SROA 2F0MA 4K6LA 1PXUA 2KCTA 1Q1EA 2KUMA 5BN4A 3A54A 4FF2A 4LAAA 4KMUC 1Z7TA 3OTOQ 1KIXA 4MNOA 2BE5D 2TSSA 1EZ8A 1N36L 4KHPQ 2K1BA 3H0GB 1V8QA 1N8RC 1I94Q 1BQQT 2A6ED 4KKSA 1M90C 1VCIA 3ONAB 2J4XA 4A3FG 1SRUA 5IOCA 4YCVA 1XNRQ 4OL7A 3H15A 4A3CH 3I4NG 1AP0A 1STYA 3K80C 1SE8A 2NVYH 1SR3A 4BXXH 3S2DB 1I3QB 3GD7A 2HHHQ 1BBXC 4NXNL 2BE5C 4ABNA 1EL0A 4RAUC 2PW5A 1YIJA 1N34Q 1X6OA 2NZOA 2EZVA 1LTLA 3SGIA 1IKLA 1JJ2A 4A93H 1NMFA 2K50A 1QZGA 2EXDA 1I4PA 1AE2A 2OT2A 3Q0AA 3S24A 1TWHH 5E4XA 1YNJC 1VQOA 4GNXC 3K57A 4DV2Q 4WJWA 2O5IC 4JI1L 3A7AB 4HMJA 1IBKL 3HOWB 5LMNW 5CV8A 2CQAA 3CCSA 3CCLA 3LGJA 4LF7Q 4EQOA 1PRTD 5I2XA 1CI3M 5C4JB 1D5MC 1K73C 3S16H 1ZXTA 3TP5A 2LSSA 2SEBD 3OTOL 3URYA 2OEOA 3PO2H 3TBIB 4UP8A 4KK7A 4KHPL 1XMOQ 3FMCA 5JAVA 1I94L 2WKCA 4ZYSA 1TS5A 5KNCA 1F2MA 4ZQ3A 4UY8C 1H9JA 2OQ0A 4X3UA 3HGBA 2UXBL 2K04A 1XNRL 3J81i 4LF4Q 1SNPA 1KTKA 2HUGA 5C4ZA 1EYCA 4GOPB 2PYKA 4J1MA 4B3TL 1V1OA 3E0JA 3LWUA 4NPSA 3HS0C 3A55A 5AFWA 5E4WC 1JJGA 1JOOA 3M7GA 4DK0A 5IGDA 1EY6A 1GHJA 1XMQQ 1G6PA 3K5MA 1YJNA 3DMUA 2WACA 5HURA 1N34L 5IGBA 4A3JH 2CVRA 1JORA 2LXKA 3N52A 3DHQA 4A3IH 3SK6A 1RKNA 3PQIA 3ND8A 5G3LD 4OWXB 3CCVA 1NTGA 2RCNA 1BOSA 4GKKQ 2PZTA 1O80A 3T13A 4DV2L 3VYSA 3KJPA 2E8GA 1Q90A 4QIWE 4NXMQ 1XYIA 4A3DG 1UUPA 2BCOA 1EIFA 4JW0A 2HQEA 3AFPA 2E5LQ 4A3MB 2CWAA 3WOEA 3AB9A 4RGNA 5I9OA 1E3PA 5C0XI 1C7YA 4DV4Q 1RL2A 4DGZA 4MHEA 3M4OH 3ULPA 4JI0Q 4PG3A 5EKLA 4FXKC 3VA7A 3I4OA 2L11A 2MP1A 2EJGC 4OWTB 3U4ZA 2E2HB 1XMOL 2OXPA 4HJ8A 1T5XD 4DK3C 2VL6A 3DEPA 1X3EA 3S1QH 3I2ZA 1PZJD 1R9TB 3GTQH 3I4MG 1ASYA 4GLVB 1EQVA 4PZ8A 5ELEA 2PW7A 1RIPA 3S1RB 1IZ6A 4LF4L 5M3MG 3HOXH 2KENA 1TS2A 4K5VA 2A19A 3QB3A 4DR5Q 4OX9Q 5IYBG 2ES2A 4S3SA 3RZDH 1PYWD 2DNEA 2RVLA 1SXTA 3NPPA 1Y1WB 1EYAA 4H7BA 3J80i 1F9RA 1IYUA 1HH2P 4DV6Q 1B7YB 1XMQL 1GM5A 3A5UA 4BY1B 1A3TA 5ELOA 5M5YH 2R61A 1EU4A 1SEBD 3TQYA 2AWNA 2SNSA 4FF4A 4BBRH 2G5DA 3RLNA 2MGSA 1PH6A 4JI7Q 4JG2A 4QMGA 1NSNS 3HP3A 2GVAA 4GKKL 1HZAA 4RGMA 1IKMA 1Y8OB 4XTCS 5A2QE 1IBMQ 2CHBD 1CQFA 4NXML 1CSPA 4ALPA 4M8AA 2K5VA 2B2VA 2E5LL 2AKWB 3C1EA 5H1SE 2ICIA 1K83H 1SMYD 4IPGA 1C48A 3U9SA 1D2BA 4DV1Q 3TS0A 4DUYL 4DV4L 1E2VA 2K75A 3EJIA 4A3BB 4JBKA 2BH2A 2EDGA 2R7ZH 1R4PB 4G4KA 5CORA 2KEEA 4N9TA 5C4XG 4LFAQ 4C3JB 2ZM6L 1LTGD 4X6AH 5JJKA 4DR2Q 4OX9L 4HSVA 1K28A 5LHY1 1SNQA 3JAMc 1SFOH 4AYBE 1CKNB 3S14H 1BO0A 3H6MA 2Z1CA 2R6GA 1SMYC 4JOIC 1SYFA 2Z6KA 3TZUA 2AHOB 1HPCA 4YWLA 1WTWA 1F2LA 1SYEA 4PMWA 1N9WA 4FP5D 2E75C 2VUMH 2RF4A 1B3AA 4LWCA 4DAYB 4L5SA 1BUVT 4XT3B 4R1JA 4DR6Q 3OIQA 4JV5Q 2KHJA 1NNXA 4JPBW 1I50H 4JI5Q 4JI7L 3PSIA 2CQOA 3S15H 4EQ5A 4A3CG 1VF7A 3HG9A 3D0FA 1CHPD 1IBML 1TIID 3OW7A 5G3LF 1JICA 2PI2A 3Q23A 1SNOA 4B3SL 2F0IA 2EYMA 5K36G 3I7FA 2O2LD 3VYTA 1KDBA 3S16B 2BA0A 1EY5A 5I4DA 1SMXA 4HAEA 3PO2B 1S3OA 3I3CA 1WTPA 3I73A 1S40A 2QDBA 5A35A 1HZ9A 2EJFC 1GXDC 2F4IA 4K14A 1B9MA 1EOVA 2NYZD 2WIIB 1PLFA 5DM63 2F0QA 3DM3A 4PMCA 4KKUA 4LFAL 4A3FH 1MI2A 4A3KH 1NY4A 3IFDA 2WB1G 4DR2L 1IL2A 5DLQE 3BU2A 2PQAA 4LW1A 5IP9H 3A5ZB 3I4NH 4NMZA 4HJ9A 5C6AA 2HIXA 1HNZL 1CQVA 3J81j 2UXDQ 1HZBA 4MTKA 2Q2IA 5FK9C 2GN5A 3CHBD 3HOUB 1WTHA 1JWMD 2I07B 4DR6L 4JV5L 4FNFA 1U4LA 2NZHA 2SOBA 4A3EH 2KECA 3PF5A 4JI5L 4Y7NB 1K9MC 1CZGA 4L5TA 1VQ9A 1IW7D 5JVH3 4R8IA 5M3FB 2NN6I 3EVQA 2D9UA 2NWGA 1J5EL 1VQLA 4LK1C 4IUTA 4A4IA 1EWCA 3E9IA 2DY7A 1JWSD 4NKLA 3SHLA 3GTMH 3RD4A 1VQEA 2A69D 2BA1A 2RSNA 2WAQB 1IYJB 1I6HB 2JA8B 5C0XJ 4A3JG 3HOZH 4XQNA 5A2QL 3UDIA 4A3IG 4DAVA 4B3MQ 4V0BA 1NR4A 2R7FA 2A8VA 3TN2A 1W6KA 1JR0D 1RF2D 2B8GA 2WP8J 2OCEA 2Z0SA 5HGTA 1N33Q 5C3EG 2EY6A 3HOXB 4E6IA 2YTXA 5J22A 3W1BA 4JVZA 1IW7C 1EFWA 1H9SA 2E2IH 1G8ZD 2D5DA 2D62A 3VYUA 3PUZA 1HFNA 1LYLA 1RTNA 3K0YA 5C3XA 3I55A 1W6JA 5KIXA 5C5LA 2M2LA 3A8KE 2F0UA 3H3VH 2B2YC 4B9XA 3CCQA 2L4NA 4EX5A 1YNXA 4ZUJA 1C9OA 1D1IA 1OXTA 1WCMB 2UXDL 3MHBA 3L2PA 5M5YB 2PZWA 4IQZA 4IFDI 3IL8A 4I7AA 4BBRB 3CW2C 1EOTA 1OXVA 1L1OC 2ICEC 1JC7A 2NTTA 2ZXPA 3K5LA 1JJCB 4FDBA 1PVOA 2MO1A 2NVXB 4AQYQ 4JBWA 1T5EA 2NB0A 1YHAA 1JB7A 1VQAA 4KD3A 1J6QA 4O0AA 1MD2D 4JI4Q 5M9OA 1JE5A 2RHSB 2Z4IA 4TQUS 5GAEC 1PFNA 2IHFA 5LMUQ 2OWOA 4ZLTF 4IUQA 4CGYB 4C3HH 5JJIA 1FYCA 3MWYW 4FF1A 4OEMB 3ULLA 4DNTB 1QUQA 1TQOA 3IAYA 5BN5A 4L5RC 3E0EA 2R7ZB 4B3ML 2JK8A 1NAPA 1A63A 1RCVD 3K59A 1SYGA 1U0LA 3I91A 1I4XA 1LT5D 1T9HA 4LF9Q 3M4QA 2KCCA 5CMDA 3HOVB 1XJVA 4UAIA 5T1GA 3I4MH 2LKVA 2N3SA 1ZKOA 5EBCA 5AJ3Q 1XWEA 3KF8B 1LTAD 5FO9B 3R2IA 4POGA 2EVBA 1RDPD 4YHHL 1WVLA 1VDZA 5CYUA 4BWGB 4HJAA 3G6JB 3GO5A 1I4QA 4L5QA 4OO1H 2B63H 2F4VQ 4LFCL 1ASZA 2VUMB 4OIJA 4XIGS 1EIGA 4BBSB 4JI2L 2JE6I 1L0XB 1Q3LA 2IPKD 4QJFA 4B08A 1A0IA 1I5FA 3NTHA 4N8X1 1E24A 2VQFQ 1PH4A 1I50B 4ZAIA 2QILA 1H9KA 3BDLA 4DR7Q 2SNMA 2B39A 2XGTA 4KY5A 3M85A 2B2UC 1LT4D 3MC0B 4AQYL 1A6XA 2F52A 3CP0A 2GVBA 3N6RA 3CMAA 1NR2A 2L55A 3G48A 2K6AA 1XPRA 2SDFA 4JI4L 3T51B 3S1NB 3OMGA 1I4HA 2F0WA 1U4PA 4DUZL 1Q12A 2K7VA 4P74A 2HDMA 1Y1VH 4PZ7A 3GTJB 4LFBQ 3CRLC 3R2TA 1HTPA 4X64Q 1MSHA 3K7UC 1GHKA 3BS1A 2A73B 4H13C 3KDFA 3CXCA 5D3IB 4JI6Q 2RDHA 4HCEA 2RCFA 4A3FB 2K5QA 1IBLL 3EBEA 3QWNA 5M5XH 4RA8A 1PFSA 3AMUA 4POFA 2Z4HA 1N32Q 2PNRC 2XWBB 4YWKA 4L8JA 1KNEA 3I4NB 5EBDA 3I90A 1LV9A 5FO7B 2XN9C 1PYBA 1GUOA 3BDCA 1A15A 1SNMA 2IX0A 3A7LA 2F4VL 1B44D 1NCVA 1PH9A 3KFUA 3FRPB 1JOKA 1YZ6A 3U58A 4XDXA 4K5WA 1LABA 3C3LA 1LTTD 3MEHA 5KGUA 4K8IA 3EN2A 3PMFA 2VQFL 1GD7A 2ID0A 3IFTA 2QEXA 4V190 2HD3A 1DGSA 1TWCB 3CCRA 1YI2A 3U50C 1IYVA 1KLGD 5TSSA 1YNJD 2IT1A 1QVGA 4A3KG 1ET6A 1MHWC 2YYZA 5C44H 5IP9G 2R7DA 3GTMB 3T1YL 1STHA 4DV5Q 4XQJA 4DR1L 1V9PA 1FNUA 5K36H 1EWHA 2N49A 2A1AA 4YWMA 4GOPC 1PTOB 4X66L 1KAAA 1MJCA 4LFBL 1V1QA 1PFBA 4JC0A 1AW7A 3L3OC 5HY6A 2KHSA 3TS2A 4JI6L 1FGUA 1FL0A 3AQQA 4A3EG 2MJ8A 3K5OA 4C3IG 1GJXA 2K28A 2QF7A 3HEJA 5KEEA 1ML0D 4LF5Q 2ZTCA 3BVMA 3L0OA 4JI8L 1PH8A 3NUCA 4RMFA 4GNXA 3PIO3 2NZ1D 4DNIA 2B2TC 1S72A 1D7QA 2WFWA 3Q24A 3TRZA 3GTLB 3J81c 1UEAB 2QA4A 5GAGC 4UPAA 3ZYYX 2RDGA 3HOZG 1EYGA 2D2CC 1PHJA 4LMQD 3HKZG 1J8IA 4TKOB 1F9SA 2Q2HA 2JP1A 3S9WA 2O5JC 1BF4A 4IFDJ 1KDAA 3SK4A 1EFID 1TWFB 1L0YB 3RNUA 3PF4A 4O1NA 1YJWA 4L6TB 1O7ZA 4K2KA 4ODGA 2FHTA 2JA5G 1MKHA 4A3DB 1JT8A 1FVIA 1LTSD 4HR7B 3HOYG 2F0PA 3NTIA 3K7AH 4RFBA 3CCEA 1STBA 4DV5L 3ZJYC 2UU9Q 2Y0SG 1KABA 3DWQA 1UAPA 2HHHL 1Q7YC 3LWEA 1TT2A 2E2DC 1SN8A 2YU9H 2K33A 1ICFB 2PQEA 1FJGQ 1RTOA 2CH4W 5CV6A 2NVQH 3I4MB 3SK8A 4JCVE 1VQDA 3M4PA 3GV3A 3VYRA 4LF5L 5C3EH 4X3KA 5M3MB 2BDNA 2FINB 4I7ZC 3FKIB 4QCLA 2MO0A 1D8LA 3CMEA 3CQZB 5D65A 2ZJQA 3NWTA 1KAWA 2ZJRA 1XNQQ 5JPNC 3PO3H 5IT9c 2K5NA 4LF7L 1SLJA 3QIAA 4C3HG 1TY0A 3F2DA 4RKLA 2F3IA 2K03A 3UDFA 4CJ2C 1TWAB 3GTOH 3D4WA 5C4HA 2EY1A 4IJLA 2AWOA 3BZDB 2XNAC 2NVTH 1CA5A 2L9HA 2XTIA 3G7LA 1HNWQ 3AU7A 2VY3A 4HJ7A 3NQIA 3ULJA 4K0KQ 1EQQA 4A76A 2KVMA 1E2WA 4OGQC 1H9MA 2N88A 4EVOA 1VQMA 4GLAC 1CFMA 5M5WB 4FF3A 1ENFA 4OO1G 1OXSC 3PIP3 2B63G 1HRJA 4K8JA 3RR5A 5GAHC 3NELA 4ZCKA 2PMZB 4WFN3 3M3YH 1FR3A 1GVPA 3B6YA 2L5TA 2H1EA 3UI2A 2K5WA 1WD1A 3MTSA 2LY7A 5IYCH 5GQOA 2KOLA 1SAPA 2UUCQ 3I72A 2K5DA 1B70B 1HJPA 3K0XA 4QB4A 1VQPA 1HR0W 1ET9A 5M5XB 1FNWA 2GA4B 1PRTB 1STEA 4A75A 2KHIA 5C4XB 4JYAQ 1O7IA 1K8AC 1TKWB 1UNSA 3RZOH 5IE8A 1B8AA 3FPPA 3SE0A 1NBWA 2I5MX 1PV4A 3ICEA 3STBD 2J7ZA 3V05A 1VQNA 2OTJA 4LUZA 4P72A 3KBGA 2QDLA 1CSQA 1SE4A 4Q0FA 1MSGA 1Y1VG 1NMGA 1L2FA 1STNA 2JA6G 4RGOS 4KLKA 1KXLA 2VW9A 2I46A 1TU2B 2MUYA 4R4IA 3GTGH 1KNAA 4GN4B 2FMMA 4JI0L 2XIWA 2PCFB 3PUYA 1Y14B 1TY2A 5C0XG 3C46A 1D6EC 3PV0A 5BR8Q 1X3PA 3I56A 2XSCA 3KUPA 3NBHA 3KLSA 1HNWL 1WYDA 3CC7A 2F3VA 3JAME 1VQKA 2R92H 2MPMA 5KNDA 1WD0A 4DR5L 2N55A 3STBC 1QZHA 1ICWA 2NVYB 4DA2A 1B2TA 4NW2A 1Q1BA 1BCPB 4ME3A 4QUFA 2LMCB 5F2DA 2F0GA 4JOIA 1HA5A 1Z47A 4DV6L 1DYQA 3UDGA 3Q6SA 4A93B 3X3MA 2ZTEA 4KN4C 2EXZA 1LTRD 1TWHB 3FP9A 3MFYA 4OONA 1V43A 4I65A 4RCNA 4YCUA 3BVZA 3MVVA 2F3WA 3KJOA 2FFKB 4WJ3M 2WAQE 2WB1B 5C44G 1VQHA 4YY3Q 3U4VA 1EWIA 1EY7A 4JI3Q 2PNHA 4HN7A 2F0DA 4CDFC 3P20A 2AQ2B 1BBWA 3MXNA 4A3LG 2K52A 4HTHA 4H02A 1S5ED 4DV1L 1CKOA 3KLSX 1VQ5A 3HZXA 5FJ8G 5DEHA 1TR5A 5E7NA 1XTDA 4LF8Q 5T1IA 1SYBA 2PO4A 1FGBD 1XTCD 3P7JA 3I70A 1PH3A 1PH7A 2IWHA 4BY7H 5BR8L 1H95A 1CHQD 1EEFD 1LUZA 3TZDA 1IXRA 3QOLA 3GQBA 2VB3X 4F88A 1PFMA 4DF7A 2CW0C 4UP9A 4KKTA 1Q82C 1Q46A 3KLWA 3D4DA 3NBHB 3R3OA 1DM0B 5EKKA 2R93H 1E22A 5E3FA 4YIJA 3KLRA 4C1NI 4EQNA 2FJ2A 4DV7Q 5I6WA 1RODA 3J7ZC 3IKJA 4A3JB 2E74C 4IZ8A 5JJZA 3K6OA 2HIVA 4X65Q 2JQOA 4A3IB 4CDCC 1OTCA 4A3GH 1AE3A 1Z9FA 4G57A 2OQKA 3WDNA 2UUAQ 1VF5C 4UDUC 1CZWA 4QF4A 5JOBA 5C3EB 1BXTA 4C3IH 1G291 2TMPA 1MJEA 1JOQA 1STGA 1SSOA 1GUWA 4QGUA 4IOCA 5JEAJ 1V1PA 2RA4A 1ILQA 4JI3L 1BR9A 1O78A 2AQ1B 2ZT9C 3H94A 2QGQA 3P75A 2HT1A 3M4OB 3H09A 4GKJQ 2ATWA 1QG7A 3MA2B 4O42A 4CKCA 3MXNB 3S1QB 4LF8L 2E76C 3PUXA 3GTQB 4DXGA 2UXCQ 4FXDA 2G9DA 2KQ3A 4XYOA 4APVA 5IIFA 3A8IE 3RZDB 2JA5H 3BYYB 3CPFA 2L1BA 5CV4A 3PO3G 1I3QH 3KF6A 3HOYH 3S2DH 1BVSA 3FHWA 3HOUG 1SE2A 3DUZA 1JE4A 2F0HA 5I9PA 1BDOA 4L63B 1LO5D 1S5DD 4AYBG 2L0CA 5FLMG 2CKZB 1EZ6A 1S5BD 3JAML 2B2YA 2VZAA 4KJNA 1BBUA 3EROA 4B3RQ 2PQAB 4DV0Q 3EFXD 4H0LC 1GUSA 2HCCA 3OPOA 2UUAL 2AMCB 1SE3A 1PH5A 5KYLA 1G51A 1TXYA 1X56A 2JA7G 5HGQA 5EPLA 3CRKC 5IYDH 1L1OA 2M00A 3HOWH 4RH6A 5KYIA 3QJYA 3SEBA 1VMCA 2JEBI 1FNVA 1A2UA 1EEID 2YV5A 3NP8A 2XRQD 3H91A 3CD6A 1K83B 3AFQA 3FVQA 4OELB 4TVAB 2B2WC 3DLLA 2MHVA 2RKSA 1SYCA 4KY6A 1I4GA 4GN5A 4N8FA 1DONA 5I6YA 2NN6G 3K81C 2WV6D 1V1PB 3GP7A 5IYCG 4DR4Q 3GTPH 4CJ1B 3NQTA 3MXUA 4AIMA 2HQLA 4FYDA 1B9NA 2UXCL 4H44C 1TWGH 2IHEA 4PV1C 1N33L 1UEBA 4IJHA 2NBFA 2V1CC 5J3BA 3V96A 1A2TA 4CBVA 4FO2A 2ZJPA 1SFOB 2WINB 3D4RA 2DY8A 3S14B 2X6GA 4Q5VA 5ELBA 4LNQA 5FLXc 1TS4A 3HFZB 2EE1A 3MXGA 1VQGA 3S2HH 4U673 1H9SB 5EQ0A 1OXUA 1MGSA 1A62A 1G6ZA 1DXMA 4B3RL 3SK5A 1PTOD 1PDQA 2VNUD 1JCKB 4DV0L 4MIUA 4X62Q 3KOJA 3TP8A 3M7NA 1O7YA 2F0SA 5EGTA 2IX1A 3S15B 1BKBA 5DAUA 1BNZA 2XRSD 5FO8B 4IFDG 1CM9A 2F0FA 3D3RA 5C5MA 2R92G 1MIUA 1K3RA 2B2UA 3TP7A 4A3MH 5IGFA 1B3QA 3RMHA 4KJOA 3TEHB 3A0JA 1GUNA 1X3FA 2F0KA 3MZ5A 4K6DA 2VXWA 5LMUL 5IGGA 4JK1C 1P16A 1YNND 2FMCA 3NEMA 2JA6H 5JJLA 1LT3D 1SJHD 3KBXA 3F2BA 1PTOC 2EYJA 3J7AF 1R9TH 1WOCA 3UE1A 4P73A 4ID6A 1R4QB 1NJIC 5JVG3 3S1RH 2AUJD 5C0XH 1E2ZA 1S5FD 4BA2I 1QB5D 4A3KB 4N9PA 4LF9L 2QKIC 2N78A 1HQMC 1QUQB 4CKBA 1RHPA 5AJ3L 1Y1WH 4XT1B 3J7AV 1ONLA 3PUVA 1K8MA 3FPUB 4IN3A 1YVCA 2F0VA 1QE6A 2O4XA 4BY1H 1WTVA 1DZ1A 1YNNC 1B1ZA 4NDXA 1STAA 2AUKA 5GADC 3CKIB 2M9VA 4JI1Q 1G91A 4KD4A 4BY7G 4A3EB 3L7ZC 4C3IB 2IW3A 2VB2X 3X3NA 4DR7L 5DNFA 4HIOA 2XVSA 1Y8PB 5EJWA 2EJMA 3A56A
chains in the Genus database with same CATH topology
3BYTB 2K32A 4DXFA 1K8OA 2EY5A 1XXGA 5NUCA 1EY0A 2C9OA 1EIHA 3HOZB 1X3QA 1EQTA 3HKZB 1Q8IA 3NBIA 1ILPA 5IGEA 1RD9D 2XWJB 3WOFA 3T56B 3A8JE 1C8CA 3EQLC 2JA5B 4DU9A 4TRDA 2E2IB 4KHZA 5ELFA 1HHVA 2RDFA 4CKEA 5KNBA 3HOYB 2A5HA 3J81E 3VR6A 4PNYA 4FXGC 1SNCA 2B2TA 3K5NA 4ZKCB 2Y0SB 2A6EC 5KRUA 5BN3A 5FLXL 3E5SA 1OO9B 2IJ0A 3F2UA 2JYOA 1Y69U 4RKBA 3MFGA 3J7YW 1EU3A 2F0OA 3C1FA 4OIKA 4BA1I 4ULLA 4G7HC 1PTOF 2F0NA 4Z9CB 1QILA 4ZRZA 1D5ZC 1M8AA 5D14A 2QEJC 3I8ZA 2EYFA 4F8MA 1EY4A 1PMRA 1XX8A 4C3HB 3DM1A 3GTPB 5EPJA 4OO1I 1SBBB 1TWGB 3OWFA 1C4QA 1WTOA 4R9WA 1PRTC 1AFPA 1EY8A 4DN4M 5IT9E 2RBMA 3S2HB 3I4LA 4PMBA 2B63B 2A6HD 1E0BA 2ZXRA 1HXYD 3BG3A 3J80E 5CBEE 4G7OC 4IURA 1BCPD 4XQQA 3DEOA 3MAQA 1G2TA 1PZID 5EPKA 2B8FA 2RQXA 3VR2A 5COYA 1CTMA 1F77A 2Z8LA 1A3UA 2JSOA 2KA7A 2F1MA 4FVMA 4RHRA 4ME5A 2A6HC 4EQPA 1Y1VB 2JA6B 3MXPA 4F87A 4BS9A 1ZYRD 2L12A 2NN6H 1Z6HA 4OHJA 3QO2A 1BCPC 2K05A 2EPBA 3BDOA 1GUTA 4IALA 4RCOA 3NXWA 1WTQA 4KI0A 1S5CD 2Q8TA 4DAYA 1EYDA 4PQXA 1QJOA 2DNCA 2IL8A 3ERQA 1MBYA 5CV9A 2RSOA 5IGCA 4KTAA 3D31A 5JEAG 5DM73 3T4AC 2EOTA 1ZYRC 1LTBD 1FD7D 4XYQA 4MN3A 3J81L 1NUCA 1D5XC 2KJXA 5CC4A 4CHTB 2B2VC 2ZXOA 5CGKA 1S4ZA 2X69A 4GZYC 3OIPA 5C44B 1ENCA 4IFDH 1HQRD 3HRZC 5LL6S 2PPBC 3VR5A 1ZEQX 4QIWB 1LT6D 4DAPA 1PRTF 1HCZA 4KY7A 4LJZC 2EY2A 1HA6A 1PZKD 3NSWA 3FEWX 4HEDA 2Q8IB 3GTKB 3VA5A 1ESFA 3NE5B 4IUPA 1U4MA 1HTLD 4C56C 3NTKA 4X3TA 5ELDA 5J39A 2CW0D 4P2CB 1SDFA 4C2MB 1QWYA 3SXHA 1II3A 1HFGA 3S17B 1SYDA 1D1KA 1AZPA 3V2TA 3KK7A 1F9PA 5IT9L 1GUGA 1M4VA 2HDLA 4C3JG 3TMEA 2BDOA 3OHXC 5CV7A 5FKAC 2WKDA 1QOHA 5E1FA 4K2LA 1BCPF 3EA6A 5ISRA 2KCNA 1X32A 3J80L 1QNUA 3K7AB 3SR1A 3W3AA 1IHZA 1U9RA 5JPMC 2R3ZA 3Q22A 4ZUIA 2NTSA 4IUVA 3FDTA 2YU9B 4J8QA 4KV6A 3RLFA 2NVQB 1ENAA 1DD2A 4NP5A 1LLRD 3GV6A 3NK9A 3NWSA 2EYLA 3PO3B 3S1MB 2PZUA 1ESRA 1JWUD 4F7XA 5CV5A 4HCSA 4J6HA 4AYBB 3OMCA 3GTOB 3R93A 1GOZA 1J9OA 2F0EA 3NHHA 4R8NA 3TSSA 2NVTB 1AZQA 2JA7B 4TSSA 3D6CA 1HUNA 2JXMB 5CBAE 2C5CA 2E2JB 3LX0A 4IUUA 4X3SA 2IX3A 3DWPA 1PTOH 4RHSA 3PUWA 3M3YB 3KF8A 1I4RA 5LL6X 1WTXA 4ILWA 5D3DA 1DOMA 3RUZA 2G9HD 3ND9A 4QUCA 1F2YA 1WTRA 5K5PA 3TP6A 4G7ZC 3RZOB 1CA6A 1DOLA 2A69C 1DCZA 3SDZA 4B9WA 3T16A 1CT1D 1KDCA 4M1UB 2OF1A 1AN8A 2B2WA 1QNKA 1KLUD 3GTGB 3VR4A 2DN8A 3QG1A 5ELCA 2EYHA 1LACA 1DJRD 1O7LA 4ZKBB 1F2ZA 3LNNA 2A68D 2BOSA 5IODA 2KEDA 3L9AX 3VR3A 1OXXK 4WORA 2R92B 5FLXE 2HCIA 4U68A 2H4OA 1Y8NB 3D8GA 3DXJC 1VMPA 3P1HA 1B4OA 3E6ZX 1RJTA 3W2DA 4DK1A 2Q8RE 2EYPA 4HSPA 1B50A 1HUMA 5C3WA 1A3VA 2J0TD 4C1NK 4KHVA 2LS01 2A68C 1EY9A 2F0LA 1SNDA 2QCPX 4XXEA 3C2PA 4CJ0B 1CK1A 1JB3A 1TS3A 2ENBA 3T53B 3TDQA 1B53A 1H9RA 3SVMA 3CU7A 1I6VC 5JEAH 4HMIA 1IL8A 3O13A 3OWEB 5CR3A 1U4RA 2JEAI 2X6LA 1TVXA 1LTID 4BY7B 4DFAA 3OOCA 4IUNA 4DNRB 4WRDA 1F9QA 4RWSC 1QCBD 3BVGA 1AEXA 3QOJA 4ZK9B 3R8BA 2K01A 1JQYD 2LFNA 1DOKA 2V4DA 2R93B 1G2SA 2F03A 2NUCA 2A74C 4EGVA 3D6WA 5FOBB 4RGTA 4KN7C 3OSOA 4A3GB 3H3VC 3K58A 2F0JA 5I2YA 2AQ3B 4K5XA 2EYOA 1SJED 2F0TA 3M4YA 5EKIA 5J1ZA 3ITPA 3U9OA 3DWAA 2F0MA 4K6LA 1PXUA 1Q1EA 2KUMA 5BN4A 3A54A 4FF2A 4LAAA 4KMUC 1Z7TA 2BE5D 2TSSA 1EZ8A 2K1BA 3H0GB 1V8QA 1BQQT 2A6ED 4KKSA 1VCIA 3ONAB 2J4XA 5IOCA 4OL7A 1AP0A 1STYA 3S2DB 1I3QB 3GD7A 1BBXC 1EL0A 2BE5C 4ABNA 4RAUC 2PW5A 2EZVA 1IKLA 1I4PA 2OT2A 3Q0AA 5E4XA 1YNJC 3K57A 4WJWA 2O5IC 3A7AB 4HMJA 3HOWB 5CV8A 2CQAA 4EQOA 1PRTD 5I2XA 1CI3M 5C4JB 1D5MC 1ZXTA 3TP5A 2SEBD 3URYA 2OEOA 3TBIB 4KK7A 3FMCA 5JAVA 2WKCA 4ZYSA 1TS5A 5KNCA 1F2MA 4ZQ3A 1H9JA 4X3UA 3HGBA 2K04A 1SNPA 1KTKA 2HUGA 5C4ZA 1EYCA 2PYKA 4J1MA 1V1OA 3E0JA 3LWUA 3HS0C 3A55A 5AFWA 5E4WC 1JOOA 3M7GA 4DK0A 5IGDA 1EY6A 1GHJA 3K5MA 3DMUA 2WACA 5HURA 5IGBA 2CVRA 1JORA 3N52A 3DHQA 3SK6A 1RKNA 3ND8A 5G3LD 1BOSA 2PZTA 1O80A 3T13A 3VYSA 1Q90A 1XYIA 1UUPA 2BCOA 2HQEA 4A3MB 3WOEA 3AB9A 4RGNA 5I9OA 5C0XI 4DGZA 4MHEA 5EKLA 3VA7A 4FXKC 2L11A 2MP1A 2EJGC 2E2HB 2OXPA 1T5XD 3DEPA 1PZJD 1R9TB 1EQVA 5ELEA 2PW7A 3S1RB 4K5VA 1TS2A 3QB3A 4S3SA 1PYWD 2DNEA 2RVLA 1SXTA 3NPPA 1Y1WB 1EYAA 4H7BA 1F9RA 1IYUA 4BY1B 1A3TA 2R61A 1EU4A 1SEBD 2AWNA 2SNSA 4FF4A 2MGSA 4QMGA 1NSNS 3HP3A 4RGMA 1IKMA 1Y8OB 4XTCS 5A2QE 2CHBD 1CQFA 4M8AA 2B2VA 3C1EA 2ICIA 1SMYD 1C48A 3U9SA 1D2BA 1E2VA 3EJIA 4A3BB 2EDGA 1R4PB 4G4KA 5CORA 2KEEA 4N9TA 4C3JB 1LTGD 4HSVA 5LHY1 1SNQA 1BO0A 3H6MA 2Z1CA 2R6GA 1SMYC 1SYFA 3TZUA 1HPCA 1WTWA 1F2LA 1SYEA 4PMWA 4FP5D 2E75C 1B3AA 1BUVT 4XT3B 3OIQA 1VF7A 3HG9A 1CHPD 1TIID 3OW7A 5G3LF 1JICA 3Q23A 1SNOA 5K36G 2F0IA 2EYMA 3VYTA 2O2LD 3S16B 1KDBA 2BA0A 1EY5A 5I4DA 4HAEA 3PO2B 3I3CA 1WTPA 3I73A 2QDBA 5A35A 2EJFC 1GXDC 2F4IA 4K14A 1B9MA 2NYZD 2WIIB 1PLFA 5DM63 2F0QA 4PMCA 4KKUA 1MI2A 3IFDA 4NMZA 5C6AA 1CQVA 5FK9C 3CHBD 3HOUB 1JWMD 2I07B 4FNFA 1U4LA 2SOBA 2KECA 4Y7NB 1CZGA 1IW7D 5JVH3 4R8IA 5M3FB 2NN6I 3EVQA 2D9UA 2NWGA 4LK1C 4IUTA 1EWCA 2DY7A 1JWSD 4NKLA 3SHLA 3RD4A 2A69D 2BA1A 2RSNA 2WAQB 1I6HB 2JA8B 5C0XJ 4XQNA 5A2QL 4DAVA 4V0BA 1NR4A 3TN2A 1W6KA 1JR0D 1RF2D 2B8GA 2WP8J 5HGTA 2EY6A 3HOXB 4E6IA 5J22A 1IW7C 1H9SA 1G8ZD 2D5DA 2D62A 3VYUA 3PUZA 1HFNA 1RTNA 3K0YA 5C3XA 1W6JA 5KIXA 5C5LA 2M2LA 3A8KE 2F0UA 2B2YC 4B9XA 2L4NA 4ZUJA 1D1IA 1OXTA 1WCMB 3MHBA 5M5YB 2PZWA 4IQZA 4IFDI 3IL8A 4BBRB 1EOTA 1OXVA 2ICEC 1JC7A 2NTTA 2ZXPA 3K5LA 2NVXB 4JBWA 1T5EA 2NB0A 4KD3A 1MD2D 5M9OA 2Z4IA 4TQUS 1PFNA 4ZLTF 4IUQA 4CGYB 1FYCA 3MWYW 4FF1A 4DNTB 1TQOA 3IAYA 2R7ZB 5BN5A 1NAPA 1RCVD 3K59A 1SYGA 3I91A 1I4XA 1LT5D 2KCCA 5CMDA 3HOVB 4UAIA 5T1GA 2LKVA 1ZKOA 5EBCA 1XWEA 1LTAD 5FO9B 3R2IA 2EVBA 1RDPD 1WVLA 1VDZA 5CYUA 4BWGB 3G6JB 3GO5A 1I4QA 4OO1H 2VUMB 4OIJA 4XIGS 1EIGA 4BBSB 2JE6I 1L0XB 1Q3LA 2IPKD 4B08A 3NTHA 1I50B 4ZAIA 2QILA 1H9KA 3BDLA 2SNMA 2B39A 4KY5A 3M85A 2B2UC 1LT4D 3MC0B 1A6XA 3N6RA 1NR2A 2L55A 2K6AA 2SDFA 3T51B 3S1NB 3OMGA 1I4HA 2F0WA 1U4PA 1Q12A 2K7VA 2HDMA 3GTJB 3CRLC 3R2TA 1HTPA 1MSHA 1GHKA 3BS1A 2A73B 4H13C 5D3IB 2RDHA 4HCEA 4A3FB 2K5QA 3QWNA 4RA8A 3AMUA 2Z4HA 2PNRC 2XWBB 4L8JA 1KNEA 3I4NB 5EBDA 3I90A 1LV9A 5FO7B 2XN9C 1GUOA 3BDCA 1A15A 1SNMA 2IX0A 3A7LA 1B44D 1NCVA 3FRPB 1JOKA 4XDXA 4K5WA 1LABA 3C3LA 1LTTD 3MEHA 5KGUA 4K8IA 3PMFA 2ID0A 3IFTA 4V190 1TWCB 1IYVA 1KLGD 5TSSA 1YNJD 2IT1A 1ET6A 2YYZA 3GTMB 1STHA 4XQJA 1FNUA 5K36H 1EWHA 1PTOB 1KAAA 1PFBA 1AW7A 3L3OC 2KHSA 2MJ8A 3K5OA 4C3IG 1GJXA 2K28A 2QF7A 3HEJA 5KEEA 1ML0D 3BVMA 3NUCA 3PIO3 2NZ1D 2B2TC 3Q24A 3GTLB 1UEAB 3ZYYX 2RDGA 2D2CC 4LMQD 1J8IA 4TKOB 1F9SA 2JP1A 3S9WA 2O5JC 1BF4A 4IFDJ 1KDAA 3SK4A 1EFID 1TWFB 1L0YB 4O1NA 4L6TB 1O7ZA 4K2KA 4ODGA 2FHTA 4A3DB 1LTSD 4HR7B 2F0PA 3NTIA 4RFBA 1STBA 1KABA 3DWQA 1UAPA 3LWEA 1TT2A 2E2DC 2K33A 2PQEA 1RTOA 5CV6A 3I4MB 3SK8A 3GV3A 3VYRA 4X3KA 5M3MB 2BDNA 2FINB 4I7ZC 3FKIB 4QCLA 3CQZB 5D65A 3NWTA 5JPNC 3QIAA 4C3HG 1TY0A 4RKLA 2K03A 4CJ2C 1TWAB 3D4WA 5C4HA 2EY1A 2AWOA 3BZDB 2XNAC 1CA5A 2L9HA 3G7LA 3AU7A 3NQIA 2KVMA 1E2WA 4OGQC 1H9MA 2N88A 4EVOA 1CFMA 5M5WB 4FF3A 1ENFA 4OO1G 1OXSC 3PIP3 1HRJA 4K8JA 2PMZB 4WFN3 1FR3A 2L5TA 2H1EA 3UI2A 2K5WA 1WD1A 3MTSA 2LY7A 2KOLA 1SAPA 3I72A 2K5DA 4QB4A 1ET9A 5M5XB 1FNWA 2GA4B 1PRTB 1STEA 5C4XB 1TKWB 1UNSA 3FPPA 3SE0A 2J7ZA 3V05A 3KBGA 1SE4A 4Q0FA 1MSGA 1STNA 4RGOS 2I46A 1TU2B 2MUYA 1KNAA 2FMMA 2XIWA 2PCFB 3PUYA 1TY2A 5C0XG 3C46A 1D6EC 3PV0A 1X3PA 2XSCA 3KUPA 3NBHA 3KLSA 2F3VA 3JAME 2MPMA 5KNDA 1WD0A 2N55A 1ICWA 2NVYB 4DA2A 1B2TA 4NW2A 1Q1BA 1BCPB 4QUFA 2LMCB 5F2DA 2F0GA 1HA5A 1Z47A 1DYQA 3Q6SA 4A93B 3X3MA 4KN4C 2EXZA 1LTRD 1TWHB 3MFYA 1V43A 4I65A 4RCNA 3BVZA 3MVVA 2F3WA 2FFKB 2WB1B 1EY7A 4HN7A 2F0DA 3P20A 2AQ2B 3MXNA 4HTHA 1S5ED 3KLSX 3HZXA 5DEHA 1TR5A 5T1IA 1SYBA 2PO4A 1FGBD 1XTCD 3P7JA 3I70A 2IWHA 1CHQD 1EEFD 3TZDA 3QOLA 3GQBA 2VB3X 4F88A 1PFMA 4DF7A 2CW0C 4KKTA 3R3OA 3D4DA 1DM0B 5EKKA 5E3FA 4YIJA 3KLRA 4C1NI 4EQNA 2FJ2A 5I6WA 1RODA 3IKJA 4A3JB 2E74C 4IZ8A 5JJZA 3K6OA 4A3IB 4G57A 3WDNA 1VF5C 4UDUC 1CZWA 4QF4A 5JOBA 5C3EB 1BXTA 1G291 2TMPA 1JOQA 1STGA 1SSOA 1GUWA 5JEAJ 1V1PA 2RA4A 1ILQA 1BR9A 1O78A 2AQ1B 2ZT9C 3H94A 3P75A 3M4OB 3H09A 1QG7A 3MA2B 4O42A 4CKCA 3S1QB 2E76C 3PUXA 3GTQB 4DXGA 4FXDA 2G9DA 2KQ3A 4XYOA 5IIFA 3A8IE 3RZDB 3BYYB 2L1BA 5CV4A 1SE2A 3DUZA 1JE4A 2F0HA 5I9PA 1BDOA 4L63B 1LO5D 1S5DD 2L0CA 1EZ6A 1S5BD 3JAML 2B2YA 4KJNA 3EROA 3EFXD 4H0LC 1GUSA 2HCCA 3OPOA 1SE3A 5KYLA 5EPLA 3CRKC 2M00A 4RH6A 5KYIA 3QJYA 3SEBA 1VMCA 2JEBI 1FNVA 1A2UA 1EEID 3NP8A 2XRQD 3H91A 1K83B 3FVQA 2B2WC 2MHVA 2RKSA 1SYCA 4KY6A 1I4GA 1DONA 5I6YA 2NN6G 2WV6D 1V1PB 3GP7A 4CJ1B 3NQTA 3MXUA 4FYDA 1B9NA 4H44C 4PV1C 2NBFA 3V96A 1A2TA 4CBVA 4FO2A 1SFOB 2WINB 3D4RA 2DY8A 3S14B 2X6GA 4Q5VA 5ELBA 1TS4A 2EE1A 3MXGA 4U673 1H9SB 5EQ0A 1OXUA 1MGSA 1G6ZA 1DXMA 3SK5A 1PTOD 1PDQA 2VNUD 1JCKB 4MIUA 3TP8A 3M7NA 1O7YA 2F0SA 5EGTA 2IX1A 3S15B 5DAUA 1BNZA 2XRSD 5FO8B 4IFDG 1CM9A 2F0FA 3D3RA 5C5MA 2B2UA 3TP7A 5IGFA 3RMHA 4KJOA 1GUNA 2F0KA 3MZ5A 4K6DA 2VXWA 5IGGA 4JK1C 1YNND 2FMCA 1LT3D 1SJHD 3KBXA 1PTOC 2EYJA 3J7AF 4ID6A 1R4QB 5JVG3 2AUJD 5C0XH 1E2ZA 1S5FD 4BA2I 1QB5D 4A3KB 4N9PA 2QKIC 1HQMC 4CKBA 1RHPA 4XT1B 3J7AV 1ONLA 3PUVA 1K8MA 3FPUB 4IN3A 2F0VA 1QE6A 2O4XA 1WTVA 1DZ1A 1YNNC 1B1ZA 4NDXA 1STAA 2AUKA 3CKIB 2M9VA 1G91A 4KD4A 4A3EB 3L7ZC 4C3IB 2IW3A 2VB2X 3X3NA 5DNFA 2XVSA 1Y8PB 5EJWA 2EJMA 3A56A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D4W A;  5CGK A;  3OSO A;  5C4H A;  1ENA A;  2EY1 A;  3HEJ A;  1EY5 A;  5C3X A;  5JAV A;  1EY8 A;  5KEE A;  5KIX A;  2F0J A;  1F2Z A;  2EY5 A;  2RBM A;  4NP5 A;  1ENC A;  2EXZ A;  3NUC A;  5C5L A;  1A3T A;  1F2M A;  2F0U A;  4PMB A;  4ZQ3 A;  2QDB A;  5NUC A;  1EY0 A;  5IOD A;  4B9X A;  2OEO A;  3NK9 A;  3OMG A;  4K5X A;  2F0W A;  4I65 A;  4ZUJ A;  3SK5 A;  2SNS A;  2EYL A;  2EYO A;  3MHB A;  4WOR A;  4K14 A;  2F0T A;  5J1Z A;  4MIU A;  3MVV A;  2F3W A;  2PZW A;  4QMG A;  1NSN S;  3ITP A;  3U9O A;  3TP8 A;  1SNP A;  2KQ3 A;  2F0S A;  5EGT A;  2F0M A;  2PZU A;  4KY7 A;  4EVO A;  5IIF A;  5DAU A;  2EY2 A;  2F0Q A;  3D8G A;  3P1H A;  5IGE A;  4F7X A;  1EY7 A;  4PMC A;  5C4Z A;  1EYC A;  5CV5 A;  4J6H A;  4K8J A;  2F0D A;  2PYK A;  3OMC A;  4LAA A;  2F0F A;  4J1M A;  5C5M A;  5CV4 A;  4DU9 A;  4TRD A;  1EZ8 A;  3VA5 A;  3TP7 A;  3S9W A;  4HTH A;  5IGF A;  1JOO A;  3C1E A;  1KDA A;  1EY6 A;  2EYP A;  3SK4 A;  5IGD A;  2RDF A;  2F0E A;  4KJO A;  4KD3 A;  3DMU A;  2WAC A;  4NMZ A;  5HUR A;  3NHH A;  2F0H A;  4QB4 A;  4R8N A;  5I9P A;  5IGG A;  5IGB A;  2F0K A;  3HZX A;  1A3U A;  3MZ5 A;  4K2K A;  4K6D A;  4ODG A;  1EZ6 A;  5DEH A;  5C3W A;  5C6A A;  4PNY A;  1TR5 A;  3D6C A;  1A3V A;  3DHQ A;  4KJN A;  3ERO A;  5M9O A;  1JOR A;  1SNC A;  4KHV A;  3SK6 A;  1SYB A;  1RKN A;  5IOC A;  3EJI A;  4ME5 A;  4OL7 A;  1EY9 A;  5KRU A;  5J39 A;  2F0L A;  2F0P A;  4EQP A;  1SND A;  3BDC A;  1SNM A;  2PZT A;  2EYJ A;  1STB A;  5KYL A;  3SXH A;  3E5S A;  3LX0 A;  3QOL A;  3T13 A;  3MXP A;  1II3 A;  4ID6 A;  1JOK A;  4N9T A;  1TQO A;  2M00 A;  4DF7 A;  4K5W A;  1STY A;  2SOB A;  1SYD A;  5KYI A;  3MEH A;  5KGU A;  1KAB A;  4K8I A;  2HQE A;  4RKB A;  2F0O A;  3R3O A;  3C1F A;  3D4D A;  3PMF A;  4N9P A;  1STN A;  1A2U A;  1SYG A;  3V2T A;  4IAL A;  3NP8 A;  1TT2 A;  5EKK A;  1SNQ A;  2ENB A;  2PW5 A;  5E3F A;  2F0N A;  3EVQ A;  3NXW A;  2PQE A;  4YIJ A;  4EQN A;  2LKV A;  2RKS A;  1SYC A;  5I6W A;  3H6M A;  4KY6 A;  5I9O A;  5CV6 A;  4DGZ A;  3TME A;  4IZ8 A;  5CV7 A;  1SYF A;  5EKL A;  3SK8 A;  2F0V A;  4HMI A;  5I6Y A;  3SHL A;  4NKL A;  5E1F A;  4K2L A;  1SYE A;  2O4X A;  3RUZ A;  5CR3 A;  2EYF A;  1F2Y A;  1EYD A;  4F8M A;  3ERQ A;  1EY4 A;  2OXP A;  4G57 A;  4DFA A;  5ISR A;  5K5P A;  3TP6 A;  1STH A;  3NQT A;  4IUN A;  4NDX A;  5CV9 A;  1STA A;  4QF4 A;  4WRD A;  5JOB A;  3SR1 A;  5IGC A;  2F3V A;  1IHZ A;  1AEX A;  1U9R A;  1EQV A;  4HMJ A;  4KTA A;  3QOJ A;  2PW7 A;  4KD4 A;  4B9W A;  3T16 A;  5CV8 A;  1JOQ A;  1STG A;  4K5V A;  1KAA A;  1KDC A;  3QB3 A;  4ZUI A;  3OWF A;  5HGT A;  2OF1 A;  4EQO A;  4S3S A;  1A2T A;  2EY6 A;  4E6I A;  4RKL A;  3BDL A;  1EYA A;  1NUC A;  5J22 A;  2KHS A;  2NUC A;  2SNM A;  5CC4 A;  3TP5 A;  4KY5 A;  4KV6 A;  4H7B A;  2F0G A;  5F2D A;  1SNO A;  2F0I A;  2EYM A;  3P75 A;  2EYH A;  1KDB A; 
#chains in the Genus database with same CATH topology
 2EIF A;  2B29 A;  3BYT B;  2K32 A;  4DXF A;  2R93 G;  2L15 A;  2BH8 A;  2ALY B;  1K8O A;  2EY5 A;  1E1T A;  1XXG A;  3F2C A;  5NUC A;  1EY0 A;  2C9O A;  1EIH A;  3HOZ B;  1X3Q A;  4A3B H;  1EQT A;  4A3L H;  3M9B A;  3F8T A;  4A3G G;  1YEZ A;  4GOP A;  3HKZ B;  4DR3 Q;  4X64 L;  1Q8I A;  3NBI A;  2UXB Q;  3H3V I;  1ILP A;  5FJ8 H;  5IGE A;  1RD9 D;  4C3J H;  3GTK H;  2XWJ B;  3UE0 A;  3WOF A;  3T56 B;  3A8J E;  1C8C A;  1AH9 A;  3EQL C;  2JA5 B;  4DU9 A;  4TRD A;  4B3T Q;  2E2I B;  4KHZ A;  5ELF A;  1HHV A;  3KDF B;  1N32 L;  2RDF A;  5EAY A;  4CKE A;  5KNB A;  3HOY B;  2A5H A;  3J81 E;  3CCJ A;  3VR6 A;  1K0S A;  4PNY A;  4FXG C;  1SNC A;  2B2T A;  1UWV A;  1KRT A;  3K5N A;  4ZKC B;  3H0G G;  2MQH A;  2Y0S B;  4C2M H;  2A6E C;  5KRU A;  4IPC A;  5BN3 A;  1UE5 A;  4JBJ A;  4HID A;  3S17 H;  5FLX L;  1M1K C;  3E5S A;  1OO9 B;  5L37 A;  1LM0 A;  2IJ0 A;  2I0Q A;  1VQ6 A;  3F2U A;  2JYO A;  3UDX A;  1Y69 U;  4RKB A;  3MFG A;  3J7Y W;  1EU3 A;  2F0O A;  3C1F A;  4OIK A;  4BA1 I;  4ULL A;  4G7H C;  1VQI A;  1KQS A;  1PA6 A;  1PTO F;  2F0N A;  3KYH C;  4Z9C B;  1QIL A;  2OTL A;  4ZRZ A;  2PMZ E;  1D5Z C;  3WWV A;  4DKA C;  1M8A A;  5D14 A;  2QEJ C;  3K8A A;  4WJ4 A;  3I8Z A;  2EYF A;  4F8M A;  1GO3 E;  1EY4 A;  1PMR A;  1XX8 A;  4C3H B;  4GN3 B;  1L0W A;  3DM1 A;  3GTP B;  2DUD A;  3Q8D A;  4DR3 L;  5EPJ A;  4OO1 I;  1SBB B;  1TWG B;  3OWF A;  1C4Q A;  1WTO A;  4OXP A;  5IYD G;  2CH4 A;  3HOW G;  4R9W A;  1C0A A;  1PRT C;  1AFP A;  1UE6 A;  2Q2U A;  1EY8 A;  4DN4 M;  5IT9 E;  2RBM A;  2CCZ A;  3MEF A;  3S2H B;  3I4L A;  4PMB A;  2B63 B;  2A6H D;  2VQE Q;  1VQ4 A;  3S1M H;  1E0B A;  2ZXR A;  1HXY D;  1QVC A;  1YHB A;  3HOU H;  3BG3 A;  4GNX B;  3AEV A;  4O2D A;  3J80 E;  5CBE E;  5FLM H;  2UUB Q;  4G7O C;  4IUR A;  1BCP D;  4XQQ A;  5IWA Q;  3DEO A;  4Y7N H;  3MAQ A;  5LMN Q;  4GLX A;  1G2T A;  3J80 c;  1PZI D;  5EPK A;  2B8F A;  2RQX A;  3OYY A;  5M3F H;  3VR2 A;  2H5X A;  5COY A;  2JA7 H;  1CTM A;  1F77 A;  3J7A 5;  2Z8L A;  2QW7 A;  1A3U A;  4DUY Q;  2JSO A;  2KA7 A;  2F1M A;  4FVM A;  4RHR A;  4HIK A;  2E2J H;  4ME5 A;  2A6H C;  3CCM A;  4UHV A;  4EQP A;  1I6H H;  2JA8 H;  1Y1V B;  2JA6 B;  2UU9 L;  3EIV A;  3MXP A;  4F87 A;  4BS9 A;  1ZYR D;  2L12 A;  2NN6 H;  4R4T A;  1Z6H A;  4OHJ A;  1XPO A;  1CKN A;  3QO2 A;  3GDE A;  1BCP C;  2WB1 E;  2K05 A;  3PIO A;  3OW2 A;  2EPB A;  2ASB A;  2IY5 B;  3BDO A;  1GUT A;  2ZM6 Q;  4IAL A;  3G6E A;  1FJG L;  3FKI G;  4RCO A;  2VS1 A;  4LUO A;  3NXW A;  1JMC A;  4IO9 A;  1WTQ A;  4RG1 A;  1EIY B;  4KI0 A;  1S5C D;  2Q8T A;  4DAY A;  4A3M G;  1PYS B;  2D0O A;  3ER0 A;  1EYD A;  4PQX A;  1QJO A;  2DNC A;  2IL8 A;  3ERQ A;  4CDD C;  1MBY A;  2YTY A;  5CV9 A;  2RSO A;  5IGC A;  1WCM H;  1XNQ L;  2VQE L;  4KTA A;  3G71 A;  3D31 A;  5JEA G;  5DM7 3;  3T4A C;  1KHI A;  2EOT A;  1ZYR C;  2K5H A;  1LTB D;  1FD7 D;  1W2B A;  1CUK A;  1X65 A;  4MN3 A;  4XYQ A;  2UUB L;  2Z9H A;  3J81 L;  1NUC A;  3E3X A;  5IWA L;  1D5X C;  2KJX A;  5CC4 A;  5LMN L;  1NE3 A;  4CHT B;  2NVX H;  3CC2 A;  2B2V C;  5IP7 G;  2ZXO A;  3HKS A;  5CGK A;  4B3S Q;  1S4Z A;  2X69 A;  4QL5 A;  4GZY C;  3OIP A;  1Y1W G;  5C44 B;  1ENC A;  4DK6 C;  4IFD H;  1HQR D;  4K0K L;  3HRZ C;  3RN5 A;  5LL6 S;  3CPW A;  2PPB C;  3VR5 A;  2N8N A;  2MFI A;  1ZEQ X;  4MZ9 A;  4QIW B;  1LT6 D;  3RN2 A;  3E9H A;  4BY1 G;  4DAP A;  1PRT F;  1HCZ A;  4KY7 A;  4LJZ C;  2YTV A;  2EY2 A;  1HA6 A;  3CCU A;  1PZK D;  3NSW A;  2Q2T A;  3FEW X;  4HED A;  2Q8I B;  3GTK B;  3VA5 A;  1UE7 A;  1ESF A;  3NE5 B;  2UUC L;  4IUP A;  2B3G A;  1U4M A;  3HOV H;  4DAM A;  1X9N A;  1HTL D;  2JN4 A;  1XPU A;  4C56 C;  3W5O A;  3NTK A;  4JYA L;  2Z6K C;  1HZC A;  1HNZ Q;  3F1Z A;  4X3T A;  5ELD A;  5J39 A;  2CW0 D;  4P2C B;  2PI2 E;  3AYH B;  1SDF A;  4C2M B;  1QWY A;  3SXH A;  1HR0 Q;  1U5K A;  1II3 A;  4BBS H;  1HFG A;  3S17 B;  1A8V A;  1SYD A;  4A3B G;  1D1K A;  1AZP A;  3V2T A;  3KK7 A;  1F9P A;  1EQR A;  3JAM i;  2JJQ A;  1X55 A;  5IT9 L;  1GUG A;  1M4V A;  2HDL A;  4C3J G;  4R4Q A;  3TME A;  2BDO A;  3OHX C;  5CV7 A;  3PIP A;  5FKA C;  2WKD A;  1J5E Q;  1PH2 A;  1QOH A;  5E1F A;  4K2L A;  1BCP F;  3A74 A;  3EA6 A;  4BXX G;  5ISR A;  2KCN A;  1X32 A;  3J80 L;  3S1N H;  1QNU A;  1X3G A;  3K7A B;  3SR1 A;  1KD1 C;  3W3A A;  1IHZ A;  1U9R A;  5JPM C;  3BJU A;  1VQF A;  2R3Z A;  1QVF A;  3Q22 A;  4A93 G;  3GTJ H;  1VQB A;  4ZUI A;  4QQB X;  2NTS A;  4IUV A;  3FDT A;  2YU9 B;  4J8Q A;  4KV6 A;  2K4K A;  3RLF A;  1VS0 A;  2NVQ B;  1KL9 A;  1ENA A;  1DD2 A;  3W1G A;  4NP5 A;  1LLR D;  2P5Z X;  3NEN A;  3GV6 A;  4QY7 A;  3NK9 A;  3NWS A;  2EYL A;  4MTN A;  4YY3 L;  3PO2 G;  3PO3 B;  1E1O A;  3S1M B;  2PZU A;  1ESR A;  1HR0 L;  1JWU D;  3T1H Q;  4F7X A;  5CV5 A;  4HCS A;  4J6H A;  3BZC A;  2CFM A;  4YCW A;  4AYB B;  3OMC A;  1VQ7 A;  5GRO A;  4IOA A;  3H0G H;  1WFQ A;  1YIT A;  1UE1 A;  1VQ8 A;  1HNX Q;  3GTO B;  1TWC H;  3R93 A;  1GOZ A;  4P71 A;  1GKH A;  1J9O A;  2F0E A;  3NHH A;  4R8N A;  3TSS A;  2NVT B;  1AZQ A;  2JA7 B;  4TSS A;  2DJF C;  3D6C A;  1HUN A;  3BZK A;  4HIM A;  2JXM B;  4CDE C;  1VQC A;  4Y52 H;  5CBA E;  2C5C A;  3RLO A;  3JC6 6;  2E2J B;  3LX0 A;  4R4C A;  4IUU A;  4X3S A;  1Q81 C;  2IX3 A;  3DWP A;  1PTO H;  4RHS A;  4IPH A;  3PUW A;  3M3Y B;  3KF8 A;  1WI5 A;  1I4R A;  4LF6 Q;  5LL6 X;  4DV7 L;  4R4O A;  1WTX A;  1KRS A;  4ILW A;  4X65 L;  5D3D A;  3IRB A;  1K0R A;  1DOM A;  3RUZ A;  2G9H D;  3ND9 A;  4QUC A;  2CWP A;  1F2Y A;  1WTR A;  5M3F G;  5K5P A;  3TP6 A;  4YHH Q;  4G7Z C;  3RZO B;  1CA6 A;  2K14 A;  2MNA A;  1DOL A;  4DV3 Q;  2A69 C;  4LFC Q;  4GS3 A;  1DCZ A;  4P75 A;  1YBY A;  3SDZ A;  2LXJ A;  3T16 A;  4B9W A;  3GTL H;  1CT1 D;  4JI2 Q;  2DGY A;  1KDC A;  5C4J H;  2KCM A;  2WAQ G;  4M1U B;  2JA8 G;  1E7Z A;  1VQJ A;  2OF1 A;  3T1H L;  3ERS X;  1AN8 A;  3G4S A;  2B2W A;  1QNK A;  1KLU D;  3GTG B;  3CAM A;  3VR4 A;  2DN8 A;  3CC4 A;  3QG1 A;  5ELC A;  4GKJ L;  2EYH A;  1LAC A;  1HNX L;  1TWF H;  1DJR D;  3HOX G;  3PGZ A;  1O7L A;  4ZKB B;  1F2Z A;  2KBN A;  1CKM A;  3LNN A;  4LUV A;  2A68 D;  2BOS A;  5IOD A;  4UP7 A;  2KED A;  2JA9 A;  3L9A X;  3VR3 A;  1OXX K;  1YJ9 A;  4A3D H;  4OWW B;  4WOR A;  2I5L X;  2R92 B;  4DUZ Q;  5FLX E;  2HCI A;  4U68 A;  2H4O A;  2DJG C;  2ZTD A;  1Y8N B;  3D8G A;  3DXJ C;  1VMP A;  3P1H A;  5ELN A;  1B4O A;  1WCM G;  3E6Z X;  1RJT A;  3W2D A;  3QR8 A;  4DK1 A;  4BBR G;  2C35 B;  1K3B C;  2Q8R E;  2EYP A;  1PH1 A;  4LF6 L;  4J15 A;  1IBL Q;  4HSP A;  3KF6 B;  1B50 A;  1HUM A;  5C3W A;  4DPG A;  1A3V A;  2J0T D;  4C1N K;  4KHV A;  2LS0 1;  4AH6 A;  1YHQ A;  5M3M H;  2A68 C;  1EY9 A;  2D0P A;  2F0L A;  3FKI H;  4IPD A;  1SND A;  3CQZ H;  5IYB H;  2FXQ A;  2QCP X;  4XXE A;  4JBM A;  3C2P A;  1Q86 C;  4DV3 L;  4CJ0 B;  3HKZ E;  1CK1 A;  2EQS A;  1JB3 A;  1N36 Q;  1TS3 A;  1L1O B;  2ENB A;  3T53 B;  3TDQ A;  1WJJ A;  1B53 A;  2R7Z G;  1TWA H;  1H9R A;  3SVM A;  3CU7 A;  1I6V C;  5JEA H;  2E2H H;  2Z6B A;  4HMI A;  1IL8 A;  3PCO B;  3O13 A;  4DR4 L;  3OWE B;  5CR3 A;  1U4R A;  2JEA I;  2X6L A;  1TVX A;  1LTI D;  4BY7 B;  4DFA A;  3HOV G;  1P8L A;  4HJ5 A;  3OOC A;  4IUN A;  4DNR B;  4WRD A;  1F9Q A;  4RWS C;  3T1Y Q;  2RHQ B;  1QCB D;  3BVG A;  1AEX A;  4DR1 Q;  2Y0S E;  5IP7 H;  3QOJ A;  1X54 A;  4NB3 A;  4ZK9 B;  3R8B A;  2K01 A;  1JQY D;  1KC8 C;  5M5W H;  2LFN A;  1DOK A;  1W3S A;  2V4D A;  4X66 Q;  4NXN Q;  2VUM G;  2R93 B;  1G2S A;  2F03 A;  4BBS G;  2NUC A;  3VDY A;  2A74 C;  1Q8K A;  1K8G A;  4EGV A;  3TRE A;  3D6W A;  5FOB B;  4RGT A;  5IY0 A;  4KN7 C;  3CF5 A;  3OSO A;  1EUJ A;  4A3G B;  3H3V C;  3K58 A;  2F0J A;  5I2Y A;  4JI8 Q;  5C4X H;  2AQ3 B;  4K5X A;  2I5H A;  4X62 L;  1IBK Q;  2EYO A;  1SJE D;  4PZ6 A;  2F0T A;  3M4Y A;  5EKI A;  5J1Z A;  3ITP A;  3U9O A;  3DWA A;  1SRO A;  2F0M A;  4K6L A;  1PXU A;  2KCT A;  1Q1E A;  2KUM A;  5BN4 A;  3A54 A;  4FF2 A;  4LAA A;  4KMU C;  1Z7T A;  3OTO Q;  1KIX A;  4MNO A;  2BE5 D;  2TSS A;  1EZ8 A;  1N36 L;  4KHP Q;  2K1B A;  3H0G B;  1V8Q A;  1N8R C;  1I94 Q;  1BQQ T;  2A6E D;  4KKS A;  1M90 C;  1VCI A;  3ONA B;  2J4X A;  4A3F G;  1SRU A;  5IOC A;  4YCV A;  1XNR Q;  4OL7 A;  3H15 A;  4A3C H;  3I4N G;  1AP0 A;  1STY A;  3K80 C;  1SE8 A;  2NVY H;  1SR3 A;  4BXX H;  3S2D B;  1I3Q B;  3GD7 A;  2HHH Q;  1BBX C;  4NXN L;  2BE5 C;  4ABN A;  1EL0 A;  4RAU C;  2PW5 A;  1YIJ A;  1N34 Q;  1X6O A;  2NZO A;  2EZV A;  1LTL A;  3SGI A;  1IKL A;  1JJ2 A;  4A93 H;  1NMF A;  2K50 A;  1QZG A;  2EXD A;  1I4P A;  1AE2 A;  2OT2 A;  3Q0A A;  3S24 A;  1TWH H;  5E4X A;  1YNJ C;  1VQO A;  4GNX C;  3K57 A;  4DV2 Q;  4WJW A;  2O5I C;  4JI1 L;  3A7A B;  4HMJ A;  1IBK L;  3HOW B;  5LMN W;  5CV8 A;  2CQA A;  3CCS A;  3CCL A;  3LGJ A;  4LF7 Q;  4EQO A;  1PRT D;  5I2X A;  1CI3 M;  5C4J B;  1D5M C;  1K73 C;  3S16 H;  1ZXT A;  3TP5 A;  2LSS A;  2SEB D;  3OTO L;  3URY A;  2OEO A;  3PO2 H;  3TBI B;  4UP8 A;  4KK7 A;  4KHP L;  1XMO Q;  3FMC A;  5JAV A;  1I94 L;  2WKC A;  4ZYS A;  1TS5 A;  5KNC A;  1F2M A;  4ZQ3 A;  4UY8 C;  1H9J A;  2OQ0 A;  4X3U A;  3HGB A;  2UXB L;  2K04 A;  1XNR L;  3J81 i;  4LF4 Q;  1SNP A;  1KTK A;  2HUG A;  5C4Z A;  1EYC A;  4GOP B;  2PYK A;  4J1M A;  4B3T L;  1V1O A;  3E0J A;  3LWU A;  4NPS A;  3HS0 C;  3A55 A;  5AFW A;  5E4W C;  1JJG A;  1JOO A;  3M7G A;  4DK0 A;  5IGD A;  1EY6 A;  1GHJ A;  1XMQ Q;  1G6P A;  3K5M A;  1YJN A;  3DMU A;  2WAC A;  5HUR A;  1N34 L;  5IGB A;  4A3J H;  2CVR A;  1JOR A;  2LXK A;  3N52 A;  3DHQ A;  4A3I H;  3SK6 A;  1RKN A;  3PQI A;  3ND8 A;  5G3L D;  4OWX B;  3CCV A;  1NTG A;  2RCN A;  1BOS A;  4GKK Q;  2PZT A;  1O80 A;  3T13 A;  4DV2 L;  3VYS A;  3KJP A;  2E8G A;  1Q90 A;  4QIW E;  4NXM Q;  1XYI A;  4A3D G;  1UUP A;  2BCO A;  1EIF A;  4JW0 A;  2HQE A;  3AFP A;  2E5L Q;  4A3M B;  2CWA A;  3WOE A;  3AB9 A;  4RGN A;  5I9O A;  1E3P A;  5C0X I;  1C7Y A;  4DV4 Q;  1RL2 A;  4DGZ A;  4MHE A;  3M4O H;  3ULP A;  4JI0 Q;  4PG3 A;  5EKL A;  4FXK C;  3VA7 A;  3I4O A;  2L11 A;  2MP1 A;  2EJG C;  4OWT B;  3U4Z A;  2E2H B;  1XMO L;  2OXP A;  4HJ8 A;  1T5X D;  4DK3 C;  2VL6 A;  3DEP A;  1X3E A;  3S1Q H;  3I2Z A;  1PZJ D;  1R9T B;  3GTQ H;  3I4M G;  1ASY A;  4GLV B;  1EQV A;  4PZ8 A;  5ELE A;  2PW7 A;  1RIP A;  3S1R B;  1IZ6 A;  4LF4 L;  5M3M G;  3HOX H;  2KEN A;  1TS2 A;  4K5V A;  2A19 A;  3QB3 A;  4DR5 Q;  4OX9 Q;  5IYB G;  2ES2 A;  4S3S A;  3RZD H;  1PYW D;  2DNE A;  2RVL A;  1SXT A;  3NPP A;  1Y1W B;  1EYA A;  4H7B A;  3J80 i;  1F9R A;  1IYU A;  1HH2 P;  4DV6 Q;  1B7Y B;  1XMQ L;  1GM5 A;  3A5U A;  4BY1 B;  1A3T A;  5ELO A;  5M5Y H;  2R61 A;  1EU4 A;  1SEB D;  3TQY A;  2AWN A;  2SNS A;  4FF4 A;  4BBR H;  2G5D A;  3RLN A;  2MGS A;  1PH6 A;  4JI7 Q;  4JG2 A;  4QMG A;  1NSN S;  3HP3 A;  2GVA A;  4GKK L;  1HZA A;  4RGM A;  1IKM A;  1Y8O B;  4XTC S;  5A2Q E;  1IBM Q;  2CHB D;  1CQF A;  4NXM L;  1CSP A;  4ALP A;  4M8A A;  2K5V A;  2B2V A;  2E5L L;  2AKW B;  3C1E A;  5H1S E;  2ICI A;  1K83 H;  1SMY D;  4IPG A;  1C48 A;  3U9S A;  1D2B A;  4DV1 Q;  3TS0 A;  4DUY L;  4DV4 L;  1E2V A;  2K75 A;  3EJI A;  4A3B B;  4JBK A;  2BH2 A;  2EDG A;  2R7Z H;  1R4P B;  4G4K A;  5COR A;  2KEE A;  4N9T A;  5C4X G;  4LFA Q;  4C3J B;  2ZM6 L;  1LTG D;  4X6A H;  5JJK A;  4DR2 Q;  4OX9 L;  4HSV A;  1K28 A;  5LHY 1;  1SNQ A;  3JAM c;  1SFO H;  4AYB E;  1CKN B;  3S14 H;  1BO0 A;  3H6M A;  2Z1C A;  2R6G A;  1SMY C;  4JOI C;  1SYF A;  2Z6K A;  3TZU A;  2AHO B;  1HPC A;  4YWL A;  1WTW A;  1F2L A;  1SYE A;  4PMW A;  1N9W A;  4FP5 D;  2E75 C;  2VUM H;  2RF4 A;  1B3A A;  4LWC A;  4DAY B;  4L5S A;  1BUV T;  4XT3 B;  4R1J A;  4DR6 Q;  3OIQ A;  4JV5 Q;  2KHJ A;  1NNX A;  4JPB W;  1I50 H;  4JI5 Q;  4JI7 L;  3PSI A;  2CQO A;  3S15 H;  4EQ5 A;  4A3C G;  1VF7 A;  3HG9 A;  3D0F A;  1CHP D;  1IBM L;  1TII D;  3OW7 A;  5G3L F;  1JIC A;  2PI2 A;  3Q23 A;  1SNO A;  4B3S L;  2F0I A;  2EYM A;  5K36 G;  3I7F A;  2O2L D;  3VYT A;  1KDB A;  3S16 B;  2BA0 A;  1EY5 A;  5I4D A;  1SMX A;  4HAE A;  3PO2 B;  1S3O A;  3I3C A;  1WTP A;  3I73 A;  1S40 A;  2QDB A;  5A35 A;  1HZ9 A;  2EJF C;  1GXD C;  2F4I A;  4K14 A;  1B9M A;  1EOV A;  2NYZ D;  2WII B;  1PLF A;  5DM6 3;  2F0Q A;  3DM3 A;  4PMC A;  4KKU A;  4LFA L;  4A3F H;  1MI2 A;  4A3K H;  1NY4 A;  3IFD A;  2WB1 G;  4DR2 L;  1IL2 A;  5DLQ E;  3BU2 A;  2PQA A;  4LW1 A;  5IP9 H;  3A5Z B;  3I4N H;  4NMZ A;  4HJ9 A;  5C6A A;  2HIX A;  1HNZ L;  1CQV A;  3J81 j;  2UXD Q;  1HZB A;  4MTK A;  2Q2I A;  5FK9 C;  2GN5 A;  3CHB D;  3HOU B;  1WTH A;  1JWM D;  2I07 B;  4DR6 L;  4JV5 L;  4FNF A;  1U4L A;  2NZH A;  2SOB A;  4A3E H;  2KEC A;  3PF5 A;  4JI5 L;  4Y7N B;  1K9M C;  1CZG A;  4L5T A;  1VQ9 A;  1IW7 D;  5JVH 3;  4R8I A;  5M3F B;  2NN6 I;  3EVQ A;  2D9U A;  2NWG A;  1J5E L;  1VQL A;  4LK1 C;  4IUT A;  4A4I A;  1EWC A;  3E9I A;  2DY7 A;  1JWS D;  4NKL A;  3SHL A;  3GTM H;  3RD4 A;  1VQE A;  2A69 D;  2BA1 A;  2RSN A;  2WAQ B;  1IYJ B;  1I6H B;  2JA8 B;  5C0X J;  4A3J G;  3HOZ H;  4XQN A;  5A2Q L;  3UDI A;  4A3I G;  4DAV A;  4B3M Q;  4V0B A;  1NR4 A;  2R7F A;  2A8V A;  3TN2 A;  1W6K A;  1JR0 D;  1RF2 D;  2B8G A;  2WP8 J;  2OCE A;  2Z0S A;  5HGT A;  1N33 Q;  5C3E G;  2EY6 A;  3HOX B;  4E6I A;  2YTX A;  5J22 A;  3W1B A;  4JVZ A;  1IW7 C;  1EFW A;  1H9S A;  2E2I H;  1G8Z D;  2D5D A;  2D62 A;  3VYU A;  3PUZ A;  1HFN A;  1LYL A;  1RTN A;  3K0Y A;  5C3X A;  3I55 A;  1W6J A;  5KIX A;  5C5L A;  2M2L A;  3A8K E;  2F0U A;  3H3V H;  2B2Y C;  4B9X A;  3CCQ A;  2L4N A;  4EX5 A;  1YNX A;  4ZUJ A;  1C9O A;  1D1I A;  1OXT A;  1WCM B;  2UXD L;  3MHB A;  3L2P A;  5M5Y B;  2PZW A;  4IQZ A;  4IFD I;  3IL8 A;  4I7A A;  4BBR B;  3CW2 C;  1EOT A;  1OXV A;  1L1O C;  2ICE C;  1JC7 A;  2NTT A;  2ZXP A;  3K5L A;  1JJC B;  4FDB A;  1PVO A;  2MO1 A;  2NVX B;  4AQY Q;  4JBW A;  1T5E A;  2NB0 A;  1YHA A;  1JB7 A;  1VQA A;  4KD3 A;  1J6Q A;  4O0A A;  1MD2 D;  4JI4 Q;  5M9O A;  1JE5 A;  2RHS B;  2Z4I A;  4TQU S;  5GAE C;  1PFN A;  2IHF A;  5LMU Q;  2OWO A;  4ZLT F;  4IUQ A;  4CGY B;  4C3H H;  5JJI A;  1FYC A;  3MWY W;  4FF1 A;  4OEM B;  3ULL A;  4DNT B;  1QUQ A;  1TQO A;  3IAY A;  5BN5 A;  4L5R C;  3E0E A;  2R7Z B;  4B3M L;  2JK8 A;  1NAP A;  1A63 A;  1RCV D;  3K59 A;  1SYG A;  1U0L A;  3I91 A;  1I4X A;  1LT5 D;  1T9H A;  4LF9 Q;  3M4Q A;  2KCC A;  5CMD A;  3HOV B;  1XJV A;  4UAI A;  5T1G A;  3I4M H;  2LKV A;  2N3S A;  1ZKO A;  5EBC A;  5AJ3 Q;  1XWE A;  3KF8 B;  1LTA D;  5FO9 B;  3R2I A;  4POG A;  2EVB A;  1RDP D;  4YHH L;  1WVL A;  1VDZ A;  5CYU A;  4BWG B;  4HJA A;  3G6J B;  3GO5 A;  1I4Q A;  4L5Q A;  4OO1 H;  2B63 H;  2F4V Q;  4LFC L;  1ASZ A;  2VUM B;  4OIJ A;  4XIG S;  1EIG A;  4BBS B;  4JI2 L;  2JE6 I;  1L0X B;  1Q3L A;  2IPK D;  4QJF A;  4B08 A;  1A0I A;  1I5F A;  3NTH A;  4N8X 1;  1E24 A;  2VQF Q;  1PH4 A;  1I50 B;  4ZAI A;  2QIL A;  1H9K A;  3BDL A;  4DR7 Q;  2SNM A;  2B39 A;  2XGT A;  4KY5 A;  3M85 A;  2B2U C;  1LT4 D;  3MC0 B;  4AQY L;  1A6X A;  2F52 A;  3CP0 A;  2GVB A;  3N6R A;  3CMA A;  1NR2 A;  2L55 A;  3G48 A;  2K6A A;  1XPR A;  2SDF A;  4JI4 L;  3T51 B;  3S1N B;  3OMG A;  1I4H A;  2F0W A;  1U4P A;  4DUZ L;  1Q12 A;  2K7V A;  4P74 A;  2HDM A;  1Y1V H;  4PZ7 A;  3GTJ B;  4LFB Q;  3CRL C;  3R2T A;  1HTP A;  4X64 Q;  1MSH A;  3K7U C;  1GHK A;  3BS1 A;  2A73 B;  4H13 C;  3KDF A;  3CXC A;  5D3I B;  4JI6 Q;  2RDH A;  4HCE A;  2RCF A;  4A3F B;  2K5Q A;  1IBL L;  3EBE A;  3QWN A;  5M5X H;  4RA8 A;  1PFS A;  3AMU A;  4POF A;  2Z4H A;  1N32 Q;  2PNR C;  2XWB B;  4YWK A;  4L8J A;  1KNE A;  3I4N B;  5EBD A;  3I90 A;  1LV9 A;  5FO7 B;  2XN9 C;  1PYB A;  1GUO A;  3BDC A;  1A15 A;  1SNM A;  2IX0 A;  3A7L A;  2F4V L;  1B44 D;  1NCV A;  1PH9 A;  3KFU A;  3FRP B;  1JOK A;  1YZ6 A;  3U58 A;  4XDX A;  4K5W A;  1LAB A;  3C3L A;  1LTT D;  3MEH A;  5KGU A;  4K8I A;  3EN2 A;  3PMF A;  2VQF L;  1GD7 A;  2ID0 A;  3IFT A;  2QEX A;  4V19 0;  2HD3 A;  1DGS A;  1TWC B;  3CCR A;  1YI2 A;  3U50 C;  1IYV A;  1KLG D;  5TSS A;  1YNJ D;  2IT1 A;  1QVG A;  4A3K G;  1ET6 A;  1MHW C;  2YYZ A;  5C44 H;  5IP9 G;  2R7D A;  3GTM B;  3T1Y L;  1STH A;  4DV5 Q;  4XQJ A;  4DR1 L;  1V9P A;  1FNU A;  5K36 H;  1EWH A;  2N49 A;  2A1A A;  4YWM A;  4GOP C;  1PTO B;  4X66 L;  1KAA A;  1MJC A;  4LFB L;  1V1Q A;  1PFB A;  4JC0 A;  1AW7 A;  3L3O C;  5HY6 A;  2KHS A;  3TS2 A;  4JI6 L;  1FGU A;  1FL0 A;  3AQQ A;  4A3E G;  2MJ8 A;  3K5O A;  4C3I G;  1GJX A;  2K28 A;  2QF7 A;  3HEJ A;  5KEE A;  1ML0 D;  4LF5 Q;  2ZTC A;  3BVM A;  3L0O A;  4JI8 L;  1PH8 A;  3NUC A;  4RMF A;  4GNX A;  3PIO 3;  2NZ1 D;  4DNI A;  2B2T C;  1S72 A;  1D7Q A;  2WFW A;  3Q24 A;  3TRZ A;  3GTL B;  3J81 c;  1UEA B;  2QA4 A;  5GAG C;  4UPA A;  3ZYY X;  2RDG A;  3HOZ G;  1EYG A;  2D2C C;  1PHJ A;  4LMQ D;  3HKZ G;  1J8I A;  4TKO B;  1F9S A;  2Q2H A;  2JP1 A;  3S9W A;  2O5J C;  1BF4 A;  4IFD J;  1KDA A;  3SK4 A;  1EFI D;  1TWF B;  1L0Y B;  3RNU A;  3PF4 A;  4O1N A;  1YJW A;  4L6T B;  1O7Z A;  4K2K A;  4ODG A;  2FHT A;  2JA5 G;  1MKH A;  4A3D B;  1JT8 A;  1FVI A;  1LTS D;  4HR7 B;  3HOY G;  2F0P A;  3NTI A;  3K7A H;  4RFB A;  3CCE A;  1STB A;  4DV5 L;  3ZJY C;  2UU9 Q;  2Y0S G;  1KAB A;  3DWQ A;  1UAP A;  2HHH L;  1Q7Y C;  3LWE A;  1TT2 A;  2E2D C;  1SN8 A;  2YU9 H;  2K33 A;  1ICF B;  2PQE A;  1FJG Q;  1RTO A;  2CH4 W;  5CV6 A;  2NVQ H;  3I4M B;  3SK8 A;  4JCV E;  1VQD A;  3M4P A;  3GV3 A;  3VYR A;  4LF5 L;  5C3E H;  4X3K A;  5M3M B;  2BDN A;  2FIN B;  4I7Z C;  3FKI B;  4QCL A;  2MO0 A;  1D8L A;  3CME A;  3CQZ B;  5D65 A;  2ZJQ A;  3NWT A;  1KAW A;  2ZJR A;  1XNQ Q;  5JPN C;  3PO3 H;  5IT9 c;  2K5N A;  4LF7 L;  1SLJ A;  3QIA A;  4C3H G;  1TY0 A;  3F2D A;  4RKL A;  2F3I A;  2K03 A;  3UDF A;  4CJ2 C;  1TWA B;  3GTO H;  3D4W A;  5C4H A;  2EY1 A;  4IJL A;  2AWO A;  3BZD B;  2XNA C;  2NVT H;  1CA5 A;  2L9H A;  2XTI A;  3G7L A;  1HNW Q;  3AU7 A;  2VY3 A;  4HJ7 A;  3NQI A;  3ULJ A;  4K0K Q;  1EQQ A;  4A76 A;  2KVM A;  1E2W A;  4OGQ C;  1H9M A;  2N88 A;  4EVO A;  1VQM A;  4GLA C;  1CFM A;  5M5W B;  4FF3 A;  1ENF A;  4OO1 G;  1OXS C;  3PIP 3;  2B63 G;  1HRJ A;  4K8J A;  3RR5 A;  5GAH C;  3NEL A;  4ZCK A;  2PMZ B;  4WFN 3;  3M3Y H;  1FR3 A;  1GVP A;  3B6Y A;  2L5T A;  2H1E A;  3UI2 A;  2K5W A;  1WD1 A;  3MTS A;  2LY7 A;  5IYC H;  5GQO A;  2KOL A;  1SAP A;  2UUC Q;  3I72 A;  2K5D A;  1B70 B;  1HJP A;  3K0X A;  4QB4 A;  1VQP A;  1HR0 W;  1ET9 A;  5M5X B;  1FNW A;  2GA4 B;  1PRT B;  1STE A;  4A75 A;  2KHI A;  5C4X B;  4JYA Q;  1O7I A;  1K8A C;  1TKW B;  1UNS A;  3RZO H;  5IE8 A;  1B8A A;  3FPP A;  3SE0 A;  1NBW A;  2I5M X;  1PV4 A;  3ICE A;  3STB D;  2J7Z A;  3V05 A;  1VQN A;  2OTJ A;  4LUZ A;  4P72 A;  3KBG A;  2QDL A;  1CSQ A;  1SE4 A;  4Q0F A;  1MSG A;  1Y1V G;  1NMG A;  1L2F A;  1STN A;  2JA6 G;  4RGO S;  4KLK A;  1KXL A;  2VW9 A;  2I46 A;  1TU2 B;  2MUY A;  4R4I A;  3GTG H;  1KNA A;  4GN4 B;  2FMM A;  4JI0 L;  2XIW A;  2PCF B;  3PUY A;  1Y14 B;  1TY2 A;  5C0X G;  3C46 A;  1D6E C;  3PV0 A;  5BR8 Q;  1X3P A;  3I56 A;  2XSC A;  3KUP A;  3NBH A;  3KLS A;  1HNW L;  1WYD A;  3CC7 A;  2F3V A;  3JAM E;  1VQK A;  2R92 H;  2MPM A;  5KND A;  1WD0 A;  4DR5 L;  2N55 A;  3STB C;  1QZH A;  1ICW A;  2NVY B;  4DA2 A;  1B2T A;  4NW2 A;  1Q1B A;  1BCP B;  4ME3 A;  4QUF A;  2LMC B;  5F2D A;  2F0G A;  4JOI A;  1HA5 A;  1Z47 A;  4DV6 L;  1DYQ A;  3UDG A;  3Q6S A;  4A93 B;  3X3M A;  2ZTE A;  4KN4 C;  2EXZ A;  1LTR D;  1TWH B;  3FP9 A;  3MFY A;  4OON A;  1V43 A;  4I65 A;  4RCN A;  4YCU A;  3BVZ A;  3MVV A;  2F3W A;  3KJO A;  2FFK B;  4WJ3 M;  2WAQ E;  2WB1 B;  5C44 G;  1VQH A;  4YY3 Q;  3U4V A;  1EWI A;  1EY7 A;  4JI3 Q;  2PNH A;  4HN7 A;  2F0D A;  4CDF C;  3P20 A;  2AQ2 B;  1BBW A;  3MXN A;  4A3L G;  2K52 A;  4HTH A;  4H02 A;  1S5E D;  4DV1 L;  1CKO A;  3KLS X;  1VQ5 A;  3HZX A;  5FJ8 G;  5DEH A;  1TR5 A;  5E7N A;  1XTD A;  4LF8 Q;  5T1I A;  1SYB A;  2PO4 A;  1FGB D;  1XTC D;  3P7J A;  3I70 A;  1PH3 A;  1PH7 A;  2IWH A;  4BY7 H;  5BR8 L;  1H95 A;  1CHQ D;  1EEF D;  1LUZ A;  3TZD A;  1IXR A;  3QOL A;  3GQB A;  2VB3 X;  4F88 A;  1PFM A;  4DF7 A;  2CW0 C;  4UP9 A;  4KKT A;  1Q82 C;  1Q46 A;  3KLW A;  3D4D A;  3NBH B;  3R3O A;  1DM0 B;  5EKK A;  2R93 H;  1E22 A;  5E3F A;  4YIJ A;  3KLR A;  4C1N I;  4EQN A;  2FJ2 A;  4DV7 Q;  5I6W A;  1ROD A;  3J7Z C;  3IKJ A;  4A3J B;  2E74 C;  4IZ8 A;  5JJZ A;  3K6O A;  2HIV A;  4X65 Q;  2JQO A;  4A3I B;  4CDC C;  1OTC A;  4A3G H;  1AE3 A;  1Z9F A;  4G57 A;  2OQK A;  3WDN A;  2UUA Q;  1VF5 C;  4UDU C;  1CZW A;  4QF4 A;  5JOB A;  5C3E B;  1BXT A;  4C3I H;  1G29 1;  2TMP A;  1MJE A;  1JOQ A;  1STG A;  1SSO A;  1GUW A;  4QGU A;  4IOC A;  5JEA J;  1V1P A;  2RA4 A;  1ILQ A;  4JI3 L;  1BR9 A;  1O78 A;  2AQ1 B;  2ZT9 C;  3H94 A;  2QGQ A;  3P75 A;  2HT1 A;  3M4O B;  3H09 A;  4GKJ Q;  2ATW A;  1QG7 A;  3MA2 B;  4O42 A;  4CKC A;  3MXN B;  3S1Q B;  4LF8 L;  2E76 C;  3PUX A;  3GTQ B;  4DXG A;  2UXC Q;  4FXD A;  2G9D A;  2KQ3 A;  4XYO A;  4APV A;  5IIF A;  3A8I E;  3RZD B;  2JA5 H;  3BYY B;  3CPF A;  2L1B A;  5CV4 A;  3PO3 G;  1I3Q H;  3KF6 A;  3HOY H;  3S2D H;  1BVS A;  3FHW A;  3HOU G;  1SE2 A;  3DUZ A;  1JE4 A;  2F0H A;  5I9P A;  1BDO A;  4L63 B;  1LO5 D;  1S5D D;  4AYB G;  2L0C A;  5FLM G;  2CKZ B;  1EZ6 A;  1S5B D;  3JAM L;  2B2Y A;  2VZA A;  4KJN A;  1BBU A;  3ERO A;  4B3R Q;  2PQA B;  4DV0 Q;  3EFX D;  4H0L C;  1GUS A;  2HCC A;  3OPO A;  2UUA L;  2AMC B;  1SE3 A;  1PH5 A;  5KYL A;  1G51 A;  1TXY A;  1X56 A;  2JA7 G;  5HGQ A;  5EPL A;  3CRK C;  5IYD H;  1L1O A;  2M00 A;  3HOW H;  4RH6 A;  5KYI A;  3QJY A;  3SEB A;  1VMC A;  2JEB I;  1FNV A;  1A2U A;  1EEI D;  2YV5 A;  3NP8 A;  2XRQ D;  3H91 A;  3CD6 A;  1K83 B;  3AFQ A;  3FVQ A;  4OEL B;  4TVA B;  2B2W C;  3DLL A;  2MHV A;  2RKS A;  1SYC A;  4KY6 A;  1I4G A;  4GN5 A;  4N8F A;  1DON A;  5I6Y A;  2NN6 G;  3K81 C;  2WV6 D;  1V1P B;  3GP7 A;  5IYC G;  4DR4 Q;  3GTP H;  4CJ1 B;  3NQT A;  3MXU A;  4AIM A;  2HQL A;  4FYD A;  1B9N A;  2UXC L;  4H44 C;  1TWG H;  2IHE A;  4PV1 C;  1N33 L;  1UEB A;  4IJH A;  2NBF A;  2V1C C;  5J3B A;  3V96 A;  1A2T A;  4CBV A;  4FO2 A;  2ZJP A;  1SFO B;  2WIN B;  3D4R A;  2DY8 A;  3S14 B;  2X6G A;  4Q5V A;  5ELB A;  4LNQ A;  5FLX c;  1TS4 A;  3HFZ B;  2EE1 A;  3MXG A;  1VQG A;  3S2H H;  4U67 3;  1H9S B;  5EQ0 A;  1OXU A;  1MGS A;  1A62 A;  1G6Z A;  1DXM A;  4B3R L;  3SK5 A;  1PTO D;  1PDQ A;  2VNU D;  1JCK B;  4DV0 L;  4MIU A;  4X62 Q;  3KOJ A;  3TP8 A;  3M7N A;  1O7Y A;  2F0S A;  5EGT A;  2IX1 A;  3S15 B;  1BKB A;  5DAU A;  1BNZ A;  2XRS D;  5FO8 B;  4IFD G;  1CM9 A;  2F0F A;  3D3R A;  5C5M A;  2R92 G;  1MIU A;  1K3R A;  2B2U A;  3TP7 A;  4A3M H;  5IGF A;  1B3Q A;  3RMH A;  4KJO A;  3TEH B;  3A0J A;  1GUN A;  1X3F A;  2F0K A;  3MZ5 A;  4K6D A;  2VXW A;  5LMU L;  5IGG A;  4JK1 C;  1P16 A;  1YNN D;  2FMC A;  3NEM A;  2JA6 H;  5JJL A;  1LT3 D;  1SJH D;  3KBX A;  3F2B A;  1PTO C;  2EYJ A;  3J7A F;  1R9T H;  1WOC A;  3UE1 A;  4P73 A;  4ID6 A;  1R4Q B;  1NJI C;  5JVG 3;  3S1R H;  2AUJ D;  5C0X H;  1E2Z A;  1S5F D;  4BA2 I;  1QB5 D;  4A3K B;  4N9P A;  4LF9 L;  2QKI C;  2N78 A;  1HQM C;  1QUQ B;  4CKB A;  1RHP A;  5AJ3 L;  1Y1W H;  4XT1 B;  3J7A V;  1ONL A;  3PUV A;  1K8M A;  3FPU B;  4IN3 A;  1YVC A;  2F0V A;  1QE6 A;  2O4X A;  4BY1 H;  1WTV A;  1DZ1 A;  1YNN C;  1B1Z A;  4NDX A;  1STA A;  2AUK A;  5GAD C;  3CKI B;  2M9V A;  4JI1 Q;  1G91 A;  4KD4 A;  4BY7 G;  4A3E B;  3L7Z C;  4C3I B;  2IW3 A;  2VB2 X;  3X3N A;  4DR7 L;  5DNF A;  4HIO A;  2XVS A;  1Y8P B;  5EJW A;  2EJM A;  3A56 A; 
#chains in the Genus database with same CATH homology
 3BYT B;  2K32 A;  4DXF A;  1K8O A;  2EY5 A;  1XXG A;  5NUC A;  1EY0 A;  2C9O A;  1EIH A;  3HOZ B;  1X3Q A;  1EQT A;  3HKZ B;  1Q8I A;  3NBI A;  1ILP A;  5IGE A;  1RD9 D;  2XWJ B;  3WOF A;  3T56 B;  3A8J E;  1C8C A;  3EQL C;  2JA5 B;  4DU9 A;  4TRD A;  2E2I B;  4KHZ A;  5ELF A;  1HHV A;  2RDF A;  4CKE A;  5KNB A;  3HOY B;  2A5H A;  3J81 E;  3VR6 A;  4PNY A;  4FXG C;  1SNC A;  2B2T A;  3K5N A;  4ZKC B;  2Y0S B;  2A6E C;  5KRU A;  5BN3 A;  5FLX L;  3E5S A;  1OO9 B;  2IJ0 A;  3F2U A;  2JYO A;  1Y69 U;  4RKB A;  3MFG A;  3J7Y W;  1EU3 A;  2F0O A;  3C1F A;  4OIK A;  4BA1 I;  4ULL A;  4G7H C;  1PTO F;  2F0N A;  4Z9C B;  1QIL A;  4ZRZ A;  1D5Z C;  1M8A A;  5D14 A;  2QEJ C;  3I8Z A;  2EYF A;  4F8M A;  1EY4 A;  1PMR A;  1XX8 A;  4C3H B;  3DM1 A;  3GTP B;  5EPJ A;  4OO1 I;  1SBB B;  1TWG B;  3OWF A;  1C4Q A;  1WTO A;  4R9W A;  1PRT C;  1AFP A;  1EY8 A;  4DN4 M;  5IT9 E;  2RBM A;  3S2H B;  3I4L A;  4PMB A;  2B63 B;  2A6H D;  1E0B A;  2ZXR A;  1HXY D;  3BG3 A;  3J80 E;  5CBE E;  4G7O C;  4IUR A;  1BCP D;  4XQQ A;  3DEO A;  3MAQ A;  1G2T A;  1PZI D;  5EPK A;  2B8F A;  2RQX A;  3VR2 A;  5COY A;  1CTM A;  1F77 A;  2Z8L A;  1A3U A;  2JSO A;  2KA7 A;  2F1M A;  4FVM A;  4RHR A;  4ME5 A;  2A6H C;  4EQP A;  1Y1V B;  2JA6 B;  3MXP A;  4F87 A;  4BS9 A;  1ZYR D;  2L12 A;  2NN6 H;  1Z6H A;  4OHJ A;  3QO2 A;  1BCP C;  2K05 A;  2EPB A;  3BDO A;  1GUT A;  4IAL A;  4RCO A;  3NXW A;  1WTQ A;  4KI0 A;  1S5C D;  2Q8T A;  4DAY A;  1EYD A;  4PQX A;  1QJO A;  2DNC A;  2IL8 A;  3ERQ A;  1MBY A;  5CV9 A;  2RSO A;  5IGC A;  4KTA A;  3D31 A;  5JEA G;  5DM7 3;  3T4A C;  2EOT A;  1ZYR C;  1LTB D;  1FD7 D;  4XYQ A;  4MN3 A;  3J81 L;  1NUC A;  1D5X C;  2KJX A;  5CC4 A;  4CHT B;  2B2V C;  2ZXO A;  5CGK A;  1S4Z A;  2X69 A;  4GZY C;  3OIP A;  5C44 B;  1ENC A;  4IFD H;  1HQR D;  3HRZ C;  5LL6 S;  2PPB C;  3VR5 A;  1ZEQ X;  4QIW B;  1LT6 D;  4DAP A;  1PRT F;  1HCZ A;  4KY7 A;  4LJZ C;  2EY2 A;  1HA6 A;  1PZK D;  3NSW A;  3FEW X;  4HED A;  2Q8I B;  3GTK B;  3VA5 A;  1ESF A;  3NE5 B;  4IUP A;  1U4M A;  1HTL D;  4C56 C;  3NTK A;  4X3T A;  5ELD A;  5J39 A;  2CW0 D;  4P2C B;  1SDF A;  4C2M B;  1QWY A;  3SXH A;  1II3 A;  1HFG A;  3S17 B;  1SYD A;  1D1K A;  1AZP A;  3V2T A;  3KK7 A;  1F9P A;  5IT9 L;  1GUG A;  1M4V A;  2HDL A;  4C3J G;  3TME A;  2BDO A;  3OHX C;  5CV7 A;  5FKA C;  2WKD A;  1QOH A;  5E1F A;  4K2L A;  1BCP F;  3EA6 A;  5ISR A;  2KCN A;  1X32 A;  3J80 L;  1QNU A;  3K7A B;  3SR1 A;  3W3A A;  1IHZ A;  1U9R A;  5JPM C;  2R3Z A;  3Q22 A;  4ZUI A;  2NTS A;  4IUV A;  3FDT A;  2YU9 B;  4J8Q A;  4KV6 A;  3RLF A;  2NVQ B;  1ENA A;  1DD2 A;  4NP5 A;  1LLR D;  3GV6 A;  3NK9 A;  3NWS A;  2EYL A;  3PO3 B;  3S1M B;  2PZU A;  1ESR A;  1JWU D;  4F7X A;  5CV5 A;  4HCS A;  4J6H A;  4AYB B;  3OMC A;  3GTO B;  3R93 A;  1GOZ A;  1J9O A;  2F0E A;  3NHH A;  4R8N A;  3TSS A;  2NVT B;  1AZQ A;  2JA7 B;  4TSS A;  3D6C A;  1HUN A;  2JXM B;  5CBA E;  2C5C A;  2E2J B;  3LX0 A;  4IUU A;  4X3S A;  2IX3 A;  3DWP A;  1PTO H;  4RHS A;  3PUW A;  3M3Y B;  3KF8 A;  1I4R A;  5LL6 X;  1WTX A;  4ILW A;  5D3D A;  1DOM A;  3RUZ A;  2G9H D;  3ND9 A;  4QUC A;  1F2Y A;  1WTR A;  5K5P A;  3TP6 A;  4G7Z C;  3RZO B;  1CA6 A;  1DOL A;  2A69 C;  1DCZ A;  3SDZ A;  4B9W A;  3T16 A;  1CT1 D;  1KDC A;  4M1U B;  2OF1 A;  1AN8 A;  2B2W A;  1QNK A;  1KLU D;  3GTG B;  3VR4 A;  2DN8 A;  3QG1 A;  5ELC A;  2EYH A;  1LAC A;  1DJR D;  1O7L A;  4ZKB B;  1F2Z A;  3LNN A;  2A68 D;  2BOS A;  5IOD A;  2KED A;  3L9A X;  3VR3 A;  1OXX K;  4WOR A;  2R92 B;  5FLX E;  2HCI A;  4U68 A;  2H4O A;  1Y8N B;  3D8G A;  3DXJ C;  1VMP A;  3P1H A;  1B4O A;  3E6Z X;  1RJT A;  3W2D A;  4DK1 A;  2Q8R E;  2EYP A;  4HSP A;  1B50 A;  1HUM A;  5C3W A;  1A3V A;  2J0T D;  4C1N K;  4KHV A;  2LS0 1;  2A68 C;  1EY9 A;  2F0L A;  1SND A;  2QCP X;  4XXE A;  3C2P A;  4CJ0 B;  1CK1 A;  1JB3 A;  1TS3 A;  2ENB A;  3T53 B;  3TDQ A;  1B53 A;  1H9R A;  3SVM A;  3CU7 A;  1I6V C;  5JEA H;  4HMI A;  1IL8 A;  3O13 A;  3OWE B;  5CR3 A;  1U4R A;  2JEA I;  2X6L A;  1TVX A;  1LTI D;  4BY7 B;  4DFA A;  3OOC A;  4IUN A;  4DNR B;  4WRD A;  1F9Q A;  4RWS C;  1QCB D;  3BVG A;  1AEX A;  3QOJ A;  4ZK9 B;  3R8B A;  2K01 A;  1JQY D;  2LFN A;  1DOK A;  2V4D A;  2R93 B;  1G2S A;  2F03 A;  2NUC A;  2A74 C;  4EGV A;  3D6W A;  5FOB B;  4RGT A;  4KN7 C;  3OSO A;  4A3G B;  3H3V C;  3K58 A;  2F0J A;  5I2Y A;  2AQ3 B;  4K5X A;  2EYO A;  1SJE D;  2F0T A;  3M4Y A;  5EKI A;  5J1Z A;  3ITP A;  3U9O A;  3DWA A;  2F0M A;  4K6L A;  1PXU A;  1Q1E A;  2KUM A;  5BN4 A;  3A54 A;  4FF2 A;  4LAA A;  4KMU C;  1Z7T A;  2BE5 D;  2TSS A;  1EZ8 A;  2K1B A;  3H0G B;  1V8Q A;  1BQQ T;  2A6E D;  4KKS A;  1VCI A;  3ONA B;  2J4X A;  5IOC A;  4OL7 A;  1AP0 A;  1STY A;  3S2D B;  1I3Q B;  3GD7 A;  1BBX C;  1EL0 A;  2BE5 C;  4ABN A;  4RAU C;  2PW5 A;  2EZV A;  1IKL A;  1I4P A;  2OT2 A;  3Q0A A;  5E4X A;  1YNJ C;  3K57 A;  4WJW A;  2O5I C;  3A7A B;  4HMJ A;  3HOW B;  5CV8 A;  2CQA A;  4EQO A;  1PRT D;  5I2X A;  1CI3 M;  5C4J B;  1D5M C;  1ZXT A;  3TP5 A;  2SEB D;  3URY A;  2OEO A;  3TBI B;  4KK7 A;  3FMC A;  5JAV A;  2WKC A;  4ZYS A;  1TS5 A;  5KNC A;  1F2M A;  4ZQ3 A;  1H9J A;  4X3U A;  3HGB A;  2K04 A;  1SNP A;  1KTK A;  2HUG A;  5C4Z A;  1EYC A;  2PYK A;  4J1M A;  1V1O A;  3E0J A;  3LWU A;  3HS0 C;  3A55 A;  5AFW A;  5E4W C;  1JOO A;  3M7G A;  4DK0 A;  5IGD A;  1EY6 A;  1GHJ A;  3K5M A;  3DMU A;  2WAC A;  5HUR A;  5IGB A;  2CVR A;  1JOR A;  3N52 A;  3DHQ A;  3SK6 A;  1RKN A;  3ND8 A;  5G3L D;  1BOS A;  2PZT A;  1O80 A;  3T13 A;  3VYS A;  1Q90 A;  1XYI A;  1UUP A;  2BCO A;  2HQE A;  4A3M B;  3WOE A;  3AB9 A;  4RGN A;  5I9O A;  5C0X I;  4DGZ A;  4MHE A;  5EKL A;  3VA7 A;  4FXK C;  2L11 A;  2MP1 A;  2EJG C;  2E2H B;  2OXP A;  1T5X D;  3DEP A;  1PZJ D;  1R9T B;  1EQV A;  5ELE A;  2PW7 A;  3S1R B;  4K5V A;  1TS2 A;  3QB3 A;  4S3S A;  1PYW D;  2DNE A;  2RVL A;  1SXT A;  3NPP A;  1Y1W B;  1EYA A;  4H7B A;  1F9R A;  1IYU A;  4BY1 B;  1A3T A;  2R61 A;  1EU4 A;  1SEB D;  2AWN A;  2SNS A;  4FF4 A;  2MGS A;  4QMG A;  1NSN S;  3HP3 A;  4RGM A;  1IKM A;  1Y8O B;  4XTC S;  5A2Q E;  2CHB D;  1CQF A;  4M8A A;  2B2V A;  3C1E A;  2ICI A;  1SMY D;  1C48 A;  3U9S A;  1D2B A;  1E2V A;  3EJI A;  4A3B B;  2EDG A;  1R4P B;  4G4K A;  5COR A;  2KEE A;  4N9T A;  4C3J B;  1LTG D;  4HSV A;  5LHY 1;  1SNQ A;  1BO0 A;  3H6M A;  2Z1C A;  2R6G A;  1SMY C;  1SYF A;  3TZU A;  1HPC A;  1WTW A;  1F2L A;  1SYE A;  4PMW A;  4FP5 D;  2E75 C;  1B3A A;  1BUV T;  4XT3 B;  3OIQ A;  1VF7 A;  3HG9 A;  1CHP D;  1TII D;  3OW7 A;  5G3L F;  1JIC A;  3Q23 A;  1SNO A;  5K36 G;  2F0I A;  2EYM A;  3VYT A;  2O2L D;  3S16 B;  1KDB A;  2BA0 A;  1EY5 A;  5I4D A;  4HAE A;  3PO2 B;  3I3C A;  1WTP A;  3I73 A;  2QDB A;  5A35 A;  2EJF C;  1GXD C;  2F4I A;  4K14 A;  1B9M A;  2NYZ D;  2WII B;  1PLF A;  5DM6 3;  2F0Q A;  4PMC A;  4KKU A;  1MI2 A;  3IFD A;  4NMZ A;  5C6A A;  1CQV A;  5FK9 C;  3CHB D;  3HOU B;  1JWM D;  2I07 B;  4FNF A;  1U4L A;  2SOB A;  2KEC A;  4Y7N B;  1CZG A;  1IW7 D;  5JVH 3;  4R8I A;  5M3F B;  2NN6 I;  3EVQ A;  2D9U A;  2NWG A;  4LK1 C;  4IUT A;  1EWC A;  2DY7 A;  1JWS D;  4NKL A;  3SHL A;  3RD4 A;  2A69 D;  2BA1 A;  2RSN A;  2WAQ B;  1I6H B;  2JA8 B;  5C0X J;  4XQN A;  5A2Q L;  4DAV A;  4V0B A;  1NR4 A;  3TN2 A;  1W6K A;  1JR0 D;  1RF2 D;  2B8G A;  2WP8 J;  5HGT A;  2EY6 A;  3HOX B;  4E6I A;  5J22 A;  1IW7 C;  1H9S A;  1G8Z D;  2D5D A;  2D62 A;  3VYU A;  3PUZ A;  1HFN A;  1RTN A;  3K0Y A;  5C3X A;  1W6J A;  5KIX A;  5C5L A;  2M2L A;  3A8K E;  2F0U A;  2B2Y C;  4B9X A;  2L4N A;  4ZUJ A;  1D1I A;  1OXT A;  1WCM B;  3MHB A;  5M5Y B;  2PZW A;  4IQZ A;  4IFD I;  3IL8 A;  4BBR B;  1EOT A;  1OXV A;  2ICE C;  1JC7 A;  2NTT A;  2ZXP A;  3K5L A;  2NVX B;  4JBW A;  1T5E A;  2NB0 A;  4KD3 A;  1MD2 D;  5M9O A;  2Z4I A;  4TQU S;  1PFN A;  4ZLT F;  4IUQ A;  4CGY B;  1FYC A;  3MWY W;  4FF1 A;  4DNT B;  1TQO A;  3IAY A;  2R7Z B;  5BN5 A;  1NAP A;  1RCV D;  3K59 A;  1SYG A;  3I91 A;  1I4X A;  1LT5 D;  2KCC A;  5CMD A;  3HOV B;  4UAI A;  5T1G A;  2LKV A;  1ZKO A;  5EBC A;  1XWE A;  1LTA D;  5FO9 B;  3R2I A;  2EVB A;  1RDP D;  1WVL A;  1VDZ A;  5CYU A;  4BWG B;  3G6J B;  3GO5 A;  1I4Q A;  4OO1 H;  2VUM B;  4OIJ A;  4XIG S;  1EIG A;  4BBS B;  2JE6 I;  1L0X B;  1Q3L A;  2IPK D;  4B08 A;  3NTH A;  1I50 B;  4ZAI A;  2QIL A;  1H9K A;  3BDL A;  2SNM A;  2B39 A;  4KY5 A;  3M85 A;  2B2U C;  1LT4 D;  3MC0 B;  1A6X A;  3N6R A;  1NR2 A;  2L55 A;  2K6A A;  2SDF A;  3T51 B;  3S1N B;  3OMG A;  1I4H A;  2F0W A;  1U4P A;  1Q12 A;  2K7V A;  2HDM A;  3GTJ B;  3CRL C;  3R2T A;  1HTP A;  1MSH A;  1GHK A;  3BS1 A;  2A73 B;  4H13 C;  5D3I B;  2RDH A;  4HCE A;  4A3F B;  2K5Q A;  3QWN A;  4RA8 A;  3AMU A;  2Z4H A;  2PNR C;  2XWB B;  4L8J A;  1KNE A;  3I4N B;  5EBD A;  3I90 A;  1LV9 A;  5FO7 B;  2XN9 C;  1GUO A;  3BDC A;  1A15 A;  1SNM A;  2IX0 A;  3A7L A;  1B44 D;  1NCV A;  3FRP B;  1JOK A;  4XDX A;  4K5W A;  1LAB A;  3C3L A;  1LTT D;  3MEH A;  5KGU A;  4K8I A;  3PMF A;  2ID0 A;  3IFT A;  4V19 0;  1TWC B;  1IYV A;  1KLG D;  5TSS A;  1YNJ D;  2IT1 A;  1ET6 A;  2YYZ A;  3GTM B;  1STH A;  4XQJ A;  1FNU A;  5K36 H;  1EWH A;  1PTO B;  1KAA A;  1PFB A;  1AW7 A;  3L3O C;  2KHS A;  2MJ8 A;  3K5O A;  4C3I G;  1GJX A;  2K28 A;  2QF7 A;  3HEJ A;  5KEE A;  1ML0 D;  3BVM A;  3NUC A;  3PIO 3;  2NZ1 D;  2B2T C;  3Q24 A;  3GTL B;  1UEA B;  3ZYY X;  2RDG A;  2D2C C;  4LMQ D;  1J8I A;  4TKO B;  1F9S A;  2JP1 A;  3S9W A;  2O5J C;  1BF4 A;  4IFD J;  1KDA A;  3SK4 A;  1EFI D;  1TWF B;  1L0Y B;  4O1N A;  4L6T B;  1O7Z A;  4K2K A;  4ODG A;  2FHT A;  4A3D B;  1LTS D;  4HR7 B;  2F0P A;  3NTI A;  4RFB A;  1STB A;  1KAB A;  3DWQ A;  1UAP A;  3LWE A;  1TT2 A;  2E2D C;  2K33 A;  2PQE A;  1RTO A;  5CV6 A;  3I4M B;  3SK8 A;  3GV3 A;  3VYR A;  4X3K A;  5M3M B;  2BDN A;  2FIN B;  4I7Z C;  3FKI B;  4QCL A;  3CQZ B;  5D65 A;  3NWT A;  5JPN C;  3QIA A;  4C3H G;  1TY0 A;  4RKL A;  2K03 A;  4CJ2 C;  1TWA B;  3D4W A;  5C4H A;  2EY1 A;  2AWO A;  3BZD B;  2XNA C;  1CA5 A;  2L9H A;  3G7L A;  3AU7 A;  3NQI A;  2KVM A;  1E2W A;  4OGQ C;  1H9M A;  2N88 A;  4EVO A;  1CFM A;  5M5W B;  4FF3 A;  1ENF A;  4OO1 G;  1OXS C;  3PIP 3;  1HRJ A;  4K8J A;  2PMZ B;  4WFN 3;  1FR3 A;  2L5T A;  2H1E A;  3UI2 A;  2K5W A;  1WD1 A;  3MTS A;  2LY7 A;  2KOL A;  1SAP A;  3I72 A;  2K5D A;  4QB4 A;  1ET9 A;  5M5X B;  1FNW A;  2GA4 B;  1PRT B;  1STE A;  5C4X B;  1TKW B;  1UNS A;  3FPP A;  3SE0 A;  2J7Z A;  3V05 A;  3KBG A;  1SE4 A;  4Q0F A;  1MSG A;  1STN A;  4RGO S;  2I46 A;  1TU2 B;  2MUY A;  1KNA A;  2FMM A;  2XIW A;  2PCF B;  3PUY A;  1TY2 A;  5C0X G;  3C46 A;  1D6E C;  3PV0 A;  1X3P A;  2XSC A;  3KUP A;  3NBH A;  3KLS A;  2F3V A;  3JAM E;  2MPM A;  5KND A;  1WD0 A;  2N55 A;  1ICW A;  2NVY B;  4DA2 A;  1B2T A;  4NW2 A;  1Q1B A;  1BCP B;  4QUF A;  2LMC B;  5F2D A;  2F0G A;  1HA5 A;  1Z47 A;  1DYQ A;  3Q6S A;  4A93 B;  3X3M A;  4KN4 C;  2EXZ A;  1LTR D;  1TWH B;  3MFY A;  1V43 A;  4I65 A;  4RCN A;  3BVZ A;  3MVV A;  2F3W A;  2FFK B;  2WB1 B;  1EY7 A;  4HN7 A;  2F0D A;  3P20 A;  2AQ2 B;  3MXN A;  4HTH A;  1S5E D;  3KLS X;  3HZX A;  5DEH A;  1TR5 A;  5T1I A;  1SYB A;  2PO4 A;  1FGB D;  1XTC D;  3P7J A;  3I70 A;  2IWH A;  1CHQ D;  1EEF D;  3TZD A;  3QOL A;  3GQB A;  2VB3 X;  4F88 A;  1PFM A;  4DF7 A;  2CW0 C;  4KKT A;  3R3O A;  3D4D A;  1DM0 B;  5EKK A;  5E3F A;  4YIJ A;  3KLR A;  4C1N I;  4EQN A;  2FJ2 A;  5I6W A;  1ROD A;  3IKJ A;  4A3J B;  2E74 C;  4IZ8 A;  5JJZ A;  3K6O A;  4A3I B;  4G57 A;  3WDN A;  1VF5 C;  4UDU C;  1CZW A;  4QF4 A;  5JOB A;  5C3E B;  1BXT A;  1G29 1;  2TMP A;  1JOQ A;  1STG A;  1SSO A;  1GUW A;  5JEA J;  1V1P A;  2RA4 A;  1ILQ A;  1BR9 A;  1O78 A;  2AQ1 B;  2ZT9 C;  3H94 A;  3P75 A;  3M4O B;  3H09 A;  1QG7 A;  3MA2 B;  4O42 A;  4CKC A;  3S1Q B;  2E76 C;  3PUX A;  3GTQ B;  4DXG A;  4FXD A;  2G9D A;  2KQ3 A;  4XYO A;  5IIF A;  3A8I E;  3RZD B;  3BYY B;  2L1B A;  5CV4 A;  1SE2 A;  3DUZ A;  1JE4 A;  2F0H A;  5I9P A;  1BDO A;  4L63 B;  1LO5 D;  1S5D D;  2L0C A;  1EZ6 A;  1S5B D;  3JAM L;  2B2Y A;  4KJN A;  3ERO A;  3EFX D;  4H0L C;  1GUS A;  2HCC A;  3OPO A;  1SE3 A;  5KYL A;  5EPL A;  3CRK C;  2M00 A;  4RH6 A;  5KYI A;  3QJY A;  3SEB A;  1VMC A;  2JEB I;  1FNV A;  1A2U A;  1EEI D;  3NP8 A;  2XRQ D;  3H91 A;  1K83 B;  3FVQ A;  2B2W C;  2MHV A;  2RKS A;  1SYC A;  4KY6 A;  1I4G A;  1DON A;  5I6Y A;  2NN6 G;  2WV6 D;  1V1P B;  3GP7 A;  4CJ1 B;  3NQT A;  3MXU A;  4FYD A;  1B9N A;  4H44 C;  4PV1 C;  2NBF A;  3V96 A;  1A2T A;  4CBV A;  4FO2 A;  1SFO B;  2WIN B;  3D4R A;  2DY8 A;  3S14 B;  2X6G A;  4Q5V A;  5ELB A;  1TS4 A;  2EE1 A;  3MXG A;  4U67 3;  1H9S B;  5EQ0 A;  1OXU A;  1MGS A;  1G6Z A;  1DXM A;  3SK5 A;  1PTO D;  1PDQ A;  2VNU D;  1JCK B;  4MIU A;  3TP8 A;  3M7N A;  1O7Y A;  2F0S A;  5EGT A;  2IX1 A;  3S15 B;  5DAU A;  1BNZ A;  2XRS D;  5FO8 B;  4IFD G;  1CM9 A;  2F0F A;  3D3R A;  5C5M A;  2B2U A;  3TP7 A;  5IGF A;  3RMH A;  4KJO A;  1GUN A;  2F0K A;  3MZ5 A;  4K6D A;  2VXW A;  5IGG A;  4JK1 C;  1YNN D;  2FMC A;  1LT3 D;  1SJH D;  3KBX A;  1PTO C;  2EYJ A;  3J7A F;  4ID6 A;  1R4Q B;  5JVG 3;  2AUJ D;  5C0X H;  1E2Z A;  1S5F D;  4BA2 I;  1QB5 D;  4A3K B;  4N9P A;  2QKI C;  1HQM C;  4CKB A;  1RHP A;  4XT1 B;  3J7A V;  1ONL A;  3PUV A;  1K8M A;  3FPU B;  4IN3 A;  2F0V A;  1QE6 A;  2O4X A;  1WTV A;  1DZ1 A;  1YNN C;  1B1Z A;  4NDX A;  1STA A;  2AUK A;  3CKI B;  2M9V A;  1G91 A;  4KD4 A;  4A3E B;  3L7Z C;  4C3I B;  2IW3 A;  2VB2 X;  3X3N A;  5DNF A;  2XVS A;  1Y8P B;  5EJW A;  2EJM A;  3A56 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...