4IALA

Crystal structure of staphylococcal nuclease variant delta+phs h121e at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTEEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS H121E at cryogenic temperature
rcsb
molecule keywords Thermonuclease
molecule tags Hydrolase
source organism Staphylococcus aureus
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2012-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4ialA00
4KY5A 1EY6A 3MEHA 3MVVA 4J1MA 4LAAA 2EYJA 4KJNA 5IOCA 2F0QA 1SYFA 4J6HA 5IODA 2EYOA 2F0PA 3EROA 3NQTA 3EVQA 4KV6A 2EYMA 1EY4A 4PNYA 5CV4A 2O4XA 3P1HA 3TMEA 5CC4A 2ENBA 3MHBA 4K6DA 5EGTA 3OSOA 4DGZA 3NP8A 1SNOA 1SNDA 1U9RA 2NUCA 4WORA 1SNQA 4HMIA 1KAAA 2HQEA 2F0GA 4NP5A 4ZQ3A 4IUNA 3SK5A 3MXPA 4IALA 5CV5A 1EY5A 2F0VA 3DHQA 2OEOA 4PMBA 3SK6A 3TP5A 4NDXA 5IGCA 4ME5A 3RUZA 1A3VA 2PZUA 3QOLA 2F0JA 1SNCA 1EZ6A 2F0SA 3E5SA 4KD4A 4YIJA 3SR1A 4DF7A 4K8IA 2F0MA 1A2TA 4K5WA 4MIUA 3R3OA 5C3XA 2EYLA 2F3VA 3H6MA 5CV7A 4K14A 2EY5A 5CV6A 1ENCA 4NKLA 5C6AA 3EJIA 5IIFA 1STBA 1SYCA 3OMCA 3VA5A 5CGKA 2PW7A 5J22A 5JAVA 4IZ8A 2F0OA 3QB3A 4EQNA 1EY8A 5IGBA 1SNMA 4EQOA 2F0TA 3C1EA 3TP7A 2F0EA 4F7XA 1IHZA 5ISRA 5IGGA 2OF1A 5KEEA 3LX0A 3T16A 2PQEA 1AEXA 3NK9A 5C4ZA 1STAA 2EXZA 4S3SA 4EVOA 4QF4A 5KIXA 1NUCA 1F2MA 4K2LA 3HZXA 5I6YA 5I9PA 5KGUA 5C5LA 5KYIA 4N9PA 4K5XA 3PMFA 5I9OA 3BDLA 1SYDA 5IGFA 4KY7A 4K5VA 5J39A 2F0HA 3MZ5A 1STGA 5C5MA 2PZWA 5E3FA 3NHHA 1EY0A 1JOOA 1JORA 4R8NA 5CV8A 1TQOA 1F2ZA 1KABA 1SYEA 3QOJA 2F0WA 5NUCA 1KDBA 5IGDA 4KD3A 3OWFA 1JOKA 4G57A 2RBMA 5M9OA 3NUCA 1KDAA 2QDBA 3C1FA 2EY2A 3OMGA 4HMJA 4OL7A 2SNSA 3D4DA 2PZTA 5C4HA 4RKBA 4PMCA 4DU9A 4WRDA 2EYHA 3P75A 3TP6A 1EQVA 3V2TA 4ID6A 5F2DA 4K2KA 4E6IA 2OXPA 3ERQA 2F0KA 2LKVA 2F0DA 1SYBA 2F0LA 4B9XA 3S9WA 1SYGA 2RKSA 3D8GA 5J1ZA 2KHSA 3DMUA 5KYLA 3HEJA 3D4WA 5IGEA 1STNA 4ODGA 5I6WA 1RKNA 2EYFA 5CV9A 4NMZA 2PYKA 5C3WA 2WACA 4EQPA 4I65A 2SNMA 1KDCA 4KHVA 4KTAA 4ZUIA 2F0IA 2RDFA 1ENAA 1TT2A 2F0FA 1EZ8A 1STYA 5JOBA 4RKLA 2F3WA 5KRUA 5DAUA 3SK4A 5HGTA 4KY6A 2EY6A 1II3A 5HURA 2KQ3A 1F2YA 3TP8A 4N9TA 3ITPA 4HTHA 3NXWA 3SK8A 2F0UA 4DFAA 4B9WA 1STHA 1A3UA 3BDCA 5K5PA 4F8MA 1EYCA 1EYAA 3D6CA 4QMGA 5EKKA 4KJOA 2F0NA 3SHLA 1EY7A 1EY9A 4H7BA 4QB4A 4TRDA 5CR3A 2EY1A 5DEHA 1TR5A 2M00A 1A2UA 3T13A 2EYPA 3U9OA 1JOQA 5E1FA 1SNPA 2SOBA 1NSNS 2PW5A 4K8JA 5EKLA 4ZUJA 3SXHA 1EYDA 1A3TA
chains in the Genus database with same CATH superfamily
4FF1A 3MVVA 2HCIA 1QJOA 2ALYB 4M1UB 4DV4L 3UDIA 2EYOA 1CKNB 2ZXOA 3ND9A 4DNTB 1TWFB 1LTAD 2RF4A 4OO1I 4PNYA 2NTSA 2B2VA 2ENBA 2A74C 1AE3A 1E1TA 3EA6A 4A3CG 1C9OA 1HNXL 1PFMA 2N88A 1PH5A 2K03A 1EY5A 2G5DA 2BA0A 3N6RA 1JC7A 3K59A 3I4NH 3P20A 1WTWA 5C3XA 3D0FA 2HHHQ 4LF7L 2J7ZA 4K14A 4HCSA 1ENCA 1Q82C 1X54A 5DNFA 4IZ8A 1PFBA 1I50B 1YNJD 1O7ZA 2JA7G 1OO9B 3UI2A 2F0EA 4A3KB 4X3KA 1SFOB 1PH4A 1I3QB 4A3EB 4DK1A 4EVOA 1KTKA 3CRLC 4QUCA 2B2WA 3HP3A 4WJWA 4GLXA 1Y8OB 3MEFA 1I6HB 2NN6I 3D6WA 4A75A 4XQQA 2AKWB 2PCFB 4DAYB 1SMYC 3DXJC 4OL7A 4DV6L 4DAVA 3MTSA 4DR2L 1EQVA 2PI2E 5F2DA 2UXBQ 2CWAA 2MJ8A 3NWTA 4OELB 1U4MA 2Q8TA 4JYAQ 2KCTA 1R9TB 2E2IH 2NYZD 2V1CC 5C3EH 2WKCA 1BUVT 3VR2A 3A54A 2ICEC 4JI1Q 1EIYB 1QOHA 2F0IA 4QCLA 4LF5Q 1K0SA 2UUAQ 4GN4B 2VUMH 1NR4A 4LK1C 5KNCA 3J7A5 4K0KL 2EJMA 2D5DA 2EJFC 2RCFA 1ONLA 4DFAA 5K36H 1SDFA 3KBGA 3TZDA 2M9VA 2B2TA 3H3VI 1HZBA 5EKKA 5AJ3L 2WAQB 1XWEA 4NXMQ 1ESRA 3W1BA 2IY5B 1QNKA 1K3RA 1S5ED 3K7AB 1WFQA 1WTRA 3LWEA 4LF4L 1PTOB 2EYJA 4MZ9A 1VQDA 1Q90A 2I07B 1ZEQX 1ENFA 2KCNA 1T9HA 3TMEA 4CKEA 3AYHB 1E7ZA 3MHBA 1E0BA 4XXEA 3G4SA 1MI2A 5M3FB 2Q2TA 2B63H 1MJEA 4NXNQ 3STBC 4RGOS 1BCPF 4IALA 3EIVA 3J80L 3TN2A 1NE3A 3I91A 5C4XH 5GAHC 4NW2A 1MSHA 2H4OA 4B3RQ 3PIOA 1A2TA 4MIUA 3NEMA 5C44H 1STBA 5J22A 1RTNA 3HOWH 3TZUA 4EQNA 3IFTA 1PRTC 1JE4A 3B6YA 1XMQL 3C1EA 3TP7A 4JW0A 3NSWA 3X3NA 1VQIA 2VUMG 5C0XH 4B08A 5KYIA 2MO1A 1VQ5A 3KDFA 3K58A 5K36G 5IGFA 2LXKA 5LMUQ 3HOZB 5EBDA 3NHHA 1B2TA 5FJ8H 2ES2A 3OW7A 1WOCA 1WCMH 3A0JA 3NENA 5I4DA 4B3TQ 3KF6A 1KDAA 3G6JB 3SE0A 1FL0A 1KAWA 2QF7A 1SJED 3M9BA 1SXTA 4DV5Q 1SR3A 2F0KA 5JJZA 3A5ZB 1Y1VH 4JVZA 4CKCA 5FLMH 1G2TA 3FPPA 2B63G 3T51B 2EIFA 1E24A 3S14H 2D62A 1I94Q 4AH6A 2ATWA 1DOLA 4GN3B 1R4QB 3F2DA 3CC4A 2K05A 3S1MH 1BF4A 4BBRB 3OWEB 5C4XG 3TS2A 4KY6A 5HURA 1LTGD 3I8ZA 3TP8A 3E3XA 1YJWA 5C44G 5GROA 3HOWG 3H94A 2K5QA 2JEBI 4ZKCB 5CR3A 2E2JH 3T13A 1N36Q 3CPFA 5EKIA 1CKMA 1GXDC 3S1NH 5C0XG 3GTOB 1D6EC 1ZXTA 2JN4A 2KCCA 4GNXC 4RGTA 4KV6A 4RHRA 3MFGA 5FJ8G 4DXGA 1WTQA 1WCMG 2QDLA 2AQ2B 3CAMA 2K33A 4DKAC 4HMIA 1CA5A 5JJKA 2L4NA 5CV5A 3DHQA 4EX5A 3I4LA 4DV2L 1U5KA 2DNEA 1NMGA 4TVAB 1Y1VG 2RHSB 5FLMG 4MNOA 1XX8A 1Q46A 1ASZA 1S4ZA 4APVA 3RZDH 1HNZQ 2I46A 4JBWA 2WFWA 4EQOA 1EFWA 3ULLA 1PH1A 3S16B 2IX0A 4LF9Q 1JQYD 1AEXA 3A8KE 2QW7A 4CBVA 1I6VC 4KHPL 5J39A 2Z9HA 3IFDA 4KN7C 1MJCA 1V1OA 2UUBQ 1HZAA 1LUZA 5ELCA 1SYEA 4C1NI 2F1MA 3EN2A 3GQBA 1YHAA 5IGDA 1UE6A 1Q1EA 1TWHB 1UAPA 1H9RA 3PQIA 4QGUA 3UE0A 3K0YA 5A35A 2EYHA 4DV0L 1U0LA 3VYUA 1V8QA 4B3SL 1EWHA 4C2MH 4ZRZA 4HCEA 1IBML 3CMEA 2NVYH 1PTOD 2EOTA 2XNAC 3T1HL 1IL2A 2N55A 5FLXL 2JA6G 5I2YA 4KTAA 3S2HB 3PUXA 4FDBA 2Q2HA 4XT1B 2NVXH 3GTKH 2FHTA 1KIXA 2BDOA 3O13A 5JEAJ 1KRTA 5JEAH 3N52A 1BCPC 1KNEA 1IYVA 2H5XA 3M3YH 2WP8J 4F87A 4QB4A 4HJ9A 5IP9H 2M00A 3I7FA 1OXTA 1TXYA 2R7FA 4CKBA 4KHZA 1PA6A 3SXHA 2A6HC 5M5YH 1AE2A 3FKIB 1I4RA 2VUMB 4DR7L 1DGSA 4A3FB 1TS5A 4LF6Q 3PO2H 1LABA 3DLLA 1BKBA 4MN3A 2IW3A 3GTLH 4NP5A 1VQKA 1B53A 5IGCA 4XDXA 1SNCA 1B7YB 3U4VA 4KK7A 4DAMA 4LFBQ 5BN5A 5CYUA 5KNDA 1YNJC 5IGBA 1L1OA 4ABNA 1HFGA 3S1RB 1PFSA 1B9NA 2UXCQ 3T16A 3HOXB 2QGQA 1DD2A 2ZTEA 4QF4A 1I3QH 4A3EH 2OWOA 4C56C 1B9MA 1QCBD 4IN3A 3K5OA 4L5QA 3SGIA 3M85A 2OTJA 3WOEA 3F1ZA 1PDQA 1SYDA 5C4XB 4FF2A 2Z4IA 1I6HH 4IUUA 5CBAE 3M4QA 2GA4B 5C44B 4Y7NH 3HOWB 1LACA 1JCKB 2QDBA 5IWAL 4HJ7A 2MGSA 4G7HC 4GZYC 4PMCA 2UUCL 2YU9B 4DAYA 3ER0A 3KDFB 1G51A 2NB0A 4DV1L 3G7LA 1SYBA 2F0LA 3SVMA 4X64Q 1KL9A 5ELOA 5C0XI 1V1PB 3PO2G 1R9TH 4QY7A 1VDZA 3D31A 2J0TD 4NMZA 3KF6B 2XIWA 4OONA 1WCMB 4X62Q 1TT2A 1JJ2A 1XNRQ 2QCPX 1JR0D 1LT3D 2D0PA 3A8JE 4HEDA 1XJVA 2PMZE 1IBKL 4GKKQ 5DM73 3CCRA 4A3GH 4OWTB 2PNHA 4F8MA 3CMAA 4IOAA 1WD0A 1ILPA 3LWUA 1CUKA 1S5CD 1A2UA 2JJQA 3CXCA 4UY8C 1SNPA 1PZID 2YYZA 4ZUJA 2K01A 4A3EG 4LAAA 2NTTA 1QZHA 5T1IA 4LF8L 4ZLTF 3K7AH 2F0QA 3JAMc 3NWSA 1VQBA 4L5TA 3RLNA 1EOTA 3L2PA 1XXGA 4X65L 1O78A 5IYBH 2E2JB 5M3FH 2FMCA 3SK5A 4DV3L 1RIPA 4YCUA 1CA6A 3CQZB 3R2TA 4ME5A 1BNZA 1IBLL 1N34Q 1GHKA 1G6PA 3OIQA 4WJ4A 4NKLA 1KC8C 1PHJA 4R8IA 3EBEA 5E4WC 1DM0B 2GVAA 2GN5A 3I4OA 3VYTA 1NNXA 2C35B 3AQQA 2ZM6L 4DUYQ 1O80A 5D3IB 5ISRA 2FXQA 2L9HA 1SBBB 2JA6B 1FR3A 2L0CA 4AYBE 4A3GG 1W6JA 1WYDA 5JVH3 3W3AA 1JICA 1JWUD 1I4GA 1S5BD 5CV8A 2ASBA 2AUKA 2Z6KC 3GO5A 4R1JA 4RHSA 2WAQG 1EU4A 3CC2A 4H44C 2SNSA 3K6OA 1BOSA 2RVLA 4FXKC 4GOPC 2Q2IA 4ZYSA 3J80c 4B3MQ 1EWCA 1BR9A 4JK1C 1N32L 3HKZE 5KYLA 4J8QA 2OT2A 3K7UC 5IYBG 1AW7A 5CV9A 3GTQH 4KLKA 2VQFL 1FNUA 5M3FG 4KHVA 4ZUIA 1NAPA 2WB1E 2IWHA 4GKJL 4RH6A 5H1SE 2RCNA 1YZ6A 1SROA 1C8CA 4IUTA 4O0AA 4BBRH 2R92H 1U4RA 3ITPA 1WTXA 1A63A 1WTVA 1E2VA 4HN7A 2AWNA 1LTSD 4C2MB 1JOQA 2KBNA 2NVYB 2HIXA 1TWGH 3CRKC 4DV4Q 3UDXA 3M4PA 2NVXB 3GTKB 3OOCA 4YY3L 3GTOH 3KUPA 1QVCA 3BYYB 2K5NA 2E2HH 2ZJPA 5JVG3 1IZ6A 1DJRD 1SLJA 4HIKA 1HNXQ 3NP8A 3M3YB 2RA4A 1DZ1A 5GAEC 1SSOA 3BZCA 1XPUA 1GVPA 1Z6HA 3BDOA 3NE5B 2PI2A 4LF7Q 3SR1A 3S1QH 2B3GA 1QUQB 2RSNA 2DGYA 5CV7A 2V4DA 1ASYA 4YWKA 1KD1C 3J7AV 5JAVA 2KECA 2ZTCA 1VQ9A 1EY8A 3PO2B 3R93A 2DJFC 3UDGA 4JI6L 2UXDL 2A6ED 2Z6BA 3CU7A 3C2PA 3GTLB 3S16H 4S3SA 1NUCA 3TBIB 3RN5A 4BBRG 3J81L 2R92G 4K5VA 2LSSA 1STGA 2XTIA 3ICEA 4DPGA 4KKSA 1VQJA 1L1OB 5NUCA 4DV6Q 3H3VC 3LGJA 3X3MA 4DR2Q 1EQRA 1CFMA 4A3LH 1TWHH 3IL8A 2EQSA 4E6IA 4FF4A 2BDNA 5M5XH 4GLAC 3GD7A 5FK9C 3FP9A 5LHY1 4JG2A 1QG7A 1VQGA 4YWMA 1TIID 3ZYYX 5IYDH 2AUJD 4YWLA 4FXDA 4NB3A 1K83H 2K7VA 4H0LC 4Y7NB 3MWYW 3NPPA 4DV7L 3S2HH 4OX9L 4K0KQ 1F9RA 5DAUA 2LFNA 1QE6A 4N8X1 3HOYB 4TSSA 2G9HD 4XYQA 5AJ3Q 4B9WA 4GNXA 2B2YC 4UDUC 5A2QE 2JA9A 3K0XA 1D1KA 3GTPH 2I5HA 1YJNA 4ULLA 4LF4Q 2K52A 3A7AB 3NTHA 4J6HA 2CCZA 1N33L 4RWSC 2JEAI 1F9PA 2BE5D 2X6LA 4LUVA 4OWWB 3FKIH 3OW2A 4YHHL 1X55A 2F4VL 2WINB 4A3GB 1H9MA 4K6LA 2E2DC 4A3FH 4EGVA 1SNOA 1WJJA 1NY4A 2KHJA 4A3LG 5FLXc 4ZK9B 5G3LD 3TP5A 1KNAA 2XWBB 4JI5L 1RD9D 1RHPA 2Z1CA 1UE7A 5IYDG 5IIFA 3VA7A 1VMCA 1E22A 1K28A 1G2SA 4BWGB 1XMQQ 4JI3L 3IAYA 1EFID 3BS1A 1M1KC 4JPBW 2I5LX 1SN8A 2OF1A 4DR6L 2PQEA 3GV3A 3S1RH 1CTMA 3BVMA 3HOXH 2AQ1B 4FF3A 2K32A 2R7DA 4MTKA 5IT9c 4DXFA 1J6QA 2Y0SB 3WDNA 1N8RC 2CQAA 1JORA 2AMCB 4FNFA 3QOJA 4BS9A 2YTXA 2OQ0A 1KDBA 3PF4A 4G7OC 4ZCKA 2K5WA 2K5VA 1HCZA 3D4DA 5ELNA 2JQOA 4Q0FA 3TP6A 5A2QL 4K2KA 3KK7A 5C0XJ 3G71A 5LL6X 5DM63 2YU9H 4HSPA 3FKIG 3S9WA 1CZGA 2R6GA 3D8GA 1X6OA 1DOKA 1MKHA 4A3FG 1UNSA 1PV4A 1RKNA 4DNRB 2X6GA 3CCMA 3BZDB 2FINB 1JWMD 1HR0L 1VQNA 2VNUD 5C3WA 5D3DA 3Q22A 1ZYRD 4EQPA 1V1PA 1XMOL 4A76A 4LWCA 1KQSA 2F3WA 1G8ZD 5KRUA 1EL0A 2DN8A 1C48A 1TWCH 1R4PB 3DEPA 5KNBA 4BBSG 5EJWA 2DY8A 4JOIC 3K80C 5K5PA 1K8MA 4KI0A 4A3IH 2KHIA 2EY1A 2B8FA 1PH9A 3GTQB 4L5SA 2L55A 1EWIA 4AIMA 4QIWE 4MHEA 3HOXG 1HPCA 1MD2D 1IW7C 2WV6D 4XQNA 2A1AA 1T5XD 3VR3A 4UP7A 2EE1A 2R92B 3DEOA 1JT8A 4L63B 3OSOA 1VQ8A 2NUCA 4IPDA 4PQXA 4WORA 2CW0D 2DJGC 2HQEA 2L1BA 3F2CA 4DV2Q 3OTOQ 1KXLA 1SE4A 1TWGB 2YV5A 2JK8A 4KD4A 2E75C 3A8IE 3CQZH 3KOJA 3PV0A 1HA5A 1YBYA 1E1OA 1W6KA 2PW7A 2A68D 3QG1A 2AQ3B 4DAPA 2E2HB 2TMPA 2WIIB 2XRQD 4RG1A 3PIP3 3M4YA 1SNMA 5HGQA 2F0TA 2E76C 1HR0W 4FYDA 2D9UA 1L0WA 1BO0A 3CCEA 1PRTB 3NELA 4JI2L 1BDOA 1GUOA 3IKJA 5C4JH 1J8IA 2ZXRA 1VQ6A 4KHPQ 2D2CC 5COYA 4ZKBB 2JA6H 2QEJC 3OTOL 1Y1WB 3S1QB 2K14A 3Q23A 4A3IG 1YNNC 1J5EL 1E2WA 4JI8L 4R4OA 4POGA 4FVMA 1LTRD 2FJ2A 3KLSX 1JOKA 2K28A 3NUCA 1E3PA 4JI4L 3PUVA 2NZOA 4DV0Q 1Q3LA 4DU9A 4LFAL 2IPKD 4IURA 1GUSA 4B3SQ 2F0DA 3CHBD 5T1GA 1IBMQ 2AWOA 5J1ZA 1FYCA 3Q6SA 3T1HQ 3M7GA 4JI7L 3MXGA 2PYKA 4HJ8A 3U4ZA 1S5FD 1KDCA 4G4KA 4FP5D 4CJ0B 3T56B 1QWYA 3ERSX 2A8VA 1DCZA 1BQQT 2P5ZX 2ZJQA 1FJGL 2EY6A 1S72A 4Q5VA 3BVGA 5M5XB 1XPRA 1A3UA 1B1ZA 4A3JH 2BOSA 2N49A 1Q8IA 1L2FA 3E9HA 2KA7A 2R3ZA 4CDFC 5EPLA 1GUWA 3U9OA 1AP0A 1IYUA 1K83B 4I7ZC 2L12A 4IQZA 4C1NK 1X56A 1MBYA 2LXJA 1EY6A 4C3HH 5IP7H 2UU9L 2PO4A 1Q86C 1CSPA 1LT5D 2MFIA 2E5LL 4DR7Q 1B70B 2EYMA 1CKOA 4GNXB 1IXRA 3I70A 4A3MB 3OIPA 4DGZA 1YEZA 1S40A 4BY7B 2DY7A 4PV1C 5EAYA 1JB7A 3I72A 4ZQ3A 4LFCL 3MXPA 4V190 1EUJA 1YHBA 2JYOA 3GTPB 4A3BH 2HD3A 4JCVE 1XNQL 4DF7A 4P72A 1A6XA 4UPAA 3H0GB 2CFMA 1EQTA 2ICIA 3R3OA 4HJAA 4TQUS 4UHVA 1Y69U 2CVRA 3GTJH 1EEFD 1PYWD 4DUZL 1VS0A 1JWSD 1QUQA 3OYYA 3CPWA 1UEAB 1FGUA 2A6EC 2Z6KA 4HIDA 2RQXA 5JJIA 1E2ZA 1I4QA 1EQQA 2XGTA 1JB3A 1PXUA 4HJ5A 4K5XA 2LMCB 1X3FA 1EIGA 4A3JG 1HZCA 4KN4C 4TKOB 2O5JC 4L8JA 4BBSB 4PZ7A 4HIMA 5IWAQ 2CH4A 1YHQA 4V0BA 1CSQA 2ZXPA 4IUVA 4AQYL 2UUCQ 4C3HG 5IP7G 4DV1Q 1I4PA 3HOVH 1D5XC 1DXMA 2VXWA 4WJ3M 2IHFA 4C3JB 4IFDJ 5IY0A 1OTCA 4N8FA 1LO5D 4IFDH 3PCOB 1SE8A 4IPGA 1X3EA 5LMNL 4I65A 5IYCH 3QJYA 4DR5L 1Q7YC 1ENAA 2VB3X 2VW9A 4A3BG 3PO3B 2QEXA 2JP1A 1IBKQ 2NVTH 1Z9FA 1U4LA 1VQOA 1LTID 5FKAC 3J81c 3HOYH 4GS3A 1EYCA 1BVSA 4JBMA 1F9QA 1EY7A 3D4RA 1BCPB 4H7BA 5DEHA 3HS0C 3T53B 3R8BA 1K73C 1GOZA 3K8AA 5E1FA 2VS1A 3K5MA 3L0OA 1H9KA 4LF8Q 2IX1A 3AU7A 1STEA 1B50A 1K8GA 4YCVA 3NBHA 1HQRD 3T1YL 1KLGD 1TWCB 4X65Q 1PRTD 3GV6A 2A69D 3H15A 3MXUA 1D7QA 5JPNC 1LT4D 4A3IB 4DV3Q 1KAAA 4DR3L 3JC66 3VYSA 1WTHA 3UDFA 2F0VA 3HOVG 1SE3A 1GUNA 4NDXA 3K81C 1IBLQ 2DNCA 3QOLA 1EZ6A 2F0SA 1ICWA 4YIJA 3ZJYC 1VQAA 5DLQE 4K8IA 1QVGA 4IFDG 3H6MA 1MIUA 4RMFA 3A7LA 4DR4L 1SYCA 5CGKA 1GKHA 2ZM6Q 4X66L 5IYCG 1TWAB 5M3MG 2VQEL 1Q8KA 5M5WH 4QL5A 2EZVA 1PH2A 1F2MA 5I6YA 3HRZC 5I9PA 5KGUA 1T5EA 5ELEA 4A3DB 3HOYG 3D3RA 1L0XB 3VR5A 1X3QA 1NTGA 1JOOA 1K8OA 1KABA 4DN4M 3PUWA 3GP7A 2RBMA 1I4HA 2KJXA 4AYBG 3V2TA 4RCOA 3CP0A 5C4JB 1N32Q 3PSIA 1SYGA 4HIOA 1CT1D 4OXPA 1Q81C 4BY1G 1D5MC 2VQFQ 4A93B 1ET9A 1Z7TA 3TSSA 3CCSA 1RODA 1HNWL 1ZYRC 3I90A 1QZGA 1EIFA 4GKJQ 2RDFA 4OGQC 5EPJA 2NVQB 2JXMB 4JV5L 4PG3A 3V05A 4BA1I 4XQJA 3AMUA 1GHJA 4R4CA 4PZ8A 2HDLA 3G6EA 4BA2I 3FVQA 3KFUA 3A55A 4QQBX 2C9OA 1SEBD 2WB1G 4DNIA 1YITA 2PW5A 1ILQA 1EIHA 5EPKA 4KY5A 5JPMC 4YY3Q 3G48A 2N78A 3EROA 1Y8NB 3CKIB 3I73A 2Z8LA 3GTGB 3DM1A 3QO2A 2PQAB 1I5FA 2Y0SG 3W5OA 2WAQE 3DWQA 4A3JB 1HUNA 2IL8A 1VMPA 3W1GA 4OWXB 3KLSA 4XIGS 3MAQA 2OEOA 2HIVA 4C3IH 4R4QA 1IL8A 1K9MC 1PFNA 2LY7A 2MHVA 4C3HB 4JI0L 2G9DA 1PZJD 2EDGA 1NCVA 1A0IA 1HFNA 3EJIA 3VA5A 2A68C 3TEHB 1NMFA 4IO9A 4JI6Q 3MFYA 2UXDQ 3S2DH 1NBWA 1P8LA 1HJPA 3QR8A 1QVFA 3LX0A 3Q24A 2EXZA 2YTVA 3FDTA 1UE1A 3RLOA 5TSSA 3FMCA 4A3BB 3L9AX 2I0QA 1AFPA 1PZKD 4LUOA 1LTBD 1SMXA 3C3LA 4U673 1F9SA 2CH4W 3FRPB 1TS3A 2C5CA 1Y1WH 5BR8L 3GTJB 2JA5H 4P73A 3OMGA 1C4QA 5HY6A 4RKBA 1HXYD 1EU3A 5D14A 3P75A 1X32A 1NR2A 1BCPD 1LT6D 1A62A 3JAME 4UAIA 4GOPB 3FHWA 2SEBD 2PMZB 3QIAA 4X6AH 3HEJA 3K5NA 2N8NA 4ODGA 2EVBA 3Q8DA 3DM3A 2EYFA 2ID0A 4YCWA 1D2BA 2A6HD 2K4KA 5FO7B 1J9OA 3F8TA 1DOMA 4DV7Q 4OX9Q 4C3IG 3SDZA 1PH7A 5L37A 3RN2A 3U9SA 3HOVB 3HFZB 2KQ3A 1F2YA 4HTHA 3SK8A 3DWPA 2RDHA 4BXXH 2B2UC 3BDCA 4XTCS 4DR1L 3D6CA 4OHJA 3NBIA 3SHLA 1B3QA 3PF5A 5CORA 5I9OA 1AN8A 4LW1A 2HUGA 4IFDI 2SOBA 1NSNS 3F2UA 1PTOC 3JAMi 1TKWB 1N33Q 4O2DA 5M3MB 2PNRC 4R9WA 4YHHQ 4X3UA 5GQOA 2F4VQ 3TDQA 2NVTB 5CV4A 3M4OB 2O4XA 4X3TA 3ULJA 3KJPA 2DUDA 1Y1WG 5EGTA 4OEMB 3BU2A 4A3MH 2O5IC 4ZAIA 1SNDA 2JA5G 4HR7B 2H1EA 1L0YB 2CKZB 2CWPA 4IUNA 1WTPA 3J7ZC 3CCJA 4BY7H 3A56A 4CJ1B 1FNWA 2X69A 1O7LA 4JI5Q 3FEWX 3NBHB 3J80E 3HOUH 1A3VA 1YVCA 1H9SB 1WTOA 3I56A 2YTYA 4AYBB 1A8VA 4JBKA 2BA1A 5GADC 2HHHL 4JI3Q 3H0GH 3KYHC 3SEBA 3I4MB 2F0OA 1A15A 3JAML 1PLFA 4BY1B 4DR6Q 2IJ0A 3A5UA 4L5RC 4LMQD 1X3GA 2Z0SA 2MQHA 1PH8A 2LS01 1STAA 4N9PA 4BXXG 2IHEA 3MXNA 2Q8IB 2KCMA 4DK6C 5JJLA 3R2IA 3HKZB 1TQOA 1F2ZA 1N9WA 4RAUC 1VQCA 4BBSH 3I4NG 3J80i 4POFA 2WB1B 3S17B 3E0JA 1K8AC 1HTLD 4O1NA 5BN4A 3PIO3 5M5WB 3RZOH 2JSOA 1HUMA 4RGMA 1XYIA 2UXBL 1IKMA 4JYAL 2RKSA 4C3JH 1VQ7A 1HR0Q 1STNA 3PGZA 5I6WA 4A3MG 4IJLA 2HT1A 1G291 1G6ZA 1HH2P 1XMOQ 2JA8H 2K50A 4QJFA 4ALPA 2XN9C 4BY7G 2B39A 1VQPA 4JI1L 2NZHA 4FXGC 4RKLA 3HOUG 4LF5L 4O42A 2UUAL 2RSOA 3QWNA 1XTDA 3PO3H 1GD7A 4U68A 3H0GG 1EYAA 1Q12A 4QMGA 4KJOA 1EY9A 2K5DA 1VCIA 1BBUA 3CCVA 3DUZA 4NXML 1AZQA 5J3BA 1AH9A 1HTPA 3L3OC 3U58A 1MHWC 5C3EG 1RCVD 3M7NA 1SYFA 1G91A 3E6ZX 1X3PA 3NQTA 1LYLA 3EVQA 3OPOA 4P74A 2CHBD 2WKDA 4QUFA 2A69C 2E74C 3HKSA 4IOCA 3WOFA 1VQLA 3AFQA 1QILA 1M8AA 2MP1A 4NXNL 1MGSA 2B2VC 5M9OA 3E5SA 2L15A 2I5MX 4IPHA 4C3JG 4K5WA 1Y14B 4B3RL 4FO2A 1ESFA 5LL6S 4M8AA 2KUMA 3OMCA 2R7ZH 2K75A 3CCUA 1PVOA 1FGBD 2JA8G 3U50C 1LTLA 2QILA 3PUZA 1DONA 2KOLA 3S15H 4JI2Q 1M90C 2A73B 1TWAH 2NBFA 5GAGC 5KIXA 4K2LA 4XYOA 1M4VA 5C5LA 3DWAA 3TREA 4C3IB 3PO3G 3PMFA 1EEID 3KF8A 1GUGA 1J5EQ 4A3DH 4JI8Q 5E7NA 5CBEE 1JJCB 4HSVA 5LMUL 2R93H 4JI4Q 5ELFA 4LUZA 3C1FA 3MC0B 3EFXD 4B3TL 4HMJA 4LFAQ 3S2DB 1D5ZC 2B2WC 5IE8A 2Q2UA 2OTLA 1SAPA 3J7AF 1ML0D 3CC7A 4OIJA 4I7AA 4DV5L 2M2LA 3V96A 4Y52H 3DMUA 4JI7Q 5IGEA 4DK3C 2MNAA 2JA7B 1RTOA 3KLRA 4A93H 2WACA 3H09A 2SNMA 5G3LF 3RLFA 1CZWA 2JA5B 1I94L 3L7ZC 5FLXE 4NPSA 4P2CB 1EZ8A 5JOBA 3KJOA 1FJGQ 5I2XA 2NVQH 1HZ9A 2PPBC 1TVXA 4CJ2C 2R7ZG 2B8GA 5ELDA 1TY2A 2SDFA 3PIPA 3E0EA 1UUPA 1N36L 2UU9Q 1EYDA 2E5LQ 5IODA 2B2TC 3GTMH 4CDCC 4A3DG 1EY4A 5IT9E 1VQFA 2FFKB 5CC4A 2D0OA 3GTGH 1CQFA 2R93G 1IKLA 1F77A 1U9RA 4LFCQ 1H9JA 1SNQA 3NTKA 1LLRD 1BBWA 2F0GA 3T4AC 2PQAA 1HA6A 4PMWA 1XNQQ 1FD7D 3SK6A 3I4NB 3RUZA 1BXTA 2F0JA 2K6AA 2F0MA 4LJZC 2F3VA 1JE5A 4UP8A 5CV6A 2ZT9C 4DUZQ 3CCLA 2N3SA 4A93G 2ZTDA 1HNZL 3I3CA 3CD6A 4F7XA 1XTCD 4LNQA 5KEEA 1RDPD 1SJHD 2L11A 1EOVA 1U4PA 4LF9L 3VR6A 3WWVA 1B44D 2HDMA 1TS4A 2AHOB 3BDLA 3BG3A 4J15A 3HOUB 4KY7A 2F0HA 5FO9B 1D8LA 3RR5A 4IUPA 2UUBL 2EXDA 4AQYQ 2A19A 3OWFA 1SMYD 2EY2A 4KKTA 5AFWA 5C4HA 5D65A 2QKIC 4WRDA 5FO8B 2RHQB 4ID6A 2XSCA 1GO3E 2TSSA 1PYBA 2E2IB 1B8AA 3MXNB 4B9XA 5C3EB 2KHSA 4L6TB 1VF5C 5LMNQ 2NZ1D 1CHPD 2E8GA 1GM5A 4DR5Q 1S3OA 4GOPA 2R61A 4CGYB 1V1QA 4RFBA 2J4XA 4X3SA 5IT9L 4P71A 2F52A 4OO1H 2F0FA 1P16A 4QIWB 1TS2A 3TRZA 1TWFH 3VR4A 5HGTA 5CMDA 1II3A 1CKNA 4N9TA 3RZOB 2BH8A 3NXWA 1XPOA 1STHA 3ULPA 2OCEA 1SRUA 3BVZA 1PYSB 3C46A 3MA2B 1GUTA 1RL2A 3KLWA 3AEVA 3RD4A 4F88A 3J81j 5EQ0A 4PZ6A 2JA8B 1A3TA 1UEBA 3T1YQ 2F0PA 2HCCA 5M3MH 4WFN3 4HAEA 1I50H 3M4OH 2B63B 4K6DA 2L5TA 2VL6A 1JMCA 2VZAA 4LF6L 4DR3Q 4A3KH 3TQYA 1SFOH 1CK1A 4CDEC 3STBD 1YJ9A 2KENA 3LNNA 3ND8A 1YIJA 1MSGA 1C0AA 5JEAG 3AB9A 2MO0A 2NN6H 5ELBA 2PZUA 4R4TA 4DA2A 5IP9G 4DR4Q 2K1BA 4XT3B 2BE5C 4X66Q 1B3AA 1H9SA 2RDGA 3I4MH 4LFBL 4RCNA 1X9NA 2VQEQ 2OQKA 5IGGA 4JBJA 4OO1G 2F3IA 2Z4HA 4BY1H 3H91A 3NK9A 5C4ZA 2UXCL 1ET6A 2Q8RE 2KEDA 1W3SA 1HQMC 4H13C 2VY3A 2IT1A 3OHXC 3P7JA 5EBCA 2PZWA 1CQVA 5E3FA 1YNXA 4DK0A 2F0WA 2R7ZB 1PTOF 1LV9A 4R4IA 1WD1A 5E4XA 1Y8PB 2XVSA 3S15B 1C7YA 1PMRA 4ME3A 3H3VH 2OXPA 3ERQA 1KLUD 4KMUC 5LMNW 1VQMA 1Y1VB 1UWVA 3KF8B 3S17H 1JJGA 1GJXA 1V9PA 2LKVA 1W2BA 3RNUA 4X64L 3AFPA 5FOBB 3S14B 1HNWQ 2HQLA 4A3KG 2B2UA 3I2ZA 2R93B 1IW7D 4MTNA 3S1MB 2MUYA 1O7IA 1PTOH 4X62L 4JV5Q 2NN6G 3CW2C 1XNRL 4EQ5A 1TY0A 3S24A 4CHTB 3ONAB 3VYRA 2ZJRA 1B4OA 2XWJB 3IRBA 2A5HA 1EYGA 1VF7A 3E9IA 2FMMA 1BBXC 4GKKL 1SE2A 1RF2D 3CF5A 2F0NA 3I4MG 1VQHA 2IX3A 4H02A 2EYPA 1AZPA 1OXSC 3S1NB 1LTTD 3BYTB 2VB2X 3HGBA 4GLVB 3EQLC 4JC0A 4ILWA 2KEEA 3NQIA 4Z9CB 4J1MA 3MEHA 5IOCA 1HRJA 2B2YA 4KJNA 1ICFB 1CM9A 2BCOA 1CI3M 2MPMA 1PH6A 3W2DA 1QNUA 1UE5A 2EJGC 3P1HA 4KKUA 1K0RA 3HKZG 2O2LD 1KHIA 1LM0A 5BN3A 1O7YA 1OXUA 3BJUA 4G7ZC 2F4IA 3A74A 4PMBA 4JI0Q 1QB5D 1WVLA 1YNND 3UE1A 3HOZH 3NTIA 2EYLA 3GTMB 1S5DD 3RZDB 2EY5A 2GVBA 3URYA 1N34L 4P75A 5C6AA 1V43A 3K57A 3QB3A 1RJTA 1ZKOA 3GDEA 1IHZA 3RMHA 4DUYL 1I4XA 3K5LA 2CW0C 1KRSA 3HZXA 4A4IA 1IYJB 3TS0A 2F03A 1VQ4A 3J81E 1L1OC 1VQEA 2NWGA 3MZ5A 5C5MA 5BR8Q 3KBXA 1EY0A 4GN5A 4R8NA 3I55A 3HG9A 1F2LA 1WI5A 2XRSD 3BZKA 4KD3A 4G57A 1PH3A 4A3CH 2K04A 2PZTA 1X65A 1Z47A 3Q0AA 1PRTF 1TU2B 1D1IA 4B3ML 1NJIC 2Y0SE 4UP9A 3CCQA 3F2BA 2CQOA 4IPCA 4RA8A 3D4WA 2K5HA 2KVMA 2JA7H 2B29A 3VDYA 4CDDC 1K3BC 1STYA 3J7YW 1Q1BA 1H95A 1HHVA 1DYQA 3SK4A 3J81i 2EPBA 2JE6I 1YI2A 3HOZG 1OXVA 3FPUB 1FNVA 4DR1Q 2F0UA 1CHQD 4TRDA 1TR5A 4IUQA 4OIKA 2BH2A 3PUYA 2QA4A 5M5YB 4K8JA 1OXXK 4RGNA 1FVIA 4IJHA 5EKLA 4JOIA
chains in the Genus database with same CATH topology
4FF1A 3MVVA 2HCIA 1QJOA 4M1UB 2EYOA 2ZXOA 3ND9A 4DNTB 1TWFB 1LTAD 4OO1I 4PNYA 2NTSA 2B2VA 2ENBA 2A74C 3EA6A 1PFMA 2N88A 2K03A 1EY5A 2BA0A 3N6RA 1JC7A 3K59A 3P20A 1WTWA 5C3XA 2J7ZA 4K14A 4HCSA 1ENCA 5DNFA 4IZ8A 1PFBA 1I50B 1YNJD 1O7ZA 1OO9B 3UI2A 2F0EA 4A3KB 4X3KA 1SFOB 1I3QB 4A3EB 4DK1A 4EVOA 1KTKA 3CRLC 4QUCA 2B2WA 3HP3A 4WJWA 1Y8OB 1I6HB 2NN6I 3D6WA 4XQQA 2PCFB 1SMYC 3DXJC 4OL7A 4DAVA 3MTSA 1EQVA 5F2DA 2MJ8A 3NWTA 1U4MA 2Q8TA 1R9TB 2NYZD 2WKCA 1BUVT 3VR2A 3A54A 2ICEC 1QOHA 2F0IA 4QCLA 1NR4A 4LK1C 5KNCA 2EJMA 2D5DA 2EJFC 1ONLA 4DFAA 5K36H 1SDFA 3KBGA 3TZDA 2M9VA 2B2TA 5EKKA 2WAQB 1XWEA 1ESRA 1QNKA 1S5ED 3K7AB 1WTRA 3LWEA 1PTOB 2EYJA 1Q90A 2I07B 1ZEQX 1ENFA 2KCNA 3TMEA 4CKEA 3MHBA 1E0BA 4XXEA 1MI2A 5M3FB 4RGOS 1BCPF 4IALA 3J80L 3TN2A 3I91A 4NW2A 1MSHA 2H4OA 1A2TA 4MIUA 1STBA 5J22A 1RTNA 3TZUA 4EQNA 3IFTA 1PRTC 1JE4A 3C1EA 3TP7A 3NSWA 3X3NA 5C0XH 4B08A 5KYIA 3K58A 5K36G 5IGFA 3HOZB 5EBDA 3NHHA 1B2TA 3OW7A 5I4DA 1KDAA 3G6JB 3SE0A 2QF7A 1SJED 1SXTA 2F0KA 5JJZA 4CKCA 1G2TA 3FPPA 3T51B 2D62A 1DOLA 1R4QB 2K05A 1BF4A 4BBRB 3OWEB 4KY6A 5HURA 1LTGD 3I8ZA 3TP8A 3H94A 2K5QA 2JEBI 4ZKCB 5CR3A 3T13A 5EKIA 1GXDC 5C0XG 3GTOB 1D6EC 1ZXTA 2KCCA 4RGTA 4KV6A 4RHRA 3MFGA 4DXGA 1WTQA 2AQ2B 2K33A 4HMIA 1CA5A 2L4NA 5CV5A 3DHQA 3I4LA 2DNEA 1XX8A 1S4ZA 2I46A 4JBWA 4EQOA 3S16B 2IX0A 1JQYD 1AEXA 3A8KE 4CBVA 1I6VC 5J39A 3IFDA 4KN7C 1V1OA 5ELCA 1SYEA 4C1NI 2F1MA 3GQBA 5IGDA 1Q1EA 1TWHB 1UAPA 1H9RA 3K0YA 5A35A 2EYHA 3VYUA 1V8QA 1EWHA 4ZRZA 4HCEA 1PTOD 2EOTA 2XNAC 2N55A 5FLXL 5I2YA 4KTAA 3S2HB 3PUXA 4XT1B 2FHTA 2BDOA 3O13A 5JEAJ 5JEAH 3N52A 1BCPC 1KNEA 1IYVA 2WP8J 4F87A 4QB4A 2M00A 1OXTA 4CKBA 4KHZA 3SXHA 2A6HC 3FKIB 1I4RA 2VUMB 4A3FB 1TS5A 1LABA 4MN3A 2IW3A 4NP5A 1B53A 5IGCA 4XDXA 1SNCA 4KK7A 5BN5A 5CYUA 5KNDA 1YNJC 5IGBA 4ABNA 1HFGA 3S1RB 1B9NA 3T16A 3HOXB 1DD2A 4QF4A 4C56C 1B9MA 1QCBD 4IN3A 3K5OA 3M85A 3WOEA 1PDQA 1SYDA 5C4XB 4FF2A 2Z4IA 4IUUA 5CBAE 2GA4B 5C44B 3HOWB 1LACA 1JCKB 2QDBA 2MGSA 4G7HC 4GZYC 4PMCA 2YU9B 4DAYA 2NB0A 3G7LA 1SYBA 2F0LA 3SVMA 5C0XI 1V1PB 1VDZA 3D31A 2J0TD 4NMZA 2XIWA 1WCMB 1TT2A 2QCPX 1JR0D 1LT3D 3A8JE 4HEDA 5DM73 4F8MA 1WD0A 1ILPA 3LWUA 1S5CD 1A2UA 1SNPA 1PZID 2YYZA 4ZUJA 2K01A 4LAAA 2NTTA 5T1IA 4ZLTF 2F0QA 3NWSA 1EOTA 1XXGA 1O78A 2E2JB 2FMCA 3SK5A 1CA6A 3CQZB 3R2TA 4ME5A 1BNZA 1GHKA 3OIQA 4NKLA 4R8IA 5E4WC 1DM0B 3VYTA 1O80A 5D3IB 5ISRA 2L9HA 1SBBB 2JA6B 1FR3A 2L0CA 1W6JA 5JVH3 3W3AA 1JICA 1JWUD 1I4GA 1S5BD 5CV8A 2AUKA 3GO5A 4RHSA 1EU4A 4H44C 2SNSA 3K6OA 1BOSA 2RVLA 4FXKC 4ZYSA 1EWCA 1BR9A 4JK1C 5KYLA 4J8QA 2OT2A 1AW7A 5CV9A 1FNUA 4KHVA 4ZUIA 1NAPA 2IWHA 4RH6A 1C8CA 4IUTA 1U4RA 3ITPA 1WTXA 1WTVA 1E2VA 4HN7A 2AWNA 4C2MB 1LTSD 1JOQA 2NVYB 3CRKC 2NVXB 3GTKB 3OOCA 3KUPA 3BYYB 5JVG3 1DJRD 3NP8A 3M3YB 2RA4A 1DZ1A 1SSOA 1Z6HA 3BDOA 3NE5B 3SR1A 2RSNA 5CV7A 2V4DA 3J7AV 5JAVA 2KECA 1EY8A 3PO2B 3R93A 2A6ED 3CU7A 3C2PA 3GTLB 4S3SA 1NUCA 3TBIB 3J81L 4K5VA 1STGA 4KKSA 5NUCA 3H3VC 3X3MA 1CFMA 3IL8A 4E6IA 4FF4A 2BDNA 3GD7A 5FK9C 5LHY1 1QG7A 1TIID 3ZYYX 2AUJD 4FXDA 2K7VA 4H0LC 4Y7NB 3MWYW 3NPPA 1F9RA 5DAUA 2LFNA 1QE6A 3HOYB 4TSSA 2G9HD 4XYQA 4B9WA 2B2YC 4UDUC 5A2QE 1D1KA 4ULLA 3A7AB 3NTHA 4J6HA 4RWSC 2JEAI 1F9PA 2BE5D 2X6LA 2WINB 4A3GB 1H9MA 4K6LA 2E2DC 4EGVA 1SNOA 4ZK9B 5G3LD 3TP5A 1KNAA 2XWBB 1RD9D 1RHPA 2Z1CA 5IIFA 3VA7A 1VMCA 1G2SA 4BWGB 3IAYA 1EFID 3BS1A 2OF1A 2PQEA 3GV3A 1CTMA 3BVMA 2AQ1B 4FF3A 2K32A 4DXFA 2Y0SB 3WDNA 2CQAA 1JORA 4FNFA 3QOJA 4BS9A 1KDBA 4G7OC 2K5WA 1HCZA 3D4DA 4Q0FA 3TP6A 5A2QL 4K2KA 3KK7A 5C0XJ 5LL6X 5DM63 4HSPA 3S9WA 1CZGA 2R6GA 3D8GA 1DOKA 1UNSA 1RKNA 4DNRB 2X6GA 3BZDB 2FINB 1JWMD 2VNUD 5C3WA 5D3DA 3Q22A 1ZYRD 4EQPA 1V1PA 2F3WA 1G8ZD 5KRUA 1EL0A 2DN8A 1C48A 1R4PB 3DEPA 5KNBA 5EJWA 2DY8A 5K5PA 1K8MA 4KI0A 2EY1A 2B8FA 3GTQB 2L55A 4MHEA 1HPCA 1MD2D 1IW7C 2WV6D 4XQNA 3VR3A 1T5XD 2EE1A 2R92B 3DEOA 4L63B 3OSOA 2NUCA 4WORA 4PQXA 2CW0D 2HQEA 2L1BA 1SE4A 1TWGB 4KD4A 2E75C 3A8IE 3PV0A 1HA5A 4DAPA 1W6KA 2PW7A 2A68D 3QG1A 2AQ3B 2E2HB 2TMPA 2WIIB 2XRQD 3PIP3 3M4YA 1SNMA 2F0TA 2E76C 4FYDA 2D9UA 1BO0A 1PRTB 1BDOA 1GUOA 3IKJA 1J8IA 2ZXRA 2D2CC 5COYA 4ZKBB 2QEJC 1Y1WB 3S1QB 3Q23A 1YNNC 1E2WA 4FVMA 1LTRD 2FJ2A 3KLSX 1JOKA 2K28A 3NUCA 3PUVA 1Q3LA 4DU9A 2IPKD 4IURA 1GUSA 2F0DA 3CHBD 5T1GA 2AWOA 5J1ZA 1FYCA 3Q6SA 3M7GA 3MXGA 2PYKA 1S5FD 1KDCA 4G4KA 4FP5D 4CJ0B 3T56B 1QWYA 1DCZA 1BQQT 2EY6A 4Q5VA 3BVGA 5M5XB 1A3UA 1B1ZA 2BOSA 1Q8IA 2KA7A 2R3ZA 5EPLA 1GUWA 3U9OA 1AP0A 1IYUA 1K83B 4I7ZC 2L12A 4IQZA 4C1NK 1MBYA 1EY6A 2PO4A 1LT5D 2EYMA 3I70A 4A3MB 3OIPA 4DGZA 4BY7B 2DY7A 4PV1C 3I72A 4ZQ3A 3MXPA 4V190 2JYOA 3GTPB 4DF7A 1A6XA 3H0GB 2ICIA 1EQTA 3R3OA 4TQUS 1Y69U 2CVRA 1EEFD 1PYWD 1JWSD 1UEAB 2A6EC 2RQXA 1E2ZA 1I4QA 1JB3A 1PXUA 4K5XA 2LMCB 1EIGA 4KN4C 4TKOB 2O5JC 4L8JA 4BBSB 4V0BA 2ZXPA 4IUVA 4C3HG 1I4PA 1D5XC 1DXMA 2VXWA 4C3JB 4IFDJ 1LO5D 4IFDH 4I65A 3QJYA 1ENAA 2VB3X 3PO3B 2JP1A 1U4LA 1LTID 5FKAC 1EYCA 1F9QA 1EY7A 3D4RA 1BCPB 4H7BA 5DEHA 3HS0C 3T53B 3R8BA 1GOZA 5E1FA 3K5MA 1H9KA 2IX1A 3AU7A 1STEA 1B50A 3NBHA 1HQRD 1KLGD 1TWCB 1PRTD 3GV6A 2A69D 3MXUA 5JPNC 1LT4D 4A3IB 1KAAA 3VYSA 2F0VA 1SE3A 1GUNA 4NDXA 2DNCA 3QOLA 1EZ6A 2F0SA 1ICWA 4YIJA 4K8IA 4IFDG 3H6MA 3A7LA 1SYCA 5CGKA 1TWAB 2EZVA 1F2MA 5I6YA 5KGUA 3HRZC 5I9PA 1T5EA 5ELEA 4A3DB 3D3RA 1L0XB 3VR5A 1X3QA 1JOOA 1K8OA 1KABA 4DN4M 3PUWA 3GP7A 2RBMA 1I4HA 2KJXA 3V2TA 4RCOA 5C4JB 1SYGA 1CT1D 1D5MC 4A93B 1ET9A 1Z7TA 3TSSA 1RODA 1ZYRC 3I90A 2RDFA 4OGQC 5EPJA 2NVQB 2JXMB 3V05A 4BA1I 4XQJA 3AMUA 1GHJA 2HDLA 4BA2I 3FVQA 3A55A 2C9OA 1SEBD 2PW5A 1ILQA 1EIHA 5EPKA 4KY5A 5JPMC 3EROA 1Y8NB 3CKIB 3I73A 2Z8LA 3GTGB 3DM1A 3QO2A 3DWQA 4A3JB 1HUNA 2IL8A 1VMPA 3KLSA 4XIGS 3MAQA 2OEOA 1IL8A 1PFNA 2LY7A 2MHVA 4C3HB 2G9DA 1PZJD 2EDGA 1NCVA 1HFNA 3EJIA 3VA5A 2A68C 3MFYA 3LX0A 3Q24A 2EXZA 3FDTA 5TSSA 3FMCA 4A3BB 3L9AX 1AFPA 1PZKD 1LTBD 3C3LA 4U673 1F9SA 3FRPB 1TS3A 2C5CA 3GTJB 3OMGA 1C4QA 4RKBA 1HXYD 1EU3A 5D14A 3P75A 1X32A 1NR2A 1BCPD 1LT6D 3JAME 4UAIA 2SEBD 2PMZB 3QIAA 3HEJA 3K5NA 4ODGA 2EVBA 2EYFA 2ID0A 1D2BA 2A6HD 5FO7B 1J9OA 1DOMA 4C3IG 3SDZA 3U9SA 3HOVB 2KQ3A 1F2YA 4HTHA 3SK8A 3DWPA 2RDHA 2B2UC 3BDCA 4XTCS 3D6CA 4OHJA 3NBIA 3SHLA 5CORA 5I9OA 1AN8A 2HUGA 4IFDI 2SOBA 1NSNS 3F2UA 1PTOC 1TKWB 5M3MB 2PNRC 4R9WA 4X3UA 3TDQA 2NVTB 5CV4A 3M4OB 2O4XA 4X3TA 5EGTA 2O5IC 4ZAIA 1SNDA 4HR7B 2H1EA 1L0YB 1WTPA 4IUNA 3A56A 4CJ1B 1FNWA 2X69A 1O7LA 3FEWX 3J80E 1A3VA 1WTOA 1H9SB 4AYBB 2BA1A 3I4MB 3SEBA 2F0OA 1A15A 3JAML 1PLFA 4BY1B 2IJ0A 4LMQD 2LS01 1STAA 4N9PA 3MXNA 2Q8IB 3R2IA 3HKZB 1TQOA 1F2ZA 4RAUC 2WB1B 3S17B 3E0JA 1HTLD 4O1NA 5BN4A 3PIO3 5M5WB 2JSOA 1HUMA 4RGMA 1XYIA 1IKMA 2RKSA 1STNA 5I6WA 1G291 1G6ZA 2XN9C 2B39A 4FXGC 4RKLA 4O42A 2RSOA 3QWNA 4U68A 1EYAA 1Q12A 4QMGA 4KJOA 1EY9A 2K5DA 1VCIA 3DUZA 1AZQA 1HTPA 3L3OC 1RCVD 3M7NA 1SYFA 1G91A 3E6ZX 1X3PA 3NQTA 3OPOA 3EVQA 2CHBD 2WKDA 4QUFA 2A69C 2E74C 3WOFA 1QILA 1M8AA 2MP1A 1MGSA 2B2VC 5M9OA 3E5SA 4C3JG 4K5WA 4FO2A 1ESFA 5LL6S 4M8AA 2KUMA 3OMCA 1FGBD 2QILA 3PUZA 1DONA 2KOLA 2A73B 2NBFA 5KIXA 4K2LA 4XYOA 1M4VA 5C5LA 3DWAA 4C3IB 3PMFA 1EEID 3KF8A 1GUGA 5CBEE 4HSVA 5ELFA 3C1FA 3MC0B 3EFXD 4HMJA 3S2DB 1D5ZC 2B2WC 1SAPA 3J7AF 1ML0D 4OIJA 2M2LA 3V96A 3DMUA 5IGEA 2JA7B 1RTOA 3KLRA 2WACA 3H09A 2SNMA 5G3LF 3RLFA 1CZWA 2JA5B 3L7ZC 5FLXE 4P2CB 1EZ8A 5JOBA 5I2XA 2PPBC 1TVXA 4CJ2C 2B8GA 5ELDA 1TY2A 2SDFA 1UUPA 1EYDA 5IODA 2B2TC 1EY4A 5IT9E 2FFKB 5CC4A 1CQFA 1IKLA 1F77A 1U9RA 1H9JA 1SNQA 3NTKA 1LLRD 2F0GA 3T4AC 1HA6A 4PMWA 1FD7D 3SK6A 3I4NB 3RUZA 1BXTA 2F0JA 2K6AA 2F0MA 4LJZC 2F3VA 5CV6A 2ZT9C 3I3CA 4F7XA 1XTCD 5KEEA 1RDPD 1SJHD 2L11A 1U4PA 3VR6A 1B44D 2HDMA 1TS4A 3BDLA 3BG3A 3HOUB 4KY7A 2F0HA 5FO9B 4IUPA 3OWFA 1SMYD 2EY2A 4KKTA 5AFWA 5C4HA 5D65A 2QKIC 4WRDA 5FO8B 4ID6A 2XSCA 2TSSA 2E2IB 4B9XA 5C3EB 2KHSA 4L6TB 1VF5C 2NZ1D 1CHPD 2R61A 4CGYB 4RFBA 2J4XA 4X3SA 5IT9L 4OO1H 2F0FA 4QIWB 1TS2A 3VR4A 5HGTA 5CMDA 1II3A 4N9TA 3RZOB 3NXWA 1STHA 3BVZA 3C46A 3MA2B 1GUTA 3RD4A 4F88A 5EQ0A 2JA8B 1A3TA 2F0PA 2HCCA 4WFN3 4HAEA 2B63B 4K6DA 2L5TA 1CK1A 3LNNA 3ND8A 1MSGA 5JEAG 3AB9A 2NN6H 5ELBA 2PZUA 4DA2A 2K1BA 4XT3B 2BE5C 1B3AA 1H9SA 2RDGA 4RCNA 5IGGA 4OO1G 2Z4HA 3H91A 3NK9A 5C4ZA 1ET6A 2Q8RE 2KEDA 1HQMC 4H13C 2IT1A 3OHXC 3P7JA 5EBCA 2PZWA 1CQVA 5E3FA 4DK0A 2F0WA 2R7ZB 1PTOF 1LV9A 1WD1A 5E4XA 1Y8PB 2XVSA 3S15B 1PMRA 2OXPA 3ERQA 1KLUD 4KMUC 1Y1VB 1GJXA 2LKVA 5FOBB 3S14B 2B2UA 2R93B 1IW7D 3S1MB 2MUYA 1PTOH 2NN6G 1TY0A 4CHTB 3ONAB 3VYRA 1B4OA 2XWJB 2A5HA 1VF7A 2FMMA 1BBXC 1SE2A 1RF2D 2F0NA 2IX3A 2EYPA 1AZPA 1OXSC 3S1NB 1LTTD 3BYTB 2VB2X 3HGBA 3EQLC 4ILWA 2KEEA 3NQIA 4Z9CB 4J1MA 3MEHA 5IOCA 1HRJA 2B2YA 4KJNA 1CM9A 2BCOA 1CI3M 2MPMA 3W2DA 1QNUA 2EJGC 3P1HA 4KKUA 2O2LD 5BN3A 1O7YA 1OXUA 4G7ZC 2F4IA 4PMBA 1QB5D 1WVLA 1YNND 3NTIA 2EYLA 3GTMB 1S5DD 3RZDB 2EY5A 3URYA 5C6AA 1V43A 3K57A 3QB3A 1RJTA 1ZKOA 1IHZA 3RMHA 1I4XA 3K5LA 2CW0C 3HZXA 2F03A 3J81E 3MZ5A 5C5MA 2NWGA 3KBXA 1EY0A 4R8NA 3HG9A 1F2LA 2XRSD 4KD3A 4G57A 2K04A 2PZTA 1Z47A 3Q0AA 1PRTF 1TU2B 1D1IA 4RA8A 3D4WA 2KVMA 1STYA 3J7YW 1Q1BA 1HHVA 1DYQA 3SK4A 2EPBA 2JE6I 1OXVA 3FPUB 1FNVA 2F0UA 1CHQD 4TRDA 1TR5A 4IUQA 4OIKA 3PUYA 5M5YB 4K8JA 1OXXK 4RGNA 5EKLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KY5 A;  1EY6 A;  3MEH A;  3MVV A;  4J1M A;  4LAA A;  2EYJ A;  4KJN A;  5IOC A;  2F0Q A;  1SYF A;  4J6H A;  5IOD A;  2EYO A;  2F0P A;  3ERO A;  3NQT A;  3EVQ A;  4KV6 A;  2EYM A;  1EY4 A;  4PNY A;  5CV4 A;  2O4X A;  3P1H A;  3TME A;  5CC4 A;  2ENB A;  3MHB A;  4K6D A;  5EGT A;  3OSO A;  4DGZ A;  3NP8 A;  1SNO A;  1SND A;  1U9R A;  2NUC A;  4WOR A;  1SNQ A;  4HMI A;  1KAA A;  2HQE A;  2F0G A;  4NP5 A;  4ZQ3 A;  4IUN A;  3SK5 A;  3MXP A;  4IAL A;  5CV5 A;  1EY5 A;  2F0V A;  3DHQ A;  2OEO A;  4PMB A;  3SK6 A;  3TP5 A;  4NDX A;  5IGC A;  4ME5 A;  3RUZ A;  1A3V A;  2PZU A;  3QOL A;  2F0J A;  1SNC A;  1EZ6 A;  2F0S A;  3E5S A;  4KD4 A;  4YIJ A;  3SR1 A;  4DF7 A;  4K8I A;  2F0M A;  1A2T A;  4K5W A;  4MIU A;  3R3O A;  5C3X A;  2EYL A;  2F3V A;  3H6M A;  5CV7 A;  4K14 A;  2EY5 A;  5CV6 A;  1ENC A;  4NKL A;  5C6A A;  3EJI A;  5IIF A;  1STB A;  1SYC A;  3OMC A;  3VA5 A;  5CGK A;  2PW7 A;  5J22 A;  5JAV A;  4IZ8 A;  2F0O A;  3QB3 A;  4EQN A;  1EY8 A;  5IGB A;  1SNM A;  4EQO A;  2F0T A;  3C1E A;  3TP7 A;  2F0E A;  4F7X A;  1IHZ A;  5ISR A;  5IGG A;  2OF1 A;  5KEE A;  3LX0 A;  3T16 A;  2PQE A;  1AEX A;  3NK9 A;  5C4Z A;  1STA A;  2EXZ A;  4S3S A;  4EVO A;  4QF4 A;  5KIX A;  1NUC A;  1F2M A;  4K2L A;  3HZX A;  5I6Y A;  5I9P A;  5KGU A;  5C5L A;  5KYI A;  4N9P A;  4K5X A;  3PMF A;  5I9O A;  3BDL A;  1SYD A;  5IGF A;  4KY7 A;  4K5V A;  5J39 A;  2F0H A;  3MZ5 A;  1STG A;  5C5M A;  2PZW A;  5E3F A;  3NHH A;  1EY0 A;  1JOO A;  1JOR A;  4R8N A;  5CV8 A;  1TQO A;  1F2Z A;  1KAB A;  1SYE A;  3QOJ A;  2F0W A;  5NUC A;  1KDB A;  5IGD A;  4KD3 A;  3OWF A;  1JOK A;  4G57 A;  2RBM A;  5M9O A;  3NUC A;  1KDA A;  2QDB A;  3C1F A;  2EY2 A;  3OMG A;  4HMJ A;  4OL7 A;  2SNS A;  3D4D A;  2PZT A;  5C4H A;  4RKB A;  4PMC A;  4DU9 A;  4WRD A;  2EYH A;  3P75 A;  3TP6 A;  1EQV A;  3V2T A;  4ID6 A;  5F2D A;  4K2K A;  4E6I A;  2OXP A;  3ERQ A;  2F0K A;  2LKV A;  2F0D A;  1SYB A;  2F0L A;  4B9X A;  3S9W A;  1SYG A;  2RKS A;  3D8G A;  5J1Z A;  2KHS A;  3DMU A;  5KYL A;  3HEJ A;  3D4W A;  5IGE A;  1STN A;  4ODG A;  5I6W A;  1RKN A;  2EYF A;  5CV9 A;  4NMZ A;  2PYK A;  5C3W A;  2WAC A;  4EQP A;  4I65 A;  2SNM A;  1KDC A;  4KHV A;  4KTA A;  4ZUI A;  2F0I A;  2RDF A;  1ENA A;  1TT2 A;  2F0F A;  1EZ8 A;  1STY A;  5JOB A;  4RKL A;  2F3W A;  5KRU A;  5DAU A;  3SK4 A;  5HGT A;  4KY6 A;  2EY6 A;  1II3 A;  5HUR A;  2KQ3 A;  1F2Y A;  3TP8 A;  4N9T A;  3ITP A;  4HTH A;  3NXW A;  3SK8 A;  2F0U A;  4DFA A;  4B9W A;  1STH A;  1A3U A;  3BDC A;  5K5P A;  4F8M A;  1EYC A;  1EYA A;  3D6C A;  4QMG A;  5EKK A;  4KJO A;  2F0N A;  3SHL A;  1EY7 A;  1EY9 A;  4H7B A;  4QB4 A;  4TRD A;  5CR3 A;  2EY1 A;  5DEH A;  1TR5 A;  2M00 A;  1A2U A;  3T13 A;  2EYP A;  3U9O A;  1JOQ A;  5E1F A;  1SNP A;  2SOB A;  1NSN S;  2PW5 A;  4K8J A;  5EKL A;  4ZUJ A;  3SXH A;  1EYD A;  1A3T A; 
#chains in the Genus database with same CATH topology
 4FF1 A;  3MVV A;  2HCI A;  1QJO A;  2ALY B;  4M1U B;  4DV4 L;  3UDI A;  2EYO A;  1CKN B;  2ZXO A;  3ND9 A;  4DNT B;  1TWF B;  1LTA D;  2RF4 A;  4OO1 I;  4PNY A;  2NTS A;  2B2V A;  2ENB A;  2A74 C;  1AE3 A;  1E1T A;  3EA6 A;  4A3C G;  1C9O A;  1HNX L;  1PFM A;  2N88 A;  1PH5 A;  2K03 A;  1EY5 A;  2G5D A;  2BA0 A;  3N6R A;  1JC7 A;  3K59 A;  3I4N H;  3P20 A;  1WTW A;  5C3X A;  3D0F A;  2HHH Q;  4LF7 L;  2J7Z A;  4K14 A;  4HCS A;  1ENC A;  1Q82 C;  1X54 A;  5DNF A;  4IZ8 A;  1PFB A;  1I50 B;  1YNJ D;  1O7Z A;  2JA7 G;  1OO9 B;  3UI2 A;  2F0E A;  4A3K B;  4X3K A;  1SFO B;  1PH4 A;  1I3Q B;  4A3E B;  4DK1 A;  4EVO A;  1KTK A;  3CRL C;  4QUC A;  2B2W A;  3HP3 A;  4WJW A;  4GLX A;  1Y8O B;  3MEF A;  1I6H B;  2NN6 I;  3D6W A;  4A75 A;  4XQQ A;  2AKW B;  2PCF B;  4DAY B;  1SMY C;  3DXJ C;  4OL7 A;  4DV6 L;  4DAV A;  3MTS A;  4DR2 L;  1EQV A;  2PI2 E;  5F2D A;  2UXB Q;  2CWA A;  2MJ8 A;  3NWT A;  4OEL B;  1U4M A;  2Q8T A;  4JYA Q;  2KCT A;  1R9T B;  2E2I H;  2NYZ D;  2V1C C;  5C3E H;  2WKC A;  1BUV T;  3VR2 A;  3A54 A;  2ICE C;  4JI1 Q;  1EIY B;  1QOH A;  2F0I A;  4QCL A;  4LF5 Q;  1K0S A;  2UUA Q;  4GN4 B;  2VUM H;  1NR4 A;  4LK1 C;  5KNC A;  3J7A 5;  4K0K L;  2EJM A;  2D5D A;  2EJF C;  2RCF A;  1ONL A;  4DFA A;  5K36 H;  1SDF A;  3KBG A;  3TZD A;  2M9V A;  2B2T A;  3H3V I;  1HZB A;  5EKK A;  5AJ3 L;  2WAQ B;  1XWE A;  4NXM Q;  1ESR A;  3W1B A;  2IY5 B;  1QNK A;  1K3R A;  1S5E D;  3K7A B;  1WFQ A;  1WTR A;  3LWE A;  4LF4 L;  1PTO B;  2EYJ A;  4MZ9 A;  1VQD A;  1Q90 A;  2I07 B;  1ZEQ X;  1ENF A;  2KCN A;  1T9H A;  3TME A;  4CKE A;  3AYH B;  1E7Z A;  3MHB A;  1E0B A;  4XXE A;  3G4S A;  1MI2 A;  5M3F B;  2Q2T A;  2B63 H;  1MJE A;  4NXN Q;  3STB C;  4RGO S;  1BCP F;  4IAL A;  3EIV A;  3J80 L;  3TN2 A;  1NE3 A;  3I91 A;  5C4X H;  5GAH C;  4NW2 A;  1MSH A;  2H4O A;  4B3R Q;  3PIO A;  1A2T A;  4MIU A;  3NEM A;  5C44 H;  1STB A;  5J22 A;  1RTN A;  3HOW H;  3TZU A;  4EQN A;  3IFT A;  1PRT C;  1JE4 A;  3B6Y A;  1XMQ L;  3C1E A;  3TP7 A;  4JW0 A;  3NSW A;  3X3N A;  1VQI A;  2VUM G;  5C0X H;  4B08 A;  5KYI A;  2MO1 A;  1VQ5 A;  3KDF A;  3K58 A;  5K36 G;  5IGF A;  2LXK A;  5LMU Q;  3HOZ B;  5EBD A;  3NHH A;  1B2T A;  5FJ8 H;  2ES2 A;  3OW7 A;  1WOC A;  1WCM H;  3A0J A;  3NEN A;  5I4D A;  4B3T Q;  3KF6 A;  1KDA A;  3G6J B;  3SE0 A;  1FL0 A;  1KAW A;  2QF7 A;  1SJE D;  3M9B A;  1SXT A;  4DV5 Q;  1SR3 A;  2F0K A;  5JJZ A;  3A5Z B;  1Y1V H;  4JVZ A;  4CKC A;  5FLM H;  1G2T A;  3FPP A;  2B63 G;  3T51 B;  2EIF A;  1E24 A;  3S14 H;  2D62 A;  1I94 Q;  4AH6 A;  2ATW A;  1DOL A;  4GN3 B;  1R4Q B;  3F2D A;  3CC4 A;  2K05 A;  3S1M H;  1BF4 A;  4BBR B;  3OWE B;  5C4X G;  3TS2 A;  4KY6 A;  5HUR A;  1LTG D;  3I8Z A;  3TP8 A;  3E3X A;  1YJW A;  5C44 G;  5GRO A;  3HOW G;  3H94 A;  2K5Q A;  2JEB I;  4ZKC B;  5CR3 A;  2E2J H;  3T13 A;  1N36 Q;  3CPF A;  5EKI A;  1CKM A;  1GXD C;  3S1N H;  5C0X G;  3GTO B;  1D6E C;  1ZXT A;  2JN4 A;  2KCC A;  4GNX C;  4RGT A;  4KV6 A;  4RHR A;  3MFG A;  5FJ8 G;  4DXG A;  1WTQ A;  1WCM G;  2QDL A;  2AQ2 B;  3CAM A;  2K33 A;  4DKA C;  4HMI A;  1CA5 A;  5JJK A;  2L4N A;  5CV5 A;  3DHQ A;  4EX5 A;  3I4L A;  4DV2 L;  1U5K A;  2DNE A;  1NMG A;  4TVA B;  1Y1V G;  2RHS B;  5FLM G;  4MNO A;  1XX8 A;  1Q46 A;  1ASZ A;  1S4Z A;  4APV A;  3RZD H;  1HNZ Q;  2I46 A;  4JBW A;  2WFW A;  4EQO A;  1EFW A;  3ULL A;  1PH1 A;  3S16 B;  2IX0 A;  4LF9 Q;  1JQY D;  1AEX A;  3A8K E;  2QW7 A;  4CBV A;  1I6V C;  4KHP L;  5J39 A;  2Z9H A;  3IFD A;  4KN7 C;  1MJC A;  1V1O A;  2UUB Q;  1HZA A;  1LUZ A;  5ELC A;  1SYE A;  4C1N I;  2F1M A;  3EN2 A;  3GQB A;  1YHA A;  5IGD A;  1UE6 A;  1Q1E A;  1TWH B;  1UAP A;  1H9R A;  3PQI A;  4QGU A;  3UE0 A;  3K0Y A;  5A35 A;  2EYH A;  4DV0 L;  1U0L A;  3VYU A;  1V8Q A;  4B3S L;  1EWH A;  4C2M H;  4ZRZ A;  4HCE A;  1IBM L;  3CME A;  2NVY H;  1PTO D;  2EOT A;  2XNA C;  3T1H L;  1IL2 A;  2N55 A;  5FLX L;  2JA6 G;  5I2Y A;  4KTA A;  3S2H B;  3PUX A;  4FDB A;  2Q2H A;  4XT1 B;  2NVX H;  3GTK H;  2FHT A;  1KIX A;  2BDO A;  3O13 A;  5JEA J;  1KRT A;  5JEA H;  3N52 A;  1BCP C;  1KNE A;  1IYV A;  2H5X A;  3M3Y H;  2WP8 J;  4F87 A;  4QB4 A;  4HJ9 A;  5IP9 H;  2M00 A;  3I7F A;  1OXT A;  1TXY A;  2R7F A;  4CKB A;  4KHZ A;  1PA6 A;  3SXH A;  2A6H C;  5M5Y H;  1AE2 A;  3FKI B;  1I4R A;  2VUM B;  4DR7 L;  1DGS A;  4A3F B;  1TS5 A;  4LF6 Q;  3PO2 H;  1LAB A;  3DLL A;  1BKB A;  4MN3 A;  2IW3 A;  3GTL H;  4NP5 A;  1VQK A;  1B53 A;  5IGC A;  4XDX A;  1SNC A;  1B7Y B;  3U4V A;  4KK7 A;  4DAM A;  4LFB Q;  5BN5 A;  5CYU A;  5KND A;  1YNJ C;  5IGB A;  1L1O A;  4ABN A;  1HFG A;  3S1R B;  1PFS A;  1B9N A;  2UXC Q;  3T16 A;  3HOX B;  2QGQ A;  1DD2 A;  2ZTE A;  4QF4 A;  1I3Q H;  4A3E H;  2OWO A;  4C56 C;  1B9M A;  1QCB D;  4IN3 A;  3K5O A;  4L5Q A;  3SGI A;  3M85 A;  2OTJ A;  3WOE A;  3F1Z A;  1PDQ A;  1SYD A;  5C4X B;  4FF2 A;  2Z4I A;  1I6H H;  4IUU A;  5CBA E;  3M4Q A;  2GA4 B;  5C44 B;  4Y7N H;  3HOW B;  1LAC A;  1JCK B;  2QDB A;  5IWA L;  4HJ7 A;  2MGS A;  4G7H C;  4GZY C;  4PMC A;  2UUC L;  2YU9 B;  4DAY A;  3ER0 A;  3KDF B;  1G51 A;  2NB0 A;  4DV1 L;  3G7L A;  1SYB A;  2F0L A;  3SVM A;  4X64 Q;  1KL9 A;  5ELO A;  5C0X I;  1V1P B;  3PO2 G;  1R9T H;  4QY7 A;  1VDZ A;  3D31 A;  2J0T D;  4NMZ A;  3KF6 B;  2XIW A;  4OON A;  1WCM B;  4X62 Q;  1TT2 A;  1JJ2 A;  1XNR Q;  2QCP X;  1JR0 D;  1LT3 D;  2D0P A;  3A8J E;  4HED A;  1XJV A;  2PMZ E;  1IBK L;  4GKK Q;  5DM7 3;  3CCR A;  4A3G H;  4OWT B;  2PNH A;  4F8M A;  3CMA A;  4IOA A;  1WD0 A;  1ILP A;  3LWU A;  1CUK A;  1S5C D;  1A2U A;  2JJQ A;  3CXC A;  4UY8 C;  1SNP A;  1PZI D;  2YYZ A;  4ZUJ A;  2K01 A;  4A3E G;  4LAA A;  2NTT A;  1QZH A;  5T1I A;  4LF8 L;  4ZLT F;  3K7A H;  2F0Q A;  3JAM c;  3NWS A;  1VQB A;  4L5T A;  3RLN A;  1EOT A;  3L2P A;  1XXG A;  4X65 L;  1O78 A;  5IYB H;  2E2J B;  5M3F H;  2FMC A;  3SK5 A;  4DV3 L;  1RIP A;  4YCU A;  1CA6 A;  3CQZ B;  3R2T A;  4ME5 A;  1BNZ A;  1IBL L;  1N34 Q;  1GHK A;  1G6P A;  3OIQ A;  4WJ4 A;  4NKL A;  1KC8 C;  1PHJ A;  4R8I A;  3EBE A;  5E4W C;  1DM0 B;  2GVA A;  2GN5 A;  3I4O A;  3VYT A;  1NNX A;  2C35 B;  3AQQ A;  2ZM6 L;  4DUY Q;  1O80 A;  5D3I B;  5ISR A;  2FXQ A;  2L9H A;  1SBB B;  2JA6 B;  1FR3 A;  2L0C A;  4AYB E;  4A3G G;  1W6J A;  1WYD A;  5JVH 3;  3W3A A;  1JIC A;  1JWU D;  1I4G A;  1S5B D;  5CV8 A;  2ASB A;  2AUK A;  2Z6K C;  3GO5 A;  4R1J A;  4RHS A;  2WAQ G;  1EU4 A;  3CC2 A;  4H44 C;  2SNS A;  3K6O A;  1BOS A;  2RVL A;  4FXK C;  4GOP C;  2Q2I A;  4ZYS A;  3J80 c;  4B3M Q;  1EWC A;  1BR9 A;  4JK1 C;  1N32 L;  3HKZ E;  5KYL A;  4J8Q A;  2OT2 A;  3K7U C;  5IYB G;  1AW7 A;  5CV9 A;  3GTQ H;  4KLK A;  2VQF L;  1FNU A;  5M3F G;  4KHV A;  4ZUI A;  1NAP A;  2WB1 E;  2IWH A;  4GKJ L;  4RH6 A;  5H1S E;  2RCN A;  1YZ6 A;  1SRO A;  1C8C A;  4IUT A;  4O0A A;  4BBR H;  2R92 H;  1U4R A;  3ITP A;  1WTX A;  1A63 A;  1WTV A;  1E2V A;  4HN7 A;  2AWN A;  1LTS D;  4C2M B;  1JOQ A;  2KBN A;  2NVY B;  2HIX A;  1TWG H;  3CRK C;  4DV4 Q;  3UDX A;  3M4P A;  2NVX B;  3GTK B;  3OOC A;  4YY3 L;  3GTO H;  3KUP A;  1QVC A;  3BYY B;  2K5N A;  2E2H H;  2ZJP A;  5JVG 3;  1IZ6 A;  1DJR D;  1SLJ A;  4HIK A;  1HNX Q;  3NP8 A;  3M3Y B;  2RA4 A;  1DZ1 A;  5GAE C;  1SSO A;  3BZC A;  1XPU A;  1GVP A;  1Z6H A;  3BDO A;  3NE5 B;  2PI2 A;  4LF7 Q;  3SR1 A;  3S1Q H;  2B3G A;  1QUQ B;  2RSN A;  2DGY A;  5CV7 A;  2V4D A;  1ASY A;  4YWK A;  1KD1 C;  3J7A V;  5JAV A;  2KEC A;  2ZTC A;  1VQ9 A;  1EY8 A;  3PO2 B;  3R93 A;  2DJF C;  3UDG A;  4JI6 L;  2UXD L;  2A6E D;  2Z6B A;  3CU7 A;  3C2P A;  3GTL B;  3S16 H;  4S3S A;  1NUC A;  3TBI B;  3RN5 A;  4BBR G;  3J81 L;  2R92 G;  4K5V A;  2LSS A;  1STG A;  2XTI A;  3ICE A;  4DPG A;  4KKS A;  1VQJ A;  1L1O B;  5NUC A;  4DV6 Q;  3H3V C;  3LGJ A;  3X3M A;  4DR2 Q;  1EQR A;  1CFM A;  4A3L H;  1TWH H;  3IL8 A;  2EQS A;  4E6I A;  4FF4 A;  2BDN A;  5M5X H;  4GLA C;  3GD7 A;  5FK9 C;  3FP9 A;  5LHY 1;  4JG2 A;  1QG7 A;  1VQG A;  4YWM A;  1TII D;  3ZYY X;  5IYD H;  2AUJ D;  4YWL A;  4FXD A;  4NB3 A;  1K83 H;  2K7V A;  4H0L C;  4Y7N B;  3MWY W;  3NPP A;  4DV7 L;  3S2H H;  4OX9 L;  4K0K Q;  1F9R A;  5DAU A;  2LFN A;  1QE6 A;  4N8X 1;  3HOY B;  4TSS A;  2G9H D;  4XYQ A;  5AJ3 Q;  4B9W A;  4GNX A;  2B2Y C;  4UDU C;  5A2Q E;  2JA9 A;  3K0X A;  1D1K A;  3GTP H;  2I5H A;  1YJN A;  4ULL A;  4LF4 Q;  2K52 A;  3A7A B;  3NTH A;  4J6H A;  2CCZ A;  1N33 L;  4RWS C;  2JEA I;  1F9P A;  2BE5 D;  2X6L A;  4LUV A;  4OWW B;  3FKI H;  3OW2 A;  4YHH L;  1X55 A;  2F4V L;  2WIN B;  4A3G B;  1H9M A;  4K6L A;  2E2D C;  4A3F H;  4EGV A;  1SNO A;  1WJJ A;  1NY4 A;  2KHJ A;  4A3L G;  5FLX c;  4ZK9 B;  5G3L D;  3TP5 A;  1KNA A;  2XWB B;  4JI5 L;  1RD9 D;  1RHP A;  2Z1C A;  1UE7 A;  5IYD G;  5IIF A;  3VA7 A;  1VMC A;  1E22 A;  1K28 A;  1G2S A;  4BWG B;  1XMQ Q;  4JI3 L;  3IAY A;  1EFI D;  3BS1 A;  1M1K C;  4JPB W;  2I5L X;  1SN8 A;  2OF1 A;  4DR6 L;  2PQE A;  3GV3 A;  3S1R H;  1CTM A;  3BVM A;  3HOX H;  2AQ1 B;  4FF3 A;  2K32 A;  2R7D A;  4MTK A;  5IT9 c;  4DXF A;  1J6Q A;  2Y0S B;  3WDN A;  1N8R C;  2CQA A;  1JOR A;  2AMC B;  4FNF A;  3QOJ A;  4BS9 A;  2YTX A;  2OQ0 A;  1KDB A;  3PF4 A;  4G7O C;  4ZCK A;  2K5W A;  2K5V A;  1HCZ A;  3D4D A;  5ELN A;  2JQO A;  4Q0F A;  3TP6 A;  5A2Q L;  4K2K A;  3KK7 A;  5C0X J;  3G71 A;  5LL6 X;  5DM6 3;  2YU9 H;  4HSP A;  3FKI G;  3S9W A;  1CZG A;  2R6G A;  3D8G A;  1X6O A;  1DOK A;  1MKH A;  4A3F G;  1UNS A;  1PV4 A;  1RKN A;  4DNR B;  2X6G A;  3CCM A;  3BZD B;  2FIN B;  1JWM D;  1HR0 L;  1VQN A;  2VNU D;  5C3W A;  5D3D A;  3Q22 A;  1ZYR D;  4EQP A;  1V1P A;  1XMO L;  4A76 A;  4LWC A;  1KQS A;  2F3W A;  1G8Z D;  5KRU A;  1EL0 A;  2DN8 A;  1C48 A;  1TWC H;  1R4P B;  3DEP A;  5KNB A;  4BBS G;  5EJW A;  2DY8 A;  4JOI C;  3K80 C;  5K5P A;  1K8M A;  4KI0 A;  4A3I H;  2KHI A;  2EY1 A;  2B8F A;  1PH9 A;  3GTQ B;  4L5S A;  2L55 A;  1EWI A;  4AIM A;  4QIW E;  4MHE A;  3HOX G;  1HPC A;  1MD2 D;  1IW7 C;  2WV6 D;  4XQN A;  2A1A A;  1T5X D;  3VR3 A;  4UP7 A;  2EE1 A;  2R92 B;  3DEO A;  1JT8 A;  4L63 B;  3OSO A;  1VQ8 A;  2NUC A;  4IPD A;  4PQX A;  4WOR A;  2CW0 D;  2DJG C;  2HQE A;  2L1B A;  3F2C A;  4DV2 Q;  3OTO Q;  1KXL A;  1SE4 A;  1TWG B;  2YV5 A;  2JK8 A;  4KD4 A;  2E75 C;  3A8I E;  3CQZ H;  3KOJ A;  3PV0 A;  1HA5 A;  1YBY A;  1E1O A;  1W6K A;  2PW7 A;  2A68 D;  3QG1 A;  2AQ3 B;  4DAP A;  2E2H B;  2TMP A;  2WII B;  2XRQ D;  4RG1 A;  3PIP 3;  3M4Y A;  1SNM A;  5HGQ A;  2F0T A;  2E76 C;  1HR0 W;  4FYD A;  2D9U A;  1L0W A;  1BO0 A;  3CCE A;  1PRT B;  3NEL A;  4JI2 L;  1BDO A;  1GUO A;  3IKJ A;  5C4J H;  1J8I A;  2ZXR A;  1VQ6 A;  4KHP Q;  2D2C C;  5COY A;  4ZKB B;  2JA6 H;  2QEJ C;  3OTO L;  1Y1W B;  3S1Q B;  2K14 A;  3Q23 A;  4A3I G;  1YNN C;  1J5E L;  1E2W A;  4JI8 L;  4R4O A;  4POG A;  4FVM A;  1LTR D;  2FJ2 A;  3KLS X;  1JOK A;  2K28 A;  3NUC A;  1E3P A;  4JI4 L;  3PUV A;  2NZO A;  4DV0 Q;  1Q3L A;  4DU9 A;  4LFA L;  2IPK D;  4IUR A;  1GUS A;  4B3S Q;  2F0D A;  3CHB D;  5T1G A;  1IBM Q;  2AWO A;  5J1Z A;  1FYC A;  3Q6S A;  3T1H Q;  3M7G A;  4JI7 L;  3MXG A;  2PYK A;  4HJ8 A;  3U4Z A;  1S5F D;  1KDC A;  4G4K A;  4FP5 D;  4CJ0 B;  3T56 B;  1QWY A;  3ERS X;  2A8V A;  1DCZ A;  1BQQ T;  2P5Z X;  2ZJQ A;  1FJG L;  2EY6 A;  1S72 A;  4Q5V A;  3BVG A;  5M5X B;  1XPR A;  1A3U A;  1B1Z A;  4A3J H;  2BOS A;  2N49 A;  1Q8I A;  1L2F A;  3E9H A;  2KA7 A;  2R3Z A;  4CDF C;  5EPL A;  1GUW A;  3U9O A;  1AP0 A;  1IYU A;  1K83 B;  4I7Z C;  2L12 A;  4IQZ A;  4C1N K;  1X56 A;  1MBY A;  2LXJ A;  1EY6 A;  4C3H H;  5IP7 H;  2UU9 L;  2PO4 A;  1Q86 C;  1CSP A;  1LT5 D;  2MFI A;  2E5L L;  4DR7 Q;  1B70 B;  2EYM A;  1CKO A;  4GNX B;  1IXR A;  3I70 A;  4A3M B;  3OIP A;  4DGZ A;  1YEZ A;  1S40 A;  4BY7 B;  2DY7 A;  4PV1 C;  5EAY A;  1JB7 A;  3I72 A;  4ZQ3 A;  4LFC L;  3MXP A;  4V19 0;  1EUJ A;  1YHB A;  2JYO A;  3GTP B;  4A3B H;  2HD3 A;  4JCV E;  1XNQ L;  4DF7 A;  4P72 A;  1A6X A;  4UPA A;  3H0G B;  2CFM A;  1EQT A;  2ICI A;  3R3O A;  4HJA A;  4TQU S;  4UHV A;  1Y69 U;  2CVR A;  3GTJ H;  1EEF D;  1PYW D;  4DUZ L;  1VS0 A;  1JWS D;  1QUQ A;  3OYY A;  3CPW A;  1UEA B;  1FGU A;  2A6E C;  2Z6K A;  4HID A;  2RQX A;  5JJI A;  1E2Z A;  1I4Q A;  1EQQ A;  2XGT A;  1JB3 A;  1PXU A;  4HJ5 A;  4K5X A;  2LMC B;  1X3F A;  1EIG A;  4A3J G;  1HZC A;  4KN4 C;  4TKO B;  2O5J C;  4L8J A;  4BBS B;  4PZ7 A;  4HIM A;  5IWA Q;  2CH4 A;  1YHQ A;  4V0B A;  1CSQ A;  2ZXP A;  4IUV A;  4AQY L;  2UUC Q;  4C3H G;  5IP7 G;  4DV1 Q;  1I4P A;  3HOV H;  1D5X C;  1DXM A;  2VXW A;  4WJ3 M;  2IHF A;  4C3J B;  4IFD J;  5IY0 A;  1OTC A;  4N8F A;  1LO5 D;  4IFD H;  3PCO B;  1SE8 A;  4IPG A;  1X3E A;  5LMN L;  4I65 A;  5IYC H;  3QJY A;  4DR5 L;  1Q7Y C;  1ENA A;  2VB3 X;  2VW9 A;  4A3B G;  3PO3 B;  2QEX A;  2JP1 A;  1IBK Q;  2NVT H;  1Z9F A;  1U4L A;  1VQO A;  1LTI D;  5FKA C;  3J81 c;  3HOY H;  4GS3 A;  1EYC A;  1BVS A;  4JBM A;  1F9Q A;  1EY7 A;  3D4R A;  1BCP B;  4H7B A;  5DEH A;  3HS0 C;  3T53 B;  3R8B A;  1K73 C;  1GOZ A;  3K8A A;  5E1F A;  2VS1 A;  3K5M A;  3L0O A;  1H9K A;  4LF8 Q;  2IX1 A;  3AU7 A;  1STE A;  1B50 A;  1K8G A;  4YCV A;  3NBH A;  1HQR D;  3T1Y L;  1KLG D;  1TWC B;  4X65 Q;  1PRT D;  3GV6 A;  2A69 D;  3H15 A;  3MXU A;  1D7Q A;  5JPN C;  1LT4 D;  4A3I B;  4DV3 Q;  1KAA A;  4DR3 L;  3JC6 6;  3VYS A;  1WTH A;  3UDF A;  2F0V A;  3HOV G;  1SE3 A;  1GUN A;  4NDX A;  3K81 C;  1IBL Q;  2DNC A;  3QOL A;  1EZ6 A;  2F0S A;  1ICW A;  4YIJ A;  3ZJY C;  1VQA A;  5DLQ E;  4K8I A;  1QVG A;  4IFD G;  3H6M A;  1MIU A;  4RMF A;  3A7L A;  4DR4 L;  1SYC A;  5CGK A;  1GKH A;  2ZM6 Q;  4X66 L;  5IYC G;  1TWA B;  5M3M G;  2VQE L;  1Q8K A;  5M5W H;  4QL5 A;  2EZV A;  1PH2 A;  1F2M A;  5I6Y A;  3HRZ C;  5I9P A;  5KGU A;  1T5E A;  5ELE A;  4A3D B;  3HOY G;  3D3R A;  1L0X B;  3VR5 A;  1X3Q A;  1NTG A;  1JOO A;  1K8O A;  1KAB A;  4DN4 M;  3PUW A;  3GP7 A;  2RBM A;  1I4H A;  2KJX A;  4AYB G;  3V2T A;  4RCO A;  3CP0 A;  5C4J B;  1N32 Q;  3PSI A;  1SYG A;  4HIO A;  1CT1 D;  4OXP A;  1Q81 C;  4BY1 G;  1D5M C;  2VQF Q;  4A93 B;  1ET9 A;  1Z7T A;  3TSS A;  3CCS A;  1ROD A;  1HNW L;  1ZYR C;  3I90 A;  1QZG A;  1EIF A;  4GKJ Q;  2RDF A;  4OGQ C;  5EPJ A;  2NVQ B;  2JXM B;  4JV5 L;  4PG3 A;  3V05 A;  4BA1 I;  4XQJ A;  3AMU A;  1GHJ A;  4R4C A;  4PZ8 A;  2HDL A;  3G6E A;  4BA2 I;  3FVQ A;  3KFU A;  3A55 A;  4QQB X;  2C9O A;  1SEB D;  2WB1 G;  4DNI A;  1YIT A;  2PW5 A;  1ILQ A;  1EIH A;  5EPK A;  4KY5 A;  5JPM C;  4YY3 Q;  3G48 A;  2N78 A;  3ERO A;  1Y8N B;  3CKI B;  3I73 A;  2Z8L A;  3GTG B;  3DM1 A;  3QO2 A;  2PQA B;  1I5F A;  2Y0S G;  3W5O A;  2WAQ E;  3DWQ A;  4A3J B;  1HUN A;  2IL8 A;  1VMP A;  3W1G A;  4OWX B;  3KLS A;  4XIG S;  3MAQ A;  2OEO A;  2HIV A;  4C3I H;  4R4Q A;  1IL8 A;  1K9M C;  1PFN A;  2LY7 A;  2MHV A;  4C3H B;  4JI0 L;  2G9D A;  1PZJ D;  2EDG A;  1NCV A;  1A0I A;  1HFN A;  3EJI A;  3VA5 A;  2A68 C;  3TEH B;  1NMF A;  4IO9 A;  4JI6 Q;  3MFY A;  2UXD Q;  3S2D H;  1NBW A;  1P8L A;  1HJP A;  3QR8 A;  1QVF A;  3LX0 A;  3Q24 A;  2EXZ A;  2YTV A;  3FDT A;  1UE1 A;  3RLO A;  5TSS A;  3FMC A;  4A3B B;  3L9A X;  2I0Q A;  1AFP A;  1PZK D;  4LUO A;  1LTB D;  1SMX A;  3C3L A;  4U67 3;  1F9S A;  2CH4 W;  3FRP B;  1TS3 A;  2C5C A;  1Y1W H;  5BR8 L;  3GTJ B;  2JA5 H;  4P73 A;  3OMG A;  1C4Q A;  5HY6 A;  4RKB A;  1HXY D;  1EU3 A;  5D14 A;  3P75 A;  1X32 A;  1NR2 A;  1BCP D;  1LT6 D;  1A62 A;  3JAM E;  4UAI A;  4GOP B;  3FHW A;  2SEB D;  2PMZ B;  3QIA A;  4X6A H;  3HEJ A;  3K5N A;  2N8N A;  4ODG A;  2EVB A;  3Q8D A;  3DM3 A;  2EYF A;  2ID0 A;  4YCW A;  1D2B A;  2A6H D;  2K4K A;  5FO7 B;  1J9O A;  3F8T A;  1DOM A;  4DV7 Q;  4OX9 Q;  4C3I G;  3SDZ A;  1PH7 A;  5L37 A;  3RN2 A;  3U9S A;  3HOV B;  3HFZ B;  2KQ3 A;  1F2Y A;  4HTH A;  3SK8 A;  3DWP A;  2RDH A;  4BXX H;  2B2U C;  3BDC A;  4XTC S;  4DR1 L;  3D6C A;  4OHJ A;  3NBI A;  3SHL A;  1B3Q A;  3PF5 A;  5COR A;  5I9O A;  1AN8 A;  4LW1 A;  2HUG A;  4IFD I;  2SOB A;  1NSN S;  3F2U A;  1PTO C;  3JAM i;  1TKW B;  1N33 Q;  4O2D A;  5M3M B;  2PNR C;  4R9W A;  4YHH Q;  4X3U A;  5GQO A;  2F4V Q;  3TDQ A;  2NVT B;  5CV4 A;  3M4O B;  2O4X A;  4X3T A;  3ULJ A;  3KJP A;  2DUD A;  1Y1W G;  5EGT A;  4OEM B;  3BU2 A;  4A3M H;  2O5I C;  4ZAI A;  1SND A;  2JA5 G;  4HR7 B;  2H1E A;  1L0Y B;  2CKZ B;  2CWP A;  4IUN A;  1WTP A;  3J7Z C;  3CCJ A;  4BY7 H;  3A56 A;  4CJ1 B;  1FNW A;  2X69 A;  1O7L A;  4JI5 Q;  3FEW X;  3NBH B;  3J80 E;  3HOU H;  1A3V A;  1YVC A;  1H9S B;  1WTO A;  3I56 A;  2YTY A;  4AYB B;  1A8V A;  4JBK A;  2BA1 A;  5GAD C;  2HHH L;  4JI3 Q;  3H0G H;  3KYH C;  3SEB A;  3I4M B;  2F0O A;  1A15 A;  3JAM L;  1PLF A;  4BY1 B;  4DR6 Q;  2IJ0 A;  3A5U A;  4L5R C;  4LMQ D;  1X3G A;  2Z0S A;  2MQH A;  1PH8 A;  2LS0 1;  1STA A;  4N9P A;  4BXX G;  2IHE A;  3MXN A;  2Q8I B;  2KCM A;  4DK6 C;  5JJL A;  3R2I A;  3HKZ B;  1TQO A;  1F2Z A;  1N9W A;  4RAU C;  1VQC A;  4BBS H;  3I4N G;  3J80 i;  4POF A;  2WB1 B;  3S17 B;  3E0J A;  1K8A C;  1HTL D;  4O1N A;  5BN4 A;  3PIO 3;  5M5W B;  3RZO H;  2JSO A;  1HUM A;  4RGM A;  1XYI A;  2UXB L;  1IKM A;  4JYA L;  2RKS A;  4C3J H;  1VQ7 A;  1HR0 Q;  1STN A;  3PGZ A;  5I6W A;  4A3M G;  4IJL A;  2HT1 A;  1G29 1;  1G6Z A;  1HH2 P;  1XMO Q;  2JA8 H;  2K50 A;  4QJF A;  4ALP A;  2XN9 C;  4BY7 G;  2B39 A;  1VQP A;  4JI1 L;  2NZH A;  4FXG C;  4RKL A;  3HOU G;  4LF5 L;  4O42 A;  2UUA L;  2RSO A;  3QWN A;  1XTD A;  3PO3 H;  1GD7 A;  4U68 A;  3H0G G;  1EYA A;  1Q12 A;  4QMG A;  4KJO A;  1EY9 A;  2K5D A;  1VCI A;  1BBU A;  3CCV A;  3DUZ A;  4NXM L;  1AZQ A;  5J3B A;  1AH9 A;  1HTP A;  3L3O C;  3U58 A;  1MHW C;  5C3E G;  1RCV D;  3M7N A;  1SYF A;  1G91 A;  3E6Z X;  1X3P A;  3NQT A;  1LYL A;  3EVQ A;  3OPO A;  4P74 A;  2CHB D;  2WKD A;  4QUF A;  2A69 C;  2E74 C;  3HKS A;  4IOC A;  3WOF A;  1VQL A;  3AFQ A;  1QIL A;  1M8A A;  2MP1 A;  4NXN L;  1MGS A;  2B2V C;  5M9O A;  3E5S A;  2L15 A;  2I5M X;  4IPH A;  4C3J G;  4K5W A;  1Y14 B;  4B3R L;  4FO2 A;  1ESF A;  5LL6 S;  4M8A A;  2KUM A;  3OMC A;  2R7Z H;  2K75 A;  3CCU A;  1PVO A;  1FGB D;  2JA8 G;  3U50 C;  1LTL A;  2QIL A;  3PUZ A;  1DON A;  2KOL A;  3S15 H;  4JI2 Q;  1M90 C;  2A73 B;  1TWA H;  2NBF A;  5GAG C;  5KIX A;  4K2L A;  4XYO A;  1M4V A;  5C5L A;  3DWA A;  3TRE A;  4C3I B;  3PO3 G;  3PMF A;  1EEI D;  3KF8 A;  1GUG A;  1J5E Q;  4A3D H;  4JI8 Q;  5E7N A;  5CBE E;  1JJC B;  4HSV A;  5LMU L;  2R93 H;  4JI4 Q;  5ELF A;  4LUZ A;  3C1F A;  3MC0 B;  3EFX D;  4B3T L;  4HMJ A;  4LFA Q;  3S2D B;  1D5Z C;  2B2W C;  5IE8 A;  2Q2U A;  2OTL A;  1SAP A;  3J7A F;  1ML0 D;  3CC7 A;  4OIJ A;  4I7A A;  4DV5 L;  2M2L A;  3V96 A;  4Y52 H;  3DMU A;  4JI7 Q;  5IGE A;  4DK3 C;  2MNA A;  2JA7 B;  1RTO A;  3KLR A;  4A93 H;  2WAC A;  3H09 A;  2SNM A;  5G3L F;  3RLF A;  1CZW A;  2JA5 B;  1I94 L;  3L7Z C;  5FLX E;  4NPS A;  4P2C B;  1EZ8 A;  5JOB A;  3KJO A;  1FJG Q;  5I2X A;  2NVQ H;  1HZ9 A;  2PPB C;  1TVX A;  4CJ2 C;  2R7Z G;  2B8G A;  5ELD A;  1TY2 A;  2SDF A;  3PIP A;  3E0E A;  1UUP A;  1N36 L;  2UU9 Q;  1EYD A;  2E5L Q;  5IOD A;  2B2T C;  3GTM H;  4CDC C;  4A3D G;  1EY4 A;  5IT9 E;  1VQF A;  2FFK B;  5CC4 A;  2D0O A;  3GTG H;  1CQF A;  2R93 G;  1IKL A;  1F77 A;  1U9R A;  4LFC Q;  1H9J A;  1SNQ A;  3NTK A;  1LLR D;  1BBW A;  2F0G A;  3T4A C;  2PQA A;  1HA6 A;  4PMW A;  1XNQ Q;  1FD7 D;  3SK6 A;  3I4N B;  3RUZ A;  1BXT A;  2F0J A;  2K6A A;  2F0M A;  4LJZ C;  2F3V A;  1JE5 A;  4UP8 A;  5CV6 A;  2ZT9 C;  4DUZ Q;  3CCL A;  2N3S A;  4A93 G;  2ZTD A;  1HNZ L;  3I3C A;  3CD6 A;  4F7X A;  1XTC D;  4LNQ A;  5KEE A;  1RDP D;  1SJH D;  2L11 A;  1EOV A;  1U4P A;  4LF9 L;  3VR6 A;  3WWV A;  1B44 D;  2HDM A;  1TS4 A;  2AHO B;  3BDL A;  3BG3 A;  4J15 A;  3HOU B;  4KY7 A;  2F0H A;  5FO9 B;  1D8L A;  3RR5 A;  4IUP A;  2UUB L;  2EXD A;  4AQY Q;  2A19 A;  3OWF A;  1SMY D;  2EY2 A;  4KKT A;  5AFW A;  5C4H A;  5D65 A;  2QKI C;  4WRD A;  5FO8 B;  2RHQ B;  4ID6 A;  2XSC A;  1GO3 E;  2TSS A;  1PYB A;  2E2I B;  1B8A A;  3MXN B;  4B9X A;  5C3E B;  2KHS A;  4L6T B;  1VF5 C;  5LMN Q;  2NZ1 D;  1CHP D;  2E8G A;  1GM5 A;  4DR5 Q;  1S3O A;  4GOP A;  2R61 A;  4CGY B;  1V1Q A;  4RFB A;  2J4X A;  4X3S A;  5IT9 L;  4P71 A;  2F52 A;  4OO1 H;  2F0F A;  1P16 A;  4QIW B;  1TS2 A;  3TRZ A;  1TWF H;  3VR4 A;  5HGT A;  5CMD A;  1II3 A;  1CKN A;  4N9T A;  3RZO B;  2BH8 A;  3NXW A;  1XPO A;  1STH A;  3ULP A;  2OCE A;  1SRU A;  3BVZ A;  1PYS B;  3C46 A;  3MA2 B;  1GUT A;  1RL2 A;  3KLW A;  3AEV A;  3RD4 A;  4F88 A;  3J81 j;  5EQ0 A;  4PZ6 A;  2JA8 B;  1A3T A;  1UEB A;  3T1Y Q;  2F0P A;  2HCC A;  5M3M H;  4WFN 3;  4HAE A;  1I50 H;  3M4O H;  2B63 B;  4K6D A;  2L5T A;  2VL6 A;  1JMC A;  2VZA A;  4LF6 L;  4DR3 Q;  4A3K H;  3TQY A;  1SFO H;  1CK1 A;  4CDE C;  3STB D;  1YJ9 A;  2KEN A;  3LNN A;  3ND8 A;  1YIJ A;  1MSG A;  1C0A A;  5JEA G;  3AB9 A;  2MO0 A;  2NN6 H;  5ELB A;  2PZU A;  4R4T A;  4DA2 A;  5IP9 G;  4DR4 Q;  2K1B A;  4XT3 B;  2BE5 C;  4X66 Q;  1B3A A;  1H9S A;  2RDG A;  3I4M H;  4LFB L;  4RCN A;  1X9N A;  2VQE Q;  2OQK A;  5IGG A;  4JBJ A;  4OO1 G;  2F3I A;  2Z4H A;  4BY1 H;  3H91 A;  3NK9 A;  5C4Z A;  2UXC L;  1ET6 A;  2Q8R E;  2KED A;  1W3S A;  1HQM C;  4H13 C;  2VY3 A;  2IT1 A;  3OHX C;  3P7J A;  5EBC A;  2PZW A;  1CQV A;  5E3F A;  1YNX A;  4DK0 A;  2F0W A;  2R7Z B;  1PTO F;  1LV9 A;  4R4I A;  1WD1 A;  5E4X A;  1Y8P B;  2XVS A;  3S15 B;  1C7Y A;  1PMR A;  4ME3 A;  3H3V H;  2OXP A;  3ERQ A;  1KLU D;  4KMU C;  5LMN W;  1VQM A;  1Y1V B;  1UWV A;  3KF8 B;  3S17 H;  1JJG A;  1GJX A;  1V9P A;  2LKV A;  1W2B A;  3RNU A;  4X64 L;  3AFP A;  5FOB B;  3S14 B;  1HNW Q;  2HQL A;  4A3K G;  2B2U A;  3I2Z A;  2R93 B;  1IW7 D;  4MTN A;  3S1M B;  2MUY A;  1O7I A;  1PTO H;  4X62 L;  4JV5 Q;  2NN6 G;  3CW2 C;  1XNR L;  4EQ5 A;  1TY0 A;  3S24 A;  4CHT B;  3ONA B;  3VYR A;  2ZJR A;  1B4O A;  2XWJ B;  3IRB A;  2A5H A;  1EYG A;  1VF7 A;  3E9I A;  2FMM A;  1BBX C;  4GKK L;  1SE2 A;  1RF2 D;  3CF5 A;  2F0N A;  3I4M G;  1VQH A;  2IX3 A;  4H02 A;  2EYP A;  1AZP A;  1OXS C;  3S1N B;  1LTT D;  3BYT B;  2VB2 X;  3HGB A;  4GLV B;  3EQL C;  4JC0 A;  4ILW A;  2KEE A;  3NQI A;  4Z9C B;  4J1M A;  3MEH A;  5IOC A;  1HRJ A;  2B2Y A;  4KJN A;  1ICF B;  1CM9 A;  2BCO A;  1CI3 M;  2MPM A;  1PH6 A;  3W2D A;  1QNU A;  1UE5 A;  2EJG C;  3P1H A;  4KKU A;  1K0R A;  3HKZ G;  2O2L D;  1KHI A;  1LM0 A;  5BN3 A;  1O7Y A;  1OXU A;  3BJU A;  4G7Z C;  2F4I A;  3A74 A;  4PMB A;  4JI0 Q;  1QB5 D;  1WVL A;  1YNN D;  3UE1 A;  3HOZ H;  3NTI A;  2EYL A;  3GTM B;  1S5D D;  3RZD B;  2EY5 A;  2GVB A;  3URY A;  1N34 L;  4P75 A;  5C6A A;  1V43 A;  3K57 A;  3QB3 A;  1RJT A;  1ZKO A;  3GDE A;  1IHZ A;  3RMH A;  4DUY L;  1I4X A;  3K5L A;  2CW0 C;  1KRS A;  3HZX A;  4A4I A;  1IYJ B;  3TS0 A;  2F03 A;  1VQ4 A;  3J81 E;  1L1O C;  1VQE A;  2NWG A;  3MZ5 A;  5C5M A;  5BR8 Q;  3KBX A;  1EY0 A;  4GN5 A;  4R8N A;  3I55 A;  3HG9 A;  1F2L A;  1WI5 A;  2XRS D;  3BZK A;  4KD3 A;  4G57 A;  1PH3 A;  4A3C H;  2K04 A;  2PZT A;  1X65 A;  1Z47 A;  3Q0A A;  1PRT F;  1TU2 B;  1D1I A;  4B3M L;  1NJI C;  2Y0S E;  4UP9 A;  3CCQ A;  3F2B A;  2CQO A;  4IPC A;  4RA8 A;  3D4W A;  2K5H A;  2KVM A;  2JA7 H;  2B29 A;  3VDY A;  4CDD C;  1K3B C;  1STY A;  3J7Y W;  1Q1B A;  1H95 A;  1HHV A;  1DYQ A;  3SK4 A;  3J81 i;  2EPB A;  2JE6 I;  1YI2 A;  3HOZ G;  1OXV A;  3FPU B;  1FNV A;  4DR1 Q;  2F0U A;  1CHQ D;  4TRD A;  1TR5 A;  4IUQ A;  4OIK A;  2BH2 A;  3PUY A;  2QA4 A;  5M5Y B;  4K8J A;  1OXX K;  4RGN A;  1FVI A;  4IJH A;  5EKL A;  4JOI A; 
#chains in the Genus database with same CATH homology
 4FF1 A;  3MVV A;  2HCI A;  1QJO A;  4M1U B;  2EYO A;  2ZXO A;  3ND9 A;  4DNT B;  1TWF B;  1LTA D;  4OO1 I;  4PNY A;  2NTS A;  2B2V A;  2ENB A;  2A74 C;  3EA6 A;  1PFM A;  2N88 A;  2K03 A;  1EY5 A;  2BA0 A;  3N6R A;  1JC7 A;  3K59 A;  3P20 A;  1WTW A;  5C3X A;  2J7Z A;  4K14 A;  4HCS A;  1ENC A;  5DNF A;  4IZ8 A;  1PFB A;  1I50 B;  1YNJ D;  1O7Z A;  1OO9 B;  3UI2 A;  2F0E A;  4A3K B;  4X3K A;  1SFO B;  1I3Q B;  4A3E B;  4DK1 A;  4EVO A;  1KTK A;  3CRL C;  4QUC A;  2B2W A;  3HP3 A;  4WJW A;  1Y8O B;  1I6H B;  2NN6 I;  3D6W A;  4XQQ A;  2PCF B;  1SMY C;  3DXJ C;  4OL7 A;  4DAV A;  3MTS A;  1EQV A;  5F2D A;  2MJ8 A;  3NWT A;  1U4M A;  2Q8T A;  1R9T B;  2NYZ D;  2WKC A;  1BUV T;  3VR2 A;  3A54 A;  2ICE C;  1QOH A;  2F0I A;  4QCL A;  1NR4 A;  4LK1 C;  5KNC A;  2EJM A;  2D5D A;  2EJF C;  1ONL A;  4DFA A;  5K36 H;  1SDF A;  3KBG A;  3TZD A;  2M9V A;  2B2T A;  5EKK A;  2WAQ B;  1XWE A;  1ESR A;  1QNK A;  1S5E D;  3K7A B;  1WTR A;  3LWE A;  1PTO B;  2EYJ A;  1Q90 A;  2I07 B;  1ZEQ X;  1ENF A;  2KCN A;  3TME A;  4CKE A;  3MHB A;  1E0B A;  4XXE A;  1MI2 A;  5M3F B;  4RGO S;  1BCP F;  4IAL A;  3J80 L;  3TN2 A;  3I91 A;  4NW2 A;  1MSH A;  2H4O A;  1A2T A;  4MIU A;  1STB A;  5J22 A;  1RTN A;  3TZU A;  4EQN A;  3IFT A;  1PRT C;  1JE4 A;  3C1E A;  3TP7 A;  3NSW A;  3X3N A;  5C0X H;  4B08 A;  5KYI A;  3K58 A;  5K36 G;  5IGF A;  3HOZ B;  5EBD A;  3NHH A;  1B2T A;  3OW7 A;  5I4D A;  1KDA A;  3G6J B;  3SE0 A;  2QF7 A;  1SJE D;  1SXT A;  2F0K A;  5JJZ A;  4CKC A;  1G2T A;  3FPP A;  3T51 B;  2D62 A;  1DOL A;  1R4Q B;  2K05 A;  1BF4 A;  4BBR B;  3OWE B;  4KY6 A;  5HUR A;  1LTG D;  3I8Z A;  3TP8 A;  3H94 A;  2K5Q A;  2JEB I;  4ZKC B;  5CR3 A;  3T13 A;  5EKI A;  1GXD C;  5C0X G;  3GTO B;  1D6E C;  1ZXT A;  2KCC A;  4RGT A;  4KV6 A;  4RHR A;  3MFG A;  4DXG A;  1WTQ A;  2AQ2 B;  2K33 A;  4HMI A;  1CA5 A;  2L4N A;  5CV5 A;  3DHQ A;  3I4L A;  2DNE A;  1XX8 A;  1S4Z A;  2I46 A;  4JBW A;  4EQO A;  3S16 B;  2IX0 A;  1JQY D;  1AEX A;  3A8K E;  4CBV A;  1I6V C;  5J39 A;  3IFD A;  4KN7 C;  1V1O A;  5ELC A;  1SYE A;  4C1N I;  2F1M A;  3GQB A;  5IGD A;  1Q1E A;  1TWH B;  1UAP A;  1H9R A;  3K0Y A;  5A35 A;  2EYH A;  3VYU A;  1V8Q A;  1EWH A;  4ZRZ A;  4HCE A;  1PTO D;  2EOT A;  2XNA C;  2N55 A;  5FLX L;  5I2Y A;  4KTA A;  3S2H B;  3PUX A;  4XT1 B;  2FHT A;  2BDO A;  3O13 A;  5JEA J;  5JEA H;  3N52 A;  1BCP C;  1KNE A;  1IYV A;  2WP8 J;  4F87 A;  4QB4 A;  2M00 A;  1OXT A;  4CKB A;  4KHZ A;  3SXH A;  2A6H C;  3FKI B;  1I4R A;  2VUM B;  4A3F B;  1TS5 A;  1LAB A;  4MN3 A;  2IW3 A;  4NP5 A;  1B53 A;  5IGC A;  4XDX A;  1SNC A;  4KK7 A;  5BN5 A;  5CYU A;  5KND A;  1YNJ C;  5IGB A;  4ABN A;  1HFG A;  3S1R B;  1B9N A;  3T16 A;  3HOX B;  1DD2 A;  4QF4 A;  4C56 C;  1B9M A;  1QCB D;  4IN3 A;  3K5O A;  3M85 A;  3WOE A;  1PDQ A;  1SYD A;  5C4X B;  4FF2 A;  2Z4I A;  4IUU A;  5CBA E;  2GA4 B;  5C44 B;  3HOW B;  1LAC A;  1JCK B;  2QDB A;  2MGS A;  4G7H C;  4GZY C;  4PMC A;  2YU9 B;  4DAY A;  2NB0 A;  3G7L A;  1SYB A;  2F0L A;  3SVM A;  5C0X I;  1V1P B;  1VDZ A;  3D31 A;  2J0T D;  4NMZ A;  2XIW A;  1WCM B;  1TT2 A;  2QCP X;  1JR0 D;  1LT3 D;  3A8J E;  4HED A;  5DM7 3;  4F8M A;  1WD0 A;  1ILP A;  3LWU A;  1S5C D;  1A2U A;  1SNP A;  1PZI D;  2YYZ A;  4ZUJ A;  2K01 A;  4LAA A;  2NTT A;  5T1I A;  4ZLT F;  2F0Q A;  3NWS A;  1EOT A;  1XXG A;  1O78 A;  2E2J B;  2FMC A;  3SK5 A;  1CA6 A;  3CQZ B;  3R2T A;  4ME5 A;  1BNZ A;  1GHK A;  3OIQ A;  4NKL A;  4R8I A;  5E4W C;  1DM0 B;  3VYT A;  1O80 A;  5D3I B;  5ISR A;  2L9H A;  1SBB B;  2JA6 B;  1FR3 A;  2L0C A;  1W6J A;  5JVH 3;  3W3A A;  1JIC A;  1JWU D;  1I4G A;  1S5B D;  5CV8 A;  2AUK A;  3GO5 A;  4RHS A;  1EU4 A;  4H44 C;  2SNS A;  3K6O A;  1BOS A;  2RVL A;  4FXK C;  4ZYS A;  1EWC A;  1BR9 A;  4JK1 C;  5KYL A;  4J8Q A;  2OT2 A;  1AW7 A;  5CV9 A;  1FNU A;  4KHV A;  4ZUI A;  1NAP A;  2IWH A;  4RH6 A;  1C8C A;  4IUT A;  1U4R A;  3ITP A;  1WTX A;  1WTV A;  1E2V A;  4HN7 A;  2AWN A;  4C2M B;  1LTS D;  1JOQ A;  2NVY B;  3CRK C;  2NVX B;  3GTK B;  3OOC A;  3KUP A;  3BYY B;  5JVG 3;  1DJR D;  3NP8 A;  3M3Y B;  2RA4 A;  1DZ1 A;  1SSO A;  1Z6H A;  3BDO A;  3NE5 B;  3SR1 A;  2RSN A;  5CV7 A;  2V4D A;  3J7A V;  5JAV A;  2KEC A;  1EY8 A;  3PO2 B;  3R93 A;  2A6E D;  3CU7 A;  3C2P A;  3GTL B;  4S3S A;  1NUC A;  3TBI B;  3J81 L;  4K5V A;  1STG A;  4KKS A;  5NUC A;  3H3V C;  3X3M A;  1CFM A;  3IL8 A;  4E6I A;  4FF4 A;  2BDN A;  3GD7 A;  5FK9 C;  5LHY 1;  1QG7 A;  1TII D;  3ZYY X;  2AUJ D;  4FXD A;  2K7V A;  4H0L C;  4Y7N B;  3MWY W;  3NPP A;  1F9R A;  5DAU A;  2LFN A;  1QE6 A;  3HOY B;  4TSS A;  2G9H D;  4XYQ A;  4B9W A;  2B2Y C;  4UDU C;  5A2Q E;  1D1K A;  4ULL A;  3A7A B;  3NTH A;  4J6H A;  4RWS C;  2JEA I;  1F9P A;  2BE5 D;  2X6L A;  2WIN B;  4A3G B;  1H9M A;  4K6L A;  2E2D C;  4EGV A;  1SNO A;  4ZK9 B;  5G3L D;  3TP5 A;  1KNA A;  2XWB B;  1RD9 D;  1RHP A;  2Z1C A;  5IIF A;  3VA7 A;  1VMC A;  1G2S A;  4BWG B;  3IAY A;  1EFI D;  3BS1 A;  2OF1 A;  2PQE A;  3GV3 A;  1CTM A;  3BVM A;  2AQ1 B;  4FF3 A;  2K32 A;  4DXF A;  2Y0S B;  3WDN A;  2CQA A;  1JOR A;  4FNF A;  3QOJ A;  4BS9 A;  1KDB A;  4G7O C;  2K5W A;  1HCZ A;  3D4D A;  4Q0F A;  3TP6 A;  5A2Q L;  4K2K A;  3KK7 A;  5C0X J;  5LL6 X;  5DM6 3;  4HSP A;  3S9W A;  1CZG A;  2R6G A;  3D8G A;  1DOK A;  1UNS A;  1RKN A;  4DNR B;  2X6G A;  3BZD B;  2FIN B;  1JWM D;  2VNU D;  5C3W A;  5D3D A;  3Q22 A;  1ZYR D;  4EQP A;  1V1P A;  2F3W A;  1G8Z D;  5KRU A;  1EL0 A;  2DN8 A;  1C48 A;  1R4P B;  3DEP A;  5KNB A;  5EJW A;  2DY8 A;  5K5P A;  1K8M A;  4KI0 A;  2EY1 A;  2B8F A;  3GTQ B;  2L55 A;  4MHE A;  1HPC A;  1MD2 D;  1IW7 C;  2WV6 D;  4XQN A;  3VR3 A;  1T5X D;  2EE1 A;  2R92 B;  3DEO A;  4L63 B;  3OSO A;  2NUC A;  4WOR A;  4PQX A;  2CW0 D;  2HQE A;  2L1B A;  1SE4 A;  1TWG B;  4KD4 A;  2E75 C;  3A8I E;  3PV0 A;  1HA5 A;  4DAP A;  1W6K A;  2PW7 A;  2A68 D;  3QG1 A;  2AQ3 B;  2E2H B;  2TMP A;  2WII B;  2XRQ D;  3PIP 3;  3M4Y A;  1SNM A;  2F0T A;  2E76 C;  4FYD A;  2D9U A;  1BO0 A;  1PRT B;  1BDO A;  1GUO A;  3IKJ A;  1J8I A;  2ZXR A;  2D2C C;  5COY A;  4ZKB B;  2QEJ C;  1Y1W B;  3S1Q B;  3Q23 A;  1YNN C;  1E2W A;  4FVM A;  1LTR D;  2FJ2 A;  3KLS X;  1JOK A;  2K28 A;  3NUC A;  3PUV A;  1Q3L A;  4DU9 A;  2IPK D;  4IUR A;  1GUS A;  2F0D A;  3CHB D;  5T1G A;  2AWO A;  5J1Z A;  1FYC A;  3Q6S A;  3M7G A;  3MXG A;  2PYK A;  1S5F D;  1KDC A;  4G4K A;  4FP5 D;  4CJ0 B;  3T56 B;  1QWY A;  1DCZ A;  1BQQ T;  2EY6 A;  4Q5V A;  3BVG A;  5M5X B;  1A3U A;  1B1Z A;  2BOS A;  1Q8I A;  2KA7 A;  2R3Z A;  5EPL A;  1GUW A;  3U9O A;  1AP0 A;  1IYU A;  1K83 B;  4I7Z C;  2L12 A;  4IQZ A;  4C1N K;  1MBY A;  1EY6 A;  2PO4 A;  1LT5 D;  2EYM A;  3I70 A;  4A3M B;  3OIP A;  4DGZ A;  4BY7 B;  2DY7 A;  4PV1 C;  3I72 A;  4ZQ3 A;  3MXP A;  4V19 0;  2JYO A;  3GTP B;  4DF7 A;  1A6X A;  3H0G B;  2ICI A;  1EQT A;  3R3O A;  4TQU S;  1Y69 U;  2CVR A;  1EEF D;  1PYW D;  1JWS D;  1UEA B;  2A6E C;  2RQX A;  1E2Z A;  1I4Q A;  1JB3 A;  1PXU A;  4K5X A;  2LMC B;  1EIG A;  4KN4 C;  4TKO B;  2O5J C;  4L8J A;  4BBS B;  4V0B A;  2ZXP A;  4IUV A;  4C3H G;  1I4P A;  1D5X C;  1DXM A;  2VXW A;  4C3J B;  4IFD J;  1LO5 D;  4IFD H;  4I65 A;  3QJY A;  1ENA A;  2VB3 X;  3PO3 B;  2JP1 A;  1U4L A;  1LTI D;  5FKA C;  1EYC A;  1F9Q A;  1EY7 A;  3D4R A;  1BCP B;  4H7B A;  5DEH A;  3HS0 C;  3T53 B;  3R8B A;  1GOZ A;  5E1F A;  3K5M A;  1H9K A;  2IX1 A;  3AU7 A;  1STE A;  1B50 A;  3NBH A;  1HQR D;  1KLG D;  1TWC B;  1PRT D;  3GV6 A;  2A69 D;  3MXU A;  5JPN C;  1LT4 D;  4A3I B;  1KAA A;  3VYS A;  2F0V A;  1SE3 A;  1GUN A;  4NDX A;  2DNC A;  3QOL A;  1EZ6 A;  2F0S A;  1ICW A;  4YIJ A;  4K8I A;  4IFD G;  3H6M A;  3A7L A;  1SYC A;  5CGK A;  1TWA B;  2EZV A;  1F2M A;  5I6Y A;  5KGU A;  3HRZ C;  5I9P A;  1T5E A;  5ELE A;  4A3D B;  3D3R A;  1L0X B;  3VR5 A;  1X3Q A;  1JOO A;  1K8O A;  1KAB A;  4DN4 M;  3PUW A;  3GP7 A;  2RBM A;  1I4H A;  2KJX A;  3V2T A;  4RCO A;  5C4J B;  1SYG A;  1CT1 D;  1D5M C;  4A93 B;  1ET9 A;  1Z7T A;  3TSS A;  1ROD A;  1ZYR C;  3I90 A;  2RDF A;  4OGQ C;  5EPJ A;  2NVQ B;  2JXM B;  3V05 A;  4BA1 I;  4XQJ A;  3AMU A;  1GHJ A;  2HDL A;  4BA2 I;  3FVQ A;  3A55 A;  2C9O A;  1SEB D;  2PW5 A;  1ILQ A;  1EIH A;  5EPK A;  4KY5 A;  5JPM C;  3ERO A;  1Y8N B;  3CKI B;  3I73 A;  2Z8L A;  3GTG B;  3DM1 A;  3QO2 A;  3DWQ A;  4A3J B;  1HUN A;  2IL8 A;  1VMP A;  3KLS A;  4XIG S;  3MAQ A;  2OEO A;  1IL8 A;  1PFN A;  2LY7 A;  2MHV A;  4C3H B;  2G9D A;  1PZJ D;  2EDG A;  1NCV A;  1HFN A;  3EJI A;  3VA5 A;  2A68 C;  3MFY A;  3LX0 A;  3Q24 A;  2EXZ A;  3FDT A;  5TSS A;  3FMC A;  4A3B B;  3L9A X;  1AFP A;  1PZK D;  1LTB D;  3C3L A;  4U67 3;  1F9S A;  3FRP B;  1TS3 A;  2C5C A;  3GTJ B;  3OMG A;  1C4Q A;  4RKB A;  1HXY D;  1EU3 A;  5D14 A;  3P75 A;  1X32 A;  1NR2 A;  1BCP D;  1LT6 D;  3JAM E;  4UAI A;  2SEB D;  2PMZ B;  3QIA A;  3HEJ A;  3K5N A;  4ODG A;  2EVB A;  2EYF A;  2ID0 A;  1D2B A;  2A6H D;  5FO7 B;  1J9O A;  1DOM A;  4C3I G;  3SDZ A;  3U9S A;  3HOV B;  2KQ3 A;  1F2Y A;  4HTH A;  3SK8 A;  3DWP A;  2RDH A;  2B2U C;  3BDC A;  4XTC S;  3D6C A;  4OHJ A;  3NBI A;  3SHL A;  5COR A;  5I9O A;  1AN8 A;  2HUG A;  4IFD I;  2SOB A;  1NSN S;  3F2U A;  1PTO C;  1TKW B;  5M3M B;  2PNR C;  4R9W A;  4X3U A;  3TDQ A;  2NVT B;  5CV4 A;  3M4O B;  2O4X A;  4X3T A;  5EGT A;  2O5I C;  4ZAI A;  1SND A;  4HR7 B;  2H1E A;  1L0Y B;  1WTP A;  4IUN A;  3A56 A;  4CJ1 B;  1FNW A;  2X69 A;  1O7L A;  3FEW X;  3J80 E;  1A3V A;  1WTO A;  1H9S B;  4AYB B;  2BA1 A;  3I4M B;  3SEB A;  2F0O A;  1A15 A;  3JAM L;  1PLF A;  4BY1 B;  2IJ0 A;  4LMQ D;  2LS0 1;  1STA A;  4N9P A;  3MXN A;  2Q8I B;  3R2I A;  3HKZ B;  1TQO A;  1F2Z A;  4RAU C;  2WB1 B;  3S17 B;  3E0J A;  1HTL D;  4O1N A;  5BN4 A;  3PIO 3;  5M5W B;  2JSO A;  1HUM A;  4RGM A;  1XYI A;  1IKM A;  2RKS A;  1STN A;  5I6W A;  1G29 1;  1G6Z A;  2XN9 C;  2B39 A;  4FXG C;  4RKL A;  4O42 A;  2RSO A;  3QWN A;  4U68 A;  1EYA A;  1Q12 A;  4QMG A;  4KJO A;  1EY9 A;  2K5D A;  1VCI A;  3DUZ A;  1AZQ A;  1HTP A;  3L3O C;  1RCV D;  3M7N A;  1SYF A;  1G91 A;  3E6Z X;  1X3P A;  3NQT A;  3OPO A;  3EVQ A;  2CHB D;  2WKD A;  4QUF A;  2A69 C;  2E74 C;  3WOF A;  1QIL A;  1M8A A;  2MP1 A;  1MGS A;  2B2V C;  5M9O A;  3E5S A;  4C3J G;  4K5W A;  4FO2 A;  1ESF A;  5LL6 S;  4M8A A;  2KUM A;  3OMC A;  1FGB D;  2QIL A;  3PUZ A;  1DON A;  2KOL A;  2A73 B;  2NBF A;  5KIX A;  4K2L A;  4XYO A;  1M4V A;  5C5L A;  3DWA A;  4C3I B;  3PMF A;  1EEI D;  3KF8 A;  1GUG A;  5CBE E;  4HSV A;  5ELF A;  3C1F A;  3MC0 B;  3EFX D;  4HMJ A;  3S2D B;  1D5Z C;  2B2W C;  1SAP A;  3J7A F;  1ML0 D;  4OIJ A;  2M2L A;  3V96 A;  3DMU A;  5IGE A;  2JA7 B;  1RTO A;  3KLR A;  2WAC A;  3H09 A;  2SNM A;  5G3L F;  3RLF A;  1CZW A;  2JA5 B;  3L7Z C;  5FLX E;  4P2C B;  1EZ8 A;  5JOB A;  5I2X A;  2PPB C;  1TVX A;  4CJ2 C;  2B8G A;  5ELD A;  1TY2 A;  2SDF A;  1UUP A;  1EYD A;  5IOD A;  2B2T C;  1EY4 A;  5IT9 E;  2FFK B;  5CC4 A;  1CQF A;  1IKL A;  1F77 A;  1U9R A;  1H9J A;  1SNQ A;  3NTK A;  1LLR D;  2F0G A;  3T4A C;  1HA6 A;  4PMW A;  1FD7 D;  3SK6 A;  3I4N B;  3RUZ A;  1BXT A;  2F0J A;  2K6A A;  2F0M A;  4LJZ C;  2F3V A;  5CV6 A;  2ZT9 C;  3I3C A;  4F7X A;  1XTC D;  5KEE A;  1RDP D;  1SJH D;  2L11 A;  1U4P A;  3VR6 A;  1B44 D;  2HDM A;  1TS4 A;  3BDL A;  3BG3 A;  3HOU B;  4KY7 A;  2F0H A;  5FO9 B;  4IUP A;  3OWF A;  1SMY D;  2EY2 A;  4KKT A;  5AFW A;  5C4H A;  5D65 A;  2QKI C;  4WRD A;  5FO8 B;  4ID6 A;  2XSC A;  2TSS A;  2E2I B;  4B9X A;  5C3E B;  2KHS A;  4L6T B;  1VF5 C;  2NZ1 D;  1CHP D;  2R61 A;  4CGY B;  4RFB A;  2J4X A;  4X3S A;  5IT9 L;  4OO1 H;  2F0F A;  4QIW B;  1TS2 A;  3VR4 A;  5HGT A;  5CMD A;  1II3 A;  4N9T A;  3RZO B;  3NXW A;  1STH A;  3BVZ A;  3C46 A;  3MA2 B;  1GUT A;  3RD4 A;  4F88 A;  5EQ0 A;  2JA8 B;  1A3T A;  2F0P A;  2HCC A;  4WFN 3;  4HAE A;  2B63 B;  4K6D A;  2L5T A;  1CK1 A;  3LNN A;  3ND8 A;  1MSG A;  5JEA G;  3AB9 A;  2NN6 H;  5ELB A;  2PZU A;  4DA2 A;  2K1B A;  4XT3 B;  2BE5 C;  1B3A A;  1H9S A;  2RDG A;  4RCN A;  5IGG A;  4OO1 G;  2Z4H A;  3H91 A;  3NK9 A;  5C4Z A;  1ET6 A;  2Q8R E;  2KED A;  1HQM C;  4H13 C;  2IT1 A;  3OHX C;  3P7J A;  5EBC A;  2PZW A;  1CQV A;  5E3F A;  4DK0 A;  2F0W A;  2R7Z B;  1PTO F;  1LV9 A;  1WD1 A;  5E4X A;  1Y8P B;  2XVS A;  3S15 B;  1PMR A;  2OXP A;  3ERQ A;  1KLU D;  4KMU C;  1Y1V B;  1GJX A;  2LKV A;  5FOB B;  3S14 B;  2B2U A;  2R93 B;  1IW7 D;  3S1M B;  2MUY A;  1PTO H;  2NN6 G;  1TY0 A;  4CHT B;  3ONA B;  3VYR A;  1B4O A;  2XWJ B;  2A5H A;  1VF7 A;  2FMM A;  1BBX C;  1SE2 A;  1RF2 D;  2F0N A;  2IX3 A;  2EYP A;  1AZP A;  1OXS C;  3S1N B;  1LTT D;  3BYT B;  2VB2 X;  3HGB A;  3EQL C;  4ILW A;  2KEE A;  3NQI A;  4Z9C B;  4J1M A;  3MEH A;  5IOC A;  1HRJ A;  2B2Y A;  4KJN A;  1CM9 A;  2BCO A;  1CI3 M;  2MPM A;  3W2D A;  1QNU A;  2EJG C;  3P1H A;  4KKU A;  2O2L D;  5BN3 A;  1O7Y A;  1OXU A;  4G7Z C;  2F4I A;  4PMB A;  1QB5 D;  1WVL A;  1YNN D;  3NTI A;  2EYL A;  3GTM B;  1S5D D;  3RZD B;  2EY5 A;  3URY A;  5C6A A;  1V43 A;  3K57 A;  3QB3 A;  1RJT A;  1ZKO A;  1IHZ A;  3RMH A;  1I4X A;  3K5L A;  2CW0 C;  3HZX A;  2F03 A;  3J81 E;  3MZ5 A;  5C5M A;  2NWG A;  3KBX A;  1EY0 A;  4R8N A;  3HG9 A;  1F2L A;  2XRS D;  4KD3 A;  4G57 A;  2K04 A;  2PZT A;  1Z47 A;  3Q0A A;  1PRT F;  1TU2 B;  1D1I A;  4RA8 A;  3D4W A;  2KVM A;  1STY A;  3J7Y W;  1Q1B A;  1HHV A;  1DYQ A;  3SK4 A;  2EPB A;  2JE6 I;  1OXV A;  3FPU B;  1FNV A;  2F0U A;  1CHQ D;  4TRD A;  1TR5 A;  4IUQ A;  4OIK A;  3PUY A;  5M5Y B;  4K8J A;  1OXX K;  4RGN A;  5EKL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...