4IAWA

Engineered human lipocalin 2 (c26) in complex with y-dtpa
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
180
structure length
180
Chain Sequence
b'QDSTSDLIPAPPLSKVPLQQNFQDNQFHGKWYQVGRAGNAAPREDKDLLKMTAQTYELKEDKSYNVTAVRFRKKMCEYLTMTFVPGSQPGEFTLGNIKSYPGLTSYLVRVVSTNYNQHAMVFFKKVQQNREYFSISLLGRTKELASELKENFIRFSKSLGLPENHIVFPVPIDQCIDGSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Neutrophil gelatinase-associated lipocalin
publication title Structure-guided engineering of Anticalins with improved binding behavior and biochemical characteristics for application in radio-immuno imaging and/or therapy
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 45
structure length 180
sequence length 180
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 4iawA00
2AL0X 2FR3A 5B27A 1FENA 1BWYA 3O22A 3B2IA 4XMEA 4HPDA 1KT7A 5FENA 2NNEA 1QFTA 1YIVA 3GAQA 4O9SA 5DG4A 4ZHDA 5LJHA 4GNYA 1T68X 1LIBA 2RQ0A 4BVMA 1SXWA 2CZTA 1LIEA 1B4MA 4A1HA 5LJBA 5L8OA 1RBPA 3HWGA 3WBGA 1ADLA 2ASNX 3P6FA 1O1UA 1UZ2X 4MVIA 1YWDA 2QOSC 1JYJA 1QG5A 3UEWA 2JU3A 1X8OA 4GETA 3EM0A 4QZTA 2QO6A 2HMBA 3O19A 1B56A 1HBPA 1QY0A 2G79A 1ALBA 5BVQA 3U9PC 5HZ9A 4AZMA 2WUTA 2NP1A 1TVQA 5HZ6A 2WEWA 3FA7A 3FELA 1OBQA 1AB0A 2R74A 1P6PA 1NP4A 3WXQA 1GKAA 2AT5X 1OEKA 1ZRYA 2E4JA 1XCAA 1T8VA 4AYHA 4IB8A 3RZYA 1OBUA 4GRJA 3OJYC 1BJ7A 1IFCA 5HZQA 3G7XA 5LKFA 2Q4NA 4YFQA 2QO4A 3FMZA 3AKMA 3MVFA 4M7MA 3BU1A 4ZGUA 4I3BA 1R0UA 1GT5A 3QKGA 1GXAA 1YWAA 5K06A 5D8JA 2G78A 4N7DA 4M6SA 3WJBA 4AZNA 2OVEA 4GKCA 5DPQA 4YGZA 1DZJA 2RD7C 1G85A 4QYNA 4I3DA 1BRPA 3P6EA 4XMHA 1S2PA 3BX7A 2GC9A 5IO7A 1IFBA 3APXA 4DQ3A 3TGCA 2X45A 4EDEA 3FR5A 3MBTA 4RUNA 1PMPA 4YMYA 1SY1A 1B8EA 3KFGA 1BSOA 1RLBE 5HWZA 2HYSA 3FR2A 1VYGA 4LKPA 1MVGA 2YG2A 5F6ZA 2A0AA 4UU2A 1O1VA 1JZUA 4XMCA 3JSQA 1EW3A 2O62A 5HTEA 4ZHHA 1QFVA 1AQBA 3STKA 3B2JA 1EXSA 4ALBA 1GT4A 3VG4A 1CRBA 5JR8A 3CMPA 1KT6A 1G74A 1GX8A 1OPAA 1X89A 2AT0X 2FR2A 5H9LA 3NQ3A 5F6BA 3STNA 3D97A 1QY2A 2AT3X 3CR6A 1OPBA 2F73A 4HPBA 1MDCA 1E02A 2K23A 1EPAA 4RUUA 3VG2A 3U03A 1H91A 1I04A 3O2YA 4I9SA 4A1YA 3C76X 2L67A 3Q6LA 1KT5A 1LNMA 2X46A 4KIIA 4ORWA 4HFOA 2A13A 1SY0A 2LBVA 5HA0A 2MJIA 3F9DA 3SAOA 1IW2A 1GX9A 2XKLA 2W2BA 2XSTA 4NLJA 1YP7A 5H9NA 4CK4A 3PPTA 3NP1A 1VYFA 2LBAA 1G5WA 1I05A 2FT9A 1KT4A 1MX7A 1CBIA 3WJCA 3TGBA 2HLVA 4TKBA 3KZAA 5H9AA 3F8AA 3FEKA 3P6CA 3EYCA 1DZMA 1SA8A 1A18A 4NNSA 1X8QA 5HZ8A 5H9KA 4TNNA 1TW4A 4I3CA 4AW8A 1AVGI 1EPBA 1LKEA 2QO5A 1U17A 3D96A 4HPCA 1QQSA 3L4RA 5HCDC 1ICNA 2FWVA 1I4UA 2OZQA 4YH0A 4GE1A 4ZFXA 5HA1A 5KHPA 1U0XA 2FTBA 2BLGA 1HQPA 4OS8A 5B29A 1FTPA 2EU7X 1BM5A 1L6MA 3ZUIA 1JYDA 1TXLA 3EBKA 3T1DA 2CBSA 3I17A 4YCHA 4GH7A 2A3FX 4MVLA 2PY1A 2JU8A 5EDCA 1IKJA 1ZNDA 4LZUA 1O8VA 4XMFA 5D47A 1N0SA 2WR6A 2FRSA 2WWPA 3ZQ3A 3DTQA 4ORYA 2Q39A 1GT1A 4YKOA 5D45A 2R56A 3FA8A 1CBRA 4AZOA 5LJCA 3PEDA 1LFOA 3KFHA 4AZRA 1KQXA 4NP1A 3WJGA 1ML7A 1E5PA 2OVAA 1E00A 1SY3A 2JU7A 1PEEA 1FEMA 1OEEA 4YKMA 1NP1A 3VG3A 3FIQA 2NNQA 3FENA 2AT6X 4QAEA 1BSQA 2KT4B 1YP6A 2LB6A 1Z24A 3BSZE 2LFOA 2AKQA 2Q2PA 2RCTA 4ZHFA 3U0DA 1SXXA 3B2HA 4IAWA 3WVMA 4K19A 1QABE 5FAZA 1LIFA 3I0AA 1BLRA 1ACDA 1JJJA 1EQDA 2CBRA 2GTFX 4PSQA 4HPAA 5HCCC 3BRNA 2NNDA 1SY2A 1VPRA 3HWFA 1BSYA 1X8NA 1KGLA 1LPJA 5LJDA 1LIDA 4YDBA 1DF3A 5EPQA 3HWDA 3HK1A 4ZCBA 3APVA 4WFVA 4IMOA 3ZUOA 4ZJ0A 2DM5A 1DZPA 1FDQA 1OEJA 2HZRA 3B2KA 1XKIA 2A2UA 3NX2A 3FLLA 3ELZA 1ERBA 4Y0SA 1BBPA 1CJ5A 4WFUA 4DQ4A 5HBSA 3ELXA 1B0OA 1YWBA 4Y0QA 4AZQA 1KOIA 4TQ2A 2L68A 4ORRA 5L8IA 4ORSA 4NYRA 3C77X 3C78X 1JBHA 2L5PA 4ZHCA 5LKEA 1LF7A 2P8GA 2IFBA 2L9CA 1E06A 1GM6A 1HN2A 4ORXA 4R0BA 1D3SA 1D2UA 3DSZA 5BVSA 4NLIA 1YUPA 2MM3A 3JS1A 3NX1A 1ZNKA 4A8ZA 4EFGA 1DZKA 2RCQA 1TOWA 1PM1X 3RSWA 3P6GA 1IIUA 3D95A 3PECA 2N93A 2CM4A 4XMDA 4TJZA 1QWDA 2W2AA 5BVTA 4EEJA 3HWEA 5F7GA 2GJ5A 2KTDA 1SXUA 2RA6A 1ICMA 5L8NA 2WQ9A 3B2LA 1DFVA 2HZQA 3CWKA 3NR3A 5EEEA 5LJGA 1GKAB 3S26A 2Q9SA 3FW4A 1NGLA 5HZ5A 4QZUA 4YDAA 4ORUA 1HMTA 3CQNA 4ZHGA 4IBAA 5F1EA 5FFHA 1UREA 2OFMX 2FLJA 4ZH6A 3BLGA 4QGWA 3VG5A 1KT3A 4WBKA 3BX8A 1SXYA 3FR4A 1HMRA 3FA6A 4Y0RA 3CQRA 4YFRA 4OMXA 1AELA 3WJFA 3IA8A 4YFPA 4OS3A 3P6HA 5HAEA 3CBCA 5HTDA 4IMNA 3BY0A 4OS0A 4GNWA 1ZNHA 1X8PA 4QGVA 3APUA 5EEDA 1U18A 3STMX 2HNXA 1EIOA 3P6DA 4ALOA 4TKJA 5LJEA 4QGXA 5AQ6A 3NPOA 3VG6A 5KICA 5EDBA 4ES7A 1FELA 3KFFA 4IB9A 4I9RA 1KZWA 1EIIA 2JOZA 4LZVA 2AMMX 3PH5A 4YBPA 1DV9A 1QY1A 1HMSA 5C0NA 4EXZA 1ZNLA 1A57A 1YWCA 4YGHA 3VG7A 1ERXA 2CM9A 1OBPA 3BU9A 4ARHA 2WSJA 2CZUA 2A2GA 4YCEA 1G7NA 1DC9A 5H8TA 5D48A 1KXOA 3WJEA 4YGGA 4BQUA 2FS7A 2MO5A 5EZ2A 4D6AA 1TOUA 4LKTA 2AT8X 4Y0PA 3AKNA 3UEUA 3UEXA 4TLJA 4AZPA 1MX8A 1JV4A 1X71A 4ZR2A 3APWA 2WEXA 3PH6A 1MUPA 3CBSA 1PBOA 1HBQA 2JN3A 1S7DA 2LKKA 4QYPA 3EMMA 3K3LA 5IO6A 5CE4A 1LICA 2OVDA 2AH7X 1S44A 3KQ0A 3WJDA 1ZNGA 1FE3A 4IAXA 1BRQA 1KZXA 1A2DA 1CBQA 1I06A 4MVKA 1EUOA 4XMGA 3NQ9A 3BDRA 3NADA 3TZSA 2FS6A 5LJKA 1T0VA 2R73A 2WQAE 3FEPA 2ACOA 2ALLX 4ODDA 4YBUA 1JJXA 3FW5A 3PP6A 1X8UA 1CBSA 2Q2MA 3FA9A 4OMWA 4A60A 1A3YA 3EBWA 4IB7A 2POAA 2ACPX 4N7CA 1EALA 5IO5A 5KIDA 1ZNEA 3UEVA 4TKHA 4IB6A 2W2FA 4NNTA 1KQWA 4D6BA 2K62A 3KFIA 4UU3A 1BEBA 5D4AA 1GT3A 2QM9A 4NYQA 3TF6A 3TGAA 4BOEA 2OFRX 5HCEC 3IFBA 1GGLA 3BS2A 4ZH9A 5F58A 1IKEA 2G7BA 2ANSA
chains in the Genus database with same CATH superfamily
3HOEA 2AL0X 2FR3A 5B27A 1SWGA 1JQPA 1FENA 1BWYA 3AEHA 2BC3A 3O22A 3B2IA 4XMEA 4HPDA 1KT7A 5FENA 2NNEA 1QFTA 1YIVA 3GAQA 4O9SA 5DG4A 1LUQA 5IRAA 3WZOA 3ZI8A 4ZHDA 4GNYA 1T68X 1LIBA 5LJHA 2RQ0A 3VE1A 1SXWA 4BVMA 2CZTA 1LIEA 3SLOA 1B4MA 1DF8A 5AJCA 4A1HA 5LJBA 5L8OA 1RBPA 3HWGA 4KT5A 1ADLA 4O3YA 3WBGA 2ASNX 3P6FA 1O1UA 4CPFA 2IZIA 1UZ2X 4MVIA 1YWDA 2QOSC 4O3WA 1JYJA 1QG5A 2RTEB 2JU3A 3UEWA 1MOYA 1X8OA 4GETA 1IJ8A 3EM0A 2QO6A 1SRJA 4MVEA 4QZTA 4BX6B 2HMBA 3HOLA 3O19A 2IZDB 1B56A 1HBPA 2HKDA 1QY0A 2G79A 1ALBA 4NV7A 2OF9A 2OVSA 2RTLA 5BVQA 3U9PC 1OSPO 5HZ9A 4WHIA 4AZMA 2WUTA 2NP1A 1TVQA 4MEEA 5HZ6A 2WEWA 3FA7A 4GGTA 3FELA 1OBQA 2RTNB 4I6SA 3Q34A 3VE2A 4ZGFA 1AB0A 1P6PA 2R74A 1NP4A 3WXQA 5IRWA 1GKAA 2AT5X 1OEKA 1ZRYA 2E4JA 1LCZA 1XCAA 3WZPA 1T8VA 4AYHA 3HPEA 2WPUA 4IB8A 2BS6A 3RZYA 1JJUA 5F2BA 1OBUA 1NQMA 4GRJA 2RTQB 2YMSA 1BJ7A 3OJYC 4U9CA 1IFCA 5HZQA 3G7XA 5LKFA 3RDSA 3WYQA 2Q4NA 4ML7B 4YFQA 4NV8A 1AVDA 2QO4A 3ZW0A 3FMZA 3AKMA 3MVFA 4M7MA 3BU1A 4ZGUA 4I3BA 1R0UA 1GT5A 4LQZA 3QKGA 3RDUA 1GXAA 1YWAA 4CV7A 5K06A 5D8JA 1SLDB 2G78A 4N7DA 2CAMA 4M6SA 1Y52X 3WJBA 3VHIA 4AZNA 2OVEA 4GKCA 3D9WA 5DPQA 4YGZA 1DZJA 4OKAA 4B55A 2RD7C 1MK5A 1G85A 4QYNA 4BCSA 4BX7A 3LHNA 4I3DA 4Z6JA 1BRPA 3P6EA 4XMHA 5B3MO 1S2PA 2FGSA 3SZJA 4Y5DA 3BX7A 2GC9A 4GDZA 3ZWEA 1IFBA 3APXA 4DQ3A 5IO7A 3TGCA 2X45A 4KC7A 4EDEA 3FR5A 3MBTA 4RUNA 1N9YA 1PMPA 4GZVA 3PDFA 4YMYA 4I60A 4O3XB 1SY1A 4C5PA 1B8EA 3VHHA 3KFGA 1BSOA 1RLBE 3S5VA 5HWZA 4Y59A 2IZJA 2HYSA 1SWEA 1VWOB 3FR2A 2IZCB 5CYBA 3T6LA 1VYGA 4JHQA 4LKPA 4U8UO 3CKGA 1MVGA 1SRIA 1Y9TA 2YG2A 2IZFB 2A0AA 4UU2A 1O1VA 5F6ZA 4JGLA 3P24A 3SOTA 1JZUA 4XMCA 5JD2A 3JSQA 1EW3A 2O62A 5HTEA 4ZHHA 1QFVA 1AQBA 3NBXX 3STKA 4ID2A 3WZQA 3B2JA 1EXSA 4ALBA 1GT4A 2BS5A 2RTCB 3VG4A 1CRBA 5JR8A 3CMPA 1KT6A 5AJBA 1G74A 1GX8A 1OPAA 1X89A 2AT0X 1N9MA 2FR2A 4FGIB 5H9LA 4EQAC 3NQ3A 5F6BA 3OD9A 2ZAGA 3QQ2A 1SWJA 3STNA 3ZW1A 3D97A 5L3YA 1QY2A 2AT3X 3CR6A 1OPBA 1RXKA 2F09A 2F73A 4HPBA 1MDCA 1E02A 4O49A 2K23A 4CPHB 1EPAA 2JW1A 2F01A 2OY7A 4RUUA 1LCVA 1UYOX 3VG2A 3U03A 1H91A 1I04A 3O2YA 4I9SA 4A1YA 1SWLA 2GH7A 3C76X 2L67A 3Q6LA 1KL4A 1KT5A 1LNMA 2X46A 1SWAA 4KIIA 4L3RA 4ORWA 4GJVA 4BGFA 4HFOA 3RKGA 2A13A 1VYOA 2RTPB 1SY0A 2LBVA 2DJGA 5HA0A 2MJIA 3F9DA 3SAOA 4GGRA 1IW2A 1JMZA 2LA7A 3RDXA 1GX9A 2XKLA 2IZKA 2W2BA 5B2AO 2XSTA 4NLJA 1YP7A 2GTLO 4O4SA 5H9NA 3PPTA 3NP1A 4CK4A 3OE3A 1VYFA 4PJ2A 3T6FA 2LBAA 5IXGA 1G5WA 1I05A 2FT9A 1KT4A 1MX7A 1N43A 1RAVA 1CBIA 5B10O 4L1NA 3RDMA 3WJCA 2HLVA 3TGBA 4TKBA 4YVBA 3KZAA 2IZLB 5H9AA 2ZAIA 3F8AA 3FEKA 3HTYA 3P6CA 1RSTB 3EYCA 1DZMA 1SA8A 1A18A 3EW2A 4NNSA 1X8QA 2Y3FA 2QCBA 4Z27A 5HZ8A 5H9KA 1N7YA 4TNNA 1TW4A 2GTLM 4U46A 4I3CA 1SWUA 1AVGI 5FQ8E 4AW8A 1EPBA 2OF8A 1LKEA 1SREA 2C1SA 2QO5A 1U17A 4CPIA 2Y32A 3D96A 5FQ6E 4HPCA 3AUMO 1QQSA 3L4RA 5HCDC 1ICNA 2FWVA 1I4UA 3GE2A 2OZQA 4YH0A 3LV4A 1SWCA 4GE1A 1VWNB 4ZFXA 1RSUB 5HA1A 5KHPA 1U0XA 1VWBB 2FTBA 2BLGA 4Z28A 1HQPA 4OS8A 4KH8A 1AVEA 5B29A 1FTPA 1VWDB 2EU7X 2FKGA 1L6MA 3ZUIA 1BM5A 4GK9A 1JYDA 1TXLA 4U8UN 1I9HA 3FIDA 3EBKA 3D4RA 2CBSA 4GU8A 3RY1A 3T1DA 3I17A 4YCHA 4GH7A 5BYPA 4COTA 2A3FX 4MVLA 2PY1A 2QMIA 2JU8A 3RE5A 5EDCA 2OFBA 2OL8O 5K68A 1IKJA 2I5ZO 1ZNDA 4BX7B 4LZUA 1O8VA 4XMFA 2RTHB 5D47A 1N4JA 3H3IA 3X00A 2BT9A 1N0SA 2WR6A 2FRSA 2WWPA 3ZQ3A 3DTQA 3ZZVA 2UYWA 2G5LA 4ORYA 2Q39A 1GT1A 2RN4A 4YKOA 1SLGB 5D45A 4BX6A 1NDJA 2RTDB 2VFBA 2PI3O 2R56A 1CBRA 2Y3EA 3FA8A 3RDOA 1SRGA 4AZOA 3PEDA 5LJCA 3MM0A 1LFOA 2MHDA 4JO6A 1WBIA 3KFHA 1HY2A 2RTOB 4AZRA 4CPEA 1KQXA 2UZ2A 1VWHB 4NP1A 3WJGA 1SRHA 4OELA 2X8SA 2M4LA 1K24A 1ML7A 4FQBB 1E5PA 2OVAA 1E00A 1SY3A 2JU7A 3E3CA 1PEEA 1FEMA 1SWHA 4JNJA 1OEEA 4YKMA 1NP1A 3PK2A 3RE6A 3VG3A 1HQQA 5K67A 3FIQA 2NNQA 4GD9A 3T2WA 3FENA 4FBVA 1VWKB 4CDDA 2AT6X 2FKJA 4BJ8A 2BSZA 2Z4HA 4QAEA 1BSQA 3VHMA 2KT4B 1YP6A 2LB6A 1Z24A 3BSZE 2LFOA 2AKQA 3SLJA 2Q2PA 2RCTA 4ZHFA 1SWDA 3U0DA 1SXXA 3B2HA 4IAWA 3WVMA 4K19A 2Z4IA 4CDCA 1QABE 5FAZA 1LIFA 3I0AA 1BLRA 1ACDA 1JJJA 1EQDA 2CBRA 2GTFX 2RTFB 4PSQA 4BX5B 2RTBB 4HPAA 5B5GA 5HCCC 3P02A 3BRNA 2NNDA 4BBOA 1SY2A 1VPRA 3HWFA 1BSYA 1X8NA 1KGLA 2KW1A 1LPJA 5LJDA 1LIDA 3VGWA 4YDBA 1I78A 1DF3A 5EPQA 2ZSCA 4NW4A 3HWDA 4GJSA 3HK1A 4ZCBA 3ZW2A 3APVA 4WFVA 4KCAA 4IMOA 3ZUOA 3EW1A 2DM5A 4ZJ0A 1DZPA 1FDQA 1OEJA 2HZRA 3B2KA 4EKVA 1XKIA 2A2UA 3NX2A 3FLLA 3ELZA 3T2XA 3F6ZB 1KFFA 1ERBA 2OL6O 1BBPA 1GX3A 1PTSA 1STRB 2X4MA 2X8FA 3NQKA 4WFUA 1CJ5A 1NQNA 2RTIB 3ELXA 5HBSA 4DQ4A 1B0OA 1E2TA 1YWBA 4GUZA 4Y0QA 4U3QA 1KOIA 4AZQA 2L68A 4ORRA 5L8IA 4TQ2A 2RTJA 1KL3A 4NYRA 4ORSA 3C77X 1LDQA 3C78X 1JBHA 2L5PA 4ZHCA 5LKEA 1LF7A 2L9CA 2IFBA 2P8GA 1E06A 1GM6A 1HN2A 1SWTA 4ORXA 4R0BA 2OY5O 1D3SA 3SLTA 1D2UA 2X8TA 3DSZA 5BVSA 4NLIA 1YUPA 4QQ1A 1VWPB 2MM3A 3JS1A 3NX1A 1ZNKA 2G8CO 4A8ZA 4EFGA 1DZKA 1VWCB 3LTWA 1LELA 4Z2PA 2RCQA 1TOWA 2RTMA 1SWBA 4O3ZA 1PM1X 1KL5A 3RSWA 3P6GA 4OEMA 3MX7A 4KC8A 1IIUA 3D95A 3PECA 1VWGB 2N93A 4O4UA 2CM4A 4XMDA 4CSBA 4TJZA 1QWDA 2W2AA 5BVTA 4EEJA 3HWEA 5F7GA 5B5FA 2GJ5A 2KTDA 3RBYA 5AEOA 1SXUA 2RA6A 1ICMA 5L8NA 2WQ9A 3B2LA 2KD2A 1DFVA 2OL7A 2HZQA 2IZAA 3CWKA 3OBLA 1SWNA 3NR3A 1NBXA 5EEEA 5LJGA 4CPHA 1GKAB 1W5RA 3S26A 2Q9SA 3KVNA 5B11O 1VWRB 1STSB 3FW4A 1FJ1E 1NGLA 5HZ5A 4QZUA 4YDAA 4ORUA 2RTGB 4IABA 1HMTA 3VU1A 1SWRA 3RY2A 3ZW0B 1STPA 3CQNA 4ZHGA 4IBAA 3RDQA 2MWHA 5F1EA 2FHNX 1UREA 2OFMX 5FFHA 2FLJA 5IRUA 3BLGA 4QGWA 4ZH6A 4CDEA 3VG5A 1KT3A 1MM9A 2RTKA 4WBKA 3BX8A 1SXYA 3FR4A 1HMRA 1VWJB 3FA6A 1SLEB 4Y0RA 3CQRA 1Y9LA 4YFRA 4FBOA 4OMXA 1AELA 4DCBA 3WJFA 3IA8A 4YFPA 4ON1A 3P6HA 4OS3A 1W4TA 5HAEA 3CBCA 1HXZA 3FYFA 2KTSA 4IMNA 3BY0A 4OS0A 4GNWA 4O4OA 5HTDA 1ZNHA 1Y55X 1X8PA 4QGVA 1VWEB 3APUA 5EEDA 1SMPI 1U18A 3V8UA 3STMX 2HNXA 1EIOA 3N91A 4IRWA 3P6DA 4ALOA 4TKJA 2JGSA 5LJEA 4QGXA 2A5CA 5CHKA 3WZNA 5AQ6A 3NPOA 1MEPA 2RTRB 3VG6A 4O4XA 5EDBA 4MISA 5KICA 2FHLA 1SWFA 4ES7A 2C4IA 1VWMB 1FELA 2IZBA 3KFFA 4IB9A 5FQ7E 4I9RA 2X32A 1KZWA 1EIIA 2JOZA 1SWKA 2IZGB 1VWFB 2AMMX 3PH5A 4I95A 4LZVA 3SZHA 4YBPA 1QY1A 1DV9A 1HMSA 5C0NA 4EXZA 1ZNLA 3SZIA 1A57A 1YWCA 4QNIA 4YGHA 3VG7A 1ERXA 2CM9A 1OBPA 3BU9A 4ARHA 2WSJA 2CZUA 1NC9A 2A2GA 2A5BA 1SWPA 3CKFA 3UAQA 4YCEA 3MG5A 1VWIB 1G7NA 1EI5A 1DC9A 1LDOA 5H8TA 2OFAA 3S60A 5D48A 1KXOA 3WJEA 4YGGA 4BQUA 2FS7A 2MO5A 5EZ2A 3VPJE 3WOVA 4D6AA 1TOUA 4LKTA 5CSEA 2AT8X 1JIWI 2MF6A 3AKNA 4Y0PA 3UEUA 4TLJA 3UEXA 1MX8A 3WYPA 4AZPA 1JV4A 1X71A 2GTLN 3APWA 4ZR2A 3S5XA 4CDFA 2WEXA 1VWAB 1VWQB 3PH6A 1MUPA 4MIRA 1PBYA 3CBSA 2OY8A 3ZW1B 1PBOA 2BHVA 1HBQA 4Z2OA 2JN3A 1S7DA 2LKKA 4GDAA 3EMMA 4QYPA 2QOMA 3K3LA 4GGZA 2JMBA 2OY1O 5IO6A 5CE4A 1LICA 2OVDA 2AH7X 1S44A 1Y0GA 1HXLA 3KQ0A 4QRLA 3WJDA 2X55A 1ZNGA 1FE3A 4IAXA 2VDFA 1RXJA 3FDCA 1SWSA 1BRQA 2AF5A 3RWXA 1A2DA 1CBQA 1I06A 1KZXA 4MVKA 1EUOA 4XMGA 2OYBO 2I5VO 3NQ9A 2IZEB 2X56A 3BDRA 3NADA 3TZSA 1SLFB 2FS6A 4Y0SA 5LJKA 1T0VA 1LCWA 2R73A 2WQAE 2X34A 3FEPA 2ACOA 1JMXA 2A8GA 2ALLX 4ODDA 4YBUA 1SWOA 1JJXA 3FW5A 4HWMA 4INNA 4U8UM 2DJFA 1X8UA 1CBSA 3PP6A 4Z2VA 1UYNX 2Q2MA 1WUBA 3FA9A 4OMWA 4A60A 1A3YA 3EBWA 3PQSA 2POAA 1SWQA 2ACPX 4IB7A 2RTAA 3JQOA 4N7CA 5IO5A 1EALA 5KIDA 1ZNEA 3PQUA 1Y53X 4BX5A 2IZHB 2VFCA 3UEVA 4TKHA 4IB6A 2AVIA 2C1QA 2W2FA 1KQWA 4NNTA 2K62A 3KFIA 4D6BA 4DNEA 1RXHA 1BEBA 3EC5A 4UU3A 5D4AA 1GT3A 2QM9A 4NYQA 3TF6A 3TGAA 4BOEA 1W6FA 1SRFA 2OFRX 5HCEC 3IFBA 1GGLA 3BS2A 4ZH9A 1VWLB 1K3BA 5F58A 4FBRA 1IKEA 2G7BA 2ANSA
chains in the Genus database with same CATH topology
3HOEA 2AL0X 2FR3A 5B27A 1FENA 1BWYA 3O22A 3B2IA 4XMEA 4HPDA 1KT7A 5FENA 2NNEA 1QFTA 1YIVA 3GAQA 4O9SA 5DG4A 3ZI8A 4ZHDA 5LJHA 4GNYA 1T68X 1LIBA 2RQ0A 3VE1A 1SXWA 4BVMA 2CZTA 1LIEA 1B4MA 5AJCA 4A1HA 5LJBA 5L8OA 1RBPA 3HWGA 4KT5A 1ADLA 4O3YA 3WBGA 2ASNX 3P6FA 1O1UA 1UZ2X 4MVIA 1YWDA 2QOSC 4O3WA 1JYJA 1QG5A 3UEWA 2JU3A 1X8OA 4GETA 4MVEA 3EM0A 4QZTA 2QO6A 2HMBA 3HOLA 3O19A 1B56A 1HBPA 1QY0A 2G79A 1ALBA 5BVQA 2OVSA 3U9PC 5HZ9A 4WHIA 4AZMA 2WUTA 2NP1A 1TVQA 5HZ6A 2WEWA 3FA7A 3FELA 1OBQA 4I6SA 3VE2A 4ZGFA 1AB0A 1P6PA 2R74A 1NP4A 3WXQA 1GKAA 2AT5X 1OEKA 1ZRYA 2E4JA 1XCAA 1T8VA 4AYHA 4IB8A 2BS6A 3RZYA 1OBUA 4GRJA 3OJYC 2YMSA 1BJ7A 4U9CA 1IFCA 5HZQA 3G7XA 5LKFA 2Q4NA 4ML7B 4YFQA 2QO4A 3ZW0A 3FMZA 3AKMA 3MVFA 4M7MA 3BU1A 4ZGUA 4I3BA 1R0UA 1GT5A 4LQZA 3QKGA 1GXAA 1YWAA 4CV7A 5K06A 5D8JA 2G78A 4N7DA 4M6SA 3WJBA 4AZNA 2OVEA 4GKCA 5DPQA 4YGZA 1DZJA 2RD7C 1G85A 4QYNA 3LHNA 4I3DA 1BRPA 3P6EA 4XMHA 1S2PA 3BX7A 2GC9A 4GDZA 3ZWEA 1IFBA 3APXA 4DQ3A 5IO7A 3TGCA 2X45A 4KC7A 4EDEA 3FR5A 3MBTA 4RUNA 1PMPA 4GZVA 4YMYA 4O3XB 1SY1A 1B8EA 3KFGA 1BSOA 1RLBE 3S5VA 5HWZA 2HYSA 3FR2A 5CYBA 1VYGA 4U8UO 4LKPA 1MVGA 1Y9TA 2YG2A 5F6ZA 2A0AA 4UU2A 1O1VA 1JZUA 4JGLA 3P24A 4XMCA 3JSQA 1EW3A 2O62A 5HTEA 4ZHHA 1QFVA 1AQBA 3NBXX 3STKA 4ID2A 3B2JA 1EXSA 4ALBA 1GT4A 2BS5A 3VG4A 1CRBA 5JR8A 3CMPA 1KT6A 5AJBA 1G74A 1GX8A 1OPAA 1X89A 2AT0X 2FR2A 4FGIB 5H9LA 4EQAC 3NQ3A 5F6BA 3OD9A 2ZAGA 3STNA 3ZW1A 3D97A 1QY2A 2AT3X 3CR6A 1OPBA 2F09A 2F73A 4HPBA 1MDCA 1E02A 4O49A 2K23A 1EPAA 2JW1A 4RUUA 3VG2A 3U03A 1H91A 1I04A 3O2YA 4I9SA 4A1YA 3C76X 2L67A 3Q6LA 1KT5A 1LNMA 2X46A 4KIIA 4L3RA 4ORWA 4HFOA 3RKGA 2A13A 1SY0A 2LBVA 5HA0A 2MJIA 3F9DA 3SAOA 1IW2A 2LA7A 1GX9A 2XKLA 2W2BA 2XSTA 4NLJA 1YP7A 2GTLO 4O4SA 5H9NA 3PPTA 3NP1A 4CK4A 3OE3A 1VYFA 4PJ2A 2LBAA 1G5WA 1I05A 2FT9A 1KT4A 1MX7A 1CBIA 4L1NA 3WJCA 3TGBA 2HLVA 4TKBA 3KZAA 5H9AA 2ZAIA 3F8AA 3FEKA 3HTYA 3P6CA 3EYCA 1DZMA 1SA8A 1A18A 4NNSA 1X8QA 5HZ8A 5H9KA 4TNNA 1TW4A 2GTLM 5FQ8E 4I3CA 4AW8A 1AVGI 1EPBA 1LKEA 2QO5A 1U17A 3D96A 5FQ6E 4HPCA 1QQSA 3L4RA 5HCDC 1ICNA 2FWVA 1I4UA 3GE2A 2OZQA 4YH0A 3LV4A 4GE1A 4ZFXA 5HA1A 5KHPA 1U0XA 2FTBA 2BLGA 1HQPA 4OS8A 4KH8A 5B29A 1FTPA 2EU7X 1BM5A 1L6MA 3ZUIA 4GK9A 1JYDA 1TXLA 4U8UN 3EBKA 3D4RA 2CBSA 4GU8A 3T1DA 3I17A 4YCHA 4GH7A 5BYPA 4COTA 2A3FX 4MVLA 2PY1A 2QMIA 2JU8A 5EDCA 1IKJA 1ZNDA 4LZUA 1O8VA 4XMFA 5D47A 3H3IA 2BT9A 1N0SA 2WR6A 2FRSA 2WWPA 3ZQ3A 3DTQA 3ZZVA 4ORYA 2Q39A 1GT1A 2RN4A 4YKOA 5D45A 2R56A 3FA8A 1CBRA 4AZOA 5LJCA 3PEDA 1LFOA 2MHDA 3KFHA 4AZRA 1KQXA 4NP1A 3WJGA 2X8SA 2M4LA 1ML7A 4FQBB 1E5PA 2OVAA 1E00A 1SY3A 2JU7A 3E3CA 1PEEA 1FEMA 1OEEA 4YKMA 1NP1A 3VG3A 3FIQA 2NNQA 3FENA 4FBVA 2AT6X 2Z4HA 4QAEA 1BSQA 2KT4B 1YP6A 2LB6A 1Z24A 3BSZE 2LFOA 2AKQA 2Q2PA 2RCTA 4ZHFA 3U0DA 1SXXA 3B2HA 4IAWA 3WVMA 4K19A 2Z4IA 1QABE 5FAZA 1LIFA 3I0AA 1BLRA 1ACDA 1JJJA 1EQDA 2CBRA 2GTFX 4PSQA 4HPAA 5HCCC 3P02A 3BRNA 2NNDA 1SY2A 1VPRA 3HWFA 1BSYA 1X8NA 1KGLA 2KW1A 1LPJA 5LJDA 1LIDA 4YDBA 1DF3A 5EPQA 4NW4A 3HWDA 3HK1A 4ZCBA 3ZW2A 3APVA 4WFVA 4KCAA 4IMOA 3ZUOA 4ZJ0A 2DM5A 1DZPA 1FDQA 1OEJA 2HZRA 3B2KA 1XKIA 2A2UA 3NX2A 3FLLA 3ELZA 3F6ZB 1ERBA 4Y0SA 1BBPA 2X8FA 3NQKA 1CJ5A 4WFUA 4DQ4A 5HBSA 3ELXA 1B0OA 1YWBA 4Y0QA 4AZQA 4U3QA 1KOIA 4TQ2A 2L68A 4ORRA 5L8IA 4ORSA 4NYRA 3C77X 3C78X 1JBHA 2L5PA 4ZHCA 5LKEA 1LF7A 2P8GA 2IFBA 2L9CA 1E06A 1GM6A 1HN2A 4ORXA 4R0BA 3SOTA 1D3SA 1D2UA 2X8TA 3DSZA 5BVSA 4NLIA 1YUPA 4QQ1A 2MM3A 3JS1A 3NX1A 1ZNKA 4A8ZA 4EFGA 1DZKA 2RCQA 1TOWA 4O3ZA 1PM1X 3RSWA 3P6GA 3MX7A 4KC8A 1IIUA 3D95A 3PECA 2N93A 4O4UA 2CM4A 4XMDA 4CSBA 4TJZA 1QWDA 2W2AA 5BVTA 4EEJA 3HWEA 5F7GA 2GJ5A 2KTDA 3RBYA 5AEOA 1SXUA 2RA6A 1ICMA 5L8NA 2WQ9A 3B2LA 2KD2A 1DFVA 2HZQA 3CWKA 3OBLA 3NR3A 5EEEA 5LJGA 1GKAB 3S26A 2Q9SA 3FW4A 1NGLA 5HZ5A 4QZUA 4YDAA 4ORUA 4IABA 1HMTA 3VU1A 3ZW0B 3CQNA 4ZHGA 4IBAA 2MWHA 5F1EA 5FFHA 1UREA 2OFMX 2FLJA 4ZH6A 3BLGA 4QGWA 3VG5A 1KT3A 4WBKA 3BX8A 1SXYA 3FR4A 1HMRA 3FA6A 4Y0RA 3CQRA 1Y9LA 4YFRA 4FBOA 4OMXA 1AELA 3WJFA 3IA8A 4YFPA 4ON1A 3P6HA 4OS3A 5HAEA 3CBCA 3FYFA 5HTDA 2KTSA 4IMNA 3BY0A 4OS0A 4GNWA 4O4OA 1ZNHA 1X8PA 4QGVA 3APUA 5EEDA 1SMPI 1U18A 3V8UA 3STMX 2HNXA 1EIOA 3N91A 3P6DA 4ALOA 4TKJA 5LJEA 4QGXA 5AQ6A 3NPOA 3VG6A 5KICA 4O4XA 5EDBA 4MISA 4ES7A 1FELA 3KFFA 4IB9A 5FQ7E 4I9RA 1KZWA 1EIIA 2JOZA 4LZVA 2AMMX 3PH5A 4I95A 4YBPA 1DV9A 1QY1A 1HMSA 5C0NA 4EXZA 1ZNLA 1A57A 1YWCA 4QNIA 4YGHA 3VG7A 1ERXA 2CM9A 1OBPA 3BU9A 4ARHA 2WSJA 2CZUA 2A2GA 3UAQA 4YCEA 1G7NA 1EI5A 1DC9A 5H8TA 3S60A 5D48A 1KXOA 3WJEA 4YGGA 4BQUA 2FS7A 2MO5A 5EZ2A 3VPJE 3WOVA 4D6AA 1TOUA 4LKTA 2AT8X 1JIWI 4Y0PA 3AKNA 3UEUA 3UEXA 4TLJA 4AZPA 1MX8A 1JV4A 1X71A 2GTLN 3APWA 4ZR2A 3S5XA 2WEXA 3PH6A 1MUPA 4MIRA 3ZW1B 3CBSA 1PBOA 2BHVA 1HBQA 2LKKA 1S7DA 2JN3A 4QYPA 3EMMA 3K3LA 2JMBA 5IO6A 5CE4A 1LICA 2OVDA 2AH7X 1S44A 4QRLA 3KQ0A 3WJDA 1ZNGA 1FE3A 4IAXA 1BRQA 3RWXA 1A2DA 1CBQA 1I06A 1KZXA 4MVKA 1EUOA 4XMGA 3NQ9A 3BDRA 3NADA 3TZSA 2FS6A 5LJKA 1T0VA 2R73A 2WQAE 3FEPA 2ACOA 2ALLX 4ODDA 4YBUA 1JJXA 3FW5A 4HWMA 4INNA 4U8UM 3PP6A 1X8UA 1CBSA 2Q2MA 3FA9A 4OMWA 4A60A 1A3YA 3EBWA 3PQSA 2POAA 2ACPX 4IB7A 4N7CA 1EALA 3JQOA 5IO5A 5KIDA 1ZNEA 3PQUA 3UEVA 4TKHA 4IB6A 2W2FA 4NNTA 1KQWA 4D6BA 2K62A 3KFIA 4UU3A 1BEBA 5D4AA 1GT3A 2QM9A 4NYQA 3TF6A 3TGAA 4BOEA 2OFRX 5HCEC 3IFBA 1GGLA 3BS2A 4ZH9A 5F58A 4FBRA 1IKEA 2G7BA 2ANSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AL0 X;  2FR3 A;  5B27 A;  1FEN A;  1BWY A;  3O22 A;  3B2I A;  4XME A;  4HPD A;  1KT7 A;  5FEN A;  2NNE A;  1QFT A;  1YIV A;  3GAQ A;  4O9S A;  5DG4 A;  4ZHD A;  5LJH A;  4GNY A;  1T68 X;  1LIB A;  2RQ0 A;  4BVM A;  1SXW A;  2CZT A;  1LIE A;  1B4M A;  4A1H A;  5LJB A;  5L8O A;  1RBP A;  3HWG A;  3WBG A;  1ADL A;  2ASN X;  3P6F A;  1O1U A;  1UZ2 X;  4MVI A;  1YWD A;  2QOS C;  1JYJ A;  1QG5 A;  3UEW A;  2JU3 A;  1X8O A;  4GET A;  3EM0 A;  4QZT A;  2QO6 A;  2HMB A;  3O19 A;  1B56 A;  1HBP A;  1QY0 A;  2G79 A;  1ALB A;  5BVQ A;  3U9P C;  5HZ9 A;  4AZM A;  2WUT A;  2NP1 A;  1TVQ A;  5HZ6 A;  2WEW A;  3FA7 A;  3FEL A;  1OBQ A;  1AB0 A;  2R74 A;  1P6P A;  1NP4 A;  3WXQ A;  1GKA A;  2AT5 X;  1OEK A;  1ZRY A;  2E4J A;  1XCA A;  1T8V A;  4AYH A;  4IB8 A;  3RZY A;  1OBU A;  4GRJ A;  3OJY C;  1BJ7 A;  1IFC A;  5HZQ A;  3G7X A;  5LKF A;  2Q4N A;  4YFQ A;  2QO4 A;  3FMZ A;  3AKM A;  3MVF A;  4M7M A;  3BU1 A;  4ZGU A;  4I3B A;  1R0U A;  1GT5 A;  3QKG A;  1GXA A;  1YWA A;  5K06 A;  5D8J A;  2G78 A;  4N7D A;  4M6S A;  3WJB A;  4AZN A;  2OVE A;  4GKC A;  5DPQ A;  4YGZ A;  1DZJ A;  2RD7 C;  1G85 A;  4QYN A;  4I3D A;  1BRP A;  3P6E A;  4XMH A;  1S2P A;  3BX7 A;  2GC9 A;  5IO7 A;  1IFB A;  3APX A;  4DQ3 A;  3TGC A;  2X45 A;  4EDE A;  3FR5 A;  3MBT A;  4RUN A;  1PMP A;  4YMY A;  1SY1 A;  1B8E A;  3KFG A;  1BSO A;  1RLB E;  5HWZ A;  2HYS A;  3FR2 A;  1VYG A;  4LKP A;  1MVG A;  2YG2 A;  5F6Z A;  2A0A A;  4UU2 A;  1O1V A;  1JZU A;  4XMC A;  3JSQ A;  1EW3 A;  2O62 A;  5HTE A;  4ZHH A;  1QFV A;  1AQB A;  3STK A;  3B2J A;  1EXS A;  4ALB A;  1GT4 A;  3VG4 A;  1CRB A;  5JR8 A;  3CMP A;  1KT6 A;  1G74 A;  1GX8 A;  1OPA A;  1X89 A;  2AT0 X;  2FR2 A;  5H9L A;  3NQ3 A;  5F6B A;  3STN A;  3D97 A;  1QY2 A;  2AT3 X;  3CR6 A;  1OPB A;  2F73 A;  4HPB A;  1MDC A;  1E02 A;  2K23 A;  1EPA A;  4RUU A;  3VG2 A;  3U03 A;  1H91 A;  1I04 A;  3O2Y A;  4I9S A;  4A1Y A;  3C76 X;  2L67 A;  3Q6L A;  1KT5 A;  1LNM A;  2X46 A;  4KII A;  4ORW A;  4HFO A;  2A13 A;  1SY0 A;  2LBV A;  5HA0 A;  2MJI A;  3F9D A;  3SAO A;  1IW2 A;  1GX9 A;  2XKL A;  2W2B A;  2XST A;  4NLJ A;  1YP7 A;  5H9N A;  4CK4 A;  3PPT A;  3NP1 A;  1VYF A;  2LBA A;  1G5W A;  1I05 A;  2FT9 A;  1KT4 A;  1MX7 A;  1CBI A;  3WJC A;  3TGB A;  2HLV A;  4TKB A;  3KZA A;  5H9A A;  3F8A A;  3FEK A;  3P6C A;  3EYC A;  1DZM A;  1SA8 A;  1A18 A;  4NNS A;  1X8Q A;  5HZ8 A;  5H9K A;  4TNN A;  1TW4 A;  4I3C A;  4AW8 A;  1AVG I;  1EPB A;  1LKE A;  2QO5 A;  1U17 A;  3D96 A;  4HPC A;  1QQS A;  3L4R A;  5HCD C;  1ICN A;  2FWV A;  1I4U A;  2OZQ A;  4YH0 A;  4GE1 A;  4ZFX A;  5HA1 A;  5KHP A;  1U0X A;  2FTB A;  2BLG A;  1HQP A;  4OS8 A;  5B29 A;  1FTP A;  2EU7 X;  1BM5 A;  1L6M A;  3ZUI A;  1JYD A;  1TXL A;  3EBK A;  3T1D A;  2CBS A;  3I17 A;  4YCH A;  4GH7 A;  2A3F X;  4MVL A;  2PY1 A;  2JU8 A;  5EDC A;  1IKJ A;  1ZND A;  4LZU A;  1O8V A;  4XMF A;  5D47 A;  1N0S A;  2WR6 A;  2FRS A;  2WWP A;  3ZQ3 A;  3DTQ A;  4ORY A;  2Q39 A;  1GT1 A;  4YKO A;  5D45 A;  2R56 A;  3FA8 A;  1CBR A;  4AZO A;  5LJC A;  3PED A;  1LFO A;  3KFH A;  4AZR A;  1KQX A;  4NP1 A;  3WJG A;  1ML7 A;  1E5P A;  2OVA A;  1E00 A;  1SY3 A;  2JU7 A;  1PEE A;  1FEM A;  1OEE A;  4YKM A;  1NP1 A;  3VG3 A;  3FIQ A;  2NNQ A;  3FEN A;  2AT6 X;  4QAE A;  1BSQ A;  2KT4 B;  1YP6 A;  2LB6 A;  1Z24 A;  3BSZ E;  2LFO A;  2AKQ A;  2Q2P A;  2RCT A;  4ZHF A;  3U0D A;  1SXX A;  3B2H A;  4IAW A;  3WVM A;  4K19 A;  1QAB E;  5FAZ A;  1LIF A;  3I0A A;  1BLR A;  1ACD A;  1JJJ A;  1EQD A;  2CBR A;  2GTF X;  4PSQ A;  4HPA A;  5HCC C;  3BRN A;  2NND A;  1SY2 A;  1VPR A;  3HWF A;  1BSY A;  1X8N A;  1KGL A;  1LPJ A;  5LJD A;  1LID A;  4YDB A;  1DF3 A;  5EPQ A;  3HWD A;  3HK1 A;  4ZCB A;  3APV A;  4WFV A;  4IMO A;  3ZUO A;  4ZJ0 A;  2DM5 A;  1DZP A;  1FDQ A;  1OEJ A;  2HZR A;  3B2K A;  1XKI A;  2A2U A;  3NX2 A;  3FLL A;  3ELZ A;  1ERB A;  4Y0S A;  1BBP A;  1CJ5 A;  4WFU A;  4DQ4 A;  5HBS A;  3ELX A;  1B0O A;  1YWB A;  4Y0Q A;  4AZQ A;  1KOI A;  4TQ2 A;  2L68 A;  4ORR A;  5L8I A;  4ORS A;  4NYR A;  3C77 X;  3C78 X;  1JBH A;  2L5P A;  4ZHC A;  5LKE A;  1LF7 A;  2P8G A;  2IFB A;  2L9C A;  1E06 A;  1GM6 A;  1HN2 A;  4ORX A;  4R0B A;  1D3S A;  1D2U A;  3DSZ A;  5BVS A;  4NLI A;  1YUP A;  2MM3 A;  3JS1 A;  3NX1 A;  1ZNK A;  4A8Z A;  4EFG A;  1DZK A;  2RCQ A;  1TOW A;  1PM1 X;  3RSW A;  3P6G A;  1IIU A;  3D95 A;  3PEC A;  2N93 A;  2CM4 A;  4XMD A;  4TJZ A;  1QWD A;  2W2A A;  5BVT A;  4EEJ A;  3HWE A;  5F7G A;  2GJ5 A;  2KTD A;  1SXU A;  2RA6 A;  1ICM A;  5L8N A;  2WQ9 A;  3B2L A;  1DFV A;  2HZQ A;  3CWK A;  3NR3 A;  5EEE A;  5LJG A;  1GKA B;  3S26 A;  2Q9S A;  3FW4 A;  1NGL A;  5HZ5 A;  4QZU A;  4YDA A;  4ORU A;  1HMT A;  3CQN A;  4ZHG A;  4IBA A;  5F1E A;  5FFH A;  1URE A;  2OFM X;  2FLJ A;  4ZH6 A;  3BLG A;  4QGW A;  3VG5 A;  1KT3 A;  4WBK A;  3BX8 A;  1SXY A;  3FR4 A;  1HMR A;  3FA6 A;  4Y0R A;  3CQR A;  4YFR A;  4OMX A;  1AEL A;  3WJF A;  3IA8 A;  4YFP A;  4OS3 A;  3P6H A;  5HAE A;  3CBC A;  5HTD A;  4IMN A;  3BY0 A;  4OS0 A;  4GNW A;  1ZNH A;  1X8P A;  4QGV A;  3APU A;  5EED A;  1U18 A;  3STM X;  2HNX A;  1EIO A;  3P6D A;  4ALO A;  4TKJ A;  5LJE A;  4QGX A;  5AQ6 A;  3NPO A;  3VG6 A;  5KIC A;  5EDB A;  4ES7 A;  1FEL A;  3KFF A;  4IB9 A;  4I9R A;  1KZW A;  1EII A;  2JOZ A;  4LZV A;  2AMM X;  3PH5 A;  4YBP A;  1DV9 A;  1QY1 A;  1HMS A;  5C0N A;  4EXZ A;  1ZNL A;  1A57 A;  1YWC A;  4YGH A;  3VG7 A;  1ERX A;  2CM9 A;  1OBP A;  3BU9 A;  4ARH A;  2WSJ A;  2CZU A;  2A2G A;  4YCE A;  1G7N A;  1DC9 A;  5H8T A;  5D48 A;  1KXO A;  3WJE A;  4YGG A;  4BQU A;  2FS7 A;  2MO5 A;  5EZ2 A;  4D6A A;  1TOU A;  4LKT A;  2AT8 X;  4Y0P A;  3AKN A;  3UEU A;  3UEX A;  4TLJ A;  4AZP A;  1MX8 A;  1JV4 A;  1X71 A;  4ZR2 A;  3APW A;  2WEX A;  3PH6 A;  1MUP A;  3CBS A;  1PBO A;  1HBQ A;  2JN3 A;  1S7D A;  2LKK A;  4QYP A;  3EMM A;  3K3L A;  5IO6 A;  5CE4 A;  1LIC A;  2OVD A;  2AH7 X;  1S44 A;  3KQ0 A;  3WJD A;  1ZNG A;  1FE3 A;  4IAX A;  1BRQ A;  1KZX A;  1A2D A;  1CBQ A;  1I06 A;  4MVK A;  1EUO A;  4XMG A;  3NQ9 A;  3BDR A;  3NAD A;  3TZS A;  2FS6 A;  5LJK A;  1T0V A;  2R73 A;  2WQA E;  3FEP A;  2ACO A;  2ALL X;  4ODD A;  4YBU A;  1JJX A;  3FW5 A;  3PP6 A;  1X8U A;  1CBS A;  2Q2M A;  3FA9 A;  4OMW A;  4A60 A;  1A3Y A;  3EBW A;  4IB7 A;  2POA A;  2ACP X;  4N7C A;  1EAL A;  5IO5 A;  5KID A;  1ZNE A;  3UEV A;  4TKH A;  4IB6 A;  2W2F A;  4NNT A;  1KQW A;  4D6B A;  2K62 A;  3KFI A;  4UU3 A;  1BEB A;  5D4A A;  1GT3 A;  2QM9 A;  4NYQ A;  3TF6 A;  3TGA A;  4BOE A;  2OFR X;  5HCE C;  3IFB A;  1GGL A;  3BS2 A;  4ZH9 A;  5F58 A;  1IKE A;  2G7B A;  2ANS A; 
#chains in the Genus database with same CATH topology
 3HOE A;  2AL0 X;  2FR3 A;  5B27 A;  1SWG A;  1JQP A;  1FEN A;  1BWY A;  3AEH A;  2BC3 A;  3O22 A;  3B2I A;  4XME A;  4HPD A;  1KT7 A;  5FEN A;  2NNE A;  1QFT A;  1YIV A;  3GAQ A;  4O9S A;  5DG4 A;  1LUQ A;  5IRA A;  3WZO A;  3ZI8 A;  4ZHD A;  4GNY A;  1T68 X;  1LIB A;  5LJH A;  2RQ0 A;  3VE1 A;  1SXW A;  4BVM A;  2CZT A;  1LIE A;  3SLO A;  1B4M A;  1DF8 A;  5AJC A;  4A1H A;  5LJB A;  5L8O A;  1RBP A;  3HWG A;  4KT5 A;  1ADL A;  4O3Y A;  3WBG A;  2ASN X;  3P6F A;  1O1U A;  4CPF A;  2IZI A;  1UZ2 X;  4MVI A;  1YWD A;  2QOS C;  4O3W A;  1JYJ A;  1QG5 A;  2RTE B;  2JU3 A;  3UEW A;  1MOY A;  1X8O A;  4GET A;  1IJ8 A;  3EM0 A;  2QO6 A;  1SRJ A;  4MVE A;  4QZT A;  4BX6 B;  2HMB A;  3HOL A;  3O19 A;  2IZD B;  1B56 A;  1HBP A;  2HKD A;  1QY0 A;  2G79 A;  1ALB A;  4NV7 A;  2OF9 A;  2OVS A;  2RTL A;  5BVQ A;  3U9P C;  1OSP O;  5HZ9 A;  4WHI A;  4AZM A;  2WUT A;  2NP1 A;  1TVQ A;  4MEE A;  5HZ6 A;  2WEW A;  3FA7 A;  4GGT A;  3FEL A;  1OBQ A;  2RTN B;  4I6S A;  3Q34 A;  3VE2 A;  4ZGF A;  1AB0 A;  1P6P A;  2R74 A;  1NP4 A;  3WXQ A;  5IRW A;  1GKA A;  2AT5 X;  1OEK A;  1ZRY A;  2E4J A;  1LCZ A;  1XCA A;  3WZP A;  1T8V A;  4AYH A;  3HPE A;  2WPU A;  4IB8 A;  2BS6 A;  3RZY A;  1JJU A;  5F2B A;  1OBU A;  1NQM A;  4GRJ A;  2RTQ B;  2YMS A;  1BJ7 A;  3OJY C;  4U9C A;  1IFC A;  5HZQ A;  3G7X A;  5LKF A;  3RDS A;  3WYQ A;  2Q4N A;  4ML7 B;  4YFQ A;  4NV8 A;  1AVD A;  2QO4 A;  3ZW0 A;  3FMZ A;  3AKM A;  3MVF A;  4M7M A;  3BU1 A;  4ZGU A;  4I3B A;  1R0U A;  1GT5 A;  4LQZ A;  3QKG A;  3RDU A;  1GXA A;  1YWA A;  4CV7 A;  5K06 A;  5D8J A;  1SLD B;  2G78 A;  4N7D A;  2CAM A;  4M6S A;  1Y52 X;  3WJB A;  3VHI A;  4AZN A;  2OVE A;  4GKC A;  3D9W A;  5DPQ A;  4YGZ A;  1DZJ A;  4OKA A;  4B55 A;  2RD7 C;  1MK5 A;  1G85 A;  4QYN A;  4BCS A;  4BX7 A;  3LHN A;  4I3D A;  4Z6J A;  1BRP A;  3P6E A;  4XMH A;  5B3M O;  1S2P A;  2FGS A;  3SZJ A;  4Y5D A;  3BX7 A;  2GC9 A;  4GDZ A;  3ZWE A;  1IFB A;  3APX A;  4DQ3 A;  5IO7 A;  3TGC A;  2X45 A;  4KC7 A;  4EDE A;  3FR5 A;  3MBT A;  4RUN A;  1N9Y A;  1PMP A;  4GZV A;  3PDF A;  4YMY A;  4I60 A;  4O3X B;  1SY1 A;  4C5P A;  1B8E A;  3VHH A;  3KFG A;  1BSO A;  1RLB E;  3S5V A;  5HWZ A;  4Y59 A;  2IZJ A;  2HYS A;  1SWE A;  1VWO B;  3FR2 A;  2IZC B;  5CYB A;  3T6L A;  1VYG A;  4JHQ A;  4LKP A;  4U8U O;  3CKG A;  1MVG A;  1SRI A;  1Y9T A;  2YG2 A;  2IZF B;  2A0A A;  4UU2 A;  1O1V A;  5F6Z A;  4JGL A;  3P24 A;  3SOT A;  1JZU A;  4XMC A;  5JD2 A;  3JSQ A;  1EW3 A;  2O62 A;  5HTE A;  4ZHH A;  1QFV A;  1AQB A;  3NBX X;  3STK A;  4ID2 A;  3WZQ A;  3B2J A;  1EXS A;  4ALB A;  1GT4 A;  2BS5 A;  2RTC B;  3VG4 A;  1CRB A;  5JR8 A;  3CMP A;  1KT6 A;  5AJB A;  1G74 A;  1GX8 A;  1OPA A;  1X89 A;  2AT0 X;  1N9M A;  2FR2 A;  4FGI B;  5H9L A;  4EQA C;  3NQ3 A;  5F6B A;  3OD9 A;  2ZAG A;  3QQ2 A;  1SWJ A;  3STN A;  3ZW1 A;  3D97 A;  5L3Y A;  1QY2 A;  2AT3 X;  3CR6 A;  1OPB A;  1RXK A;  2F09 A;  2F73 A;  4HPB A;  1MDC A;  1E02 A;  4O49 A;  2K23 A;  4CPH B;  1EPA A;  2JW1 A;  2F01 A;  2OY7 A;  4RUU A;  1LCV A;  1UYO X;  3VG2 A;  3U03 A;  1H91 A;  1I04 A;  3O2Y A;  4I9S A;  4A1Y A;  1SWL A;  2GH7 A;  3C76 X;  2L67 A;  3Q6L A;  1KL4 A;  1KT5 A;  1LNM A;  2X46 A;  1SWA A;  4KII A;  4L3R A;  4ORW A;  4GJV A;  4BGF A;  4HFO A;  3RKG A;  2A13 A;  1VYO A;  2RTP B;  1SY0 A;  2LBV A;  2DJG A;  5HA0 A;  2MJI A;  3F9D A;  3SAO A;  4GGR A;  1IW2 A;  1JMZ A;  2LA7 A;  3RDX A;  1GX9 A;  2XKL A;  2IZK A;  2W2B A;  5B2A O;  2XST A;  4NLJ A;  1YP7 A;  2GTL O;  4O4S A;  5H9N A;  3PPT A;  3NP1 A;  4CK4 A;  3OE3 A;  1VYF A;  4PJ2 A;  3T6F A;  2LBA A;  5IXG A;  1G5W A;  1I05 A;  2FT9 A;  1KT4 A;  1MX7 A;  1N43 A;  1RAV A;  1CBI A;  5B10 O;  4L1N A;  3RDM A;  3WJC A;  2HLV A;  3TGB A;  4TKB A;  4YVB A;  3KZA A;  2IZL B;  5H9A A;  2ZAI A;  3F8A A;  3FEK A;  3HTY A;  3P6C A;  1RST B;  3EYC A;  1DZM A;  1SA8 A;  1A18 A;  3EW2 A;  4NNS A;  1X8Q A;  2Y3F A;  2QCB A;  4Z27 A;  5HZ8 A;  5H9K A;  1N7Y A;  4TNN A;  1TW4 A;  2GTL M;  4U46 A;  4I3C A;  1SWU A;  1AVG I;  5FQ8 E;  4AW8 A;  1EPB A;  2OF8 A;  1LKE A;  1SRE A;  2C1S A;  2QO5 A;  1U17 A;  4CPI A;  2Y32 A;  3D96 A;  5FQ6 E;  4HPC A;  3AUM O;  1QQS A;  3L4R A;  5HCD C;  1ICN A;  2FWV A;  1I4U A;  3GE2 A;  2OZQ A;  4YH0 A;  3LV4 A;  1SWC A;  4GE1 A;  1VWN B;  4ZFX A;  1RSU B;  5HA1 A;  5KHP A;  1U0X A;  1VWB B;  2FTB A;  2BLG A;  4Z28 A;  1HQP A;  4OS8 A;  4KH8 A;  1AVE A;  5B29 A;  1FTP A;  1VWD B;  2EU7 X;  2FKG A;  1L6M A;  3ZUI A;  1BM5 A;  4GK9 A;  1JYD A;  1TXL A;  4U8U N;  1I9H A;  3FID A;  3EBK A;  3D4R A;  2CBS A;  4GU8 A;  3RY1 A;  3T1D A;  3I17 A;  4YCH A;  4GH7 A;  5BYP A;  4COT A;  2A3F X;  4MVL A;  2PY1 A;  2QMI A;  2JU8 A;  3RE5 A;  5EDC A;  2OFB A;  2OL8 O;  5K68 A;  1IKJ A;  2I5Z O;  1ZND A;  4BX7 B;  4LZU A;  1O8V A;  4XMF A;  2RTH B;  5D47 A;  1N4J A;  3H3I A;  3X00 A;  2BT9 A;  1N0S A;  2WR6 A;  2FRS A;  2WWP A;  3ZQ3 A;  3DTQ A;  3ZZV A;  2UYW A;  2G5L A;  4ORY A;  2Q39 A;  1GT1 A;  2RN4 A;  4YKO A;  1SLG B;  5D45 A;  4BX6 A;  1NDJ A;  2RTD B;  2VFB A;  2PI3 O;  2R56 A;  1CBR A;  2Y3E A;  3FA8 A;  3RDO A;  1SRG A;  4AZO A;  3PED A;  5LJC A;  3MM0 A;  1LFO A;  2MHD A;  4JO6 A;  1WBI A;  3KFH A;  1HY2 A;  2RTO B;  4AZR A;  4CPE A;  1KQX A;  2UZ2 A;  1VWH B;  4NP1 A;  3WJG A;  1SRH A;  4OEL A;  2X8S A;  2M4L A;  1K24 A;  1ML7 A;  4FQB B;  1E5P A;  2OVA A;  1E00 A;  1SY3 A;  2JU7 A;  3E3C A;  1PEE A;  1FEM A;  1SWH A;  4JNJ A;  1OEE A;  4YKM A;  1NP1 A;  3PK2 A;  3RE6 A;  3VG3 A;  1HQQ A;  5K67 A;  3FIQ A;  2NNQ A;  4GD9 A;  3T2W A;  3FEN A;  4FBV A;  1VWK B;  4CDD A;  2AT6 X;  2FKJ A;  4BJ8 A;  2BSZ A;  2Z4H A;  4QAE A;  1BSQ A;  3VHM A;  2KT4 B;  1YP6 A;  2LB6 A;  1Z24 A;  3BSZ E;  2LFO A;  2AKQ A;  3SLJ A;  2Q2P A;  2RCT A;  4ZHF A;  1SWD A;  3U0D A;  1SXX A;  3B2H A;  4IAW A;  3WVM A;  4K19 A;  2Z4I A;  4CDC A;  1QAB E;  5FAZ A;  1LIF A;  3I0A A;  1BLR A;  1ACD A;  1JJJ A;  1EQD A;  2CBR A;  2GTF X;  2RTF B;  4PSQ A;  4BX5 B;  2RTB B;  4HPA A;  5B5G A;  5HCC C;  3P02 A;  3BRN A;  2NND A;  4BBO A;  1SY2 A;  1VPR A;  3HWF A;  1BSY A;  1X8N A;  1KGL A;  2KW1 A;  1LPJ A;  5LJD A;  1LID A;  3VGW A;  4YDB A;  1I78 A;  1DF3 A;  5EPQ A;  2ZSC A;  4NW4 A;  3HWD A;  4GJS A;  3HK1 A;  4ZCB A;  3ZW2 A;  3APV A;  4WFV A;  4KCA A;  4IMO A;  3ZUO A;  3EW1 A;  2DM5 A;  4ZJ0 A;  1DZP A;  1FDQ A;  1OEJ A;  2HZR A;  3B2K A;  4EKV A;  1XKI A;  2A2U A;  3NX2 A;  3FLL A;  3ELZ A;  3T2X A;  3F6Z B;  1KFF A;  1ERB A;  2OL6 O;  1BBP A;  1GX3 A;  1PTS A;  1STR B;  2X4M A;  2X8F A;  3NQK A;  4WFU A;  1CJ5 A;  1NQN A;  2RTI B;  3ELX A;  5HBS A;  4DQ4 A;  1B0O A;  1E2T A;  1YWB A;  4GUZ A;  4Y0Q A;  4U3Q A;  1KOI A;  4AZQ A;  2L68 A;  4ORR A;  5L8I A;  4TQ2 A;  2RTJ A;  1KL3 A;  4NYR A;  4ORS A;  3C77 X;  1LDQ A;  3C78 X;  1JBH A;  2L5P A;  4ZHC A;  5LKE A;  1LF7 A;  2L9C A;  2IFB A;  2P8G A;  1E06 A;  1GM6 A;  1HN2 A;  1SWT A;  4ORX A;  4R0B A;  2OY5 O;  1D3S A;  3SLT A;  1D2U A;  2X8T A;  3DSZ A;  5BVS A;  4NLI A;  1YUP A;  4QQ1 A;  1VWP B;  2MM3 A;  3JS1 A;  3NX1 A;  1ZNK A;  2G8C O;  4A8Z A;  4EFG A;  1DZK A;  1VWC B;  3LTW A;  1LEL A;  4Z2P A;  2RCQ A;  1TOW A;  2RTM A;  1SWB A;  4O3Z A;  1PM1 X;  1KL5 A;  3RSW A;  3P6G A;  4OEM A;  3MX7 A;  4KC8 A;  1IIU A;  3D95 A;  3PEC A;  1VWG B;  2N93 A;  4O4U A;  2CM4 A;  4XMD A;  4CSB A;  4TJZ A;  1QWD A;  2W2A A;  5BVT A;  4EEJ A;  3HWE A;  5F7G A;  5B5F A;  2GJ5 A;  2KTD A;  3RBY A;  5AEO A;  1SXU A;  2RA6 A;  1ICM A;  5L8N A;  2WQ9 A;  3B2L A;  2KD2 A;  1DFV A;  2OL7 A;  2HZQ A;  2IZA A;  3CWK A;  3OBL A;  1SWN A;  3NR3 A;  1NBX A;  5EEE A;  5LJG A;  4CPH A;  1GKA B;  1W5R A;  3S26 A;  2Q9S A;  3KVN A;  5B11 O;  1VWR B;  1STS B;  3FW4 A;  1FJ1 E;  1NGL A;  5HZ5 A;  4QZU A;  4YDA A;  4ORU A;  2RTG B;  4IAB A;  1HMT A;  3VU1 A;  1SWR A;  3RY2 A;  3ZW0 B;  1STP A;  3CQN A;  4ZHG A;  4IBA A;  3RDQ A;  2MWH A;  5F1E A;  2FHN X;  1URE A;  2OFM X;  5FFH A;  2FLJ A;  5IRU A;  3BLG A;  4QGW A;  4ZH6 A;  4CDE A;  3VG5 A;  1KT3 A;  1MM9 A;  2RTK A;  4WBK A;  3BX8 A;  1SXY A;  3FR4 A;  1HMR A;  1VWJ B;  3FA6 A;  1SLE B;  4Y0R A;  3CQR A;  1Y9L A;  4YFR A;  4FBO A;  4OMX A;  1AEL A;  4DCB A;  3WJF A;  3IA8 A;  4YFP A;  4ON1 A;  3P6H A;  4OS3 A;  1W4T A;  5HAE A;  3CBC A;  1HXZ A;  3FYF A;  2KTS A;  4IMN A;  3BY0 A;  4OS0 A;  4GNW A;  4O4O A;  5HTD A;  1ZNH A;  1Y55 X;  1X8P A;  4QGV A;  1VWE B;  3APU A;  5EED A;  1SMP I;  1U18 A;  3V8U A;  3STM X;  2HNX A;  1EIO A;  3N91 A;  4IRW A;  3P6D A;  4ALO A;  4TKJ A;  2JGS A;  5LJE A;  4QGX A;  2A5C A;  5CHK A;  3WZN A;  5AQ6 A;  3NPO A;  1MEP A;  2RTR B;  3VG6 A;  4O4X A;  5EDB A;  4MIS A;  5KIC A;  2FHL A;  1SWF A;  4ES7 A;  2C4I A;  1VWM B;  1FEL A;  2IZB A;  3KFF A;  4IB9 A;  5FQ7 E;  4I9R A;  2X32 A;  1KZW A;  1EII A;  2JOZ A;  1SWK A;  2IZG B;  1VWF B;  2AMM X;  3PH5 A;  4I95 A;  4LZV A;  3SZH A;  4YBP A;  1QY1 A;  1DV9 A;  1HMS A;  5C0N A;  4EXZ A;  1ZNL A;  3SZI A;  1A57 A;  1YWC A;  4QNI A;  4YGH A;  3VG7 A;  1ERX A;  2CM9 A;  1OBP A;  3BU9 A;  4ARH A;  2WSJ A;  2CZU A;  1NC9 A;  2A2G A;  2A5B A;  1SWP A;  3CKF A;  3UAQ A;  4YCE A;  3MG5 A;  1VWI B;  1G7N A;  1EI5 A;  1DC9 A;  1LDO A;  5H8T A;  2OFA A;  3S60 A;  5D48 A;  1KXO A;  3WJE A;  4YGG A;  4BQU A;  2FS7 A;  2MO5 A;  5EZ2 A;  3VPJ E;  3WOV A;  4D6A A;  1TOU A;  4LKT A;  5CSE A;  2AT8 X;  1JIW I;  2MF6 A;  3AKN A;  4Y0P A;  3UEU A;  4TLJ A;  3UEX A;  1MX8 A;  3WYP A;  4AZP A;  1JV4 A;  1X71 A;  2GTL N;  3APW A;  4ZR2 A;  3S5X A;  4CDF A;  2WEX A;  1VWA B;  1VWQ B;  3PH6 A;  1MUP A;  4MIR A;  1PBY A;  3CBS A;  2OY8 A;  3ZW1 B;  1PBO A;  2BHV A;  1HBQ A;  4Z2O A;  2JN3 A;  1S7D A;  2LKK A;  4GDA A;  3EMM A;  4QYP A;  2QOM A;  3K3L A;  4GGZ A;  2JMB A;  2OY1 O;  5IO6 A;  5CE4 A;  1LIC A;  2OVD A;  2AH7 X;  1S44 A;  1Y0G A;  1HXL A;  3KQ0 A;  4QRL A;  3WJD A;  2X55 A;  1ZNG A;  1FE3 A;  4IAX A;  2VDF A;  1RXJ A;  3FDC A;  1SWS A;  1BRQ A;  2AF5 A;  3RWX A;  1A2D A;  1CBQ A;  1I06 A;  1KZX A;  4MVK A;  1EUO A;  4XMG A;  2OYB O;  2I5V O;  3NQ9 A;  2IZE B;  2X56 A;  3BDR A;  3NAD A;  3TZS A;  1SLF B;  2FS6 A;  4Y0S A;  5LJK A;  1T0V A;  1LCW A;  2R73 A;  2WQA E;  2X34 A;  3FEP A;  2ACO A;  1JMX A;  2A8G A;  2ALL X;  4ODD A;  4YBU A;  1SWO A;  1JJX A;  3FW5 A;  4HWM A;  4INN A;  4U8U M;  2DJF A;  1X8U A;  1CBS A;  3PP6 A;  4Z2V A;  1UYN X;  2Q2M A;  1WUB A;  3FA9 A;  4OMW A;  4A60 A;  1A3Y A;  3EBW A;  3PQS A;  2POA A;  1SWQ A;  2ACP X;  4IB7 A;  2RTA A;  3JQO A;  4N7C A;  5IO5 A;  1EAL A;  5KID A;  1ZNE A;  3PQU A;  1Y53 X;  4BX5 A;  2IZH B;  2VFC A;  3UEV A;  4TKH A;  4IB6 A;  2AVI A;  2C1Q A;  2W2F A;  1KQW A;  4NNT A;  2K62 A;  3KFI A;  4D6B A;  4DNE A;  1RXH A;  1BEB A;  3EC5 A;  4UU3 A;  5D4A A;  1GT3 A;  2QM9 A;  4NYQ A;  3TF6 A;  3TGA A;  4BOE A;  1W6F A;  1SRF A;  2OFR X;  5HCE C;  3IFB A;  1GGL A;  3BS2 A;  4ZH9 A;  1VWL B;  1K3B A;  5F58 A;  4FBR A;  1IKE A;  2G7B A;  2ANS A; 
#chains in the Genus database with same CATH homology
 3HOE A;  2AL0 X;  2FR3 A;  5B27 A;  1FEN A;  1BWY A;  3O22 A;  3B2I A;  4XME A;  4HPD A;  1KT7 A;  5FEN A;  2NNE A;  1QFT A;  1YIV A;  3GAQ A;  4O9S A;  5DG4 A;  3ZI8 A;  4ZHD A;  5LJH A;  4GNY A;  1T68 X;  1LIB A;  2RQ0 A;  3VE1 A;  1SXW A;  4BVM A;  2CZT A;  1LIE A;  1B4M A;  5AJC A;  4A1H A;  5LJB A;  5L8O A;  1RBP A;  3HWG A;  4KT5 A;  1ADL A;  4O3Y A;  3WBG A;  2ASN X;  3P6F A;  1O1U A;  1UZ2 X;  4MVI A;  1YWD A;  2QOS C;  4O3W A;  1JYJ A;  1QG5 A;  3UEW A;  2JU3 A;  1X8O A;  4GET A;  4MVE A;  3EM0 A;  4QZT A;  2QO6 A;  2HMB A;  3HOL A;  3O19 A;  1B56 A;  1HBP A;  1QY0 A;  2G79 A;  1ALB A;  5BVQ A;  2OVS A;  3U9P C;  5HZ9 A;  4WHI A;  4AZM A;  2WUT A;  2NP1 A;  1TVQ A;  5HZ6 A;  2WEW A;  3FA7 A;  3FEL A;  1OBQ A;  4I6S A;  3VE2 A;  4ZGF A;  1AB0 A;  1P6P A;  2R74 A;  1NP4 A;  3WXQ A;  1GKA A;  2AT5 X;  1OEK A;  1ZRY A;  2E4J A;  1XCA A;  1T8V A;  4AYH A;  4IB8 A;  2BS6 A;  3RZY A;  1OBU A;  4GRJ A;  3OJY C;  2YMS A;  1BJ7 A;  4U9C A;  1IFC A;  5HZQ A;  3G7X A;  5LKF A;  2Q4N A;  4ML7 B;  4YFQ A;  2QO4 A;  3ZW0 A;  3FMZ A;  3AKM A;  3MVF A;  4M7M A;  3BU1 A;  4ZGU A;  4I3B A;  1R0U A;  1GT5 A;  4LQZ A;  3QKG A;  1GXA A;  1YWA A;  4CV7 A;  5K06 A;  5D8J A;  2G78 A;  4N7D A;  4M6S A;  3WJB A;  4AZN A;  2OVE A;  4GKC A;  5DPQ A;  4YGZ A;  1DZJ A;  2RD7 C;  1G85 A;  4QYN A;  3LHN A;  4I3D A;  1BRP A;  3P6E A;  4XMH A;  1S2P A;  3BX7 A;  2GC9 A;  4GDZ A;  3ZWE A;  1IFB A;  3APX A;  4DQ3 A;  5IO7 A;  3TGC A;  2X45 A;  4KC7 A;  4EDE A;  3FR5 A;  3MBT A;  4RUN A;  1PMP A;  4GZV A;  4YMY A;  4O3X B;  1SY1 A;  1B8E A;  3KFG A;  1BSO A;  1RLB E;  3S5V A;  5HWZ A;  2HYS A;  3FR2 A;  5CYB A;  1VYG A;  4U8U O;  4LKP A;  1MVG A;  1Y9T A;  2YG2 A;  5F6Z A;  2A0A A;  4UU2 A;  1O1V A;  1JZU A;  4JGL A;  3P24 A;  4XMC A;  3JSQ A;  1EW3 A;  2O62 A;  5HTE A;  4ZHH A;  1QFV A;  1AQB A;  3NBX X;  3STK A;  4ID2 A;  3B2J A;  1EXS A;  4ALB A;  1GT4 A;  2BS5 A;  3VG4 A;  1CRB A;  5JR8 A;  3CMP A;  1KT6 A;  5AJB A;  1G74 A;  1GX8 A;  1OPA A;  1X89 A;  2AT0 X;  2FR2 A;  4FGI B;  5H9L A;  4EQA C;  3NQ3 A;  5F6B A;  3OD9 A;  2ZAG A;  3STN A;  3ZW1 A;  3D97 A;  1QY2 A;  2AT3 X;  3CR6 A;  1OPB A;  2F09 A;  2F73 A;  4HPB A;  1MDC A;  1E02 A;  4O49 A;  2K23 A;  1EPA A;  2JW1 A;  4RUU A;  3VG2 A;  3U03 A;  1H91 A;  1I04 A;  3O2Y A;  4I9S A;  4A1Y A;  3C76 X;  2L67 A;  3Q6L A;  1KT5 A;  1LNM A;  2X46 A;  4KII A;  4L3R A;  4ORW A;  4HFO A;  3RKG A;  2A13 A;  1SY0 A;  2LBV A;  5HA0 A;  2MJI A;  3F9D A;  3SAO A;  1IW2 A;  2LA7 A;  1GX9 A;  2XKL A;  2W2B A;  2XST A;  4NLJ A;  1YP7 A;  2GTL O;  4O4S A;  5H9N A;  3PPT A;  3NP1 A;  4CK4 A;  3OE3 A;  1VYF A;  4PJ2 A;  2LBA A;  1G5W A;  1I05 A;  2FT9 A;  1KT4 A;  1MX7 A;  1CBI A;  4L1N A;  3WJC A;  3TGB A;  2HLV A;  4TKB A;  3KZA A;  5H9A A;  2ZAI A;  3F8A A;  3FEK A;  3HTY A;  3P6C A;  3EYC A;  1DZM A;  1SA8 A;  1A18 A;  4NNS A;  1X8Q A;  5HZ8 A;  5H9K A;  4TNN A;  1TW4 A;  2GTL M;  5FQ8 E;  4I3C A;  4AW8 A;  1AVG I;  1EPB A;  1LKE A;  2QO5 A;  1U17 A;  3D96 A;  5FQ6 E;  4HPC A;  1QQS A;  3L4R A;  5HCD C;  1ICN A;  2FWV A;  1I4U A;  3GE2 A;  2OZQ A;  4YH0 A;  3LV4 A;  4GE1 A;  4ZFX A;  5HA1 A;  5KHP A;  1U0X A;  2FTB A;  2BLG A;  1HQP A;  4OS8 A;  4KH8 A;  5B29 A;  1FTP A;  2EU7 X;  1BM5 A;  1L6M A;  3ZUI A;  4GK9 A;  1JYD A;  1TXL A;  4U8U N;  3EBK A;  3D4R A;  2CBS A;  4GU8 A;  3T1D A;  3I17 A;  4YCH A;  4GH7 A;  5BYP A;  4COT A;  2A3F X;  4MVL A;  2PY1 A;  2QMI A;  2JU8 A;  5EDC A;  1IKJ A;  1ZND A;  4LZU A;  1O8V A;  4XMF A;  5D47 A;  3H3I A;  2BT9 A;  1N0S A;  2WR6 A;  2FRS A;  2WWP A;  3ZQ3 A;  3DTQ A;  3ZZV A;  4ORY A;  2Q39 A;  1GT1 A;  2RN4 A;  4YKO A;  5D45 A;  2R56 A;  3FA8 A;  1CBR A;  4AZO A;  5LJC A;  3PED A;  1LFO A;  2MHD A;  3KFH A;  4AZR A;  1KQX A;  4NP1 A;  3WJG A;  2X8S A;  2M4L A;  1ML7 A;  4FQB B;  1E5P A;  2OVA A;  1E00 A;  1SY3 A;  2JU7 A;  3E3C A;  1PEE A;  1FEM A;  1OEE A;  4YKM A;  1NP1 A;  3VG3 A;  3FIQ A;  2NNQ A;  3FEN A;  4FBV A;  2AT6 X;  2Z4H A;  4QAE A;  1BSQ A;  2KT4 B;  1YP6 A;  2LB6 A;  1Z24 A;  3BSZ E;  2LFO A;  2AKQ A;  2Q2P A;  2RCT A;  4ZHF A;  3U0D A;  1SXX A;  3B2H A;  4IAW A;  3WVM A;  4K19 A;  2Z4I A;  1QAB E;  5FAZ A;  1LIF A;  3I0A A;  1BLR A;  1ACD A;  1JJJ A;  1EQD A;  2CBR A;  2GTF X;  4PSQ A;  4HPA A;  5HCC C;  3P02 A;  3BRN A;  2NND A;  1SY2 A;  1VPR A;  3HWF A;  1BSY A;  1X8N A;  1KGL A;  2KW1 A;  1LPJ A;  5LJD A;  1LID A;  4YDB A;  1DF3 A;  5EPQ A;  4NW4 A;  3HWD A;  3HK1 A;  4ZCB A;  3ZW2 A;  3APV A;  4WFV A;  4KCA A;  4IMO A;  3ZUO A;  4ZJ0 A;  2DM5 A;  1DZP A;  1FDQ A;  1OEJ A;  2HZR A;  3B2K A;  1XKI A;  2A2U A;  3NX2 A;  3FLL A;  3ELZ A;  3F6Z B;  1ERB A;  4Y0S A;  1BBP A;  2X8F A;  3NQK A;  1CJ5 A;  4WFU A;  4DQ4 A;  5HBS A;  3ELX A;  1B0O A;  1YWB A;  4Y0Q A;  4AZQ A;  4U3Q A;  1KOI A;  4TQ2 A;  2L68 A;  4ORR A;  5L8I A;  4ORS A;  4NYR A;  3C77 X;  3C78 X;  1JBH A;  2L5P A;  4ZHC A;  5LKE A;  1LF7 A;  2P8G A;  2IFB A;  2L9C A;  1E06 A;  1GM6 A;  1HN2 A;  4ORX A;  4R0B A;  3SOT A;  1D3S A;  1D2U A;  2X8T A;  3DSZ A;  5BVS A;  4NLI A;  1YUP A;  4QQ1 A;  2MM3 A;  3JS1 A;  3NX1 A;  1ZNK A;  4A8Z A;  4EFG A;  1DZK A;  2RCQ A;  1TOW A;  4O3Z A;  1PM1 X;  3RSW A;  3P6G A;  3MX7 A;  4KC8 A;  1IIU A;  3D95 A;  3PEC A;  2N93 A;  4O4U A;  2CM4 A;  4XMD A;  4CSB A;  4TJZ A;  1QWD A;  2W2A A;  5BVT A;  4EEJ A;  3HWE A;  5F7G A;  2GJ5 A;  2KTD A;  3RBY A;  5AEO A;  1SXU A;  2RA6 A;  1ICM A;  5L8N A;  2WQ9 A;  3B2L A;  2KD2 A;  1DFV A;  2HZQ A;  3CWK A;  3OBL A;  3NR3 A;  5EEE A;  5LJG A;  1GKA B;  3S26 A;  2Q9S A;  3FW4 A;  1NGL A;  5HZ5 A;  4QZU A;  4YDA A;  4ORU A;  4IAB A;  1HMT A;  3VU1 A;  3ZW0 B;  3CQN A;  4ZHG A;  4IBA A;  2MWH A;  5F1E A;  5FFH A;  1URE A;  2OFM X;  2FLJ A;  4ZH6 A;  3BLG A;  4QGW A;  3VG5 A;  1KT3 A;  4WBK A;  3BX8 A;  1SXY A;  3FR4 A;  1HMR A;  3FA6 A;  4Y0R A;  3CQR A;  1Y9L A;  4YFR A;  4FBO A;  4OMX A;  1AEL A;  3WJF A;  3IA8 A;  4YFP A;  4ON1 A;  3P6H A;  4OS3 A;  5HAE A;  3CBC A;  3FYF A;  5HTD A;  2KTS A;  4IMN A;  3BY0 A;  4OS0 A;  4GNW A;  4O4O A;  1ZNH A;  1X8P A;  4QGV A;  3APU A;  5EED A;  1SMP I;  1U18 A;  3V8U A;  3STM X;  2HNX A;  1EIO A;  3N91 A;  3P6D A;  4ALO A;  4TKJ A;  5LJE A;  4QGX A;  5AQ6 A;  3NPO A;  3VG6 A;  5KIC A;  4O4X A;  5EDB A;  4MIS A;  4ES7 A;  1FEL A;  3KFF A;  4IB9 A;  5FQ7 E;  4I9R A;  1KZW A;  1EII A;  2JOZ A;  4LZV A;  2AMM X;  3PH5 A;  4I95 A;  4YBP A;  1DV9 A;  1QY1 A;  1HMS A;  5C0N A;  4EXZ A;  1ZNL A;  1A57 A;  1YWC A;  4QNI A;  4YGH A;  3VG7 A;  1ERX A;  2CM9 A;  1OBP A;  3BU9 A;  4ARH A;  2WSJ A;  2CZU A;  2A2G A;  3UAQ A;  4YCE A;  1G7N A;  1EI5 A;  1DC9 A;  5H8T A;  3S60 A;  5D48 A;  1KXO A;  3WJE A;  4YGG A;  4BQU A;  2FS7 A;  2MO5 A;  5EZ2 A;  3VPJ E;  3WOV A;  4D6A A;  1TOU A;  4LKT A;  2AT8 X;  1JIW I;  4Y0P A;  3AKN A;  3UEU A;  3UEX A;  4TLJ A;  4AZP A;  1MX8 A;  1JV4 A;  1X71 A;  2GTL N;  3APW A;  4ZR2 A;  3S5X A;  2WEX A;  3PH6 A;  1MUP A;  4MIR A;  3ZW1 B;  3CBS A;  1PBO A;  2BHV A;  1HBQ A;  2LKK A;  1S7D A;  2JN3 A;  4QYP A;  3EMM A;  3K3L A;  2JMB A;  5IO6 A;  5CE4 A;  1LIC A;  2OVD A;  2AH7 X;  1S44 A;  4QRL A;  3KQ0 A;  3WJD A;  1ZNG A;  1FE3 A;  4IAX A;  1BRQ A;  3RWX A;  1A2D A;  1CBQ A;  1I06 A;  1KZX A;  4MVK A;  1EUO A;  4XMG A;  3NQ9 A;  3BDR A;  3NAD A;  3TZS A;  2FS6 A;  5LJK A;  1T0V A;  2R73 A;  2WQA E;  3FEP A;  2ACO A;  2ALL X;  4ODD A;  4YBU A;  1JJX A;  3FW5 A;  4HWM A;  4INN A;  4U8U M;  3PP6 A;  1X8U A;  1CBS A;  2Q2M A;  3FA9 A;  4OMW A;  4A60 A;  1A3Y A;  3EBW A;  3PQS A;  2POA A;  2ACP X;  4IB7 A;  4N7C A;  1EAL A;  3JQO A;  5IO5 A;  5KID A;  1ZNE A;  3PQU A;  3UEV A;  4TKH A;  4IB6 A;  2W2F A;  4NNT A;  1KQW A;  4D6B A;  2K62 A;  3KFI A;  4UU3 A;  1BEB A;  5D4A A;  1GT3 A;  2QM9 A;  4NYQ A;  3TF6 A;  3TGA A;  4BOE A;  2OFR X;  5HCE C;  3IFB A;  1GGL A;  3BS2 A;  4ZH9 A;  5F58 A;  4FBR A;  1IKE A;  2G7B A;  2ANS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...