4IAYA

Room temperature x-ray structure of camp dependent protein kinase a in complex with high sr2+ concentration, adp and phosphorylated peptide psp20
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
336
structure length
333
Chain Sequence
VKEFLAKAKEDFLKKWETPSQNTAQLDQFDRIKTLGTGSFGRVMLVKHKESGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVAGGEMFSHLRRIGRFEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFTEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cAMP-dependent protein kinase catalytic subunit alpha
publication title Insights into the Phosphoryl Transfer Catalyzed by cAMP-Dependent Protein Kinase: An X-ray Crystallographic Study of Complexes with Various Metals and Peptide Substrate SP20.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase/peptide
total genus 107
structure length 333
sequence length 336
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2012-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4iayA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4iayA02
1WBOA 3KVWA 1MUOA 2R3GA 2QOBA 3MY1A 4QP4A 5HBEA 3TJCA 1ZY5A 3L1SA 3W2OA 3QTZA 5IG1A 5IPJA 3DQXA 4TYGA 5T68A 5JQ5A 4E73A 4DH7A 5CI7A 4PTGA 4X3FB 1W0XC 4ZZNA 3QTUA 2J90A 1NA7A 3OXTA 4QP1A 3ULIA 3GU6A 2WMXA 3E88A 4QMLA 4IH8A 4FKPA 2WQBA 3QC4A 2YM6A 3Q9YA 3ZYAA 3O8PA 2XNPA 3IOKA 4M13A 2CNUA 4I5HA 3HA8A 4C36A 2GSFA 5B2LA 5D12A 4CGAA 3EN6A 3BELA 4QYEA 4WBOA 2FB8A 1NT2A 3QD0A 5CU4A 4RVLA 2CLQA 2NRUA 3KEXA 3VS4A 4AE9A 1O6YA 4EUTA 3DNDA 3CQUA 4NL0A 3PPKA 2XA4A 3NAXA 4FUYA 4BDAA 5C8NA 1ZMVA 2A1AB 5K9IA 2PYWA 2CCHA 2VTLA 4HOKA 2WEVA 4L46A 3UYSA 5JQ8A 2UZDA 4FTNA 4MQ1A 3CKXA 1UV5A 3BRBA 2B7AA 2Z7LA 2VTNA 3ORPA 4NM0A 1KUTA 4W4VA 3S4QA 5KMNA 4GH2A 1FQ1B 1XBBA 3F5PA 4R1YA 3MN3A 4RZVA 2QOKA 3PLSA 3O71A 3QUEA 5FG8A 4EOOA 3EYGA 4CCBA 3ITZA 4O0RA 2Z8CA 2QNJA 5F4NA 4BDGA 4OAVB 3KL8A 3H9FA 3TIZA 4GUBA 3VWAA 2VUWA 4IVCA 5GHVA 2DS1A 2ZM1A 4IAIA 4ZTRA 2UV2A 4FICA 2FO0A 3NNXA 2ZV7A 1MRYA 2FSMX 1Z5MA 5FQDC 4RC3A 4ZK5A 4ANNA 4MBLA 2JKMA 5EG3A 4E6AA 4DCEA 5CF5A 1GAGA 2OW3A 5CLPA 3VBTA 4YZCA 4NCTA 3ZRKA 4ZEGA 3KXZA 2W05A 3GI3A 4EYJA 2RFDA 4O1OA 5AV4A 2QHNA 4U8ZA 1M2PA 2JBOA 4CT1A 4BBFA 2ZDUA 2PULA 2PTKA 2VTOA 1OM1A 4XUFA 3OFMA 1EH4A 1U5RA 2VTQA 2XK8A 4FODA 2OF2A 3O0GA 4C34A 4R5SA 2R64A 3GBZA 3QA0A 4C4GA 3C7QA 4ZSGA 5FBNC 4L6QA 5FP6A 4E6DA 2BAJA 3CTHA 3OXZA 3W55A 2CNQA 3R2BA 4IW0A 2XIZA 5TO8A 4GK2A 4W4YA 4YR8A 2B9IA 4RJ7A 5KKRB 4HGTA 5E8XA 3NPCA 3PJCA 3TDVA 1S9IA 5CU3A 4U3ZA 4Q5EA 3AC3A 3AT2A 4OT6A 4NYEA 1V0PA 3IKAA 4YLLA 3FMDA 3RPVA 2VGOA 2HXQA 4UN0C 2FSTX 3JVRA 2OZAA 3R8VA 2ITUA 2W0JA 4AXAA 5J87A 4B8LA 4C37A 4EH8A 3PWYA 2ZDTA 3LW0A 4GVJA 3EFLA 1UU8A 5HQ0A 5KMOA 1KSWA 4NKAA 4HVGA 1WZYA 1PYEA 4DFBA 1YDTE 4F9CA 1PY5A 3S3IA 4WNMA 2RG5A 3FHIA 3NUPA 5LCKA 5FEDA 5CAQA 5IQCA 3I60A 1J7IA 4HYUA 4IXPA 3D15A 4FKRA 4R3CA 4IZ5A 5D7AA 2OK1A 5CNOA 4ZY6A 4XX9A 3R30A 2W1ZA 3OW4A 4FZ6A 4HPUE 5AP7A 2XNNA 4A7CA 4DGOA 4FNXA 1W84A 3D7TA 5E8WA 4M15A 2X8EA 4ZSJA 5H8EA 3E93A 1URCA 5CAVA 5A9UA 4DEHA 3P7CA 4QP7A 4QTBA 4USFA 1ZMWA 2GQRA 2BHHA 3QGWA 4DHFA 1NVRA 4UWYA 4F63A 4QMTA 4XLVA 2XB7A 3BU5A 2GNLA 4C4HA 1GZKA 1OPLA 4NW5A 5HNGA 3LFSA 4NJ3A 3R9NA 2X39A 4WUAA 3RZFA 3TN8A 1H00A 3BEAA 5CX9A 4LGHA 5FD2A 3DLZA 1P5EA 4YZBA 4HVSA 2R3HA 2UW5A 1VYZA 3QX2A 4E20A 4GT5A 3BQRA 5AR2A 4F7LA 2ACXA 3QLFA 2W5BA 2X8DA 3PIZA 4IAYA 2BKKA 4FC0A 3S0OA 5LVPA 2R0UA 2WMTA 3HV7A 3UGCA 3KXXA 3FZPA 4E5AX 4AA0A 4QD6A 1PF8A 3GU8A 3UO6A 2OGVA 4ZZMA 2UW6A 4F4PA 3ENMA 3QU0A 1OIQA 4J1RA 4BCIA 3LQ8A 4WHZA 5D9HA 2ZAZA 3V5JA 3KULA 3NX8A 4FVPA 2BPMA 4XLIA 5EKOA 3RM7A 5HZNA 1YW2A 1XWSA 3ZS5A 1H1WA 4FTJA 2XBAA 4JG7A 4DITA 3CBLA 5ETFA 5I0BA 3FHRA 1LEWA 3AMAA 2WNTA 3FXZA 4IZ7A 4C4JA 4NJDA 3TJDA 5L2WA 3RNYA 3RBWA 3S00A 3ACJA 3ZUTA 3PVGA 4PY1A 4AW0A 4FZFB 4DFXE 4R7IA 5JH6A 3PG3A 3RWPA 4NM7A 4AN2A 4EOMA 3UO4A 3LMHA 3G33A 3CY2A 1J1CA 2HWPA 2ITPA 3G0EA 5EW3A 3T3VA 4LQMA 3QTIA 5AP6A 3VO3A 2HY0A 2VNWA 5AIKA 3ZC6A 4AOTA 5HBJA 2PE2A 3KRRA 4K0YA 1Y57A 2H34A 3A8WA 1QL6A 2OF4A 3GCVA 3R28A 4FTKA 4EOPA 4RPVA 5M4UA 3HDMA 4KKHA 4BHNA 5HLPA 3HDNA 3EFWA 4B7TA 4C8BA 4IB5A 4RVKA 2OH0E 1WBWA 3VULA 3ZUVA 3FKOA 4UALA 4QMOA 3R7IA 4ZXTA 3ORTA 4LV5A 2BRBA 4FTOA 3ORIA 2YM4A 4O83A 4PDYA 1TQPA 5AUWA 1GJOA 4FK6A 4GFMA 5AV0A 2GHGA 4H3PA 2XH5A 3PVBA 4FT5A 3UZPA 1PRYA 5E1EA 2J9MA 4AG8A 2Z7SA 3BIZA 4DEGA 3LLTA 4I20A 3ZU7A 4IE9A 5BYLA 5B2KA 1PXOA 2HZNA 3QRKA 3WF7A 5FM3A 3VIDA 2OG8A 2X9EA 3RK5A 4WUNA 4DGMA 5HCZA 1YXVA 4DAWA 2C5YA 3II5A 1IASA 4PDSA 5AAGA 3LCTA 2WPAA 2Y4PA 4IWPA 1R3CA 4KS7A 3UQFA 3ORXA 2C3KA 5HE0A 3UOJA 4X2GA 3FEGA 2IWIA 4QMYA 1PMEA 4BR3A 2X9FA 5DR6A 2W5AA 3RGFA 4QQCA 4XYFA 3SV0A 3TM0A 3I7BA 3MB7A 4LUDA 3DCVA 1DI8A 4FVQA 1BLXA 4YLJA 3OCTA 4JAIA 4A9RA 3FSFA 4FV6A 4IEBA 4M97A 1K2PA 4BTKA 2PVNA 4WRGA 5DRDA 4FNYA 5AM7A 4C2VA 4U80A 4DFUA 4BY9E 2XM9A 3LFBA 3CPCA 5KZIA 4RJ8A 2ZB1A 2CGVA 3AC4A 3DXQA 3GC7A 2UZLA 4Y46A 4IACA 1P14A 3RKBA 4IM2A 4EWQA 2XNBA 4D0WA 4ZAUA 4JS8A 1OBGA 3TL8A 4A9YA 5C4KA 1T45A 1YQJA 3A7GA 3TNWA 4F65A 3W8LA 5AAEA 1ZY4A 2WZJA 5CANA 1G8SA 3LKMA 4JJRA 4NWMA 1T46A 3V8TA 2LAVA 1J1BA 1OL6A 3BLHA 3TWJA 5JZNA 5TT7A 4PP7A 4AZEA 4AZVA 2HIWA 5EYMA 5CEIA 4D1XA 5HG9A 2PUUA 5LMKC 2QOHA 2W96B 1B39A 3RAIA 3Q6WA 5HIEA 3LFNA 3QKKA 4L3PA 2WTIA 5IISA 4FTLA 3SW4A 3RZBA 4DYMA 4GKIA 5HVKA 1WVYA 5CNNA 4FZAB 1L8TA 2C5VA 4BGQA 3P79A 4NSTA 3NRMA 4BTMA 1Y6AA 4FR4A 3MTFA 3OCGA 5FEQA 5JMSA 3HNGA 1YKRA 3NUAA 4DTKA 3W32A 5CALA 1FVVA 3KMMA 2BROA 4FT0A 4AZFA 2CNVA 1DS5A 1Y6BA 2CHLA 4Z7HA 3GC8A 4AW5A 3UE4A 2BAKA 4RSSA 2UZVA 3PVWA 4FMQA 4E5BA 2YEXA 3HYHA 2UW3A 4ZIMA 4FSQA 2RFNA 4MKCA 3W8QA 2EVAA 2EB2A 2YJRA 3ZSIA 2WQOA 4I0RA 2ONLA 3R7YA 4RLKA 4JR7A 3DDPA 1SM2A 2X81A 4LL5A 4LM5A 5JFSA 4FV0A 3ZO4A 2PVLA 3HMOA 4CQGA 4E4NA 5IQIA 3K3JA 1TVOA 3MWUA 4FNWA 5JFXA 4F6UA 3BKBA 2WKMA 2UVZA 5LJJA 3QCQA 4I23A 2J0JA 4JR3A 4L7SA 3LCDA 4RFZA 3PP0A 5DEWA 4CNHA 3NVKI 4MD8E 4ZJVA 4AZSA 2X2LA 4O0UA 4CFWA 3N4TA 2REIA 5FXQA 1JKKA 2ITWA 1KE8A 3EQPA 2JDOA 3KMUA 5CI6A 3ZO2A 4JBQA 1AGWA 3QXOA 3TKIA 5BVDA 4EQCA 3MPMA 3OCSA 4QP3A 2I1MA 3MVHA 3OVVA 1I44A 2GNGA 1G3NA 5HESA 4EHZA 5GIOE 3PY0A 3EOCA 1QPCA 1ZMUA 4PMMA 4MXXA 3FMEA 2RF9A 3TNPC 2C4GA 1PKGA 2CN5A 4N4SA 1F0QA 2DYLA 4LMUA 4E6QA 3DXPA 4WIHA 3AC8A 3OZ6A 1AD5A 4FEQA 4JQ8A 1LUFA 5FTOA 3V5LA 5IH5A 2PVYA 3ZCLA 4L68A 1Q8UA 3GU4A 5A4QA 4IFCA 3W2SA 3E87A 3GCQA 4HNIA 4U42A 4AW1A 2GDOA 5AV3A 4QPSA 3TT0A 1YHVA 4IZYA 3O7LD 4PMTA 2CKEA 5BVEA 1U54B 4FL2A 3U4WA 2J6MA 4YP8A 2QO2A 4KRDA 3ZO3A 4MH7A 3GCPA 2WTJA 4NM5A 3NW7A 4LV8A 5CZIA 2RSVA 2A4LA 5E92A 2V5QA 3PVUA 4RG0A 4Y83A 3DY7A 3ODZX 2OIDA 5D41A 3ZFXA 3TI1A 3QZIA 3ZRLA 4DTBA 3UQGA 3U9NA 5M06A 4QMMA 2UZOA 1ZYSA 3RHXA 1YOMA 4CFVA 4DA5A 4G9CA 4F70A 3KK8A 4YJTA 4IWDA 4M7IA 4YBKA 4JIKA 2XVDA 3TNIA 5HX8A 4EC8A 4IFGA 2QO9A 4ACGA 3UIXA 1VEBA 3WZJA 2OWBA 4X21A 4MNFA 4L3LA 3QYWA 2UZBA 4LUEA 4CMUA 3C4FA 3R73A 3GT8A 4RIOA 1SMHA 3L8SA 5D1JA 2KULA 3RPRA 4C2WA 3HV6A 2VV9A 1SZMA 3VUHA 3OS3A 5CXHA 4ZTNA 2IZRA 4FZ7A 3K3IA 4FV7A 4BDIA 4IB1A 2CKPA 4C02A 2OFUA 4DG3E 4KBAA 4F64A 4RX9A 5ANJA 4U6RA 1H8FA 3VJNA 4D28A 3IW4A 3ORKA 4DC2A 5CF8A 5A4EA 5AR5A 4OTIA 1K9AA 4I24A 3V3VA 4EH7A 4OAUC 5L6PA 4JQ7A 4J99A 4MXOA 4FKSA 4NIFA 3U54A 2QLUA 3RWQA 2PZPA 1XJDA 1O9UA 3RAKA 5BMMA 2VO7A 4GJ2A 2X8IA 3WIKA 4TWNA 5ETCA 2VTTA 4IAKA 5IQFA 3VHKA 5BUIA 5AP3A 4H39A 1XH9A 3AGLA 4EH9A 3QCSA 3JPVA 3I6UA 4PNIA 5DH3A 4AWIA 2Q0BA 3PZHA 5BX0A 2LGCA 4F1OA 1OL7A 2XKCA 3QKLA 4M8TA 2YIYA 4MWIA 5IQBA 4Y72A 4F9WA 4W4WA 4NFMA 3BHUA 2W7XA 4FBXA 1REJA 3TUCA 2XK9A 3QCYA 3IDBA 3MIAA 3OOMA 4G16A 1VJYA 4ZTLA 4CFMA 3ID6C 4ASXA 2WEIA 3BEGA 1XR1A 4E4XA 1F5QA 2YITA 2E9NA 4DCAA 4PL5A 2PZYA 5FEEA 5FM2A 2J0KA 3KXMA 5I9YA 2PY3A 3C0IA 3LAUA 3MBLA 4MEDA 3H4JA 4TTHB 3OXIA 3R8UA 2R3RA 4ZS0A 1M7NA 1SNXA 2UZTA 2BAQA 3BPRA 3HUBA 2HW7A 3FQHA 1OPKA 2ESMA 2HAKA 1Q8WA 4QTAA 3DNEA 3CS9A 4U3YA 3DU8A 4FIIA 4YNEA 4PQNA 3AGMA 3FZTA 4RIYA 5AM6A 1G5SA 4ANOA 3HKOA 2BTSA 4O2ZA 1BL6A 2BVAA 3QRJA 4CKRA 3KQ7A 2J50A 4BCKA 1Q3DA 5E8YA 5J9LA 3BHYA 2Y0AA 2OKRA 1PXLA 3GVUA 3C51A 4IJ9A 5K0KA 3RHKA 2VTHA 2W1IA 1F3MC 3ZXZA 3DV3A 4A07A 4ZTMA 2XZSA 1W83A 4XG2A 3ZBXA 3C0GA 4EHGA 3PA4A 4BZOA 4U7ZA 5I9XA 1UNGA 3A7JA 3LZBA 2C6LA 3B2WA 3TV4A 3HV5A 3RMFA 1U5QA 1VYWA 3KXHA 2ERKA 4C35A 3F7ZA 5GZAA 3FI2A 4RJ5A 3JY9A 1OIRA 4BZDA 4R5YA 4FKWA 3F2NA 3U6IA 3NYVA 4I4EA 5GIPE 3FUPA 3KXNA 2HELA 1XH7A 5I3OA 4EK6A 5L2IA 3TIYA 3C4WA 5LMBA 3DKCA 5G6VA 3MIYA 3RJCA 4EJNA 2HWOA 5BVNA 2BIKB 3NWWA 1JPAA 5AJQA 5FWKK 3MFTA 3ZC5A 4B8MA 5JGBA 1S9JA 1JWHA 2HENA 3KXGA 5JRQA 1MP8A 4MYGA 4TL0A 4RGJA 1M2QA 3R21A 2A2AA 4KS8A 3EQFA 2F49A 2V62A 4E8AA 2W1EA 4AGCA 2JGZA 4OTGA 3TG1A 3QX4A 5CQUA 4ACDA 3NW6A 3E8DA 2PE0A 3UDBA 1PXIA 4OBQA 2UZNA 3DBQA 4O84A 1JQHA 4JDKA 4FT7A 5M4IA 3BGQA 1Q4LA 4F1MA 5EKNA 1QCFA 2PUNA 5KZ0A 3DB6A 2P4IA 3FYJX 4RFMA 4D4YA 4FA2A 3DTCA 3CC6A 2WMQA 3VBQA 4EUUA 3D2IA 3AD6A 5CS6A 4BI1A 4ANLA 4DEBA 2IN6A 1RE8A 3B2TA 3TTIA 3V6SA 3M11A 3FKNA 5AUTA 2CGWA 5IUGA 1IR3A 3ZLYA 4X3JA 4GVAA 4CLJA 4CRLA 5DI1A 3U4UA 5CEMA 2OJIA 2W1GA 1H1RA 5EDPA 4CZYB 1YDSE 3QD2B 4BVUA 3LFCA 5LXMA 2H8HA 5ACKA 3UJGA 1U46A 4CMOA 2UW8A 4HCVA 4UMRA 4BDEA 2J51A 2O0UA 1P4OA 5BYYA 4O7WA 3H30A 4IDVA 2QD9A 4I6BA 5EM5A 1Q62A 5HTCA 1XH5A 5CYIA 5FXRA 4DG0E 4QMSA 1OKZA 4AGWA 4GK4A 4AU8A 5BUJA 5EM6A 4I4FA 4NW6A 3QQLA 3GENA 4QT1A 3R7UA 4FG8A 3ZSGA 3MW1A 3FZOA 1FVTA 3FLYA 4ANQA 3TKUA 4BBEA 3Q9XA 2VX0A 2YCRA 3R1NA 2XNMA 4EONA 1GZ8A 5CAUA 2JIIA 3SG9A 1UNLA 4BDDA 4WBBB 3QTQA 4O0SA 3M42A 3QQKA 4RJ6A 5DOSA 3DKGA 1UVRA 1ZYDA 3R01A 4JQEA 1JSTA 1H08A 1YI3A 5IKWA 3EFJA 4ARKA 4FOBA 5HD7A 3W2QA 3WIGA 2F4JA 2XCHA 3GP0A 3OY3A 4FI1A 4CD0A 4EOJA 2PVMA 3G6HA 2QONA 4TNDA 3QQHA 4YJNA 2ETMA 4LOQA 4Y85A 3UVQA 1G8AA 2YDKA 2B53A 4RJ4A 4EOIA 2CGXA 2YIXA 3LLAA 1SVHA 3EN5A 2EU9A 4JBVA 5M55A 5E8VA 4WA9A 5DPVA 1DM2A 1OI9A 2ITYA 4O6LA 3R8ZA 1XKKA 2HCKA 3VQUA 3QALE 3C50A 3SRVB 4ZSAA 2VX1A 2PMLX 4JIAA 4F0GA 3A7IA 2CDZA 1UU7A 4D9UA 4E93A 4L3JA 4EWHA 1OL1A 2WD1A 5F20A 5I9ZA 1XH8A 4O82A 4K11A 5A6OA 2CPKE 2G01A 4FTMA 5EQEA 2YISA 4I21A 3COKA 5LOHA 4QMZA 5KUPA 4QMUA 1JVPP 3QZFA 5HNBA 1Q8YA 4QMQA 3BLQA 2YAAA 3DS6A 5IU2A 3F5XA 4R8QA 3GOKA 5J8IA 4CFXA 1ZWSA 1KV1A 2YWPA 4RC4A 2VNYA 4Z9LA 3PSDA 4ACMA 2WAJA 3R7OA 4CKJA 1PMUA 2CCIA 1H25A 2W17A 4EK3A 1KV2A 1GIIA 2X7GA 3PY1A 4GSBA 4C57A 1H4LA 5CZHA 4FSWA 1RJBA 2OZOA 2J5FA 4IQ6A 4NCTC 5DR2A 4DFNA 2JDVA 3EQCA 3F3WA 4GW8A 4ZTHA 1KWPA 3V01A 4F08A 1Z9XA 2XJ0A 2VWBA 2X0GA 3E3PA 3NYNA 3P0MA 5E8ZA 3QFVA 1A9UA 3QTXA 5AWMA 3U87A 5CT7A 4E4LA 3A2CA 1E9HA 1U4DA 5AR4A 1TQIA 2CN8A 1J7LA 2V0DA 4UMTA 4CG9A 2F2CB 4XHKB 3KVXA 2ZV8A 3BCEA 2FUMA 5HD4A 2C5NA 4JBPA 4V0GB 4MF1A 3FLZA 4ERWA 5BQ0A 3MY5A 5KE0A 4YJPA 4GL9A 4U41A 4ORKA 2WQNA 2WMUA 2R2PA 3O8TA 1M7QA 2OH4A 3D4QA 1M14A 3DAJA 4I5PA 1OBDA 4FEUA 4PTCA 4E5WA 2C5OA 5AFVA 1CKIA 1XBCA 3WI6A 3ZMMA 4D2VA 1Y8GA 3QWJA 3LPBA 3Q2MA 3SW7A 3LXPA 2E2BA 2QU6A 4FIFA 3EN4A 2IW6A 4BCNA 5FDXA 1WBTA 2IVVA 2JDSA 4KAOA 4M69A 3BU3A 2GNFA 1NVSA 3V6RA 3CE3A 3F2AA 2PVJA 3E7OA 3MSSA 5B0XA 2PE1A 2PZIA 4I6FA 4C33A 4EH6A 2IZUA 4G17A 4J98A 3D5WA 3GCSA 5KHXA 1WVXA 5HG7A 4IADA 4DH3A 4EEVA 2JFMA 2XYUA 3DAKA 5HX6A 5TE0A 4BCFA 3HP5A 3MFSA 2JFLA 4EYMA 3I4BA 2G2FA 4GCJA 2X6EA 4XOYA 1E1VA 1H1SA 3DFCB 3HMMA 4F7NA 1VZOA 5LVMA 4OT5A 5ETIA 2OU7A 4K6ZA 4RVTA 3O96A 5J1WA 3F5UA 5JGDA 1GY3A 4RBLA 1UA2A 2Z60A 1J7UA 4KIKA 3DFAA 2WU7A 4QQTA 4I6HA 4XS2A 3E5AA 4L67A 4XV3A 2WFYA 3CEKA 3I5ZA 5KMIA 5LWMA 2ERZE 4PP9A 2JIVA 3FPQA 5DMZA 5A4LA 1Q5KA 4FNZA 4I3ZA 4MVFA 3VS0A 3G6GA 5AIRA 3RK7A 1OKWA 1PXKA 4G5JA 3GCUA 5HE3A 4AE6A 2JDTA 2C3LA 5M4FA 4QYYA 1JLUE 2OFVA 3EN7A 3GU5A 1CTPE 3THBA 5AAFA 3VHEA 5AUZA 3AD5A 3R1SA 3RI1A 3TKHA 3A7FA 3EL7A 1YHWA 2DWBA 3DDQA 1XH6A 5D7VA 4DFZE 2V7OA 3GQIA 3LQ3A 2CMWA 5K4JA 4A06A 3FLSA 3ZBFA 3BYMA 2ZV2A 3UIBA 4LGGA 3FXXA 4W8DA 4ZY4A 1BL7A 4G3EA 3FV8A 4HNFA 4HYHA 2FYSA 3RM6A 4RA5A 4BZNA 1YXUA 5E7RA 2QI8A 4FEWA 4PPBA 5HOAA 2J0MB 1OUKA 3UVPA 3WZEA 4WSYA 4Y5HA 1BI8A 2ZVAA 5ACBC 4C4IA 3BV3A 2C1AA 4OLIA 4OBOA 3RTPA 4ASDA 5FDPA 5HU3A 5HVJA 4O91A 4OTRA 3H3CA 3UBDA 5CVHA 3QF9A 4AOIA 4L8MA 4IX6A 4U44A 2R4BA 2XM8A 3IW6A 1ND4A 4XG4A 4BWKA 3FMKA 5EYDA 3OWPA 2VU3A 3GXLA 2B54A 2W1CA 4IJPA 3EKNA 3Q96A 4UXLA 3NCGA 1Q97A 2GTMA 2UW4A 4AUAA 4UEUA 5CTPA 3GQLA 1REKA 4XMOA 4CZTA 3CXWA 4TY1A 1QPDA 3BI6A 2GNJA 3EJ1A 4E26A 3RP9A 4HYSA 2AYPA 2EWAA 3PJ2A 3PXQA 5IEXA 5EI6A 3BYVA 5LVOA 5M51A 2G2IA 2C5XA 4U43A 2BZHB 4RA4A 5AR7A 5F94A 3DOGA 2SRCA 3LFFA 2HOGA 4FTCA 3IGGA 4IX3A 4S34A 2ZMCA 5C8MA 3KRLA 5AV1A 5C27A 2BMCA 3UIUA 4YHJA 4X2NA 1YHSA 2X2MA 4NTTA 1SVEA 3RK9A 5A6NA 4AW2A 5A46A 4V05A 3DLSA 4ZJJA 3AOXA 3BLRA 3IDPA 2C6EA 2WHBA 3QGYA 4QQ5A 3QQFA 5FTQA 4JX3A 4N57A 4R6VA 3R2YA 4GYGA 2R3LA 1OL5A 4YC8A 3HECA 4XG8A 2YLEA 2XMYA 4O7VA 4S30A 3Q32A 3VS5A 1ZYCA 4BIDA 1ZZLA 4P90A 2PSQA 4GKHA 1XQZA 2BDFA 2JBPA 5H2UA 4EZ3A 4O7NA 3V04A 5JZJA 4XP2A 4ANBA 3P1AA 5AR3A 4PTEA 2OZAB 2WIPA 1M52A 1OITA 2O5KA 4FTUA 3PP1A 3DB8A 4JDJA 3FY2A 4PV0A 4RIWB 4YC3A 3VUGA 1WVWA 3KF7A 1OZ1A 2P3GX 2CLXA 3EH9A 3O50A 3CY3A 2C69A 4BKZA 4BYJA 3KREA 3N51A 4I94A 4FKLA 4RMZA 4BDJA 3VS1A 4L00A 4IHPA 2YIWA 1U59A 1IAJA 4HVIA 3ROYA 3KCFA 2WTWA 2OO8X 4O1PA 4ZP5A 4K77A 4UZHA 3WF9A 4FGRA 1ZARA 5DG5A 1MRUA 3AD4A 4EH5A 2I0YA 2VGPA 2W5HA 4XP0A 5EI2A 2VWWA 4AACA 3D7TB 3A61A 4TYEA 3CJGA 5H3QA 3KU2A 4O86A 2PMIA 1W98A 3PXZA 4F6WA 3FMNA 1IEPA 2KTYA 4FSTA 3LFQA 5EDRA 2E9UA 5AV2A 3HRBA 4DBNA 4HGLA 4P2KA 4XG9A 4BKJA 5LMAA 3V5PA 4PDPA 4ZOGA 1FVRA 1ZRZA 1SNUA 2IVTA 5CEPA 1YXTA 2C47A 4BFMA 4RX5A 2PHKA 3HRFA 4USDA 3Q04A 4RX8A 5CU2A 4XV9A 1L3RE 1R39A 5AUYA 2F7ZE 4G2FA 3VF8A 4QTDA 2XEZA 4MCVA 2G2HA 4UWCA 5A4TA 2W99B 4CEGA 5B2MA 3LJ0A 4FIJA 1BX6A 3OT3A 5DT4A 4QP2A 5M57A 3NVMB 3AXWA 3UVRA 5AP0A 3E8EA 1AQ1A 4ZTQA 3I5NA 3Q60A 3KA0A 5GINE 4YO4A 2XIKA 4H1MA 4I22A 3SAYA 1H26A 4WOVA 1CM8A 1P4FA 2GQGA 2HK5A 1ZOHA 3MGYA 4L52A 5F1ZA 2IG7A 3UPXA 4X6RA 3OBGA 4MHAA 3A62A 3PSBA 4DGNA 1PJKA 5L6WL 5AP5A 4Z3VA 2VTMA 3EB0A 5M07A 3H9RA 2XK6A 2YM8A 4JLCA 4NM3A 3UC3A 2HYYA 5L8KA 4KWPA 3WILA 2ONLC 1BI7A 3MS9A 4G6OA 2R5TA 1ZYLA 3HUCA 5DLSA 2QURA 3W1FA 1PXJA 4XG6A 3R7VA 4C3FA 2JC6A 4LG4A 1CKPA 2GFCA 1V1KA 4BCJA 3C5IA 3LQ5A 5GNKA 1XBAA 1FMOE 1ZZ2A 2HY81 3F3UA 4JG8A 4MWHA 4F7JA 5CF4A 1JKTA 3P86A 2YM7A 3IOPA 2YA9A 3CQEA 3NR9A 3EYHA 2R3OA 3KC3A 4W9WA 1OKYA 3V8SA 2A19B 2QQ7A 4QOXA 4BDBA 4YZNA 3GOPA 3P08A 2X7FA 3IG7A 4FSZA 4IB3A 5KBQA 2QODA 2GU8A 4CV8A 3OTUA 3MH3A 3CJFA 3PXKA 5M4CA 3FL5A 3SG8A 1IA8A 3VQHA 3C4CA 3LMGA 5GJGA 3SXSA 4DBXA 4ZMEA 4APCA 4LRKA 4KKEA 1JSVA 5BVKA 4J7BA 3R9HA 5CU0A 2C0OA 4U0IA 4J52A 3VBWA 5K5NA 2WO6A 2E9VA 4YLKA 3SOAA 2FGIA 3R02A 2Z02A 2ZMDA 5HTBA 4NUSA 4TT7A 3U9CA 4N0SA 3ACKA 1KE9A 3MJ1A 2PUPA 1OUYA 4KBCA 4NKSA 5CEKA 4TYHB 2PMNX 2B9HA 3P9JA 2UVYA 4HGSA 4D5KA 3Q5ZA 3TV6A 4F1TA 4ZSLA 4LGDA 4XNEA 1HCLA 3DJ5A 3VS2A 4AT3A 4EK4A 5M53A 3B8QA 3N9XA 3ZLSA 3TCPA 3FMMA 4P4CA 5E1SA 4EL9A 1ZOEA 3CIKA 3AC2A 4PPCA 5HE2A 2PMOX 2J4ZA 3VVHA 4KSQA 3QZHA 3I0QA 3ERKA 3RINA 3NMUF 2BDWA 4AA5A 4G6LA 4PDOA 2GQSA 4GT4A 4G5PA 4KABA 3OY1A 4HCTA 4ITHA 1UU3A 3PA3A 3G51A 3EQIA 5L4QA 4FUXA 4YZDA 3MVMA 4FIHA 4NFNA 4EOKA 3FZ1A 3R83A 3OROA 3ZM4A 2H9VA 3UNKA 2JLDA 5DYJA 1Q8TA 4RWIA 4BGGA 2ITTA 5E8TA 1YI4A 3R9OA 3RPYA 2J5EA 2OJ9A 4FKGA 4QMVA 3WBLA 3NDMA 3QUDA 2C6IA 3CKWA 5EW8A 5DHJA 3OMVA 4QMPA 1WMKA 3G90X 4RVMA 3WYXA 2NPQA 2C0TA 2W4OA 4M12A 3KN6A 2XK3A 2Z7QA 2AC3A 3OWKA 3R8LA 2NNWB 1CSNA 3L9NA 3R9RA 1V0OA 3MTLA 3U51A 2XNOA 4C61A 5HLWA 2R9SA 2X4FA 3MA6A 5BYZA 5GZ9A 5H8BA 1H24A 2IVUA 4AZTA 4TWPA 4BTFA 2R7BA 4JAJA 3ZDUA 4O7RA 2W06A 4EZ5A 3TTJA 4OTQA 3HAVA 2WMBA 1QPJA 4IAZA 4OTDA 2HZ0A 4OR5A 2F2UA 4O0TA 1OL2A 3DJ6A 1UKIA 4FSUA 2ZOQA 4UMUA 3G2FA 4CFFA 1FMKA 4YUQA 1HOWA 4GIIA 4Q2AA 3CP9A 3Q9ZA 5EM7A 3AC1A 4XCUA 5AMNA 1ERKA 1LEZA 3EQRA 3RALA 3OG7A 4GYIA 2JKQA 5DIAA 3E8CA 4AP7A 3E64A 3UYTA 4AA4A 1PW2A 4EBWA 4FGBA 3M1SA 2QG5A 3GU7A 5E8UA 4MNEA 3F3TA 5CVGA 2XJ2A 4ID7A 3AQVA 3NIZA 2FSLX 2C1BA 3WYYA 1DAWA 3FLQA 5CEQA 4DEEA 4AZWA 1NW1A 2ZM3A 2VZ6A 1V0BA 3TDWA 4ENXA 4EHEA 4GU6A 4LRMA 3CPBA 2C6MA 5M56A 3DK6A 4YJUA 4D58A 2IW8A 5EM8A 2WMVA 4PMPA 4RFYA 3ORZA 4FL1A 2VWIA 3P78A 4GFGA 5AUXA 1Y91A 2P55A 3ODYX 3UODA 1JKLA 1FGKA 4DFLA 2PUIA 4BGHA 3ZDIA 3QHRA 4L7FA 3UOKA 5GJDA 4E6CA 2R3PA 3FC1X 5IA4A 5J79A 5HTIA 4LYNA 3HLLA 1BKXA 4CQEA 4EJ7A 4FE2A 3NIEA 3GB2A 4IANA 5L3AA 3D14A 2YERA 3VUDA 2R3QA 2I6LA 4WG3A 2QG7A 2WTVA 2BZJA 4D4RA 4S31A 4ALUA 4N6YA 4O0YA 4BCOA 2XIXA 4PL4A 5HCYA 4I93A 4GRBA 2WB8A 5CASA 4FKQA 1YXSA 4DF3A 3BBWA 4DEIA 2EUFB 3F3VA 1PMVA 3QQJA 2P33A 2BR1A 2PWLA 2WOTA 3DGKA 3QD4A 5I9WA 3A60A 4LFIA 3R8MA 3IO7A 3KRWA 3TACA 3ZEPA 3SA0A 2I0EA 4EH4A 4DEAA 4FTRA 4IMYA 3R63A 2BFXA 3LJ1A 2J7TA 4R1VA 5F95A 5GJFA 5EK7A 3MYGA 3QQUA 3VUMA 3T9IA 2QR7A 2W9ZB 3L9LA 3POOA 4J71A 3D7ZA 3NUSA 3KFAA 3NNVA 3Q5IA 5FBOA 4YZ9A 2Y8OA 2F7XE 3G9NA 4UWBA 3SXFA 4DLJA 2UZWE 1OPJA 3TZ9A 3O8UA 4O38A 3OEZA 2O63A 4UB7A 5HEZA 3Q9WA 2WTKC 3VBXA 4R7HA 4EORA 2W1FA 2WXVA 3I0OA 3VC4A 3PE1A 3ET7A 2GMXA 4QNAA 5TOZA 5M44A 3SD0A 3VS6A 3QC9A 2UW0A 4IM3A 4JXFA 4XG3A 2YZAA 4QMWA 2XRUA 4FTAA 2JAVA 3UO5A 3LFEA 2J0LA 4XV1A 4ZLZA 1OKVA 4YJRA 5ANOA 4A9SA 5IQGA 2OI4X 3EKKA 5T6KA 3ZH8A 4ASEA 2JKKA 3DXNA 1Q41A 4HYIA 3QTRA 5JSMA 3P23A 2BCJA 4M67A 2GS7A 4X3FA 4R7BA 3ULZA 3BHHA 3CD3A 2XP2A 5DFPA 3BHVA 4YPSA 2Y6OA 3OUNB 3PIXA 3MV5A 4PF4A 4U40A 5DNRA 5IA5A 2ETKA 4C62A 5C1QB 4D4SA 5IA2A 3MPTA 1XHAA 3TUBA 3OBJA 3ORMA 4II5A 4BI2A 2BKZA 3F66A 3O7LB 3UMWA 4UBAA 3ZONA 3FI8A 1JNKA 4OTHA 1PXMA 3UZTA 2J0IA 2VO3A 4QNYA 4XOZA 2VAGA 2EXMA 2OXYA 3FWQA 4AAAA 3LCOA 2F7EE 5M08A 3FXWA 4G34A 5ANKA 4AN9A 4WO5A 3D5XA 2YDIA 5HICA 4FV8A 1H28A 4FEXA 4IIRA 4LRJA 3ORLA 3MH0A 2RL5A 3UMXA 3L8PA 4M0ZA 3TZ7A 4RLLA 2QOOA 2CKQA 5KMMA 2EXEA 4M66A 3C5UA 3UG1A 1VR2A 1ZAOA 3FY0A 3UIMA 1XO2B 3FKLA 3NGAA 3BZ3A 3QRUA 3TV7A 3VBYA 2BRGA 4ZMFA 1PHKA 2B9FA 1YOLA 3KMWA 4G1WA 4YHFA 4CV9A 4QPMA 3OF0A 3LXNA 4YC6A 5E8SA 4C7TA 3SHEA 4JBOA 3ANQA 4AFJA 3UZRA 2DUVA 3BV2A 3T9TA 1STCE 5DVRA 1DAYA 2P2IA 3CLYA 2UZEA 3C4ZA 4IDTA 4MQ2A 3F88A 4RIXB 2JIUA 2CJMA 5DBXA 4OTPA 1WBVA 4RQVA 2VTAA 1FPUA 5LWNA 4ZY5A 3W33A 4PPAA 4TWCA 5HIBA 5HNIX 5IQHA 1UWHA 3OOGA 5IDNA 3HX4A 3TEIA 5TF9A 2JDRA 3MFRA 4BRXA 3P5KA 4RIYB 2YIQA 4TXCA 3OTVA 3VUIA 3BE9A 4L53A 4XG7A 3DT1A 1OECA 2P0CA 4K18A 4HJOA 4OTWA 3ZOSA 4IZAA 5EQYA 4MBIA 5ETAA 1GZNA 4DGLC 4YNOA 3NZ0A 2OBJA 2V7AA 3LE6A 3MA3A 4EK8A 2E9PA 3MDYA 5L2SA 2C3JA 4S2ZA 4Y5QA 4TKSA 3OC1A 4IAAA 5D10A 4TN6A 4AOJA 1WBSA 2G9XA 2XKFA 3LXKA 4S32A 4O0VA 2GTNA 2B1PA 5CQWA 1YOJA 2YACA 3PG1A 3QL8A 4FTIA 3CSVA 5AUVA 3ETAA 3HV4A 4EKKA 2IJMA 3CGOA 2VWYA 1PMNA 1QMZA 3H9OA 4BB4A 3ROCA 3PA5A 4BCGA 3WARA 5ANEA 4G6NA 4F9YA 2BIYA 3DTWA 3WF6A 3F7WA 4O27B 4AX8A 3RAWA 2VTJA 2XJ1A 3MY0A 2X1NA 1OIYA 4C4EA 3UOHA 4CG8A 3RCJA 3F82A 2BILB 4IVBA 2Z7RA 3QCXA 4XRJA 4YTCA 5K4IA 4U45A 4FL3A 4FZDB 3FI4A 4KIOA 3R6XA 3UC4A 1FGIA 1KOBA 1UU9A 3HEGA 4IAFA 4ZLOA 4HZSA 3QKMA 4OW8A 3VUTA 2QOFA 4O2PA 5JK3A 3G15A 3R1QA 1UWJA 2Q0NA 4G3FA 2OIBA 3FQSA 3OT8A 4FT9A 5IUIA 2YWVA 2PVHA 5G1XA 5JRSA 3D5UA 4O7LA 5IQAA 3PLAE 4I1ZA 2B55A 2WTKB 3VBVA 1OB3A 3Q3BA 4QRCA 2XCKA 2YFXA 4K2RA 4WNPA 3FMHA 2W1HA 2ITZA 2RGPA 4ZJIA 5IUHA 3E7VA 3RNIA 4JX7A 5JEBA 3IW5A 5C03A 1JOWB 4O0WA 4ZSEA 3PDTA 2Y9QA 4A9UA 4F9BA 3NNWA 2WMAA 2YHVA 3DKFA 3NS9A 4NTSA 4UZDA 4H05A 2R3NA 3R7GA 4BICA 2QU5A 3WOWA 4ACHA 3DBEA 3DK3A 3L8XA 4MK0A 4MXZA 4XEYA 1JKSA 2YJSA 3CR0A 4JVGA 5LARA 5FRIA 3PE2A 3NLBA 4EQUA 3R00A 2DQ7X 3MJ2A 4ANMA 1IG1A 3ZHPC 3PJ3A 4GIHA 5JN2A 5A4CA 4WRSA 4FTQA 2WTCA 2HW6A 2O65A 3IECA 2I7QA 2C30A 2G1TA 3R04A 2ZYBA 4FT3A 5DN3A 2GPHA 2W9FB 3K54A 3VW8A 3E8NA 3LJ2A 3JUHA 3M2WA 2ZM4A 3TUDA 5ITAA 1J91A 2C6DA 2OSCA 5EOBA 4AFEA 2O2UA 2PVRA 4QO9A 4RT7A 5M09A 2A27A 2Y7JA 2VD5A 4G3GA 3W2PA 2FSOX 4AT4A 4C38A 3GC0A 3VW6A 5I3RA 4FSNA 5KBRA 1O6KA 2R7IA 1WBPA 4UXQA 5HLNA 3U55A 4IB0A 4DE4A 3KB7A 4FKJA 3LHJA 2O64A 2HZ4A 2Z2WA 1Q24A 4C58A 3IW8A 4I5MA 4O7SA 3HGKA 4ZS4A 3DBDA 1YI6A 4E1ZA 4DT9A 5EOLA 5JT2A 2PZ5A 1YWVA 2OXXA 5DA3A 2B9JA 3DBFA 3VRZA 2UZUE 4PUZA 3HAMA 3BYSA 1ZXEA 5CVFA 2PVKA 5LQFA 3OW3A 3S95A 2YM5A 3A4PA 4PMSA 3NYXA 3W2RA 4ALWA 4OUCA 2VWVA 4P7EA 3PZEA 3QXPA 4ITIA 4O22A 5EQPA 1CMKE 4DH1A 3DPKA 4U5JA 4HZRA 1OIUA 3I7CA 1BUHA 3FLWA 1P2AA 3QTSA 4NEUA 5CXZA 1YVJA 4RJ3A 4H3QA 2AC5A 5KCVA 4OTFA 1CDKA 2PL0A 3I6WA 5DT0A 4BHZA 3W10A 4FOCA 1HCKA 3S1HA 2C6KA 3LCSA 4X2KA 3S2PA 4GG7A 4EQMA 2XF0A 4FKTA 4U9AA 3PRIA 3LIJA 5EDQA 4IC8A 1ATPE 4D2WA 4IC7A 3GFWA 4PNKA 5DEYA 4D2RA 4ANSA 3R0TA 1YWRA 4U79A 1MQBA 3SGCA 5HVYA 3NCZA 5ANGA 4YURA 1R78A 1KOAA 3P7BA 3IW7A 4RIWA 1M2RA 4YTHA 4EC9A 3DAEA 4BN1A 3JY0A 3LMIA 3NEWA 5EI8A 4HGEA 4FIGA 5CEOA 2RG6A 5HU9A 1H0VA 1RDQE 2YABA 3AT4A 3DQWA 3QYZA 4FV5A 3R8PA 2XYNA 3QRIA 3GC9A 4DG2E 3FI3A 5IA3A 2ITNA 4V01A 4NT4A 2RFSA 3C13A 3ZM9A 5KO1A 3FBVA 3UQCA 2R3IA 1J3HA 5CWZA 3UTOA 3C0HA 2VWZA 4O0XA 3NAYA 1Q3WA 5CSPA 5EFQA 4YPDA 3D0EA 4BIBA 2Q83A 4IBMA 4LMNA 3IS5A 4BDKA 1H1PA 3OCBA 3Q53A 4W4XA 3HMIA 4EKLA 5J1VA 2C0IA 4BCPA 3BYUA 4FF8A 4IX5A 1Q8ZA 3O2MA 4GFOA 4YU2A 1R1WA 5AP1A 2XIRA 2BFYA 1KE6A 4UMQA 1ZYJA 4K1BA 5DT3A 1GNGA 5CAPA 4D2TA 2OICA 3FL4A 4IVDA 4A4XA 3AMBA 3JVSA 3UP7A 5K3YA 5K5XA 5AUUA 3LM5A 2XS0A 3GNIB 2JD5A 4IVAA 4BF2A 5L2QA 5HG8A 2ITXA 4G9RA 4D0XA 4M69B 4EZ7A 4D5HA 5HORA 3F5GA 4G3CA 4J8NA 3KRXA 5KX8A 1BMKA 2QC6A 4F6SA 4P5QA 2BZIB 3WF5A 4XBUA 4MX9A 2F9GA 3PSCA 3UNJA 4CRSA 3H0ZA 1YXXA 4KRCA 5EYCA 2OLCA 3F61A 1QPEA 4LOPA 1A06A 3G9LX 4Y95A 5BVWA 2I0VA 1H1QA 5J7HA 2BRHA 1TQMA 2HZIA 5JFVA 3IGOA 4GV1A 4MXCA 2RFEA 4Q9SA 4I6QA 4A9TA 4KIKB 3IONA 2PPQA 4GT3A 2X4ZA 3C4XA 3PRFA 4R78A 4QPAA 3ZFMA 4C3PA 4F7SA 5IH4A 4M14A 4G31A 3VRYA 4A4OA 5CF6A 3VF9A 1Z57A 3REPA 3ZUUA 4RZWA 2EXCX 2VO6A 3TZ8A 2H96A 4E3CA 4X6QC 4CVAA 3N4VA 4ZZOA 5AX9A 4O7TA 2Y4IC 4TWOA 5AX3A 5LCJA 4KINA 4QMXA 1NY3A 4I41A 2O3PA 4GS6A 4PWNA 2IVSA 4KIPA 4WG4A 5C9CA 1DI9A 4NH1A 3EQDA 2IZTA 5HIDA 1LR4A 5C01A 4FKOA 5BVFA 3F9NA 1SYKA 4QP6A 4BKYA 3FPMA 2YN8A 5I5ZA 5H9BA 4F0FA 2UUEA 3LFAA 5KMJA 4YTFA 5IDPA 4AF3A 3AT3A 3FDNA 4J53A 3DA6A 4FSRA 3A8XA 4XH6A 4CT2A 2NP8A 4UX9A 4QQJA 4ZLYA 4J8MA 3IDCA 3GEQA 4H36A 5E9EA 3DZQA 3L9PA 3OP5A 2JKOA 3PJ1A 4YTIA 3V5WA 3LVPA 3KK9A 5T3QA 4CYIA 4TYHA 5BMSA 3FLNC 1PXNA 3PTGA 4BDHA 2XNEA 4BIEA 2CSNA 2ETRA 3CTQA 4LL0A 2PVFA 4C3RA 2GS2A 1WFCA 3MB6A 3ZXTA 3FSKA 2JEDA 5HHWA 3QZGA 4PX6A 4QYFA 3C1XA 3UPZA 3EMGA 3AMYA 5LVNA 3QHWA 2QOQA 4F99A 3QTWA 3GGFA 2R3FA 4K9YA 3DZOA 4XJ0A 3QBNA 4DN5A 1B38A 2WMWA 1YWNA 4M84A 4MD9E 2V22A 2PK9A 4W9XA 4MD7E 2XUUA 3SKCA 4CLIA 4CCUA 4QTEA 3O23A 4H58A 5KMKA 4TNBA 1W82A 4K33A 5FUTA 5A3XA 2OXDA 3T8OA 1R0PA 3CD8A 4RRVA 4UYNA 5CSWA 5DR9A 3RAHA 4YMJA 4I0SA 3EWHA 3BHTA 4D1SA 4KIQA 4PL3A 3EZRA 4DLIA 3JYAA 3PJ8A 4KD1A 1U54A 5J7BA 3O51A 4BL1A 3KULB 3DBCA 2QVSE 3OUKA 4FV3A 2R0IA 4BYIA 1NVQA 3QUPA 4NZWB 3PFQA 5E91A 4HW7A 5B7VA 5IEYA 3R7EA 2GNIA 3PPZA 5HBHA 3E63A 4D1ZA 3I1AA 2VN9A 3WZDA 4YHTA 4FG7A 4B6LA 5ICPA 5IQDA 4B4LA 4AGDA 3K2LA 4ALVA 5BNJA 1JBPE 4GMYA 4U81A 4YO6A 3KF4A 3P7AA 3FE3A 4KSPA 3V5TA 4XP3A 1UNHA 5AR8A 2BALA 1ZOGA 2WU6A 3VS3A 3W2CA 4CTCA 4S33A 4FSMA 1XH4A 3VUKA 3R1YA 3U8WA 2YCSA 3Q4UA 1A48A 1E1XA 2I0HA 1MQ4A 4BDFA 4EOSA 3HVCA 4WD5A 3F69A 4KNBA 4UV0A 3WZUA 2YCQA 2RIOA 2ITOA 4X7QA 1GOLA 4KUJA 3FZRA 3ZFYA 1W8CA 4P5ZA 4BBMA 3BBTB 2WTDA 5IMXA 5E90A 4TRLA 3Q4CA 4MF0A 3FMJA 3QA8A 2B4SB 4O21A 2VTPA 3UG2A 3V8WA 5C4LA 4HCUA 3QAME 3O17A 3K5VA 4IX4A 3WF8A 4FV9A 4AQCA 4EOQA 4ZTSA 4TYIA 2PU8A 2VWXA 5EHLA 3SQQA 3NUNA 1UKHA 3Q52A 4DT8A 4C0TA 3UP2A 5IQEA 3MI9A 3RPSA 2E9OA 3NW5A 4BC6A 3U6JA 5LMKA 4GJ3A 4Z16A 4RWLA 1R0EA 2NO3A 3KKVA 5TR6A 4BWPA 4R3PA 2QOCA 3U6HA 4R77A 3NUYA 2X7OA 1IRKA 2X6DA 3BWJA 3TNHA 3JS2A 3QQGA 3Q4ZA 4AS0A 4Q9ZA 5EYKA 4OBPA 4IM0A 4L42A 3A7HA 2AUHA 2X2KA 4GEOA 3QWKA 4FTTA 5CSVA 3V51A 3VS7A 3HRCA 5H8GA 3FJQE 4QMNA 3ORNA 2Y4IB 4EH3A 2QHMA 1I09A 3COIA 4J97A 4APPA 4U97A 4KA3A 5HCXA 3FYKX 4FK3A 4AT5A 3W18A 4JOAA 5HO7A 2WMSA 2J2IB 2XK4A 4CXAA 3QLGA 1KE7A 3ATTA 2UW9A 5TKDA 3I81A 4ONAA 2GFSA 4EBVA 2R3KA 2P2HA 3TXOA 3D94A 4L01A 2QCSA 2QR8A 2BDJA 3E92A 3FAAA 3OD6X 4MXYA 3SC1A 4RQKA 2ITQA 4FKVA 5DE2A 3DK7A 2ZB0A 3GFEA 5CT0A 3BE2A 3MH2A 3EZVA 2XKEA 2H6DA 3MPAA 3T3UA 3ZSHA 4D2PA 5IA1A 3CGFA 3ZEWA 3QRTA 1PYXA 3ELJA 3HP2A 4RX7A 4QP9A 4WSQA 5HI2A 4DTAA 3DJ7A 4D4VA 4JL9A 5J95A 2YDJA 3COHA 3PY3A 2VWUA 2W1DA 4EI4A 2GNHA 5CSXA 3D5VA 2G15A 3JR1A 4YJQA 1K3AA 5EHOA 5HO6A 3VNTA 5GZ8A 4C59A 4B0GA 3FMLA 4XRLA 4CYJA 2BTRA 3SVVA 4JI9A 1GIHA 2GCDA 5AA9A 2BZKB 4FYNA 3VAPA 2A0CX 3F3ZA 4Z55A 2BUJA 4EK5A 4GU9A 4D9TA 3KGAA 3RVGA 1OGUA 5ANDA 4MAOA 1H07A 4GUEA 4HPTE 3H10A 4JRNA 2C68A 3PXFA 4ASZA 5FTGA 1URWA 3CCNA 3NSZA 2GHMA 1Q99A 3SLSA 3R9DA 3PUPA 3PXYA 4FX3A 4O6EA 5LVLA 4JNWA 3ALOA 4CTBA 1MRVA 3OWJA 4USEA 2ITVA 5IH6A 4KBKA 3SXRA 2WGJA 5C8KA 5EW9A 4DINA 2OJGA 3EFKA 5I9VA 4JDHA 3IK3A 5I9UA 3OEFX 4BCMA 2BRMA 3BX5A 1W7HA 2YZLA 4O81A 5J5SA 3WE8A 3PXRA 4GG5A 2V55A 1Q61A 1YRPA 2ZJWA 3A99A 4QTCA 3ZTXA 4BDCA 4BTJA 3HA6A 4E4MA 5IA0A 4O7ZA 4OGRA 5HE1A 2CGUA 3BYOA 3OHTA 3GUBA 5IZFA 2Y6MA 5EHYA 3ANRA 1PXPA 4GK3A 4B9DA 3FC2A 3G0FA 1PKDA 3HMPA 4UY9A 3W16A 3KCKA 4L45A 5K0XA 3P4KA 3DKOA 2XKDA 4CFUA 1CKJA 3H0YA 1JAMA 1GIJA 4L44A 3WZKA 3NUXA 3ZLWA 2VTIA 3SOCA 5IMEA 5IEVA 3NYOA 2WOUA 2C6OA 5AP2A 3Q2JA 2IW9A 4NU1A 3BWFA 2YAKA 4QYHA 4R3RA 3AC5A 2B0QA 4Y8DA 5A14A 4FV1A 3JXWA 4F9AA 3ENHA 4QYGA 4HVHA 4WG5A 3HV3A 5A54A 3F2RA 4CZUA 3CTJA 3IPHA 4H3BA 5JFWA 1H0WA 3R22A 3KN5A 2FH9A 4NK9A 4J95A 2R3JA 4CMTA 3TNQB 3D2KA 3LCKA 1H01A 2WQEA 3ZZWA 5L6OA 2UW7A 2YM3A 2VTRA 3LFDA 2VO0A 1OMWA 2RKUA 3BGPA 3D83A 5EH0A 3UOLA 4ENYA 2QKWB 2BHEA 2IO6A 4X3FC 4L43A 4E7WA 4G3DA 3ZZEA 4RIXA 2IZSA 5BVOA 5DRBA 1Y8YA 3VJOA 2W4KA 4O96A 2UVXA 3EQBA 4KB8A 4KKGA 1RQQA 5J5TA 4ITJA 3FZSA 2QOIA 3PPJA 3SDJA 4EH2A 3EN9A 2QKRA 3B8RA 3EIDA 5KHWA 2VTSA 4YGAA 5HKMA 5AA8A 1JSUA 3HMNA 4XV2A 2QOLA 5CU6A 3L9MA 2EB3A 2XEYA 4Q5HA 4A4LA 2PZRA 4D2SA 3R71A 1FBNA 2FA2A 1H27A 1APME 2WMRA 4BCQA 2OIQA 2XNGA 3MVLA 3EHAA 3LOKA 4LI5A 4X2FA 4CFNA 2YCFA 4EOLA 3E3BX 3E62A 3OWLA 3QD3A 4DEDA 5KNJA 4UYAA 1OVEA 2VRXA 3C4EA 3KRJA 4IWQA 4WNOA 3SX9A 2ZV9A 2XK7A 4QP8A 4ACCA 4FV2A 1KE5A 4ERKA 4TZRA 3HL7A 1NXKA 2GS6A 2F57A 4N6ZA 2BRNA 3EQGA 4M68A 4YSJA 1TKIA 1LPUA 3C9WA 5CY3A 4K8AA 4JDIA 4MTAA 4PRJA 4N70A 2C3IB 3VN9A 4I5CA 3BGZA 5HO8A 3PIYA 4FKIA 4NIFB 4YBJA 4AGUA 3K5UA 3PWDA 2O8YA 3BQCA 2WQMA 2C6TA 4MNEB 3SRVA 1RW8A 2QO7A 5DGZA 5L8LA 4YZMA 3CQWA 5ANIA 3MESA 4FKUA 2XIYA 4YSMA 4F09A 4B99A 3N4UA 2W4JA 2B52A 2R3MA 4FSYA 3RCDA 3ZLXA 5AEPA 3LM0A 3FQEA 1WBNA 4MBJA 5DWRA 4FVRA 4TPTA 3WE4A 3F6XA 3PYYA 4LOOA 4V04A 5FLFA 4YJVA 3V5QA 1M17A 4DGGA 2WELA 4HVDA 1IA9A 3Q6UA 2GHLA 4YJSA 3HZTA 4RWJA 4FG9A 4FV4A 5FP5A 2JAMA 3MH1A 5CENA 5C26A 4FEVA 4M3QA 1B6CB 3AG9A 3Q4TA 4X0MA 4JRVA 4XBRA 2VX3A 3TZMA 5FXSA 4RWKA 5CAOA 4FYOA 1GZOA 3RPOA 4D55A 4O7YA 4WKQA 4WT6A 3EQHA 3MFUA 1YDRE 5HGIA 3ZRMA 5IF1A 2JITA 4UMPA 1WCCA 3IQ7A 3UNZA 2XBJA 4MXAA 5HG5A 5F9EA 4DFYA 4CKIA 4BWXA 5JKGA 4DH5A 5E4HA 4CSVA 4TYJA 3G5DA 2XRWA 5CSHA 2QLQA 5J9ZA 4Y73A 4EHVA 3BU6A 5L2TA 3D9VA 1LP4A 4V0GA 2OJFE 2FVDA 5L8JA 3KY2A 4DH8A 3COMA 5BUEA 2NRYA 5KKRC 1X8BA 5JGAA 3ATSA 3NNUA 3POZA 1FINA 2YIRA 3I79A 4JT3A 5D11A 1O6LA 4C4FA 2WIHA 2IPXA 4M0YA 5AADA 1BYGA 3MVJA 2YLFA 4IWOA 5I4NA 4WNKA 4Z7GA 1SVGA 4FIEA 4I92A 1FOTA 2HXLA 4JG6A 5FGKA 2OJJA 3L8VA 5BPYA 4X2JA 3NUUA 4J96A 4I0TA 3LXLA 3ALNA 3ZO1A 5J9YA 1ZLTA 4YJOA 2CKOA 5KMLA 1WAKA 1IAHA 5AP4A 4RC2A 4AN3A 2I40A 3A4OX 4L9IA 4W8EA 4BI0A 3EL8A 4TW9A 4H1JA 4F0IA 4BCHA
chains in the Genus database with same CATH superfamily
1WBOA 3KVWA 1MUOA 2R3GA 2QOBA 3MY1A 4QP4A 5HBEA 3TJCA 1ZY5A 3L1SA 3W2OA 3QTZA 5IG1A 5IPJA 3DQXA 4TYGA 5T68A 5JQ5A 4E73A 4DH7A 5CI7A 4PTGA 4X3FB 1W0XC 4ZZNA 3QTUA 1W2DA 2J90A 1NA7A 3OXTA 4QP1A 3ULIA 3GU6A 2WMXA 3E88A 4QMLA 4IH8A 4FKPA 2WQBA 3QC4A 2YM6A 3Q9YA 3ZYAA 3O8PA 2XNPA 3IOKA 4M13A 2CNUA 4I5HA 3HA8A 4C36A 2GSFA 5B2LA 5D12A 4CGAA 3EN6A 3BELA 4QYEA 4AQKA 4WBOA 2FB8A 1NT2A 3QD0A 5CU4A 4RVLA 2CLQA 2NRUA 3KEXA 3VS4A 4AE9A 1O6YA 4EUTA 3DNDA 3CQUA 4NL0A 3PPKA 2XA4A 3NAXA 4FUYA 4BDAA 5C8NA 1ZMVA 2A1AB 5K9IA 2PYWA 2CCHA 2VTLA 4HOKA 2WEVA 4L46A 3UYSA 5JQ8A 2UZDA 4FTNA 4MQ1A 4DHIB 3CKXA 1UV5A 3BRBA 2B7AA 2Z7LA 2VTNA 3ORPA 4O4EA 4NM0A 1KUTA 4W4VA 3S4QA 5KMNA 4GH2A 1FQ1B 1XBBA 3F5PA 4R1YA 3MN3A 4RZVA 3PFYA 2QOKA 3PLSA 3O71A 3QUEA 5FG8A 4EOOA 3EYGA 3PUFC 4CCBA 3ITZA 4O0RA 2Z8CA 2QNJA 5F4NA 4BDGA 4OAVB 3KL8A 3H9FA 3TIZA 4GUBA 3VWAA 2VUWA 4IVCA 5GHVA 2DS1A 2ZM1A 4IAIA 4ZTRA 2UV2A 4FICA 2FO0A 3NNXA 2ZV7A 1MRYA 2FSMX 1Z5MA 5FQDC 4RC3A 4ZK5A 4ANNA 4MBLA 2JKMA 5EG3A 4E6AA 4DCEA 5CF5A 1GAGA 2OW3A 5CLPA 3VBTA 4YZCA 4NCTA 3ZRKA 4ZEGA 4FJVA 3KXZA 2W05A 3GI3A 4EYJA 2RFDA 4O1OA 5AV4A 2QHNA 4U8ZA 1M2PA 2JBOA 4CT1A 4BBFA 2ZDUA 2PULA 2PTKA 2VTOA 1OM1A 4XUFA 3OFMA 1EH4A 1U5RA 2VTQA 2XK8A 4FODA 2OF2A 3O0GA 4C34A 4R5SA 2R64A 3GBZA 3QA0A 4C4GA 3C7QA 4ZSGA 5FBNC 4L6QA 5FP6A 4E6DA 2BAJA 3CTHA 3OXZA 3W55A 2CNQA 3R2BA 4IW0A 2XIZA 5TO8A 4GK2A 4W4YA 4YR8A 2B9IA 4RJ7A 5KKRB 4HGTA 5E8XA 3NPCA 3PJCA 3TDVA 1S9IA 5CU3A 4U3ZA 4Q5EA 3AC3A 3AT2A 4OT6A 4NYEA 1V0PA 3IKAA 4YLLA 3FMDA 3RPVA 2VGOA 2HXQA 4UN0C 2FSTX 3JVRA 2OZAA 3R8VA 2ITUA 2W0JA 4AXAA 5J87A 4B8LA 4C37A 4EH8A 3PWYA 2ZDTA 3LW0A 4GVJA 3EFLA 1UU8A 5HQ0A 5KMOA 1KSWA 4NKAA 4HVGA 1WZYA 1PYEA 4DFBA 1YDTE 4F9CA 1PY5A 3S3IA 4WNMA 2RG5A 3FHIA 3NUPA 5LCKA 5FEDA 5CAQA 5IQCA 3I60A 1J7IA 4HYUA 4IXPA 3D15A 4FKRA 4R3CA 4IZ5A 5D7AA 2OK1A 5CNOA 4ZY6A 4XX9A 3R30A 2W1ZA 3OW4A 4FZ6A 4HPUE 5AP7A 2XNNA 4A7CA 4DGOA 2XAMA 4FNXA 1W84A 3D7TA 5E8WA 4M15A 2X8EA 4ZSJA 5H8EA 3E93A 1URCA 5CAVA 5A9UA 4DEHA 3P7CA 4QP7A 4QTBA 4USFA 1ZMWA 2GQRA 2BHHA 3QGWA 4DHFA 1NVRA 4UWYA 4F63A 4QMTA 4XLVA 2XB7A 3BU5A 2GNLA 4C4HA 1GZKA 1OPLA 4NW5A 5HNGA 3LFSA 4NJ3A 3R9NA 2X39A 4WUAA 3RZFA 3TN8A 1H00A 3BEAA 5CX9A 4LGHA 5FD2A 3DLZA 1P5EA 4YZBA 4HVSA 2R3HA 2UW5A 1VYZA 3QX2A 4E20A 4GT5A 3BQRA 5AR2A 4F7LA 2ACXA 3QLFA 2W5BA 2X8DA 3PIZA 4IAYA 2BKKA 4FC0A 3S0OA 5LVPA 2R0UA 2WMTA 3HV7A 3UGCA 3KXXA 3FZPA 4E5AX 4AA0A 4QD6A 1PF8A 3GU8A 3UO6A 2OGVA 4ZZMA 2UW6A 4F4PA 3ENMA 3QU0A 1OIQA 4J1RA 4BCIA 3LQ8A 4WHZA 5D9HA 2ZAZA 3V5JA 3KULA 3NX8A 4FVPA 2BPMA 4XLIA 5EKOA 3RM7A 5HZNA 1YW2A 1XWSA 3ZS5A 1H1WA 4FTJA 2XBAA 4JG7A 4DITA 3CBLA 5ETFA 5I0BA 3FHRA 1LEWA 3AMAA 2WNTA 3FXZA 4IZ7A 4C4JA 4NJDA 3TJDA 5L2WA 3RNYA 2X0PA 3RBWA 3S00A 3ACJA 4BJJA 3ZUTA 3PVGA 4PY1A 4AW0A 4FZFB 4DFXE 4R7IA 5JH6A 3PG3A 3RWPA 4NM7A 4AN2A 4EOMA 4O4CA 3UO4A 3LMHA 3G33A 3CY2A 1J1CA 2HWPA 2ITPA 3G0EA 5EW3A 3T3VA 4LQMA 3QTIA 5AP6A 3VO3A 2HY0A 2VNWA 5AIKA 3ZC6A 4AOTA 5HBJA 2PE2A 3KRRA 4K0YA 1Y57A 2H34A 3A8WA 1QL6A 2OF4A 3GCVA 3R28A 4FTKA 4EOPA 4RPVA 5M4UA 2XAOA 3HDMA 4KKHA 4BHNA 5HLPA 3HDNA 3EFWA 4FRFA 4B7TA 4C8BA 3TMOA 4IB5A 4RVKA 2OH0E 1WBWA 3VULA 3ZUVA 3FKOA 4UALA 4QMOA 3R7IA 4ZXTA 3ORTA 4LV5A 2BRBA 4FTOA 3ORIA 2YM4A 4O83A 4PDYA 1TQPA 5AUWA 1GJOA 4FK6A 4GFMA 5AV0A 2GHGA 4H3PA 2XH5A 3PVBA 4FT5A 3UZPA 1PRYA 5E1EA 2J9MA 4AG8A 2Z7SA 3BIZA 4DEGA 3LLTA 4I20A 3ZU7A 4IE9A 5BYLA 5B2KA 1PXOA 2HZNA 3QRKA 3WF7A 5FM3A 3VIDA 2OG8A 2X9EA 3RK5A 4WUNA 4DGMA 5HCZA 1YXVA 4DAWA 2C5YA 3II5A 1IASA 4PDSA 5AAGA 3LCTA 2WPAA 2Y4PA 4IWPA 1R3CA 4KS7A 3UQFA 3ORXA 2C3KA 5HE0A 3UOJA 4X2GA 3FEGA 2IWIA 4QMYA 1PMEA 4BR3A 2X9FA 5DR6A 2W5AA 3RGFA 4QQCA 4XYFA 3SV0A 3TM0A 3I7BA 3MB7A 4LUDA 3DCVA 1DI8A 4FVQA 1BLXA 4YLJA 3OCTA 4JAIA 4A9RA 3FSFA 4FV6A 4IEBA 4M97A 1K2PA 4BTKA 2PVNA 4WRGA 5DRDA 4FNYA 5AM7A 4C2VA 4U80A 4DFUA 4BY9E 2XM9A 3LFBA 3CPCA 5KZIA 4RJ8A 2ZB1A 2CGVA 3AC4A 3DXQA 3GC7A 2UZLA 4Y46A 4IACA 1P14A 3RKBA 4IM2A 4EWQA 2XNBA 4D0WA 4ZAUA 4JS8A 1OBGA 3TL8A 4A9YA 5C4KA 1T45A 1YQJA 3A7GA 3TNWA 4F65A 3W8LA 5AAEA 1ZY4A 2WZJA 5CANA 1G8SA 3LKMA 4JJRA 4NWMA 1T46A 3V8TA 2LAVA 1J1BA 1OL6A 3BLHA 3TWJA 5JZNA 5TT7A 4PP7A 4AZEA 4AZVA 2HIWA 5EYMA 5CEIA 4D1XA 5HG9A 2PUUA 5LMKC 2QOHA 2W96B 1B39A 3RAIA 3Q6WA 5HIEA 3LFNA 3QKKA 4L3PA 2WTIA 5IISA 4FTLA 3SW4A 3RZBA 4DYMA 4GKIA 5HVKA 1WVYA 5CNNA 4FZAB 1L8TA 2C5VA 4BGQA 3P79A 4NSTA 3NRMA 4BTMA 1Y6AA 4FR4A 3MTFA 3OCGA 5FEQA 5JMSA 3HNGA 1YKRA 3NUAA 4DTKA 3W32A 5CALA 1FVVA 3KMMA 2BROA 4FT0A 4AZFA 2CNVA 1DS5A 1Y6BA 2CHLA 4Z7HA 3GC8A 4AW5A 3UE4A 2BAKA 4RSSA 2UZVA 3PVWA 4FMQA 4E5BA 2YEXA 3HYHA 2UW3A 4ZIMA 4FSQA 2RFNA 4MKCA 3W8QA 2EVAA 2EB2A 2YJRA 3ZSIA 2WQOA 4I0RA 2ONLA 3R7YA 4RLKA 4JR7A 3DDPA 1SM2A 2X81A 4LL5A 4LM5A 5JFSA 4FV0A 3ZO4A 2PVLA 3HMOA 4CQGA 4E4NA 5IQIA 3K3JA 1TVOA 3MWUA 4FNWA 5JFXA 4F6UA 3BKBA 2WKMA 2UVZA 5LJJA 3QCQA 4I23A 2J0JA 4JR3A 4L7SA 3LCDA 4RFZA 3PP0A 5DEWA 4CNHA 3NVKI 4MD8E 4ZJVA 4AZSA 2X2LA 4O0UA 4CFWA 3N4TA 2REIA 5FXQA 1JKKA 2ITWA 1KE8A 3EQPA 2JDOA 3KMUA 5CI6A 3ZO2A 4JBQA 1AGWA 3QXOA 3TKIA 5BVDA 4EQCA 3MPMA 3OCSA 4QP3A 2I1MA 3MVHA 3OVVA 1I44A 2GNGA 1G3NA 5HESA 4EHZA 5GIOE 3PY0A 3EOCA 1QPCA 1ZMUA 4PMMA 4MXXA 3FMEA 2RF9A 4I6LA 3TNPC 2C4GA 1PKGA 2CN5A 4N4SA 1F0QA 2DYLA 4LMUA 4E6QA 3DXPA 4WIHA 3AC8A 3OZ6A 1AD5A 4FEQA 4JQ8A 1LUFA 5FTOA 3V5LA 5IH5A 2PVYA 3ZCLA 4L68A 1Q8UA 3GU4A 5A4QA 4IFCA 3W2SA 3E87A 3GCQA 4HNIA 4U42A 4AW1A 4LV7A 2GDOA 5AV3A 4QPSA 3TT0A 1YHVA 4IZYA 3O7LD 4PMTA 2CKEA 5BVEA 1U54B 4FL2A 3U4WA 2J6MA 4YP8A 2QO2A 4KRDA 3ZO3A 4MH7A 3GCPA 2WTJA 4NM5A 3NW7A 4LV8A 5CZIA 2RSVA 2A4LA 5E92A 2V5QA 3PVUA 4RG0A 4Y83A 3DY7A 3ODZX 2OIDA 5D41A 3ZFXA 3TI1A 3QZIA 1W2FA 3ZRLA 3UQGA 4DTBA 3U9NA 5M06A 4QMMA 2UZOA 1ZYSA 3RHXA 1YOMA 4CFVA 4DA5A 4G9CA 4F70A 3KK8A 4YJTA 4IWDA 4M7IA 4YBKA 4JIKA 2XVDA 3TNIA 5HX8A 1ST0A 4EC8A 4IFGA 2QO9A 4ACGA 3UIXA 1VEBA 3WZJA 2OWBA 4X21A 4MNFA 4L3LA 3QYWA 2UZBA 4LUEA 4CMUA 3C4FA 3R73A 3GT8A 4RIOA 1SMHA 3L8SA 5D1JA 2KULA 3RPRA 4C2WA 3HV6A 2VV9A 1SZMA 3VUHA 3OS3A 5CXHA 4ZTNA 2IZRA 4FZ7A 3K3IA 4FV7A 4BDIA 4IB1A 2CKPA 4C02A 2XALA 2OFUA 4DG3E 4KBAA 4F64A 4RX9A 5ANJA 4U6RA 1H8FA 3VJNA 4D28A 3IW4A 3ORKA 4DC2A 5CF8A 5A4EA 5AR5A 4OTIA 1K9AA 4I24A 3V3VA 4EH7A 4OAUC 5L6PA 4JQ7A 4J99A 4MXOA 4FKSA 4NIFA 3U54A 2QLUA 3RWQA 4JMQA 2PZPA 1XJDA 1O9UA 3RAKA 5BMMA 2VO7A 4GJ2A 2X8IA 3WIKA 4TWNA 5ETCA 2VTTA 4IAKA 5IQFA 3VHKA 5BUIA 5AP3A 4H39A 1XH9A 3AGLA 4EH9A 3QCSA 3JPVA 3I6UA 4PNIA 5DH3A 4AWIA 2Q0BA 3PZHA 5BX0A 2LGCA 4F1OA 1OL7A 2XKCA 3QKLA 4M8TA 2YIYA 4MWIA 5IQBA 4Y72A 4F9WA 4W4WA 4NFMA 3BHUA 2W7XA 4FBXA 1REJA 3TUCA 2XK9A 3QCYA 3IDBA 3MIAA 3OOMA 4G16A 1VJYA 4ZTLA 4CFMA 3ID6C 4ASXA 2WEIA 3BEGA 1XR1A 4E4XA 1F5QA 2YITA 2E9NA 4DCAA 4PL5A 2PZYA 5FEEA 5FM2A 2J0KA 3KXMA 5I9YA 2PY3A 3C0IA 3LAUA 3MBLA 4MEDA 3H4JA 4TTHB 3OXIA 3R8UA 2R3RA 4ZS0A 1M7NA 1SNXA 2UZTA 2BAQA 3BPRA 3HUBA 2HW7A 3FQHA 1OPKA 2ESMA 2HAKA 1Q8WA 4QTAA 3DNEA 3CS9A 4U3YA 3DU8A 4FIIA 4YNEA 4PQNA 3AGMA 3FZTA 4RIYA 5AM6A 1G5SA 4ANOA 3HKOA 2BTSA 4O2ZA 1BL6A 2BVAA 3QRJA 4CKRA 3KQ7A 2J50A 4BCKA 1Q3DA 5E8YA 5J9LA 3BHYA 2Y0AA 2OKRA 3KIOC 1PXLA 3GVUA 3C51A 4IJ9A 5K0KA 3RHKA 2VTHA 2W1IA 1F3MC 3ZXZA 3DV3A 4A07A 4ZTMA 2XZSA 1W83A 4XG2A 3ZBXA 3C0GA 4EHGA 3PA4A 4BZOA 4U7ZA 5I9XA 1UNGA 3A7JA 3LZBA 2C6LA 3B2WA 3TV4A 3HV5A 3RMFA 1U5QA 1VYWA 3KXHA 2ERKA 4C35A 3F7ZA 5GZAA 3FI2A 4RJ5A 3JY9A 1OIRA 1OGYA 4BZDA 4R5YA 4FKWA 3F2NA 3U6IA 3NYVA 4I4EA 5GIPE 3FUPA 3KXNA 2HELA 1XH7A 5I3OA 4EK6A 5L2IA 3TIYA 3C4WA 5LMBA 3DKCA 5G6VA 3MIYA 3RJCA 4EJNA 2HWOA 5BVNA 2BIKB 3NWWA 1JPAA 5AJQA 5FWKK 3MFTA 3ZC5A 4B8MA 5JGBA 1S9JA 1JWHA 2HENA 3KXGA 5JRQA 1MP8A 4MYGA 4TL0A 4RGJA 1M2QA 3R21A 2A2AA 4KS8A 3EQFA 2F49A 2V62A 4E8AA 2W1EA 4AGCA 2JGZA 4OTGA 3TG1A 3QX4A 5CQUA 4ACDA 3NW6A 3E8DA 2PE0A 3UDBA 1PXIA 4OBQA 2UZNA 3DBQA 4O84A 1JQHA 4JDKA 4FT7A 5M4IA 3BGQA 1Q4LA 4F1MA 5EKNA 1QCFA 2PUNA 5KZ0A 3DB6A 2P4IA 3FYJX 4RFMA 4D4YA 4FA2A 3DTCA 3CC6A 2WMQA 3VBQA 4EUUA 3D2IA 3AD6A 5CS6A 4BI1A 4ANLA 4DEBA 2IN6A 1RE8A 3B2TA 3TTIA 3V6SA 3M11A 3FKNA 5AUTA 2CGWA 5IUGA 4O4BB 1IR3A 3ZLYA 4X3JA 4GVAA 4CLJA 4CRLA 5DI1A 3U4UA 5CEMA 2OJIA 2W1GA 1H1RA 5EDPA 4CZYB 1YDSE 3QD2B 4BVUA 3LFCA 5LXMA 2H8HA 5ACKA 3UJGA 1U46A 4CMOA 2UW8A 4HCVA 4UMRA 4BDEA 2J51A 3W0OA 2O0UA 1P4OA 5BYYA 4O7WA 3H30A 4IDVA 2QD9A 4I6BA 5EM5A 1Q62A 5HTCA 1XH5A 5CYIA 5FXRA 4DG0E 4QMSA 1TFFA 1OKZA 4AGWA 4GK4A 4AU8A 5BUJA 5EM6A 4I4FA 4NW6A 3QQLA 3GENA 4QT1A 3R7UA 3O5AA 4FG8A 3ZSGA 3MW1A 3FZOA 1FVTA 3FLYA 4ANQA 3TKUA 4BBEA 3Q9XA 2VX0A 2YCRA 3R1NA 2XNMA 4EONA 1GZ8A 5CAUA 2JIIA 3SG9A 1UNLA 4BDDA 4WBBB 3QTQA 4O0SA 3M42A 3QQKA 4RJ6A 5DOSA 3DKGA 1UVRA 1ZYDA 3R01A 4JQEA 1JSTA 1H08A 1YI3A 5IKWA 3EFJA 4ARKA 4FOBA 5HD7A 3W2QA 3WIGA 2F4JA 2XCHA 3GP0A 3OY3A 4FI1A 4CD0A 4EOJA 2PVMA 3G6HA 3ML1A 2QONA 4TNDA 3QQHA 4YJNA 2ETMA 4LOQA 4Y85A 3UVQA 1G8AA 2YDKA 2B53A 4RJ4A 4EOIA 2CGXA 2YIXA 3LLAA 1SVHA 3EN5A 2EU9A 4JBVA 5M55A 5E8VA 4WA9A 5DPVA 1DM2A 1OI9A 2ITYA 4O6LA 3R8ZA 1XKKA 2HCKA 3VQUA 3QALE 3C50A 3SRVB 4ZSAA 2VX1A 2PMLX 4JIAA 4F0GA 3A7IA 2CDZA 1UU7A 4D9UA 4E93A 4L3JA 4EWHA 1OL1A 2WD1A 5F20A 5I9ZA 1XH8A 4O82A 4K11A 5A6OA 2CPKE 2G01A 4FTMA 5EQEA 2YISA 4I21A 3COKA 5LOHA 4QMZA 5KUPA 4QMUA 1JVPP 3QZFA 5HNBA 1Q8YA 4QMQA 3BLQA 2YAAA 3DS6A 5IU2A 3F5XA 4R8QA 3GOKA 5J8IA 4CFXA 1ZWSA 1KV1A 2YWPA 4RC4A 2VNYA 4Z9LA 3PSDA 4ACMA 2WAJA 3R7OA 4CKJA 1PMUA 2CCIA 1H25A 2W17A 4EK3A 1KV2A 1GIIA 2X7GA 3PY1A 4GSBA 4C57A 1H4LA 5CZHA 4FSWA 1RJBA 2OZOA 2J5FA 4IQ6A 4NCTC 5DR2A 4DHJA 4DFNA 2JDVA 3EQCA 3F3WA 4GW8A 4ZTHA 1KWPA 3V01A 4F08A 1Z9XA 2XJ0A 2VWBA 2X0GA 3E3PA 3NYNA 3P0MA 5E8ZA 3QFVA 1A9UA 3QTXA 5AWMA 3U87A 5CT7A 4E4LA 3A2CA 1E9HA 1U4DA 5AR4A 1TQIA 2CN8A 1J7LA 2V0DA 4UMTA 4CG9A 2F2CB 4XHKB 3KVXA 2ZV8A 3BCEA 2FUMA 5HD4A 3P5JC 2C5NA 4JBPA 4V0GB 4MF1A 3FLZA 4ERWA 5BQ0A 3MY5A 5KE0A 4YJPA 4GL9A 4U41A 4ORKA 2WQNA 2WMUA 2R2PA 3O8TA 1M7QA 2OH4A 3D4QA 1M14A 3DAJA 4I5PA 1OBDA 4FEUA 4PTCA 4E5WA 2C5OA 5AFVA 1CKIA 1XBCA 3WI6A 3ZMMA 4D2VA 1Y8GA 3QWJA 3LPBA 3Q2MA 3SW7A 3LXPA 2E2BA 2QU6A 4FIFA 3EN4A 2IW6A 4BCNA 5FDXA 1WBTA 2IVVA 2JDSA 4KAOA 4M69A 3BU3A 2GNFA 1NVSA 3V6RA 3CE3A 3F2AA 2PVJA 3E7OA 3MSSA 5B0XA 2PE1A 2PZIA 4I6FA 4C33A 4EH6A 2IZUA 4G17A 4J98A 3D5WA 3GCSA 5KHXA 1WVXA 5HG7A 4IADA 4DH3A 4EEVA 2JFMA 2XYUA 3DAKA 5HX6A 3W0PA 5TE0A 4BCFA 3HP5A 3MFSA 2JFLA 4EYMA 3I4BA 2G2FA 4GCJA 2X6EA 4XOYA 1E1VA 1H1SA 3DFCB 3HMMA 4F7NA 1VZOA 5LVMA 4OT5A 5ETIA 2OU7A 4K6ZA 4RVTA 3O96A 5J1WA 3F5UA 5JGDA 1GY3A 3BLAA 4RBLA 1UA2A 2Z60A 1J7UA 4KIKA 3DFAA 2WU7A 4QQTA 4I6HA 4XS2A 3E5AA 4L67A 4XV3A 2WFYA 3CEKA 3I5ZA 5KMIA 5LWMA 2ERZE 4PP9A 2JIVA 3FPQA 5DMZA 5A4LA 1Q5KA 4FNZA 4I3ZA 4MVFA 3VS0A 3G6GA 5AIRA 3RK7A 1OKWA 1PXKA 4G5JA 3GCUA 5HE3A 4AE6A 2JDTA 2C3LA 5M4FA 4QYYA 1JLUE 2OFVA 3EN7A 3GU5A 1CTPE 3THBA 5AAFA 3VHEA 5AUZA 3AD5A 3R1SA 3RI1A 3TKHA 3A7FA 3EL7A 1YHWA 2DWBA 3DDQA 1XH6A 5D7VA 4DFZE 2V7OA 3GQIA 3LQ3A 2CMWA 5K4JA 4A06A 3FLSA 3ZBFA 3BYMA 2ZV2A 3UIBA 4LGGA 3FXXA 4W8DA 4ZY4A 1BL7A 4G3EA 3FV8A 4HNFA 4HYHA 2FYSA 3RM6A 4RA5A 4BZNA 1YXUA 5E7RA 2QI8A 4FEWA 4PPBA 5HOAA 2J0MB 1OUKA 3UVPA 3WZEA 4WSYA 4Y5HA 1BI8A 2ZVAA 5ACBC 4C4IA 3BV3A 2C1AA 4OLIA 4OBOA 3RTPA 4ASDA 5FDPA 5HU3A 5HVJA 4O91A 4OTRA 3H3CA 3UBDA 5CVHA 3QF9A 4DDGA 4AOIA 4L8MA 4IX6A 4U44A 2R4BA 2XM8A 3IW6A 1ND4A 4XG4A 4BWKA 3FMKA 5EYDA 3OWPA 2VU3A 3GXLA 2B54A 2W1CA 4IJPA 3EKNA 3Q96A 4UXLA 3NCGA 1Q97A 2GTMA 2UW4A 4AUAA 4UEUA 5CTPA 3GQLA 1REKA 4XMOA 4CZTA 3CXWA 4TY1A 1QPDA 3BI6A 2GNJA 3EJ1A 4E26A 3RP9A 4HYSA 2AYPA 2EWAA 3PJ2A 3PXQA 5IEXA 5EI6A 3BYVA 5LVOA 5M51A 2G2IA 2C5XA 4U43A 2BZHB 4RA4A 5AR7A 5F94A 3DOGA 2SRCA 3LFFA 2HOGA 4FTCA 3IGGA 4IX3A 4S34A 2ZMCA 5C8MA 3KRLA 5AV1A 5C27A 2BMCA 3UIUA 4YHJA 4X2NA 1YHSA 2X2MA 4NTTA 1SVEA 3RK9A 5A6NA 4AW2A 5A46A 4V05A 3DLSA 4ZJJA 3AOXA 3BLRA 3IDPA 2C6EA 2WHBA 3QGYA 4QQ5A 3QQFA 5FTQA 4JX3A 4N57A 4R6VA 3R2YA 4GYGA 2R3LA 1OL5A 4YC8A 3HECA 4XG8A 2YLEA 2XMYA 4O7VA 4S30A 3Q32A 3VS5A 1ZYCA 4BIDA 1ZZLA 4P90A 2PSQA 4GKHA 1XQZA 2BDFA 2JBPA 5H2UA 4EZ3A 4O7NA 3V04A 5JZJA 4XP2A 4ANBA 3P1AA 5AR3A 4PTEA 2OZAB 2WIPA 1M52A 1OITA 2O5KA 4FTUA 3PP1A 3DB8A 4JDJA 3FY2A 4PV0A 4RIWB 4YC3A 3VUGA 1WVWA 3KF7A 1OZ1A 2P3GX 2CLXA 4AXEA 3EH9A 3O50A 3CY3A 2C69A 4BKZA 4BYJA 3KREA 3N51A 4I94A 4FKLA 4RMZA 4BDJA 3VS1A 4L00A 4IHPA 2YIWA 1U59A 1IAJA 4HVIA 3ROYA 3KCFA 2WTWA 2OO8X 4O1PA 4ZP5A 4K77A 4UZHA 3WF9A 4FGRA 1ZARA 5DG5A 1MRUA 2XARA 3AD4A 4EH5A 2I0YA 2VGPA 2W5HA 4XP0A 5EI2A 2VWWA 4AACA 3D7TB 3A61A 4TYEA 3CJGA 5H3QA 3KU2A 4O86A 2PMIA 1W98A 3PXZA 4F6WA 3FMNA 1IEPA 2KTYA 4FSTA 3LFQA 5EDRA 2E9UA 5AV2A 3HRBA 4DBNA 4HGLA 4P2KA 4XG9A 4BKJA 5LMAA 3V5PA 4PDPA 4ZOGA 1FVRA 1ZRZA 1SNUA 2IVTA 5CEPA 1YXTA 2C47A 4BFMA 4RX5A 2PHKA 3HRFA 1TZDA 4USDA 3Q04A 4RX8A 5CU2A 4XV9A 1L3RE 1R39A 5AUYA 2F7ZE 4G2FA 3VF8A 4QTDA 2XEZA 4MCVA 2G2HA 4UWCA 5A4TA 2W99B 4CEGA 5B2MA 3LJ0A 4FIJA 1BX6A 3OT3A 5DT4A 4QP2A 5M57A 3NVMB 3AXWA 3UVRA 5AP0A 3E8EA 1AQ1A 4ZTQA 3I5NA 3Q60A 3KA0A 5GINE 4YO4A 2XIKA 4H1MA 4I22A 3SAYA 1H26A 4WOVA 1CM8A 1P4FA 2GQGA 2HK5A 1ZOHA 3MGYA 4L52A 5F1ZA 1ST4A 3UPXA 4X6RA 3OBGA 4MHAA 3A62A 3PSBA 4DGNA 1PJKA 5L6WL 5AP5A 4Z3VA 2VTMA 3EB0A 5M07A 3H9RA 2XK6A 2YM8A 4JLCA 4NM3A 3UC3A 2HYYA 5L8KA 4KWPA 3WILA 2ONLC 1BI7A 3MS9A 4G6OA 2R5TA 1ZYLA 3HUCA 5DLSA 2QURA 3W1FA 1PXJA 4XG6A 3R7VA 4C3FA 2JC6A 4LG4A 1CKPA 2GFCA 1V1KA 4BCJA 3C5IA 3LQ5A 5GNKA 1XBAA 1FMOE 1ZZ2A 2HY81 3F3UA 4JG8A 4MWHA 4F7JA 5CF4A 4BJJB 1JKTA 3P86A 2YM7A 3IOPA 2YA9A 3CQEA 3NR9A 3EYHA 2R3OA 3KC3A 4W9WA 1OKYA 3V8SA 2A19B 2QQ7A 4QOXA 4BDBA 4YZNA 3GOPA 3P08A 2X7FA 3IG7A 4FSZA 4IB3A 5KBQA 2QODA 2GU8A 4CV8A 3OTUA 3MH3A 3CJFA 3PXKA 5M4CA 3FL5A 3SG8A 1IA8A 3VQHA 3C4CA 3LMGA 5GJGA 3SXSA 4DBXA 4ZMEA 4APCA