4IB0A

X-ray structure of camp dependent protein kinase a in complex with high na+ concentration, adp and phosphorylated peptide psp20
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
337
structure length
334
Chain Sequence
SVKEFLAKAKEDFLKKWETPSQNTAQLDQFDRIKTLGTGSFGRVMLVKHKESGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVAGGEMFSHLRRIGRFEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFTEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cAMP-dependent protein kinase catalytic subunit alpha
publication title Metal-Free cAMP-Dependent Protein Kinase Can Catalyze Phosphoryl Transfer.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase/peptide
total genus 106
structure length 334
sequence length 337
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2012-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4ib0A01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4ib0A02
2OU7A 3TUBA 4O0YA 4FKLA 4MBLA 2BAQA 4XX9A 3N4VA 4NH1A 2W5HA 2W5AA 3QFVA 3KRWA 3SG8A 2BIKB 3QAME 5EM8A 3CEKA 3V5QA 4FG8A 4F7NA 2CKQA 3QD3A 4FKJA 5EI8A 3BYUA 3LMIA 4UZHA 3LXPA 4YZBA 2JEDA 4ZJIA 4NM0A 4CNHA 2NP8A 2XBAA 2JIIA 5C4LA 3MIAA 4GMYA 3CJFA 3LW0A 3CR0A 3IECA 1OKVA 2OLCA 4PPAA 2VNYA 3D5WA 4DFXE 1BMKA 3R0TA 4RRVA 4M68A 3QCSA 2R0IA 3SVVA 1YOLA 4IHPA 4RFMA 5FRIA 5EKNA 4GYGA 1W0XC 4S33A 3ODZX 1TKIA 5I0BA 4FIIA 4AGCA 3HECA 3MJ2A 4EQCA 5HG9A 2PE0A 5HHWA 2Y8OA 1WVYA 2CNQA 1TQMA 2ETRA 5HVJA 4HNFA 2GSFA 3PG1A 2I0EA 4NIFA 3KMUA 4QMSA 3AT3A 2R3KA 4EJNA 2VX0A 1XH4A 5B7VA 3BEGA 3KF7A 3LAUA 3P7BA 2EXEA 3AMAA 2I0YA 4JBOA 2X2KA 4JG7A 4L53A 4QTDA 4PQNA 4DTKA 3MPAA 4BL1A 4IX5A 4AAAA 2UZUE 3GVUA 3DDPA 3PY0A 3W2QA 5JQ5A 5HLPA 2QOQA 2VWWA 4G9CA 4A4OA 3AOXA 2Q0BA 4AE9A 4CEGA 4RGJA 4FG9A 4WNMA 2VX3A 3ZONA 5JZJA 1Y8GA 4AS0A 5IQAA 1LEWA 4K9YA 4FT0A 3ROCA 4W9XA 2PVNA 4U9AA 4QP4A 3OVVA 1ZZ2A 2P2IA 5CVGA 4K0YA 4BIBA 4M12A 1ZRZA 3E5AA 3NAXA 3Q9XA 5HG8A 3ZTXA 1O6YA 4HGEA 4YJPA 1ZMWA 4DFNA 2QOBA 2CKOA 3VS0A 3UVQA 3ZZWA 2C3LA 5FP5A 3VS5A 4B7TA 3F9NA 2C6LA 3I79A 5KMIA 2WU7A 4TYEA 5HEZA 3E93A 4U97A 1YI6A 4NYEA 5DH3A 2A19B 2WU6A 4W8EA 3UIBA 3R2YA 4YPSA 2XNOA 3F5UA 4WG4A 4BZDA 1OM1A 3E3BX 4C62A 5E9EA 1UNHA 3EN6A 4RWKA 2BKZA 1SVHA 4EC9A 1ZAOA 5IA4A 1ZYJA 4YP8A 3EQIA 3RNIA 3HV5A 4CVAA 4GIHA 4MH7A 4GT5A 3REPA 3V3VA 2JIUA 2ACXA 1Q24A 2UZEA 2XKEA 3EQFA 4Y95A 4F0IA 5M44A 3HMIA 4UXLA 4DEEA 4TWNA 4H1MA 2BFYA 4AXAA 3OS3A 2EXCX 3NZ0A 4HCUA 4MXCA 4U42A 5AUWA 4UMQA 4EKLA 5CEPA 4BIEA 2OIBA 4FKOA 4MBJA 4DEHA 4EH9A 5AUUA 3FLSA 2UW7A 2Y0AA 4G34A 4CV9A 2J9MA 2V62A 2WO6A 3DQXA 2VTLA 3II5A 4LQMA 5AAEA 3TUDA 2PUUA 5JFWA 1YXVA 4JBPA 1AGWA 3ZO3A 4AZWA 5J87A 3CJGA 4HNIA 3FL5A 4AW1A 4ONAA 3H9RA 3CP9A 4QMMA 3ZYAA 4CQEA 1OBDA 4O0TA 1R0PA 1J7UA 3VW8A 2J7TA 3E7VA 2XM9A 2VWVA 3QA0A 4CYIA 2OF4A 1W7HA 4O21A 5FWKK 3FKLA 2WQOA 2JD5A 2YCFA 3PA3A 2W5BA 3Q04A 3ACJA 3EQPA 5F94A 1DI8A 3A99A 4RVLA 3R9OA 3D15A 5HBHA 3RHKA 2BIYA 3LCDA 4OUCA 4D2TA 1OB3A 1GZNA 5F95A 1XBCA 4BDHA 3QX2A 4JAJA 3VHEA 5AM7A 3Q6UA 3BI6A 4YZCA 5AM6A 3RK9A 3F3ZA 3HZTA 3FMKA 4KKEA 4CTCA 2VTAA 2XF0A 3QUDA 3FL4A 5HIDA 1S9IA 3UVPA 1UNLA 4IAIA 4FUYA 2YM3A 3IOKA 4V05A 1BI8A 2WEIA 4OBOA 4D58A 4YC8A 2HZ4A 2WD1A 2B7AA 4XV2A 4AT4A 4M69A 2FYSA 4IW0A 4DGNA 5CAOA 4ACMA 4CSVA 2JBPA 1J7IA 4EOIA 2UZDA 4JDJA 4JI9A 4Z3VA 3A4PA 5DT4A 5CAVA 5LWMA 4G16A 3BGZA 1VR2A 4W4WA 2CN5A 4FTOA 1JOWB 1XWSA 4LMNA 2FA2A 3NYVA 3I0OA 2QONA 4RA5A 4DFBA 2OW3A 3LQ8A 3L8VA 1BL7A 4RVMA 4ZAUA 2BHEA 3QKKA 4OTDA 4UMUA 4DEGA 5DR2A 2XBJA 3UIMA 3KMMA 3BZ3A 5D11A 4HYSA 3TIYA 4DLIA 1PMNA 3QTSA 3MWUA 4DTBA 4FT3A 3C1XA 3JY0A 2C1AA 3HGKA 3QWKA 3DKGA 4IM2A 3BELA 4FSYA 4D2VA 3QZHA 4D2SA 3AD4A 3LFCA 5JZNA 3R7EA 5J8IA 5CT7A 4LYNA 5AAGA 5BMMA 4RLLA 4BVUA 5KKRC 2B4SB 4KIQA 3C4ZA 4PUZA 1Q8UA 4B8LA 5M4CA 4DE4A 2PMIA 5HU3A 2UW9A 5EDQA 2VV9A 3HRFA 2O64A 2QG5A 3HX4A 4G3FA 4JAIA 4JS8A 2X2LA 5CT0A 5AUZA 3I6UA 2QI8A 4IZ7A 4AZSA 5ITAA 2XNPA 3FI3A 2IPXA 4IB5A 1JKKA 4S34A 1IA8A 4O7YA 1GNGA 1MRYA 4FF8A 4X2FA 5FXRA 3CPCA 2J4ZA 3A7JA 3PVGA 4FKPA 3WF9A 3A60A 4AZVA 5EI6A 3EKKA 1UA2A 4JOAA 4ZZNA 1REJA 2ERZE 2HZ0A 3QTXA 5AR2A 3AMBA 5HLWA 3EIDA 4LOPA 2Z7QA 3NW6A 4O81A 3PWDA 3CGFA 1FBNA 4GJ2A 4M67A 3W55A 2GFCA 5HG5A 3E88A 4M0ZA 3QRTA 4NZWB 3TN8A 2IVTA 2IZTA 3QZIA 5HO8A 5DMZA 4TWOA 3R8LA 3I7BA 2GQSA 1YQJA 4IAKA 3RALA 3RAKA 3U6JA 2GS6A 3D5UA 2QURA 4DINA 2OZAB 4RMZA 5JSMA 3PY1A 2DUVA 4ZY4A 1CKJA 3Q4UA 4V0GB 4CFVA 3MB6A 1GZ8A 2Y6MA 3A62A 3OZ6A 4ASZA 3FHIA 1WVWA 4LM5A 3QF9A 3MH3A 3K5VA 4XG8A 3FKOA 4KD1A 5DLSA 3LLTA 1Q8TA 1PXNA 3PWYA 3PJCA 4Z9LA 4CKRA 4USEA 5L2TA 4C4GA 5J95A 5AUVA 2FSOX 3RM6A 4PMSA 5IA2A 4FKQA 1LP4A 3OEZA 5GZ9A 2GNLA 3EYHA 4IFCA 4TWPA 4EH7A 2W9ZB 3NSZA 4XCUA 3QX4A 3BGPA 3QQGA 4FK3A 4YLLA 2OJ9A 3VBVA 1GAGA 1YHWA 4FIEA 5IH5A 4O83A 2EU9A 4P5ZA 3KXZA 2VN9A 4O0UA 2ONLC 1OIUA 4Q5HA 4ZZOA 3DT1A 4NKAA 4G9RA 4XLIA 4XV1A 3ROYA 3PZHA 4A9RA 5I9WA 1APME 4DG2E 4J53A 3LE6A 5B0XA 5AR5A 4BDGA 3UPZA 4GCJA 1B38A 3MFUA 3F3UA 4PY1A 4O0SA 4HPTE 3LJ0A 3O96A 5DGZA 4TNDA 3N4TA 2ITZA 4QTCA 5M53A 2OSCA 2FB8A 4I5PA 4G31A 3S00A 3F3TA 1BLXA 4MK0A 3F5GA 4ID7A 4PMMA 2YIQA 5BUJA 3QRUA 3Q9YA 4FV9A 4QMZA 4ZSLA 1U46A 4KRCA 2UVXA 3IG7A 5DEWA 4FG7A 2BTSA 4R6VA 4D28A 3DGKA 1Q61A 5FEQA 2C30A 4YHJA 5FM2A 2PMLX 5L6PA 3CD8A 3QGYA 2YACA 2G15A 3WARA 4BCKA 4IWDA 5HESA 3BE9A 3CCNA 4FSTA 3LM5A 4BBMA 5GJFA 1E1XA 5IMXA 2Z60A 4YUQA 4J95A 1QCFA 2O3PA 1Q5KA 1V0PA 2R3HA 1ZYCA 4NW5A 3FPMA 5EM6A 5EW8A 2B9FA 1MRVA 3LIJA 2Y7JA 4XOZA 3U9CA 4DAWA 5HU9A 3S4QA 3KXHA 1ND4A 4JIKA 4USFA 3KULA 3M2WA 2BAJA 2RF9A 1Q8ZA 3O7LD 3Q5IA 4FMQA 4P90A 4YO6A 2GTMA 5LVLA 3Q52A 3D2IA 4XG9A 1H1RA 3BRBA 3B2WA 4KSPA 1U5QA 1UU9A 3PRFA 5JQ8A 5JFVA 4YC3A 4D2RA 5M08A 4E26A 5HD4A 4XEYA 1PYXA 3CKWA 4BHZA 2EWAA 2J6MA 3NGAA 4AA0A 2XJ2A 4U80A 4QQCA 4C58A 4DBXA 3UC4A 4E1ZA 5J79A 4N4SA 5CXHA 4AACA 2ITQA 5LQFA 4Y8DA 1NVSA 2WTDA 2R3QA 4CFWA 1H07A 2UZVA 3S1HA 4GL9A 2WMBA 4RIYB 4PMPA 2XIXA 3V5PA 4I92A 1KE9A 2YM5A 3C9WA 4X2KA 1OIYA 3D14A 4O2ZA 3DCVA 3TG1A 1UVRA 3UDBA 4CZYB 4AT5A 1YWRA 5I3RA 4YTHA 2WHBA 4FV3A 4KBAA 4NT4A 2CHLA 4K33A 2BROA 2X1NA 3WZKA 4AGWA 4CZTA 1G8AA 3QUEA 3FC1X 3G0EA 3CBLA 4GEOA 3JXWA 5GIPE 3MPTA 4CLJA 3OG7A 3A7GA 2YCRA 1WBWA 5LXMA 4UB7A 1JKSA 1XBAA 2XNNA 2YDIA 4FEWA 1QPEA 2VO7A 2ITOA 2XS0A 4I93A 2W1DA 5FTGA 1PMVA 5CI7A 2BZHB 2IZUA 5A54A 4FSNA 4O0VA 4C37A 5AWMA 4QMPA 3OT8A 3BYMA 3SXSA 4MAOA 4WIHA 5CSXA 3OUNB 5FP6A 5KE0A 3R7YA 2GS7A 3R8ZA 5AFVA 3QQKA 5E8XA 2V7OA 4LGGA 4OTWA 3NUYA 3F2RA 3BCEA 3PIXA 4TY1A 2LGCA 3BHVA 3G51A 4Y73A 5CEQA 3COHA 4M97A 4U41A 5BPYA 4KKGA 3PTGA 4FSWA 1BYGA 5TOZA 4APPA 3ZSHA 4CT1A 2ONLA 4BCOA 4F7SA 1OL2A 2X2MA 3G5DA 1KE7A 4LL0A 3GU7A 2WGJA 3VUGA 5GZ8A 5IQDA 2WQEA 1XQZA 4FSUA 4F08A 2A1AB 5DR6A 1OKYA 1H1PA 3OFMA 2C3JA 2GNHA 4AP7A 2QOFA 3K5UA 3HV4A 4M14A 2OXDA 5M07A 4Q5EA 3ZSIA 3H0YA 1YI4A 4V04A 4AZTA 4WSYA 1TQIA 1VZOA 2HOGA 2I1MA 4FSMA 2R7IA 2PL0A 5HQ0A 3UNJA 4UWBA 3QZFA 2PUIA 4CFUA 2Z2WA 4W4VA 2BAKA 5FDXA 2YLFA 4FT9A 5DBXA 3U6IA 2CKEA 3LHJA 4C4FA 4U3YA 4YBKA 2C6TA 4WNPA 5BUIA 3R8VA 4YJTA 2HXQA 3P1AA 2E9OA 3VUTA 4DC2A 2AC5A 4GVAA 2YHVA 2WZJA 2GTNA 2O0UA 2WMXA 1Y6BA 3DLSA 5A9UA 5AP1A 3SKCA 5FG8A 3BEAA 4JDKA 3MYGA 4JDHA 4B0GA 4PNIA 4RWIA 1HCKA 2NNWB 4QMOA 1H1SA 2YZAA 2HAKA 3ZH8A 4BGQA 3ZM9A 4AUAA 2C0OA 2EUFB 4OW8A 4YZNA 2G2HA 5A14A 4AU8A 3EZRA 3ZUUA 3UZRA 4FA2A 5AEPA 4DF3A 3UQFA 2R3GA 3OW4A 3QTIA 4DYMA 3FSKA 3IW8A 4TN6A 4D0WA 5BVOA 4X2NA 4LL5A 1PRYA 3MS9A 3G90X 3TNHA 3UIXA 2CKPA 4RC4A 3UG2A 3ZCLA 4QMWA 4IANA 4AZFA 2UW0A 3DNEA 3NPCA 3PVBA 3F66A 3AXWA 3ZU7A 3WZEA 3MVMA 5FQDC 4EK3A 2ZDUA 3POOA 4OAVB 4AGUA 4ZTMA 3OXTA 4YNEA 5HCYA 3QTZA 2W1CA 4II5A 4M8TA 3AQVA 3ENMA 1GIIA 5FBOA 2OG8A 1WBTA 3HAVA 4JG8A 4WBOA 4CKIA 3OHTA 1OKWA 3RPYA 4C4IA 5CALA 2X7OA 4QNAA 3UPXA 3F69A 3FLZA 1H0VA 3ANRA 1L3RE 2IVVA 2R3LA 2A27A 2UW6A 3ZRKA 2YJSA 3ULZA 4I94A 4NIFB 2QOHA 1NVRA 2RG5A 5AP7A 3SW7A 2UV2A 5KX8A 3WE4A 2QU5A 3V6RA 3C4FA 4C59A 3IDBA 1FGKA 1BI7A 3TI1A 3OMVA 2E9UA 4LRKA 5K3YA 2P0CA 2XJ1A 3FMNA 5AR4A 3RCDA 3NUNA 2BMCA 4U5JA 3VRYA 3EKNA 4GH2A 3ZUTA 3TT0A 4L52A 4UXQA 3D83A 4QP9A 4EOLA 4DFLA 3U4UA 4EK5A 3R7UA 4F1TA 1RDQE 2W4JA 4J99A 5IA0A 4DH3A 5EI2A 4Q9SA 1BX6A 2YIXA 2KULA 4QMQA 3E63A 2YERA 4G3DA 4ITIA 3FAAA 4NWMA 3BYSA 4O7TA 1Z9XA 2C0TA 3O2MA 3WF6A 3ZXZA 5M09A 4EC8A 4FEQA 3A7FA 4RX9A 5IDPA 3D2KA 1R78A 2VTJA 2FH9A 1G5SA 3EN7A 2ZB0A 4EH3A 3NW7A 3VS2A 3Q53A 5IQIA 2YIRA 3OXZA 2VAGA 4FSQA 1CDKA 2P3GX 4NM3A 2G2FA 4R3PA 4QQ5A 4IIRA 4E5BA 2CSNA 4EORA 2ZMCA 3N4UA 3RWQA 4KS7A 3G33A 3VUKA 4RWJA 4EOOA 1OBGA 2FO0A 2YEXA 3UE4A 5GIOE 2O5KA 5AP0A 4D1ZA 4UV0A 3GU5A 1HCLA 4I6HA 4ERKA 3LXNA 4QP3A 3F3VA 4J97A 4ZXTA 4PDSA 1I44A 3NNVA 3FXZA 2ZAZA 2W99B 3BU5A 4FVQA 5HNGA 4BWXA 5JT2A 1YXUA 4RIOA 3W2RA 1UWJA 2VTIA 2XRUA 5CU3A 3RJCA 1RJBA 4LUEA 5CZHA 3ODYX 1J7LA 2BALA 2V22A 4IMYA 2ZOQA 3KFAA 3AGMA 2BZIB 2PZYA 4JX3A 3AD6A 2EXMA 3EQRA 4FT7A 1A06A 2ITTA 2J5EA 4J8MA 2QOOA 1Q3WA 2YDKA 3PSBA 3JVSA 2BHHA 4LOOA 3MIYA 4YJNA 5AV4A 2H8HA 5AP4A 2XIKA 3KRRA 2X81A 4FODA 2R64A 4ZSGA 5AMNA 1YHVA 3VS4A 3O8UA 4X2GA 2ZJWA 3TZ8A 4D5HA 4EH2A 1REKA 3JVRA 4XP0A 4FTQA 4QP1A 1UNGA 4FOBA 3AC8A 1PKGA 3RZFA 1FVVA 2ITVA 4PTEA 4Z16A 2QR8A 4GFOA 4F6UA 3PY3A 2JC6A 5K0KA 3T9TA 3F2AA 1U5RA 3E62A 5I9XA 3FQSA 3L1SA 4MD8E 4YC6A 4I22A 3A7IA 5AX9A 5KBQA 5EKOA 4YTCA 3PE1A 1WBOA 4IB1A 1V0OA 1YXTA 2WMTA 3BV3A 4K11A 4C36A 3BHUA 3FDNA 2XIRA 5HO6A 1ATPE 4WNKA 5E1EA 4C57A 3WF7A 4BHNA 2CGVA 1NW1A 3ZOSA 2HW7A 4FIJA 1ZYDA 2H96A 3H4JA 4YZ9A 3GOPA 1UU3A 5CZIA 3FMJA 4ZOGA 3RWPA 1T46A 2RG6A 5D7AA 3LCOA 4X3FA 5AR7A 4ANQA 2ITPA 2W1EA 5HNBA 3OXIA 5EDPA 4R3CA 3DPKA 4M69B 3EMGA 3SQQA 3QQHA 4BICA 4C7TA 3OBGA 2ITWA 3COMA 5T6KA 4RZWA 3ATSA 2ITNA 3I81A 4B9DA 2R3PA 3TEIA 4R5SA 3JR1A 2Q0NA 5HVKA 1DAYA 3QXPA 2YITA 2VTNA 1J91A 4NU1A 5J7BA 3ID6C 2V5QA 4YSMA 3R73A 1XHAA 3F2NA 3UO6A 3KRLA 4WHZA 3VS3A 3SGCA 3D7TA 3FLYA 2VNWA 4EH6A 4FKUA 4A9UA 4LGDA 4D5KA 3QKMA 5FLFA 3VQUA 3EFKA 4G3GA 5BYYA 3R8MA 4UMPA 4FC0A 3MVJA 4NM5A 5HE1A 2CGWA 2QNJA 4QOXA 4XBRA 1Q3DA 2ZM4A 3FWQA 2XZSA 1GIJA 4L7SA 2QKWB 5A46A 5H8BA 4LV5A 3V5LA 1JPAA 4QP6A 3ZSGA 5EK7A 4EK8A 3SXRA 4BCGA 4B6LA 3MJ1A 4IC7A 3PXZA 3I6WA 4YNOA 1KWPA 1CKIA 1S9JA 2R4BA 4DGGA 1X8BA 1W83A 3ZO1A 1H28A 2I0VA 3NUSA 3EFJA 3LLAA 3CLYA 3DXPA 1PXIA 3LXKA 4O91A 4D2PA 4ZEGA 2FSMX 3UQCA 4FZ6A 5HTBA 4E20A 2BDFA 4HJOA 4L01A 4GG5A 3S2PA 2F7EE 5HTCA 3LFQA 3P7AA 4JQ8A 4KBKA 5FXSA 3UOJA 2W7XA 4MNEA 4CG8A 1IA9A 1U54A 2C5YA 2V0DA 3MDYA 3RP9A 3KK9A 1K2PA 5BX0A 4KUJA 3ZO2A 2QLQA 2CDZA 4F63A 3R30A 1PXMA 3MA3A 5IH6A 3L9PA 5L2SA 4PF4A 5CSVA 4EZ7A 2YDJA 4OTRA 4CRLA 4TXCA 4FNXA 4DHFA 3GNIB 5HTIA 4FNYA 3G15A 3HKOA 5EG3A 4EOMA 3MY0A 4HVSA 4OT6A 4BCJA 5LOHA 4F09A 4MVFA 4QO9A 4F1MA 3LFSA 4JRVA 4BCMA 1VJYA 5C27A 4G3CA 4A06A 2IVSA 1Q97A 4IAZA 3GU6A 2IZRA 3VF8A 4D1XA 4D2WA 3Q3BA 4JLCA 4O22A 1XH9A 3SDJA 2QCSA 3QQLA 3OEFX 3VQHA 4OBPA 4FIFA 4EK4A 3BQCA 3TJDA 4MF0A 4P4CA 4LFIA 3UOHA 5LJJA 3CC6A 3F7ZA 4XHKB 4BN1A 4ZMFA 4XNEA 3COIA 4ZJJA 3L9NA 3OBJA 1PJKA 3C50A 5CU6A 3FMLA 3NVMB 4QPSA 4EEVA 4BR3A 4BCIA 5IEXA 1YKRA 4CZUA 3VUMA 3LFEA 3NUXA 4O27B 3V6SA 4C4JA 4EOQA 4I6BA 4JQEA 4ACDA 4JG6A 4C3FA 3MTFA 2R3MA 1IR3A 3MSSA 3WIKA 1H4LA 3H9OA 4U0IA 4U8ZA 1FVRA 2JAMA 4X21A 5A4TA 5EYKA 1YRPA 5FUTA 5DRDA 3ZDUA 2VTSA 2WB8A 4UBAA 2WTKB 4AX8A 1ZOGA 3EQGA 4ITJA 3IDCA 3U51A 2Y4IB 3FPQA 5D12A 5BVNA 2OH4A 4JBQA 3SV0A 3ZM4A 3KN6A 4YMJA 3D9VA 4ZS0A 5JEBA 2VGOA 2BFXA 1H27A 3A8XA 1UV5A 3U55A 3AG9A 4MD7E 3GC7A 4QQTA 3U6HA 2VTTA 5FM3A 3HAMA 4I4FA 3M42A 1R39A 2QHNA 3KL8A 5F4NA 5HX8A 2WMUA 3R28A 5GJDA 3HEGA 4QMVA 2ZDTA 2UW3A 4BTKA 5AA9A 2J0LA 3UG1A 2VUWA 4PDPA 4ANLA 2W96B 3L9LA 2Q83A 4DN5A 2X6DA 4X3JA 1RW8A 2P33A 2R0UA 3IS5A 3OOGA 4L44A 3LXLA 4KRDA 5AIKA 4B99A 3NIEA 3TTIA 5AX3A 3VWAA 4IX3A 3DBEA 4J1RA 2W1HA 3PP0A 4ANNA 3ZRLA 2C5VA 5HO7A 3JYAA 4BTJA 3T9IA 5L6WL 3UOLA 1XR1A 3S0OA 3OY3A 1YWNA 5CVHA 3QRJA 3RAHA 2GHGA 3KULB 3PPZA 3RAIA 3COKA 4E8AA 3TACA 4E6QA 2PUPA 3PP1A 5HE0A 4GS6A 3MFSA 3D94A 1JWHA 4X2JA 5AIRA 5EH0A 4FUXA 3FZOA 4GK2A 1Q99A 3ANQA 4MXXA 1Y8YA 4BRXA 3EH9A 3T3VA 4EOPA 3HMOA 2HZIA 4U40A 4F9BA 4TZRA 2W9FB 4X7QA 4O0WA 4ZLOA 1XH5A 2YM4A 2PUNA 2QOCA 1FMOE 3O7LB 1EH4A 3BHTA 3RM7A 3OUKA 5KHXA 3SD0A 4HGSA 3BYOA 5M57A 4LV8A 3P78A 3ZMMA 3BU3A 5L2WA 2VZ6A 3TZMA 5BUEA 5J7HA 3GBZA 3FYJX 5LMKC 3DBDA 3LOKA 5J1WA 3KXGA 1VEBA 1YOJA 3PUPA 3D0EA 3Q4ZA 4MEDA 4FGBA 4UMTA 3UP7A 4EOSA 1KOBA 1XH8A 5ANOA 1ZMUA 5HE2A 1W8CA 4Y5HA 3TNPC 5GJGA 1JNKA 3H30A 4RJ6A 5C26A 5JFSA 3HMPA 3PSCA 4DEAA 3FXWA 2GDOA 4TNBA 4RZVA 4C2VA 3VULA 5ACKA 3TJCA 4CCBA 4EI4A 3HA8A 4XG6A 3GGFA 4JBVA 2JLDA 5CEOA 4DFZE 5LVMA 4D55A 3NUPA 2UZLA 4XV3A 2SRCA 3LZBA 3LKMA 4QTBA 4L67A 3R83A 5F9EA 5CVFA 2W05A 3F5XA 3LMGA 3OP5A 5HLNA 4YO4A 3F7WA 3LFDA 4U45A 1JLUE 4S31A 4YU2A 2VWZA 4C4EA 3GP0A 4IM0A 2NRUA 1MUOA 2B53A 3CD3A 2QOIA 2WOUA 2WQMA 4AFEA 1CTPE 3DJ6A 4KS8A 5H8GA 4ASDA 3TDVA 3I1AA 4AWIA 4O7RA 5I9UA 4HZRA 2H34A 3K3IA 1YOMA 3HLLA 4MCVA 4N0SA 4O6LA 5AR3A 3R9HA 3DB8A 2P55A 4KB8A 4EZ5A 3EWHA 3ORMA 2I7QA 2WMQA 5AUTA 4FTKA 3UZTA 4OGRA 1XH6A 3NW5A 4IVDA 4JVGA 3W18A 4C0TA 5HVYA 5KMNA 3R1YA 4QP7A 5T3QA 1PXKA 1Y6AA 3B8QA 5CI6A 5IA3A 2F57A 4FV6A 1K3AA 2BCJA 4D4VA 4QP8A 4RIWA 4EH4A 2PMOX 3JS2A 4AN9A 2XA4A 1G3NA 1GJOA 1B6CB 3FJQE 3KC3A 1KOAA 4B4LA 4MWIA 4ZTQA 5L6OA 2ZVAA 3EN4A 3C5IA 4RVKA 2GS2A 5AP3A 3ZEWA 4IWOA 4C2WA 1PXJA 3MV5A 1NXKA 3CY3A 3MPMA 2VO0A 4R5YA 4K8AA 2GNJA 2VU3A 3FLWA 3G0FA 2OIDA 2OZOA 5L8JA 2YN8A 4EKKA 3NLBA 2RIOA 3R1NA 2VRXA 3ZLWA 3KEXA 2R3OA 5CX9A 4PV0A 5JH6A 2C6DA 3QWJA 2VTPA 1QMZA 3IOPA 3FZSA 4IACA 2GHMA 3A4OX 4FTIA 2W1GA 4P5QA 4PL5A 5CU4A 3VUHA 3SG9A 1YW2A 3EZVA 2Z8CA 4IC8A 3NRMA 3KA0A 2CMWA 3FKNA 1Q8WA 3QD0A 3TZ7A 5AV0A 4DGMA 2YIYA 1OPLA 3KF4A 4W4XA 5EW9A 3ZLSA 2AUHA 3IGGA 2Z7LA 4OTIA 3NNUA 5AADA 3DOGA 5EFQA 4UZDA 2YM8A 1U4DA 4G6LA 4FV1A 2ESMA 4RJ7A 3KREA 3GENA 2ETMA 3QLGA 3FHRA 4D4SA 4TYGA 2X8DA 2PVKA 5M55A 4AG8A 5A4EA 5AR8A 3TM0A 3LJ2A 2HWOA 4H1JA 4USDA 1FPUA 2WMAA 4MHAA 1LPUA 2GU8A 2XIYA 5JRSA 4C4HA 3DKCA 2C6MA 2QOLA 3FQHA 3LM0A 5IKWA 3V5WA 3EOCA 5FDPA 4O7VA 3GCPA 4DGLC 1PW2A 3ACKA 4GU6A 4C3PA 3QC4A 4LOQA 4KWPA 3DNDA 3M1SA 1URWA 2RFNA 4FOCA 4L00A 4ZK5A 2ZV8A 5CF6A 4XG4A 3EB0A 2E9VA 3FBVA 4YHTA 4QMYA 4EHZA 5A4QA 3PVWA 1JSUA 3OTVA 4HCVA 5LMBA 3ZFYA 2B0QA 5EHOA 2F9GA 1JSVA 2R3IA 4XBUA 4DH5A 2W1IA 4JQ7A 4ACHA 5B2MA 2OF2A 3Q96A 2CGXA 3BLRA 1XBBA 3I0QA 4GKHA 3HP2A 3E64A 3PYYA 4IB3A 4IX4A 3K3JA 1GIHA 2J0JA 4J71A 3F3WA 4PTGA 1FOTA 4G17A 5JFXA 2RGPA 4NCTC 1IG1A 3FY2A 2JFLA 4FSZA 5CS6A 4TWCA 2VGPA 3BHYA 5CF8A 4FX3A 5KMOA 4JDIA 3UO5A 2I6LA 4IJPA 2HENA 2GNIA 2RFEA 3G6GA 3QTRA 3QTWA 3WZJA 4XV9A 5FGKA 2X8IA 4NSTA 3DFCB 3E8EA 5IEYA 5IQBA 3IO7A 3I7CA 3QQJA 3ZC6A 4DLJA 2PULA 3RCJA 3TDWA 3LQ3A 2EB2A 4RBLA 4EWQA 3CQEA 3ITZA 2ZMDA 1CM8A 1IASA 4M3QA 4RJ8A 3KKVA 3NAYA 5L4QA 4ASXA 4TL0A 1H0WA 3OWLA 3NYXA 3NX8A 3PPKA 2IJMA 4E93A 4L3LA 3QQUA 2PYWA 3PG3A 4IADA 5GNKA 3VBYA 4G1WA 3C4EA 3UO4A 2G2IA 1ZLTA 3MW1A 4H3BA 3HV3A 4U44A 4UYNA 3QQFA 4ZTRA 3KXMA 2O8YA 4MWHA 2XK6A 3HMNA 2OO8X 3C5UA 4HGLA 3ULIA 5M06A 4J8NA 4IJ9A 2OK1A 4KSQA 4NW6A 5KNJA 4UWCA 4KIPA 2ERKA 4AE6A 1R1WA 3ORTA 5AV1A 3DK6A 3E87A 2YA9A 3A61A 3GT8A 3R00A 2ITXA 4JNWA 4MD9E 2VWBA 3O23A 4RT7A 1RE8A 3AC1A 3AT2A 1O9UA 1DAWA 4OLIA 5EYDA 3ZDIA 4DCEA 5JKGA 3G9LX 2YWPA 4WUNA 4LG4A 4ALVA 4RIXA 1Y91A 2EVAA 5C9CA 1CSNA 2R2PA 3IKAA 4ENXA 1M7NA 3QXOA 4HYIA 4PWNA 4UN0C 5CSPA 5HX6A 5JMSA 4HVIA 2GHLA 3VHKA 5IPJA 3PLAE 1JBPE 3CS9A 3ORZA 2Y9QA 2XK9A 4BGGA 4I5HA 2G01A 2GNGA 4LMUA 3E8NA 4L43A 4HVHA 3QRIA 5IISA 3QYWA 5CNNA 2BRGA 4BBEA 4RC2A 3QCXA 5BVFA 3EFWA 4KBCA 4YJUA 3ORNA 3AT4A 2PMNX 3HRCA 4WA9A 1SVEA 3I5NA 2BZKB 1O6LA 4FIGA 5I5ZA 3SOCA 1OL1A 1FVTA 3NR9A 4EBWA 5HNIX 2XEZA 1H8FA 3ZLYA 4BKJA 4GK4A 3H0ZA 2YCQA 1P14A 5AP6A 4MQ1A 3DAKA 4DT8A 2CNUA 3K54A 5EM7A 5LCKA 3L9MA 3PA5A 4O1OA 4DFYA 4MNFA 5JGDA 2YWVA 4X3FB 1PMUA 3DJ5A 5FEEA 4C38A 1WFCA 3VIDA 2JDVA 4FV8A 2J0IA 2ZB1A 4QT1A 2XKDA 4YPDA 5DHJA 4CFFA 4F9WA 2PY3A 2WOTA 3H10A 4NM7A 1JVPP 3W1FA 4UEUA 2ZM3A 2XCHA 4U79A 4MXOA 1UU7A 3EN5A 3TKUA 1OMWA 3Q5ZA 1NT2A 2XKCA 2VTHA 4I0TA 3AC2A 3CSVA 5FTQA 1SNUA 3BLQA 4CLIA 3D7TB 5ANJA 4YJQA 3IGOA 3FMDA 4R77A 5CAPA 3RTPA 5IQGA 2WPAA 2QG7A 3OCGA 4NJDA 2G9XA 4WBBB 2UVYA 4J98A 2UUEA 4FV7A 2X4FA 4YGAA 4Y83A 5BYLA 4M66A 5CANA 2GQGA 5ANGA 5HBEA 5EYMA 3TV7A 2PTKA 3QYZA 4CXAA 3PXFA 3SC1A 1PXLA 4RQVA 2RFSA 1WAKA 5EW3A 4O84A 4JRNA 3RMFA 4FTMA 3C13A 2XJ0A 3ORIA 4JR3A 2CGUA 4BDKA 1TQPA 5BVWA 5IZFA 2E2BA 3CQUA 3BE2A 3ELJA 4OTFA 4NL0A 3A8WA 5A3XA 3SRVA 1M2QA 3EQDA 1ZARA 4L9IA 4FTUA 3UTOA 4CRSA 3ATTA 5E90A 5HOAA 4I0RA 2R9SA 4QMTA 3R1SA 5K0XA 3EL7A 3MN3A 4WD5A 4I1ZA 4K2RA 4ORKA 4RX7A 2WTVA 2O2UA 3EN9A 2OICA 3HNGA 5A4LA 4GIIA 3RKBA 4BBFA 3UBDA 4D9UA 3DK7A 4MNEB 3R7VA 4DCAA 5BVDA 1U54B 1J3HA 4D0XA 4H05A 5B2KA 4EYMA 1MQBA 2VWUA 2JDSA 3DTWA 4FKSA 5DN3A 1JKTA 3DBCA 3QHRA 4N6YA 4RWLA 3VBQA 3ZEPA 4DG0E 4L6QA 4CFNA 3R9RA 3P5KA 4W9WA 3PSDA 5CU0A 4UX9A 4XUFA 3ETAA 2YZLA 3DZQA 4C8BA 4LRJA 3D5XA 3M11A 3PJ1A 2ZYBA 3PZEA 2QC6A 3OT3A 4R1YA 1ZOEA 4A07A 3FMEA 4YR8A 4I6FA 3Q9ZA 2BRMA 2XNEA 5CQUA 3SX9A 4O38A 4PPBA 3P86A 3BYVA 4GUEA 5E4HA 4FTAA 2FUMA 2B52A 4IAAA 4RG0A 4D1SA 1LUFA 4LI5A 4NEUA 3UZPA 5CU2A 2FVDA 2YFXA 3N51A 3AC3A 2W4KA 3OTUA 3PXRA 3ORPA 4XG3A 5CEMA 3UC3A 3T3UA 4PL3A 5ETCA 4FTNA 3R01A 3RZBA 2B9HA 2XNMA 4MBIA 1ZY4A 3UODA 5L8KA 4R78A 4QMLA 3W2CA 4F9CA 4BF2A 3F5PA 3QBNA 4WG5A 5K4JA 5KO1A 3QL8A 5D41A 5T68A 3Q2JA 5DWRA 5HORA 4RJ5A 4DG3E 3RVGA 5IA1A 1M14A 5AAFA 4Z7GA 2J0MB 1JSTA 3KRXA 2GNFA 2XK7A 3POZA 4L7FA 4I4EA 2R3JA 3R63A 4ASEA 5A6NA 4FZFB 3R7IA 3Q2MA 4KIKA 1KUTA 4RX5A 3BIZA 2DYLA 3ENHA 3TL8A 5D9HA 4F7JA 1J1BA 2CCIA 5G6VA 1SNXA 2QLUA 2VTMA 4XH6A 4BI0A 5KMJA 4PTCA 4BTMA 2OGVA 4FKTA 3H9FA 4BWPA 1OUKA 4PX6A 4DH1A 3IW5A 1Q62A 3A2CA 4ZP5A 3UOKA 3DB6A 4NK9A 5D1JA 3KQ7A 4LGHA 3VVHA 4Y5QA 4FVRA 5EQPA 4ZS4A 3KRJA 2NPQA 4Y72A 4BDBA 1FMKA 3UYTA 4CCUA 4BWKA 3OY1A 4E4NA 3V8TA 4L3PA 3V5TA 4YLJA 3O17A 1YDRE 5E8WA 1IRKA 4TT7A 1YXXA 3TKIA 4QMNA 4O7ZA 5IDNA 5HE3A 4KABA 4YTIA 1PMEA 3FZPA 1WBPA 3Q4CA 1UWHA 2A0CX 3EL8A 5E7RA 1G8SA 1L8TA 3MY5A 1ZYLA 3HUCA 3QC9A 3NUUA 4QYYA 3VW6A 3ZHPC 2OJJA 2PHKA 1F3MC 3ORXA 2X6EA 3IW4A 2X7GA 3P7CA 4ALWA 3W10A 3RBWA 3KCFA 4WO5A 1H26A 4IM3A 2PE1A 4CV8A 4BYIA 5JK3A 5DIAA 2O65A 3PPJA 3WYYA 1AD5A 5CLPA 1H24A 3HRBA 3OWJA 4BCNA 1H1QA 5HCXA 3F82A 3GU4A 4MF1A 4H3QA 3BX5A 3SXFA 5ANIA 3W8LA 3FMHA 1KE5A 2VD5A 2BILB 5AP5A 3R6XA 5J1VA 3VC4A 4CTBA 3FZTA 3ZS5A 3DJ7A 5A6OA 2XYUA 4WT6A 3TNWA 2X9FA 2YCSA 3FV8A 3MVLA 5M4IA 1LEZA 5IUHA 3I5ZA 3DA6A 4C3RA 3P0MA 4G2FA 4EH8A 2C3IB 4BY9E 4N70A 4BTFA 3FXXA 2JDRA 3L8PA 3O8PA 2GCDA 5GHVA 2B9JA 2PZRA 2RKUA 4E5AX 3KCKA 4S2ZA 4BZOA 4C34A 2F7XE 2O63A 3LCKA 4I21A 4K6ZA 1IAJA 4PDOA 4PL4A 2WMSA 3DAJA 4GG7A 5D10A 3WBLA 3U8WA 3HVCA 4U7ZA 1SZMA 3QLFA 4FL2A 1W84A 3OW3A 3Q60A 4GRBA 1WBSA 4AQCA 4YJOA 2C4GA 2F7ZE 4MKCA 3RPSA 2JFMA 4CQGA 4L46A 1IEPA 3TNQB 4CT2A 5GZAA 4AFJA 4FTJA 5KHWA 4TYIA 4QTAA 3KN5A 4BIDA 2XB7A 4QYFA 3ZFXA 2IG7A 4JT3A 1ZYSA 4M15A 2IW8A 1OZ1A 5ICPA 5D7VA 3GQLA 3SHEA 4OTPA 2F4JA 2X39A 4ZIMA 3F88A 4I24A 2HY81 3QU0A 1Q4LA 1H1WA 4XP2A 4M13A 3RPOA 4CGAA 5DA3A 4UYAA 5LMAA 1DS5A 2ITUA 5HGIA 2E9NA 4TYHA 5F1ZA 3BLHA 3R1QA 4DEIA 4YJSA 3PLSA 3OOMA 3JUHA 4RQKA 4FI1A 2WELA 3FI4A 2YLEA 2DWBA 4QRCA 3R71A 4F65A 4RIWB 2XYNA 2ITYA 3UP2A 3WE8A 2P2HA 4L68A 4S30A 4ANMA 3QTQA 1WBNA 4FK6A 4MQ2A 2HWPA 3TWJA 5IU2A 4BCFA 2J0KA 4EZ3A 4KNBA 4R1VA 5LWNA 1FINA 3KXXA 2R3RA 2GFSA 3V04A 5C1QB 1FGIA 2XRWA 3FMMA 3PA4A 4HPUE 3GC9A 3W32A 3HV7A 3DV3A 3CTHA 3KU2A 3SAYA 4FTTA 3Q32A 4AOJA 4F6WA 1IAHA 4I20A 4N57A 3NYNA 3V5JA 4AN2A 5TE0A 1YI3A 1U59A 1XJDA 3GC8A 3R7GA 4FL3A 3BHHA 4ZTHA 5EQEA 3E7OA 4FKWA 1M2PA 3CPBA 4RPVA 2WQNA 2BRHA 4CD0A 1WMKA 4QQJA 1R0EA 1TVOA 2UZBA 2WTIA 4FZ7A 4WG3A 3SA0A 3V8WA 2BKKA 1OITA 2UZWE 3PJ3A 2XNGA 5IUIA 2BUJA 3PFQA 3UGCA 3PXQA 2FSLX 2C5XA 2GMXA 2BTRA 2HYYA 2XKFA 3FLQA 3GFEA 4RX8A 4DEBA 2PVHA 4WKQA 4E6CA 3QD4A 2HXLA 4FNWA 2CN8A 5KBRA 2YISA 5FXQA 4IVCA 1P4OA 4F0GA 3V51A 2ZV2A 4QYHA 2YJRA 4K1BA 3D5VA 5CY3A 3TTJA 3C7QA 1BUHA 2PVMA 4BZNA 3WZDA 3KMWA 5I4NA 4QYEA 5CEIA 2R3FA 2IVUA 4HZSA 4GFMA 4NUSA 5E91A 3UYSA 1W98A 5TF9A 1H00A 2WIPA 3PXYA 3WI6A 4ACGA 3KY2A 1JQHA 4GUBA 5EYCA 4HVGA 4C61A 5CAQA 5J9ZA 1OGUA 4FKIA 3S95A 3ALOA 4FR4A 3G9NA 5TT7A 4F70A 3HL7A 3E3PA 4CG9A 4I0SA 4APCA 1PKDA 1SVGA 4OTQA 4DITA 3UMWA 4EOKA 4V01A 3VJOA 3GCUA 4MXZA 1WZYA 2XM8A 2C6KA 4E4XA 4F9YA 5GINE 3QALE 1VYZA 3BBWA 1JKLA 4BKZA 5K9IA 1KV1A 3P9JA 2RFDA 1DI9A 4L3JA 4TRLA 4XMOA 4HVDA 5IQHA 1MP8A 4QTEA 4F7LA 2PE2A 3L8SA 3PDTA 5FBNC 5M4UA 3IW7A 2C68A 3FZRA 5IUGA 5IF1A 1QPJA 5ETIA 5HZNA 4IVBA 5KKRB 3OCSA 3V01A 2FGIA 4AOIA 3D7ZA 3IK3A 4GU9A 4AN3A 3VNTA 4UALA 4AT3A 5TKDA 4IDTA 4U81A 2XEYA 2LAVA 2C3KA 2VTRA 3QD2B 4FKGA 4IWPA 5CYIA 3FUPA 4DBNA 5KZIA 4HW7A 1M2RA 2AC3A 3IONA 4IB0A 4P2KA 4ZSAA 4EJ7A 1Y57A 3EQBA 5DI1A 3G6HA 2WAJA 4GT4A 3DDQA 2P4IA 3ZZEA 4EH5A 2HZNA 5H8EA 3AD5A 3LFBA 3JPVA 4FYOA 3K2LA 3UVRA 1CMKE 2WTJA 1CKPA 2IW9A 5B2LA 1MRUA 3R9NA 5DYJA 4K18A 4IXPA 4XYFA 5DT3A 3WYXA 5AUXA 2CPKE 3HMMA 5ACBC 4O2PA 3TIZA 5BYZA 1Z57A 3OWPA 3SLSA 4C33A 2JAVA 2VO6A 3O50A 2Z7RA 2WTKC 3NNWA 4QD6A 4FVPA 4AF3A 2Y4IC 4FBXA 5BMSA 4EQUA 3E8DA 3QUPA 4D4RA 2JKOA 5ANEA 3LVPA 4E73A 5EDRA 2UVZA 3ZLXA 3CIKA 3FE3A 4GK3A 5L2IA 3LMHA 1E1VA 1PHKA 3E92A 3QRKA 3TZ9A 1P5EA 4EUTA 5CXZA 3SOAA 3Q4TA 4IEBA 4E6AA 3RGFA 2C5OA 2UZNA 2WIHA 2HK5A 1P4FA 3WIGA 2UW8A 3B2TA 2CLXA 3MB7A 5IEVA 4RIXB 1SM2A 3DFAA 2UW4A 2B9IA 3UMXA 1XO2B 4MYGA 3ERKA 3O51A 4FIHA 2OKRA 3U87A 4ZTNA 5CAUA 1T45A 4FT5A 2WEVA 4GT3A 4QYGA 3GEQA 4EBVA 4OTHA 2ZM1A 1QPDA 4MXAA 4EUUA 3B8RA 5AV2A 2HELA 3OD6X 4ZY5A 1Z5MA 3RK7A 5I9VA 5DOSA 3MH2A 2JKQA 2YAAA 1GZKA 2YM6A 5HG7A 3GCVA 3HV6A 4ZMEA 4ITHA 3VBWA 3GI3A 4FV2A 4YZMA 4JR7A 3UNZA 4B8MA 1YVJA 3ET7A 3HUBA 2YAKA 2OFUA 4F64A 3DS6A 4BB4A 4DFUA 2PSQA 5JGBA 3LFNA 5IQFA 2RL5A 5K5NA 2OWBA 4N6ZA 3CTQA 5DT0A 4IZAA 3DKFA 3I60A 1MQ4A 3RK5A 4CMUA 3NCGA 2ZV7A 4FZDB 4FSRA 5EHYA 4F99A 3MH0A 3C0IA 4A4LA 4ZSJA 2B55A 4ANBA 4HOKA 4AW5A 1OPJA 2Y4PA 4BDCA 2C6EA 2A4LA 2JGZA 4WRGA 5HI2A 2PVRA 3EYGA 3QTUA 2PK9A 2R5TA 3MA6A 2V55A 4A9SA 4PDYA 2WMWA 5A4CA 3TUCA 3PXKA 2OI4X 3KVXA 3FC2A 2IZSA 3EJ1A 1Q41A 3QA8A 4QMXA 2WTWA 5FD2A 2QO7A 1NVQA 3WF8A 1V0BA 4TKSA 4YURA 5C8KA 2Z7SA 2Z02A 3U9NA 3W16A 4FKVA 4W4YA 3QGWA 5I3OA 3ZO4A 2JBOA 5C4KA 3IDPA 4RVTA 5E8TA 5KZ0A 4NJ3A 3ZFMA 4UY9A 5LVOA 1F0QA 4RSSA 4ZY6A 2BPMA 4F0FA 4M0YA 5IH4A 3NYOA 3AC4A 3R02A 2IN6A 4O6EA 3DBQA 4RLKA 5M56A 5L8LA 5TO8A 3C0HA 2OJGA 5EM5A 4A9YA 3ORKA 3IQ7A 1OUYA 3PJ8A 4MX9A 5CQWA 4BFMA 5H9BA 4C02A 4FGRA 2XH5A 4O7NA 3CGOA 4RJ4A 2XNBA 2VWYA 2QODA 2VTQA 2GPHA 4LUDA 4G5PA 3RINA 5M51A 4FEVA 2XUUA 3SRVB 2QOKA 5LMKA 2IW6A 4G6NA 3QZGA 4Y46A 3W33A 3R22A 3FLNC 1OKZA 1V1KA 4FV5A 3DXNA 4JXFA 2PPQA 5DRBA 3FZ1A 3FY0A 4IQ6A 3ORLA 3GUBA 3OROA 3VUDA 2C0IA 1GY3A 3VS1A 3UIUA 2VTOA 3S3IA 1SMHA 2QR7A 4KIOA 4BDAA 3MFTA 2NO3A 5I9ZA 4IX6A 1YHSA 2UW5A 4PPCA 4NFNA 4QP2A 4X6QC 4EOJA 1ZZLA 4OT5A 4E4MA 4XG2A 5ANKA 3GC0A 3HP5A 5CENA 4XG7A 5BVEA 4MTAA 3MI9A 2VX1A 3VO3A 4GYIA 4DH8A 4OR5A 4EHVA 4ZJVA 4PMTA 2X4ZA 4R7HA 3I4BA 3GCQA 1BL6A 3IPHA 3O0GA 3ZRMA 4TPTA 4OTGA 2QHMA 4CFXA 2JDOA 4IZ5A 1QPCA 2NRYA 2PZPA 3CTJA 2C6OA 3G2FA 2PVLA 3R04A 4G3EA 4CMTA 3FYKX 1XKKA 2C69A 1PY5A 1J1CA 4FICA 2GQRA 5EQYA 3VS6A 4Z55A 3DZOA 3PIYA 3VN9A 2CJMA 2H9VA 3CQWA 5L3AA 2BRBA 3BQRA 4QNYA 5BQ0A 4FV0A 2C6IA 4IDVA 3MESA 2YIWA 3Q6WA 5AUYA 3O71A 5AJQA 2Y6OA 3DK3A 4KA3A 4NFMA 4GSBA 3PE2A 4NTSA 4WNOA 3OCBA 3Q9WA 4QPMA 3WF5A 5J9YA 1UKIA 3LFAA 4E3CA 1K9AA 3C4WA 4E7WA 2I40A 1GZOA 5JN2A 4IAYA 3DAEA 4ACCA 4FNZA 1STCE 4XJ0A 5CASA 5CF4A 5JRQA 2XMYA 1OIQA 2WMVA 2UZOA 4XOYA 4RJ3A 4BDEA 2YM7A 4A4XA 4H39A 2C47A 4GFGA 1LR4A 4KIKB 1ZY5A 2OJIA 2PVFA 4IVAA 4CYJA 3F6XA 5KMLA 3CY2A 4IFGA 1KSWA 3T8OA 3EHAA 3UNKA 3BWJA 1OVEA 5G1XA 3LJ1A 2BVAA 4FL1A 1ZWSA 3LQ5A 2BRNA 2HIWA 4U6RA 4ZTSA 1M7QA 4AGDA 1WCCA 1B39A 5KUPA 4EL9A 1OL6A 4U3ZA 2XK3A 5CSWA 5IG1A 3GOKA 3PRIA 4JIAA 4ENYA 4EWHA 5DPVA 4F9AA 4FEXA 1E9HA 2J51A 1NY3A 2PU8A 4RFZA 2WNTA 2ETKA 2I0HA 4WUAA 4F4PA 1A9UA 2CNVA 1JAMA 4AW2A 5H2UA 4PNKA 3P08A 4MXYA 5CWZA 4FEUA 4O96A 4F1OA 2CLQA 2PVJA 3HDNA 2PWLA 5E8YA 4A9TA 3RNYA 4YJRA 3L8XA 1H08A 3R21A 2J2IB 2OIQA 2W06A 4R7BA 4Y85A 3NS9A 4DTAA 2WMRA 3HDMA 4BI2A 2HY0A 4I3ZA 3BWFA 1SYKA 3IW6A 2BDJA 3TNIA 3AGLA 4XS2A 1KV2A 4DH7A 3AC5A 3ZBXA 2JKKA 5M4FA 3QKLA 4BYJA 3HA6A 4FTLA 3NWWA 4O1PA 4GKIA 4FZAB 3BGQA 2JDTA 2QVSE 3CXWA 4IE9A 3O8TA 1FQ1B 4WRSA 5CTPA 5DG5A 4ZTLA 1UKHA 1YWVA 5HCZA 1XH7A 4H36A 5HD7A 3VBXA 4ERWA 5JGAA 5J9LA 4O7LA 3NIZA 3GQIA 3QCQA 4DT9A 3PJ2A 4BCPA 3D4QA 2JIVA 4EQMA 2QO2A 5I9YA 4IBMA 3RAWA 2F2UA 2ZV9A 2F49A 1YDTE 2QO9A 3PIZA 2J50A 2W0JA 5E8VA 2JKMA 3VF9A 1R3CA 3THBA 1WBVA 3GB2A 4ANSA 1A48A 2OZAA 4NCTA 2XCKA 5DVRA 2J90A 5HIBA 3RPRA 4V0GA 5ANDA 4HYHA 2OJFE 2OBJA 3V8SA 2H6DA 1HOWA 2QD9A 4GW8A 1M17A 1OL5A 2B54A 5DEYA 5AP2A 5IMEA 3A7HA 3EQCA 5F20A 3P79A 4D9TA 3AMYA 3C4CA 1QL6A 2XIZA 1H01A 3C4XA 3NDMA 1VYWA 4JL9A 3ALNA 4J52A 4J96A 5ETAA 3TV4A 3C0GA 4XLVA 5FTOA 1OIRA 2W1FA 3MY1A 4H58A 5KMKA 4XP3A 2PVYA 5H3QA 3BBTB 1ERKA 3DLZA 3KGAA 4G5JA 4R8QA 4KAOA 3LCSA 3MGYA 1OI9A 3FI2A 4ALUA 1M52A 2KTYA 4H3PA 2OH0E 2XK8A 2C5NA 4K77A 5C03A 3UQGA 1P2AA 4PP7A 5KMMA 3MBLA 1URCA 4TYHB 3WILA 4ZZMA 2W17A 2WQBA 3RHXA 3QCYA 4TTHB 4C35A 3LFFA 4D4YA 2VWXA 4AA5A 4IH8A 5LARA 1BKXA 1NA7A 1OPKA 3BU6A 3GU8A 3KK8A 4KINA 3MH1A 4PP9A 4OAUC 3FI8A 4ZLZA 2WKMA 3KB7A 3W2OA 4RFYA 4X3FC 3C51A 5HBJA 3DY7A 5LVPA 5CNOA 4EK6A 3NVKI 4RA4A 2EB3A 2OFVA 3DU8A 3NNXA 3OF0A 5EOBA 2VO3A 5J5TA 3RI1A 4TYJA 2BDWA 3UJGA 3FEGA 3TKHA 1ZMVA 5IQEA 1DM2A 3DBFA 4YJVA 1OL7A 4YLKA 4I5MA 2OXYA 3KXNA 4EHGA 4Z7HA 5BNJA 3N9XA 2V7AA 2F2CB 4GVJA 2IO6A 1PXPA 2YABA 4IWQA 4BDIA 1AQ1A 4O82A 2OXXA 2X8EA 4ZSEA 1I09A 4BKYA 5KCVA 5CSHA 2W4OA 3BPRA 5J5SA 3GFWA 4TW9A 3W8QA 1UU8A 4EHEA 4WOVA 4IAFA 1RQQA 2BZJA 4QPAA 5BVKA 5L2QA 4BC6A 5DFPA 2QQ7A 3OCTA 4BI1A 3EFLA 5IQCA 4AW0A 5K5XA 2B1PA 3DQWA 4XRLA 5ETFA 4F6SA 3R2BA 4E5WA 2C1BA 2PZ5A 3NCZA 4A7CA 4JX7A 4GJ3A 2IWIA 5EOLA 2HW6A 4BCHA 4YTFA 3HYHA 4NTTA 4RIYA 4HYUA 4O0XA 4J7BA 3P4KA 2DQ7X 4EYJA 1KE8A 5HIEA 3VUIA 4AA4A 1KE6A 4R7IA 4BGHA 4I23A 5EHLA 5E8SA 4BDFA 3CE3A 2JITA 4GV1A 3R7OA 3LCTA 4BDJA 3BKBA 4FKRA 2X9EA 4M7IA 5TR6A 4HGTA 3TV6A 4WSQA 4S32A 2VWIA 2REIA 1ZXEA 3VS7A 4DGOA 2HCKA 2QKRA 2R3NA 4YZDA 4M84A 4O7SA 4AOTA 2XVDA 2AYPA 5DE2A 3BV2A 4JJRA 4EONA 3CKXA 4Q2AA 4FTRA 4G6OA 5HKMA 1F5QA 5LCJA 2R7BA 4I6QA 4FYNA 4AZEA 3U4WA 4E6DA 2X0GA 5AV3A 4ARKA 5DR9A 3WZUA 5CF5A 3MTLA 4ZLYA 1OECA 4O7WA 5LVNA 4I5CA 4BCQA 4YSJA 1ZOHA 3NEWA 4UWYA 4DA5A 3P23A 2W1ZA 5IA5A 3ZC5A 4U43A 4QMUA 1WVXA 2CCHA 5K4IA 4Q9ZA 5E8ZA 4FE2A 3ZUVA 2XK4A 3QHWA 3F61A 3OWKA 4L42A 4PRJA 3VBTA 4O86A 1W82A 3R8UA 3LPBA 1O6KA 3MVHA 2PZIA 3VJNA 3ZBFA 3NUAA 2BR1A 4O0RA 5AA8A 2DS1A 2WXVA 4NKSA 3GCSA 3DXQA 4HCTA 3VRZA 2X7FA 4W8DA 4FTCA 3DTCA 4R3RA 3TXOA 5C01A 3TCPA 3MFRA 5HICA 3SW4A 1PXOA 3GXLA 4BDDA 4DEDA 5C8MA 3PVUA 4KKHA 1PYEA 2XP2A 3FQEA 3NMUF 5C8NA 4CKJA 1H25A 5CEKA 3EQHA 3KVWA 3R9DA 3U54A 1GOLA 4FV4A 2WFYA 4OBQA 2QU6A 4P7EA 3RPVA 3E8CA 2G1TA 2FSTX 4L45A 4YBJA 3R8PA 3W2PA 4ANOA 3VAPA 1PF8A 3OC1A 4RC3A 5FEDA 3WOWA 4CMOA 3DKOA 4YHFA 4L8MA 4IZYA 5E92A 4I41A 4X6RA 4LRMA 1YXSA 2A2AA 3W2SA 1YDSE 3JY9A 5DNRA 2WTCA 4E4LA 2E9PA 3FSFA 4XRJA 4X0MA 2UZTA 1Q8YA 3H3CA 2J5FA 4CFMA 5E1SA 4UMRA 2RSVA 3ZXTA 5E8UA
chains in the Genus database with same CATH superfamily
3W0SA 2OU7A 3TUBA 4O0YA 4FKLA 4MBLA 2BAQA 4XX9A 3N4VA 4NH1A 2W5HA 2W5AA 3QFVA 3KRWA 3SG8A 2BIKB 3QAME 5EM8A 3CEKA 3V5QA 4FG8A 4F7NA 2CKQA 3QD3A 4FKJA 5EI8A 3BYUA 3LMIA 4UZHA 3LXPA 4YZBA 2JEDA 4ZJIA 4NM0A 4CNHA 2NP8A 2XBAA 2JIIA 5C4LA 3MIAA 4GMYA 3CJFA 3LW0A 3CR0A 3IECA 1OKVA 2OLCA 4PPAA 2VNYA 3D5WA 4DFXE 1BMKA 3R0TA 4RRVA 4M68A 3QCSA 2R0IA 3SVVA 1YOLA 4IHPA 4RFMA 5FRIA 5EKNA 4GYGA 1W0XC 4S33A 3ODZX 1TKIA 5I0BA 4FIIA 4AGCA 3HECA 3MJ2A 4EQCA 5HG9A 2PE0A 5HHWA 2Y8OA 1WVYA 3TMOA 4AAYA 2CNQA 1TQMA 2ETRA 5HVJA 4HNFA 2GSFA 3PG1A 2I0EA 4NIFA 3KMUA 4QMSA 3AT3A 2R3KA 4EJNA 2VX0A 1XH4A 5B7VA 3BEGA 3KF7A 3LAUA 3P7BA 2EXEA 3AMAA 2I0YA 4JBOA 2X2KA 4JG7A 4L53A 4QTDA 4PQNA 4DTKA 3MPAA 4BL1A 4IX5A 4AAAA 2UZUE 3GVUA 3DDPA 3PY0A 3W2QA 5JQ5A 5HLPA 2QOQA 2VWWA 4G9CA 4A4OA 3AOXA 2Q0BA 4AE9A 4CEGA 4RGJA 4FG9A 4WNMA 2VX3A 3ZONA 5JZJA 1Y8GA 4AS0A 5IQAA 1LEWA 4K9YA 4FT0A 3ROCA 4W9XA 2PVNA 4U9AA 4QP4A 3OVVA 1ZZ2A 2P2IA 5CVGA 4K0YA 4BIBA 4M12A 1ZRZA 3E5AA 3NAXA 3Q9XA 5HG8A 3ZTXA 1O6YA 4HGEA 4YJPA 1ZMWA 4DFNA 2QOBA 2CKOA 3VS0A 3UVQA 3ZZWA 2C3LA 5FP5A 3VS5A 4B7TA 3F9NA 2C6LA 3I79A 5KMIA 2WU7A 4TYEA 5HEZA 3E93A 4U97A 1YI6A 4NYEA 5DH3A 2A19B 2WU6A 4W8EA 3UIBA 3R2YA 4YPSA 2XNOA 3F5UA 4WG4A 4BZDA 1OM1A 3E3BX 4C62A 5E9EA 1UNHA 3EN6A 4RWKA 2BKZA 1SVHA 4EC9A 1ZAOA 5IA4A 3BLAA 1ZYJA 4YP8A 3EQIA 3RNIA 3HV5A 4CVAA 4GIHA 4MH7A 4GT5A 3REPA 3V3VA 2JIUA 2ACXA 1Q24A 2UZEA 2XKEA 3EQFA 4Y95A 4F0IA 5M44A 3HMIA 4UXLA 4DEEA 4TWNA 4H1MA 2BFYA 4AXAA 3OS3A 2EXCX 3NZ0A 4HCUA 4MXCA 4U42A 5AUWA 4UMQA 4EKLA 5CEPA 4BIEA 2OIBA 4FKOA 4MBJA 4DEHA 4EH9A 5AUUA 3FLSA 2UW7A 2Y0AA 4G34A 4CV9A 2J9MA 2V62A 2WO6A 3DQXA 2VTLA 3II5A 4LQMA 5AAEA 3TUDA 2PUUA 5JFWA 1YXVA 4JBPA 1AGWA 3ZO3A 4AZWA 5J87A 3CJGA 4HNIA 3FL5A 4AW1A 4F78A 4ONAA 3H9RA 3CP9A 4QMMA 3ZYAA 4CQEA 1OBDA 4O0TA 1R0PA 1J7UA 3VW8A 2J7TA 3E7VA 2XM9A 2VWVA 3QA0A 4CYIA 2OF4A 1W7HA 4O21A 5FWKK 3FKLA 2WQOA 2JD5A 2YCFA 3PA3A 4DHZA 2W5BA 3Q04A 3ACJA 3EQPA 5F94A 1DI8A 3A99A 4RVLA 3R9OA 3D15A 5HBHA 3RHKA 2BIYA 3LCDA 4OUCA 4D2TA 1OB3A 1GZNA 5F95A 1XBCA 4BDHA 3QX2A 4JAJA 3VHEA 5AM7A 3Q6UA 3BI6A 4YZCA 5AM6A 3RK9A 3F3ZA 3HZTA 3FMKA 4KKEA 4O4CA 4CTCA 2VTAA 2XF0A 3QUDA 3FL4A 5HIDA 1S9IA 3UVPA 1UNLA 4IAIA 4FUYA 2YM3A 3IOKA 4V05A 1BI8A 2WEIA 4OBOA 4D58A 4YC8A 2HZ4A 2WD1A 2B7AA 4XV2A 4AT4A 4M69A 2FYSA 4IW0A 4DGNA 5CAOA 4ACMA 4CSVA 2JBPA 1J7IA 4EOIA 2UZDA 4JDJA 4JI9A 4Z3VA 3A4PA 5DT4A 5CAVA 3UDSA 4JMQA 5LWMA 4G16A 3BGZA 1VR2A 4W4WA 2CN5A 4FTOA 1JOWB 1XWSA 4LMNA 2FA2A 3NYVA 3I0OA 2QONA 4RA5A 4DFBA 2OW3A 3LQ8A 3L8VA 1BL7A 4RVMA 4ZAUA 2BHEA 3QKKA 4OTDA 4UMUA 4DEGA 5DR2A 2XBJA 3UIMA 3KMMA 3BZ3A 5D11A 4HYSA 3TIYA 4DLIA 1PMNA 3QTSA 3MWUA 4DTBA 4FT3A 3C1XA 3JY0A 2C1AA 3HGKA 3QWKA 3DKGA 4IM2A 3BELA 4FSYA 4D2VA 3QZHA 4D2SA 3AD4A 3LFCA 5JZNA 3R7EA 5J8IA 5CT7A 4LYNA 5AAGA 5BMMA 4RLLA 4BVUA 5KKRC 2B4SB 4KIQA 3C4ZA 4PUZA 1Q8UA 4B8LA 5M4CA 4DE4A 2PMIA 5HU3A 2UW9A 5EDQA 2VV9A 3HRFA 2O64A 2QG5A 3HX4A 4G3FA 4JAIA 4JS8A 2X2LA 5CT0A 5AUZA 3I6UA 2QI8A 4IZ7A 4AZSA 5ITAA 2XNPA 3FI3A 2IPXA 4IB5A 1JKKA 4S34A 1IA8A 4O7YA 1GNGA 1MRYA 4FF8A 4X2FA 5FXRA 3CPCA 2J4ZA 3A7JA 3PVGA 4FKPA 3WF9A 3A60A 4AZVA 5EI6A 3EKKA 1UA2A 4JOAA 4ZZNA 1REJA 2ERZE 2HZ0A 3QTXA 5AR2A 3AMBA 5HLWA 3EIDA 4LOPA 2Z7QA 3NW6A 4O81A 3PWDA 3CGFA 1FBNA 4GJ2A 4M67A 3W55A 2GFCA 5HG5A 3E88A 4M0ZA 3QRTA 4NZWB 3TN8A 2IVTA 2IZTA 3QZIA 5HO8A 5DMZA 4TWOA 3R8LA 3I7BA 2GQSA 1YQJA 4IAKA 3RALA 3RAKA 3U6JA 2GS6A 3D5UA 2QURA 4DINA 2OZAB 4RMZA 5JSMA 3PY1A 2DUVA 4FRFA 4ZY4A 1CKJA 3Q4UA 4V0GB 4CFVA 3MB6A 1GZ8A 2Y6MA 3A62A 3OZ6A 4ASZA 4DDGA 3FHIA 1WVWA 4LM5A 3QF9A 3MH3A 3K5VA 4XG8A 3FKOA 4KD1A 5DLSA 3LLTA 1Q8TA 1PXNA 3PWYA 3PJCA 4Z9LA 4CKRA 4USEA 5L2TA 4C4GA 5J95A 5AUVA 2FSOX 3RM6A 4PMSA 5IA2A 4FKQA 1LP4A 3OEZA 5GZ9A 2GNLA 3EYHA 4IFCA 4TWPA 4EH7A 4FJVA 2W9ZB 3NSZA 4XCUA 3QX4A 3BGPA 3QQGA 4FK3A 4YLLA 2OJ9A 3VBVA 1GAGA 1YHWA 4FIEA 5IH5A 4O83A 2EU9A 4P5ZA 3KXZA 2VN9A 4O0UA 2ONLC 1OIUA 4Q5HA 4ZZOA 3DT1A 4NKAA 4G9RA 4XLIA 4XV1A 3ROYA 3PZHA 4A9RA 5I9WA 4AXEA 1APME 4DG2E 4J53A 3LE6A 5B0XA 5AR5A 4BDGA 3UPZA 4GCJA 1B38A 3MFUA 3F3UA 4PY1A 4O0SA 4HPTE 3LJ0A 3O96A 5DGZA 4TNDA 3N4TA 2ITZA 4QTCA 5M53A 2OSCA 2FB8A 4I5PA 4G31A 3S00A 3F3TA 1BLXA 4MK0A 3F5GA 4ID7A 4PMMA 2YIQA 5BUJA 3QRUA 3Q9YA 4FV9A 4QMZA 4ZSLA 1U46A 4KRCA 2UVXA 3IG7A 5DEWA 4FG7A 2BTSA 4R6VA 4D28A 3DGKA 1Q61A 5FEQA 2C30A 4YHJA 5FM2A 2PMLX 5L6PA 3CD8A 3QGYA 2YACA 2G15A 3WARA 4BCKA 4IWDA 5HESA 3BE9A 3CCNA 4FSTA 3LM5A 4BBMA 5GJFA 1E1XA 5IMXA 2Z60A 4YUQA 4J95A 1QCFA 2O3PA 1Q5KA 1V0PA 2R3HA 1ZYCA 4NW5A 3FPMA 5EM6A 5EW8A 2B9FA 1MRVA 1TZDA 3LIJA 2Y7JA 4XOZA 3U9CA 4DAWA 5HU9A 3S4QA 3KXHA 1ND4A 4JIKA 4USFA 3KULA 3M2WA 2BAJA 2RF9A 1Q8ZA 3O7LD 3Q5IA 4FMQA 4P90A 4YO6A 2GTMA 5LVLA 3Q52A 3D2IA 4XG9A 1H1RA 3BRBA 3B2WA 4KSPA 1U5QA 1UU9A 3PRFA 5JQ8A 5JFVA 4YC3A 4D2RA 1OGYA 5M08A 4E26A 5HD4A 4XEYA 1PYXA 3CKWA 4BHZA 2EWAA 2J6MA 3NGAA 4AA0A 2XJ2A 4U80A 4QQCA 4C58A 4DBXA 3UC4A 4E1ZA 5J79A 4N4SA 5CXHA 4AACA 2ITQA 5LQFA 4DHIB 4Y8DA 1NVSA 2WTDA 2R3QA 4CFWA 1H07A 2UZVA 3S1HA 4GL9A 2WMBA 4RIYB 4PMPA 2XIXA 3V5PA 4I92A 4QDEA 1KE9A 2YM5A 3C9WA 3W0OA 4X2KA 1OIYA 3D14A 4O2ZA 3DCVA 3TG1A 1UVRA 3UDBA 4CZYB 4AT5A 1YWRA 5I3RA 4YTHA 2WHBA 4DHJA 4FV3A 4KBAA 3P5JC 4NT4A 2CHLA 4K33A 2BROA 2X1NA 3WZKA 4AGWA 4CZTA 1G8AA 3QUEA 3FC1X 3G0EA 3CBLA 4GEOA 3JXWA 5GIPE 3MPTA 4CLJA 3OG7A 3A7GA 2YCRA 1WBWA 5LXMA 4UB7A 1JKSA 1XBAA 2XNNA 2YDIA 4FEWA 1QPEA 2VO7A 2ITOA 2XS0A 4I93A 2W1DA 5FTGA 1PMVA 5CI7A 2BZHB 2IZUA 5A54A 4FSNA 4O0VA 4C37A 5AWMA 4QMPA 3OT8A 3BYMA 3SXSA 4MAOA 4WIHA 5CSXA 3OUNB 5FP6A 5KE0A 3R7YA 2GS7A 3R8ZA 5AFVA 3QQKA 5E8XA 2V7OA 4LGGA 4OTWA 3NUYA 3F2RA 3BCEA 3PIXA 4TY1A 2LGCA 3BHVA 3G51A 4Y73A 5CEQA 3COHA 4M97A 1W2CA 4U41A 5BPYA 4KKGA 3PTGA 4FSWA 1BYGA 5TOZA 4APPA 3ZSHA 4CT1A 2ONLA 4BCOA 4F7SA 1OL2A 2X2MA 3G5DA 1KE7A 4LL0A 3GU7A 2WGJA 3VUGA 5GZ8A 5IQDA 2WQEA 1XQZA 4FSUA 4F08A 2A1AB 5DR6A 1OKYA 1H1PA 3OFMA 2C3JA 2GNHA 4O4EA 4AP7A 2QOFA 3K5UA 3HV4A 4M14A 2OXDA 5M07A 4Q5EA 3ZSIA 3H0YA 1YI4A 4V04A 4AZTA 3PFYA 4WSYA 1TQIA 1VZOA 2HOGA 2I1MA 4FSMA 2R7IA 2PL0A 5HQ0A 3UNJA 4UWBA 3QZFA 2PUIA 3O5AA 4CFUA 2Z2WA 4W4VA 2BAKA 5FDXA 3BL9A 2YLFA 4FT9A 5DBXA 3U6IA 2CKEA 3LHJA 4C4FA 4U3YA 4YBKA 2C6TA 4WNPA 5BUIA 3R8VA 4YJTA 2HXQA 3P1AA 2E9OA 3VUTA 4DC2A 2AC5A 4GVAA 2YHVA 2WZJA 2GTNA 2O0UA 2WMXA 1Y6BA 3DLSA 5A9UA 5AP1A 3SKCA 5FG8A 3BEAA 4JDKA 3MYGA 4JDHA 4B0GA 4PNIA 4RWIA 1HCKA 2NNWB 4QMOA 1H1SA 2YZAA 2HAKA 3ZH8A 4BGQA 3ZM9A 4AUAA 2C0OA 2EUFB 4OW8A 4YZNA 2G2HA 5A14A 4AU8A 3EZRA 3ZUUA 3UZRA 4FA2A 5AEPA 4DF3A 3UQFA 2R3GA 3OW4A 3QTIA 4DYMA 3FSKA 3IW8A 4TN6A 4D0WA 5BVOA 4X2NA 4LL5A 1PRYA 3MS9A 3G90X 3TNHA 3UIXA 2CKPA 4RC4A 3UG2A 3ZCLA 4QMWA 4IANA 4AZFA 2UW0A 3DNEA 3NPCA 3PVBA 3F66A 3AXWA 3ZU7A 3WZEA 3MVMA 5FQDC 4EK3A 2ZDUA 3POOA 4OAVB 4AGUA 4ZTMA 3OXTA 4YNEA 5HCYA 3QTZA 2W1CA 4II5A 4M8TA 3AQVA 3ENMA 1GIIA 5FBOA 2OG8A 1WBTA 3HAVA 4JG8A 4WBOA 4CKIA 3OHTA 1OKWA 3RPYA 4C4IA 5CALA 2X7OA 4QNAA 3UPXA 3F69A 3FLZA 1H0VA 3ANRA 3W0NA 1L3RE 2IVVA 2R3LA 2A27A 2UW6A 3ZRKA 2YJSA 3ULZA 4I94A 4NIFB 2QOHA 1NVRA 2RG5A 5AP7A 3SW7A 2UV2A 5KX8A 3WE4A 2QU5A 3V6RA 3C4FA 4C59A 3IDBA 1FGKA 1BI7A 3TI1A 3OMVA 2E9UA 4LRKA 5K3YA 2P0CA 2XJ1A 3FMNA 5AR4A 3RCDA 3NUNA 2BMCA 4U5JA 3VRYA 3EKNA 4GH2A 3ZUTA 3TT0A 4L52A 4UXQA 4LDTA 3D83A 4QP9A 4EOLA 4DFLA 3U4UA 4EK5A 3R7UA 4F1TA 1RDQE 2W4JA 4J99A 5IA0A 4DH3A 5EI2A 4Q9SA 1BX6A 2YIXA 2KULA 4QMQA 3E63A 2YERA 4G3DA 4ITIA 3FAAA 4NWMA 3BYSA 4O7TA 1Z9XA 2C0TA 3O2MA 3WF6A 3ZXZA 5M09A 4EC8A 4FEQA 3A7FA 4RX9A 5IDPA 3D2KA 1R78A 2VTJA 2FH9A 1G5SA 3EN7A 2ZB0A 4EH3A 3NW7A 3VS2A 3Q53A 5IQIA 2YIRA 3OXZA 2VAGA 4FSQA 1CDKA 2P3GX 4NM3A 2G2FA 4R3PA 4QQ5A 4IIRA 4E5BA 2CSNA 4EORA 2ZMCA 3N4UA 3RWQA 4KS7A 3G33A 3VUKA 4RWJA 4EOOA 1OBGA 2FO0A 2YEXA 3UE4A 1ST4A 2O5KA 5AP0A 5GIOE 4D1ZA 4UV0A 3GU5A 1HCLA 4I6HA 4ERKA 3LXNA 4QP3A 3F3VA 4J97A 4ZXTA 4PDSA 1I44A 3NNVA 3FXZA 2ZAZA 2W99B 3BU5A 4FVQA 5HNGA 4BWXA 5JT2A 1XMMA 1YXUA 4RIOA 3W2RA 1UWJA 2VTIA 2XRUA 5CU3A 3RJCA 1RJBA 4LUEA 5CZHA 3ODYX 1J7LA 2BALA 2V22A 4IMYA 2ZOQA 3KFAA 3AGMA 2BZIB 2PZYA 4JX3A 3AD6A 2EXMA 3EQRA 4FT7A 1A06A 2ITTA 2J5EA 4J8MA 2QOOA 1Q3WA 2YDKA 3PSBA 3JVSA 2BHHA 4LOOA 3MIYA 4YJNA 5AV4A 2H8HA 5AP4A 2XIKA 3KRRA 2X81A 4FODA 2R64A 4ZSGA 5AMNA 1YHVA 3VS4A 3O8UA 4X2GA 2ZJWA 3TZ8A 4D5HA 4EH2A 1REKA 3JVRA 4XP0A 4FTQA 4QP1A 1UNGA 4FOBA 3AC8A 1PKGA 3RZFA 1FVVA 2ITVA 4PTEA 4Z16A 2QR8A 4GFOA 4F6UA 3PY3A 2JC6A 5K0KA 3T9TA 3F2AA 1U5RA 3E62A 5I9XA 3FQSA 3L1SA 4MD8E 4YC6A 4I22A 2XARA 3A7IA 5AX9A 5KBQA 5EKOA 4YTCA 3PE1A 1WBOA 4IB1A 1V0OA 1YXTA 2WMTA 3BV3A 4K11A 4C36A 3BHUA 3FDNA 2XIRA 5HO6A 1ATPE 4WNKA 5E1EA 4C57A 3WF7A 4BHNA 2CGVA 1NW1A 3ZOSA 2HW7A 4FIJA 1ZYDA 2H96A 3H4JA 4YZ9A 3GOPA 1UU3A 5CZIA 3FMJA 4ZOGA 3RWPA 1T46A 2RG6A 5D7AA 3LCOA 4X3FA 5AR7A 4ANQA 2ITPA 2W1EA 5HNBA 3OXIA 5EDPA 4R3CA 3DPKA 4M69B 3EMGA 3SQQA 3QQHA 4BICA 4C7TA 3OBGA 2ITWA 3COMA 5T6KA 4RZWA 3ATSA 2ITNA 3NFGB 3I81A 4B9DA 2R3PA 3TEIA 4R5SA 3JR1A 2Q0NA 5HVKA 1DAYA 3QXPA 2YITA 2VTNA 1J91A 4NU1A 5J7BA 3ID6C 2V5QA 4YSMA 3R73A 1XHAA 3F2NA 3UO6A 3KRLA 4WHZA 3VS3A 3SGCA 3D7TA 3FLYA 2VNWA 4EH6A 4FKUA 4A9UA 4LGDA 4D5KA 3QKMA 5FLFA 3VQUA 3EFKA 4G3GA 5BYYA 3R8MA 4UMPA 4FC0A 3MVJA 4NM5A 5HE1A 2CGWA 2QNJA 4QOXA 4XBRA 1Q3DA 2ZM4A 3FWQA 2XZSA 1GIJA 4L7SA 2QKWB 5A46A 5H8BA 4LV5A 3V5LA 1JPAA 4QP6A 3ZSGA 5EK7A 4EK8A 3SXRA 4BCGA 4B6LA 3MJ1A 4IC7A 3PXZA 3I6WA 4YNOA 1KWPA 1CKIA 1S9JA 2R4BA 4DGGA 1X8BA 1W83A 3ZO1A 1H28A 2I0VA 3NUSA 3EFJA 3LLAA 3CLYA 3DXPA 1PXIA 3LXKA 4O91A 4D2PA 4ZEGA 2FSMX 3UQCA 4FZ6A 5HTBA 4E20A 2BDFA 4HJOA 4L01A 4GG5A 3S2PA 2F7EE 5HTCA 3LFQA 3P7AA 4JQ8A 4KBKA 5FXSA 3UOJA 2W7XA 4MNEA 4CG8A 1IA9A 1U54A 2C5YA 2V0DA 3MDYA 3RP9A 3KK9A 1K2PA 5BX0A 4KUJA 3ZO2A 2QLQA 2CDZA 4F63A 3R30A 1PXMA 3MA3A 5IH6A 3L9PA 5L2SA 4PF4A 5CSVA 4EZ7A 2YDJA 4OTRA 4CRLA 4TXCA 4FNXA 4DHFA 3GNIB 5HTIA 4FNYA 3G15A 3HKOA 5EG3A 4EOMA 3MY0A 4HVSA 4OT6A 4BCJA 5LOHA 4F09A 4MVFA 4QO9A 4F1MA 3LFSA 4JRVA 4BCMA 1VJYA 5C27A 4G3CA 4A06A 2IVSA 1Q97A 4IAZA 3GU6A 2IZRA 3VF8A 4D1XA 4D2WA 3Q3BA 4JLCA 4O22A 1XH9A 3SDJA 2QCSA 3QQLA 3OEFX 3VQHA 4OBPA 4FIFA 4EK4A 3BQCA 3TJDA 4MF0A 4P4CA 4LFIA 3UOHA 5LJJA 3CC6A 3F7ZA 4XHKB 4BN1A 4ZMFA 4XNEA 3COIA 4ZJJA 3L9NA 3OBJA 1PJKA 3C50A 5CU6A 3FMLA 3NVMB 4QPSA 4EEVA 4BR3A 4BCIA 5IEXA 1YKRA 4CZUA 3VUMA 3LFEA 3NUXA 4O27B 3V6SA 4C4JA 4EOQA 4I6BA 4JQEA 4ACDA 4JG6A 4C3FA 3MTFA 2R3MA 1IR3A 3MSSA 3WIKA 1H4LA 3H9OA 4U0IA 4U8ZA 1FVRA 2JAMA 4X21A 5A4TA 5EYKA 1YRPA 5FUTA 5DRDA 3ZDUA 2VTSA 2WB8A 4UBAA 2WTKB 4AX8A 1ZOGA 3EQGA 4ITJA 3IDCA 3U51A 2Y4IB 3FPQA 5D12A 5BVNA 2OH4A 4JBQA 3SV0A 3ZM4A 3KN6A 4YMJA 3D9VA 4ZS0A 5JEBA 2VGOA 2BFXA 1H27A 3A8XA 1UV5A 3U55A 3AG9A 4MD7E 3GC7A 4QQTA 3U6HA 2VTTA 5FM3A 3HAMA 4I4FA 3M42A 1R39A 2QHNA 3KL8A 5F4NA 5HX8A 2WMUA 3R28A 5GJDA 3HEGA 4QMVA 2ZDTA 2UW3A 4BTKA 5AA9A 2J0LA 3UG1A 2VUWA 4PDPA 4ANLA 2W96B 3L9LA 2Q83A 4DN5A 2X6DA 4X3JA 1RW8A 2P33A 2R0UA 3IS5A 3OOGA 4L44A 3LXLA 4KRDA 5AIKA 4B99A 3NIEA 3TTIA 5AX3A 3VWAA 4IX3A 3DBEA 4J1RA 2W1HA 3PP0A 4ANNA 3ZRLA 2C5VA 5HO7A 3JYAA 4BTJA 3T9IA 4QDVA 5L6WL 3UOLA 1XR1A 3S0OA 3OY3A 1YWNA 2AQXA 5CVHA 3QRJA 3RAHA 2GHGA 3KULB 3PPZA 3RAIA 3COKA 4E8AA 3TACA 4E6QA 2PUPA 3PP1A 5HE0A 4GS6A 3MFSA 3D94A 1JWHA 4X2JA 5AIRA 5EH0A 4FUXA 3FZOA 4GK2A 1Q99A 3ANQA 4MXXA 1Y8YA 4BRXA 3EH9A 3T3VA 4EOPA 3HMOA 2HZIA 4U40A 4F9BA 4TZRA 2W9FB 4X7QA 4O0WA 4ZLOA 1XH5A 2YM4A 2PUNA 2QOCA 1FMOE 3O7LB 1EH4A 3BHTA 3RM7A 3OUKA 5KHXA 3SD0A 4HGSA 3BYOA 5M57A 4LV8A 3P78A 3ZMMA 3BU3A 5L2WA 2VZ6A 3TZMA 5BUEA 5J7HA 3GBZA 3FYJX 5LMKC 3DBDA 3LOKA 5J1WA 3KXGA 1VEBA 1YOJA 3PUPA 3D0EA 3Q4ZA 4MEDA 4FGBA 4UMTA 3UP7A 4EOSA 1XMLA 1KOBA 1XH8A 5ANOA 1ZMUA 5HE2A 1W8CA 4Y5HA 3TNPC 5GJGA 1JNKA 3H30A 4RJ6A 5C26A 5JFSA 3HMPA 3PSCA 4DEAA 3FXWA 2GDOA 4TNBA 4RZVA 4C2VA 3VULA 5ACKA 3TJCA 4CCBA 4EI4A 3HA8A 4XG6A 3GGFA 4JBVA 2JLDA 5CEOA 4DFZE 5LVMA 4D55A 3NUPA 2UZLA 4XV3A 2SRCA 3LZBA 3LKMA 4QTBA 4L67A 3R83A 5F9EA 5CVFA 2W05A 3F5XA 3LMGA 3OP5A 5HLNA 4YO4A 3F7WA 3LFDA 4U45A 1JLUE 4S31A 4YU2A 4MUQA 2VWZA 4C4EA 3GP0A 4IM0A 2NRUA 1MUOA 2B53A 3CD3A 2QOIA 2WOUA 2WQMA 4AFEA 3KIOC 1CTPE 3DJ6A 4KS8A 5H8GA 4ASDA 3TDVA 3I1AA 4AWIA 4O7RA 5I9UA 4HZRA 2H34A 3K3IA 1YOMA 3HLLA 4MCVA 4N0SA 4O6LA 5AR3A 3R9HA 3DB8A 2P55A 4KB8A 4EZ5A 3EWHA 2X0QA 3ORMA 2I7QA 2WMQA 5AUTA 4FTKA 3UZTA 4OGRA 1XH6A 3NW5A 4IVDA 4JVGA 3W18A 4C0TA 5HVYA 5KMNA 3R1YA 4QP7A 5T3QA 1PXKA 1Y6AA 3B8QA 5CI6A 5IA3A 2F57A 4FV6A 1K3AA 2BCJA 4D4VA 4QP8A 4RIWA 4EH4A 2PMOX 3JS2A 4AN9A 2XA4A 1G3NA 1GJOA 3NFFB 1B6CB 3FJQE 3KC3A 1KOAA 4B4LA 4MWIA 4ZTQA 5L6OA 2ZVAA 3EN4A 3C5IA 4RVKA 2GS2A 5AP3A 3ZEWA 4IWOA 4C2WA 1PXJA 3MV5A 1NXKA 3CY3A 3MPMA 2VO0A 4R5YA 4K8AA 2GNJA 2VU3A 3FLWA 3G0FA 2OIDA 2OZOA 5L8JA 2YN8A 4EKKA 3NLBA 2RIOA 3R1NA 2VRXA 3ZLWA 3KEXA 2R3OA 5CX9A 4PV0A 5JH6A 2C6DA 3QWJA 2VTPA 1QMZA 3IOPA 3FZSA 4IACA 2GHMA 3A4OX 4FTIA 2W1GA 4P5QA 4PL5A 5CU4A 3VUHA 3SG9A 1YW2A 3EZVA 2Z8CA 4IC8A 3NRMA 3KA0A 2CMWA 3FKNA 1Q8WA 3QD0A 3TZ7A 5AV0A 4DGMA 2YIYA 1OPLA 3KF4A 4W4XA 5EW9A 3ZLSA 2AUHA 3IGGA 2Z7LA 4OTIA 3NNUA 5AADA 3DOGA 5EFQA 4UZDA 2YM8A 1U4DA 4G6LA 4FV1A 2ESMA 4RJ7A 3KREA 3GENA 2ETMA 3QLGA 3FHRA 4D4SA 4TYGA 2X8DA 2PVKA 5M55A 4AG8A 5A4EA 5AR8A 3TM0A 3LJ2A 2HWOA 4H1JA 4USDA 1FPUA 2WMAA 4MHAA 1LPUA 2GU8A 2XIYA 5JRSA 4C4HA 3DKCA 2C6MA 2QOLA 3FQHA 3LM0A 5IKWA 3V5WA 3EOCA 5FDPA 2XANA 3GCPA 4DGLC 1PW2A 3ACKA 4GU6A 3ML1A 4C3PA 3QC4A 4LOQA 4KWPA 3DNDA 3M1SA 1URWA 2RFNA 4FOCA 4L00A 4ZK5A 2ZV8A 5CF6A 4XG4A 3EB0A 2E9VA 3FBVA 4YHTA 4QMYA 4EHZA 5A4QA 3PVWA 1JSUA 3OTVA 4HCVA 5LMBA 3ZFYA 2B0QA 5EHOA 2F9GA 1JSVA 2R3IA 4XBUA 4DH5A 2W1IA 4JQ7A 4ACHA 5B2MA 2OF2A 3Q96A 1ST0A 2CGXA 3BLRA 1XBBA 3I0QA 4GKHA 3HP2A 3E64A 3PYYA 4IB3A