4IB0A

X-ray structure of camp dependent protein kinase a in complex with high na+ concentration, adp and phosphorylated peptide psp20
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
337
structure length
334
Chain Sequence
b'SVKEFLAKAKEDFLKKWETPSQNTAQLDQFDRIKTLGTGSFGRVMLVKHKESGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVAGGEMFSHLRRIGRFEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFTEF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cAMP-dependent protein kinase catalytic subunit alpha
publication title Metal-Free cAMP-Dependent Protein Kinase Can Catalyze Phosphoryl Transfer.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase/peptide
total genus 106
structure length 334
sequence length 337
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2012-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4ib0A01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4ib0A02
3PIXA 4JXFA 2HELA 1K3AA 3SX9A 1UNHA 4PDOA 5I9ZA 4DEIA 3HKOA 4S30A 4I24A 5JKGA 3QRJA 2WD1A 4FT7A 3MWUA 2OH4A 3DKCA 2XZSA 3MB7A 3JR1A 2NNWB 3QUPA 3W8LA 3I7BA 2UZEA 3A2CA 3UIBA 3EN5A 1ZMUA 3FZSA 4X2KA 1YXXA 2WFYA 5DGZA 2FVDA 3VBYA 5AM7A 2XP2A 5CEMA 4FKQA 1UU3A 2G1TA 2R64A 4B7TA 2XS0A 2R3JA 4F64A 3ZLXA 5ITAA 2ZM1A 4BCFA 3R1QA 3PRFA 5IUIA 3F7ZA 4F0GA 3P08A 4EQCA 4EH6A 3TZMA 4CV8A 4JAIA 4MXOA 4AW0A 2YCQA 4L7SA 4TY1A 4FGBA 3QBNA 2P4IA 3LCSA 3QA8A 2PVMA 4B9DA 2RG6A 4MH7A 2IVTA 3BE9A 3K54A 3COKA 2BKKA 4J97A 3V6SA 3U6IA 4OTWA 3KXHA 3FKNA 3E5AA 5EYDA 5HI2A 4EBVA 1YXSA 4O7SA 4DH8A 2PZ5A 4BDDA 3SRVB 2QC6A 3Q5IA 2X7OA 3FDNA 5L8KA 2VN9A 3QCQA 1XH8A 5FTOA 3VBQA 1XH6A 3I79A 1O6YA 4G3DA 5H8EA 3WF6A 4ACHA 4CMTA 4MD8E 2X6DA 2OJJA 3PG3A 4QP9A 4ZK5A 3UG2A 3PSBA 5FD2A 5CF5A 4D0XA 3VS1A 3DBCA 4HPUE 1FVTA 5EHOA 4X2FA 2GQGA 4BZOA 3OC1A 3DKGA 4EC9A 2J7TA 3IOKA 1MQ4A 4GIHA 1YXTA 2C6EA 1FOTA 2JFLA 3O23A 4ZJIA 3L8VA 3NX8A 4FSMA 1SM2A 2QG5A 4FEXA 2W17A 3BU3A 3IW6A 3OOGA 4AT5A 1PXPA 5DR2A 3SC1A 4QQJA 4C02A 2GSFA 3E62A 3R8LA 5GZ8A 4I93A 5HNIX 5JGDA 4I4FA 4A9SA 4OUCA 1FQ1B 2RFSA 4EH5A 2XNNA 5TKDA 5E91A 4IAKA 4O0RA 3MIAA 1K2PA 1Q97A 2DUVA 2QOOA 3WIGA 2ZV8A 4DFUA 4Y85A 5IDPA 3WE8A 2YHVA 2IVSA 3CJGA 3IW5A 3OEFX 3UMWA 5AP3A 3KMMA 1U54A 3BCEA 4LL0A 3ZLSA 4EBWA 5B2MA 3EN6A 3TL8A 4E7WA 2UW3A 5DIAA 2VTPA 3BV2A 4PDSA 1YXUA 2JKQA 4LOPA 5TF9A 4L6QA 1W84A 2V22A 2IVUA 4EK5A 3QQLA 3WARA 2J5EA 3C13A 3Q4CA 4IX4A 3CJFA 3PSDA 3OY3A 3EWHA 4H3PA 3L8PA 4LRJA 4RJ8A 2QOIA 2OIDA 3LFFA 4N0SA 3ZMMA 1OB3A 4Y95A 5IA1A 4FICA 3V5QA 4MXZA 3PLAE 3R1SA 4L01A 3TACA 4HCTA 4PNIA 4FL2A 2UZWE 4EQUA 3E64A 5L6PA 4AZSA 4BDJA 5JEBA 1CMKE 2XF0A 4JX3A 5EQPA 1OUYA 3ZHPC 4KB8A 3F3TA 3EOCA 4YC6A 4NWMA 5HG7A 4DBNA 2JIIA 4UV0A 2CPKE 3E7OA 3T3UA 4F65A 3GCVA 2VNYA 1XH9A 4P5QA 1JAMA 2BFYA 3ULIA 3EB0A 2Z7QA 2VAGA 3LCKA 2VX3A 3DQWA 3I81A 4FKTA 3DKFA 3V04A 4C4JA 5HE0A 5HIBA 1WVWA 5DVRA 4A4LA 2ZV2A 2GHGA 4I20A 3PLSA 4B4LA 3QC4A 3ZRMA 5M51A 4AZFA 5GJFA 4BCJA 2X9EA 4E1ZA 2NO3A 4RT7A 4GK4A 3VIDA 1DI9A 1XH4A 5AEPA 5BUIA 2F57A 1GY3A 3MFRA 3OVVA 3CCNA 4J8MA 4DINA 5C03A 4M69A 5EDPA 3AGLA 3KMUA 5AJQA 5JSMA 2PL0A 4FV8A 3ZCLA 4ZZNA 3OP5A 4G3FA 4EJNA 3KL8A 1TKIA 3BGPA 3H10A 5HU9A 2YZLA 4D1SA 3MPMA 1WCCA 2YM8A 3F3VA 4M67A 5GNKA 2QR8A 2QOFA 4ZXTA 2FO0A 3QD0A 3GU5A 4K33A 3E8NA 4BDGA 3BKBA 4G9RA 2J50A 4XG9A 4BTMA 2XIXA 4OW8A 1VJYA 2GS2A 4LM5A 1JNKA 4ACDA 5IU2A 4USFA 3WZJA 4PRJA 3RP9A 3U4WA 4CXAA 5AV3A 5EOLA 1VZOA 1YHWA 2GNFA 4WNPA 1O6LA 1GZKA 4AN3A 4KRDA 5HBEA 3RCDA 4BI1A 5ANDA 4E4LA 4FI1A 4NKSA 5HX8A 3KXGA 2JEDA 4RA5A 5EDQA 5E1EA 5ICPA 4K11A 2QKWB 4ZEGA 4GJ3A 1QPCA 4PWNA 2ESMA 4EEVA 3E3PA 2AUHA 3KK9A 3CQEA 2I6LA 4J7BA 4X7QA 4AW1A 5DFPA 2OIQA 1MRVA 4FYNA 3PIYA 5GJGA 3I60A 1ND4A 3QAME 2W5AA 3QUEA 4BCOA 5CF4A 1MP8A 3AMYA 5HO7A 4B6LA 2YCRA 4FTRA 1E9HA 2CLQA 2WQBA 4F6SA 4K18A 2R3FA 3LKMA 4UWBA 4U5JA 4LRMA 4O0UA 4M0YA 4D4YA 2PZRA 3UIXA 3KF7A 3QHWA 4MBIA 3I6UA 3UO5A 2FSOX 3M1SA 5ANKA 4DE4A 3G0FA 4OAVB 2ITUA 4XV9A 5IKWA 3ZFMA 3DTCA 4MXXA 3GU4A 2GFCA 3R63A 5FLFA 3WILA 4BC6A 5BQ0A 5TO8A 5IQIA 4YLLA 1ZOGA 4XG3A 3Q6WA 5GJDA 2C6TA 4HNFA 3P79A 4GT3A 1Q62A 4BKZA 2AYPA 3BU6A 3O50A 2W1EA 3FKLA 4W4WA 4XG7A 3VBXA 4A4OA 3UZRA 3C5UA 3ACJA 3LXPA 4P4CA 4QTEA 3P9JA 3FMDA 5JGAA 5J9ZA 4FSNA 5BUEA 5AM6A 2QR7A 3LXNA 2C6IA 4FKRA 2BCJA 5EKNA 3NS9A 4IX3A 2WELA 2B52A 4RJ3A 3R7VA 4YZDA 3F69A 3M42A 2WQMA 1H08A 4WOVA 1WVXA 2CGXA 4K0YA 2YACA 1LR4A 3TG1A 1O6KA 4PUZA 4HGTA 5EYKA 4DEGA 3PVBA 2C0IA 4O6EA 3R8PA 3Q4TA 3RBWA 5B2KA 3UG1A 5KO1A 3PY3A 4FTIA 4DFYA 5AIRA 5FM3A 2W1ZA 3P4KA 5CQUA 4DEEA 3LAUA 3OWLA 2VWZA 4EWHA 3VF9A 5DH3A 2GTNA 3HYHA 3LMHA 3TDWA 3RVGA 4BHNA 3QTRA 3WE4A 3KMWA 4M69B 3ORZA 2OK1A 4L3JA 3QX2A 4R8QA 5FDPA 3ZDIA 4G6NA 1ZWSA 4BCIA 2UZOA 2JGZA 3LCTA 2WTWA 3OS3A 4FUYA 3BYUA 2WU7A 1KSWA 2GDOA 3QYZA 3ZFXA 2W5BA 2WTCA 4J96A 5AP1A 4TNDA 2VTTA 3OXTA 4CKJA 5BYYA 2W1IA 4C3PA 4QP2A 2XNGA 2C6MA 4OBPA 3E63A 4AFJA 5HIEA 2Q0NA 2CNQA 3DBQA 3GOKA 4ZJVA 4RX8A 4RIXA 3VRZA 3ZLYA 4QNAA 3HRBA 4M13A 4PF4A 2BR1A 1SNXA 4QOXA 2YJRA 3DCVA 4AGDA 3CD8A 2LGCA 2HW6A 3ODZX 5I9XA 4S34A 2AC3A 4E93A 2H6DA 3SAYA 3ANQA 3W2SA 4APPA 3D5VA 1JWHA 1JKLA 4GJ2A 4YNEA 5T68A 3RAHA 3TV7A 4ACCA 4HPTE 4TKSA 3ZRLA 4ANLA 4FZ7A 4C38A 3HUBA 2QNJA 2R3HA 3MSSA 3R8UA 3ZBFA 2CKQA 5AUYA 2ONLC 3NAXA 3GENA 4ERKA 2J4ZA 4CD0A 3BHTA 1ZY5A 4ZSEA 4F70A 5KCVA 5DLSA 4NCTA 2HZIA 3BLQA 2B54A 4YBJA 5ETCA 1W83A 1RDQE 4BCPA 4F0FA 4RLKA 2YN8A 4BIBA 2VWWA 3S95A 2W06A 2QOQA 2W99B 3K5UA 5DEYA 2BPMA 4KABA 4RPVA 4XV2A 4I21A 5ANIA 2OBJA 4CZYB 3C0HA 1NT2A 3ZO2A 3U8WA 4QNYA 3UOHA 1S9JA 4IDVA 3G9LX 4F7NA 1PYEA 4R3PA 3NUAA 1H07A 4JDHA 4EYJA 5IQBA 3JYAA 4AGCA 3R04A 4GH2A 3B2TA 3DFAA 3Q2JA 4RWJA 4F7LA 2Y4IB 5AR8A 2RKUA 3IKAA 1DI8A 2XK8A 3UQCA 3AC3A 4GYIA 4BCHA 2C5VA 3TCPA 4CNHA 2XNEA 5EI6A 3QLGA 1GIHA 5A3XA 4BGGA 1WAKA 1H1WA 3OWKA 4ITHA 2J6MA 5CQWA 5IG1A 1VYWA 4I23A 1TQIA 2XK3A 4K2RA 5D1JA 4LUDA 3I5NA 4FNXA 4OLIA 4GUBA 4C0TA 3N9XA 3EQCA 4I5PA 4JG8A 3RPYA 2QKRA 5CZIA 3CBLA 4G2FA 3P23A 4FKPA 2J0MB 5J8IA 4Z55A 3C4WA 4PL5A 3Q9XA 2VTSA 4IDTA 3RK9A 4YU2A 4FOCA 5DPVA 4JBQA 5HNBA 2BROA 3TN8A 4MK0A 3TUBA 3HV3A 2VX0A 3MY1A 1ZYJA 2OKRA 4YSJA 3TM0A 4JI9A 3Q32A 4AU8A 5EI2A 3CQWA 3FC2A 3OY1A 5AUZA 3E8CA 5HEZA 4ZMFA 3QRIA 4O0XA 4C4IA 3LW0A 2ITNA 2W05A 4D2RA 2C3JA 4IWDA 5E90A 5T6KA 3RI1A 2X7GA 5E7RA 3VW8A 4F9BA 2CJMA 1P14A 3GCSA 3R22A 4YHFA 4QP3A 3LJ1A 2OSCA 3D4QA 4MWHA 3EFWA 4D2TA 4AWIA 4EORA 4WNMA 4F0IA 5JZJA 3LQ8A 2WAJA 4FV4A 3RAWA 4OBQA 4CFVA 4BY9E 1YI4A 2Z7LA 4UALA 4RIXB 2ITQA 2PMOX 1VYZA 3UVRA 2XYUA 3H9FA 3CPBA 4RJ5A 3RZFA 2PUIA 5JFWA 4MF0A 4MX9A 2X0GA 4TT7A 5HTCA 4ZS4A 4IAIA 1GZ8A 2Z2WA 4HVDA 1IG1A 2XNMA 4XP2A 4ASEA 3IGOA 1UVRA 4YPDA 3CSVA 3I7CA 4XOZA 3LM0A 3FUPA 5AUXA 5AP0A 4FNYA 3WF5A 4I3ZA 5E8ZA 2R3PA 2Y6MA 4D58A 3ENHA 4BCGA 2BHHA 2A19B 3VNTA 3F9NA 5CU2A 4FG7A 5B7VA 4DAWA 5HKMA 2GHLA 4MNFA 4QP1A 3UPXA 1PXLA 3A62A 5F94A 2HIWA 3EQGA 4V04A 1XH5A 3JVRA 1PKDA 5CLPA 1RE8A 4CV9A 4DTAA 2JKMA 3MBLA 3QQHA 4FSTA 4MKCA 3COHA 4LMNA 2HK5A 3Q6UA 4CFFA 2WU6A 3NRMA 3R9OA 4ZAUA 5F9EA 5IZFA 3FMJA 4R6VA 2CCHA 4NJ3A 5CALA 4QTCA 2J5FA 2WEIA 3M11A 4DN5A 3GI3A 2FGIA 3PYYA 5CAQA 3QA0A 3I0OA 3MY5A 4E6DA 2B9IA 4RRVA 2C68A 5A14A 2WNTA 5JFSA 2R0IA 4IBMA 4A9YA 4AT3A 2W96B 4GG7A 3UPZA 4DEHA 3W2OA 3AT4A 2G9XA 3IS5A 4BDBA 3KULA 1W0XC 2OJIA 2BRGA 4DEBA 1O9UA 5LWNA 3SV0A 4CLJA 5M53A 1LEZA 5AP6A 1FVVA 4YHTA 2BDFA 4ANMA 3QTQA 5AMNA 3SOAA 3ZBXA 2UW6A 2PTKA 3EMGA 2WMVA 4MEDA 3Q04A 3O7LB 1CDKA 3DLZA 2WB8A 4M3QA 2YIXA 3B2WA 3K5VA 4FKLA 3VW6A 4DG2E 5IA3A 3GP0A 3G5DA 1Q24A 4NM5A 3VHEA 1L3RE 3SDJA 4YZNA 3VF8A 4AGUA 2ZB1A 2QU6A 4E73A 4PPBA 3ERKA 4YO4A 3MDYA 1FMKA 1REKA 3F3WA 3SG9A 1UA2A 3D83A 3A99A 4ZS0A 2YM5A 3PTGA 3KKVA 2OGVA 3R7IA 4YUQA 5LVPA 4NYEA 2QO2A 4I6BA 3MPTA 5HTBA 5IQAA 1BI7A 2VO7A 2JDOA 4C7TA 1J1BA 3WZUA 5CYIA 1BL7A 4TXCA 5E8UA 4F6WA 4IWQA 4EZ3A 2GHMA 3B8RA 1YW2A 3RK5A 4DCEA 4UMRA 4Y8DA 4F9AA 1RQQA 1QCFA 1UNGA 5AA8A 1KV2A 4KKHA 3BQCA 4HNIA 4L3LA 2WIHA 1PW2A 4ZTSA 4FEVA 3RHKA 3WOWA 3M2WA 5LMKA 2OZOA 4BVUA 4F1MA 4XS2A 4PX6A 3D9VA 4H1JA 3CS9A 1PMVA 4S31A 3DK3A 4F63A 5CSPA 4EQMA 3SQQA 4EK6A 4AQCA 2VTIA 2C5XA 3KRJA 3WYXA 3G15A 5E8XA 3G6HA 3KXMA 3C7QA 4IAAA 1U59A 4IAYA 4ITIA 4R1YA 5HIDA 3A4OX 1W8CA 3ZC6A 4A9RA 3ZFYA 1F5QA 5AAEA 2IW6A 2C30A 3U6JA 4YJNA 2PUUA 4MAOA 3D5XA 4H05A 2OLCA 4YLKA 2OWBA 3TNWA 5CT7A 4FG8A 3I1AA 4WBBB 4EK3A 2QQ7A 4FSZA 4NM0A 2R3KA 3FZOA 5FQDC 2XA4A 3FY2A 1TQMA 2PVLA 5G6VA 3D7TA 4WG5A 3RHXA 4GIIA 4D5KA 5EHYA 2XB7A 3FXZA 4BDHA 4EONA 1T45A 4Q9SA 2P3GX 1DAYA 4DTKA 4ZLOA 3MTLA 4L9IA 1WBOA 3UC4A 4EC8A 4FSUA 4DH1A 4JBVA 1PRYA 4YBKA 4ANNA 1CTPE 2NPQA 3JPVA 4E20A 3Q3BA 3RM7A 3TZ7A 4ZLZA 3LOKA 2PMIA 1SZMA 5CSWA 5E8TA 2XIYA 3KXXA 3QRTA 4W8DA 4M7IA 4BDFA 4D2WA 3KVWA 1OL2A 4CEGA 5GINE 1H00A 3LQ3A 2ZOQA 3FQEA 2BZHB 3IW8A 4HGLA 4RG0A 2ZAZA 3IW7A 5FP6A 2EB2A 3NEWA 1T46A 2UUEA 4FVPA 3RKBA 1YI3A 2OW3A 1WVYA 2WTKC 4AG8A 1UU7A 4BKYA 3QKKA 5JRSA 5E9EA 3MY0A 4M15A 4O6LA 4ORKA 2DQ7X 4NU1A 4BGHA 4ZY5A 2JLDA 4I6HA 3HA6A 3R8VA 3JVSA 3KULB 3HMIA 3ZXTA 5IQCA 2ITZA 3SOCA 4FG9A 4AE6A 3A7IA 3TIYA 2G2FA 2F4JA 1GIIA 4S32A 2QU5A 2UW9A 3F2RA 3V5TA 3MIYA 3C50A 3CC6A 3LZBA 5HCYA 3O8TA 2J0JA 1W98A 2VTRA 4L00A 1MRUA 3IG7A 4FEQA 3N4VA 3ACKA 5AV1A 4JOAA 4ACGA 5D7VA 5EW9A 5M55A 2YWVA 2CSNA 3NLBA 3L9MA 2CN5A 4NW6A 4HVHA 4OAUC 4QQTA 5CY3A 1OMWA 5IPJA 3FC1X 4Y5HA 5EDRA 3ZTXA 3DU8A 4BBMA 3PUPA 4XV1A 3NMUF 3ZO4A 4RFZA 2QOBA 4P7EA 4N57A 4IAZA 3W2CA 4R5YA 2XIRA 4QYHA 2BTSA 3P7AA 5D9HA 5DHJA 4GL9A 4IC8A 5EH0A 4BIDA 4EH3A 3CTHA 3GOPA 4YJVA 4YJOA 1Q4LA 4J98A 5LVNA 4KUJA 4CYIA 2BUJA 1FINA 3NCZA 1MUOA 5CEIA 4GYGA 3ZSHA 2O3PA 5EI8A 1H26A 4AN2A 1I44A 1M52A 4BBEA 1GAGA 3BRBA 3LPBA 1Z5MA 2UVZA 2OH0E 2HENA 2XM9A 3QFVA 1JQHA 4I0RA 4ONAA 3DNDA 5D11A 2WTDA 3RAIA 4F9YA 3R1YA 4NUSA 3UIUA 3V5LA 4GT4A 5FWKK 4GS6A 5L8JA 5L2WA 2HAKA 5TT7A 4EI4A 5CNOA 3NNXA 3ZC5A 3R1NA 3UVQA 4BDCA 4PDYA 4BFMA 3ZU7A 1BX6A 4M12A 2O2UA 3SKCA 3OXZA 2HWOA 3I6WA 4KWPA 4UEUA 3TKIA 5IA2A 3DK6A 3D0EA 3IONA 4KS8A 4MBJA 5K0XA 5AWMA 4F1OA 4D2SA 3MFUA 2BZKB 2B1PA 1V0PA 2YM7A 4C59A 3PVWA 4YTFA 2ERZE 1CKJA 4PPAA 3VQHA 4WRGA 5M06A 3D7ZA 3D7TB 3GCQA 3DGKA 3SG8A 1M2RA 2QLUA 1OECA 4LGDA 2WMBA 3OW3A 1TVOA 4DH3A 1XWSA 4QMLA 3PP0A 4D28A 4YP8A 3HDMA 3DBFA 3S2PA 2W9FB 4RJ7A 4FTLA 3OBGA 3MYGA 4F4PA 3I4BA 1OVEA 5BVEA 3T9TA 4BCNA 3EQPA 4DGGA 1QPDA 3RNIA 1Y6AA 2FSMX 2IZSA 3U51A 4C4EA 2XYNA 3IECA 5K0KA 3C51A 4FYOA 5H9BA 2CGWA 1Z57A 4GEOA 3AC4A 4LUEA 4QTBA 1KE6A 3IGGA 3F5XA 5CI7A 2R3LA 2JAMA 4FZFB 1OIYA 3W8QA 3DAJA 3ZUVA 1W82A 2WTJA 1HCKA 3WF7A 4NJDA 3QD2B 2XCHA 3BE2A 3S0OA 2RL5A 5F95A 3TV4A 5KZIA 5DA3A 3ZZWA 4A07A 3SW4A 1VR2A 4D5HA 5FBNC 2H9VA 3R8ZA 2OJGA 4XLVA 1H1PA 4BTJA 3HVCA 3MA6A 2BZIB 3VUIA 2F7ZE 3PE1A 4WUNA 1LPUA 3NYXA 4KIPA 4C3FA 5JH6A 1BUHA 4J95A 1LP4A 5EFQA 4XX9A 3VUDA 4GKIA 5IQFA 4JG6A 4QMZA 1NVRA 2ZVAA 4RIOA 5C8MA 1PMNA 3LCDA 2RSVA 1CM8A 4IHPA 3JY9A 3DB6A 3DKOA 4TTHB 4RSSA 4HVSA 3LXKA 4EOOA 3O51A 3ORPA 1B38A 3F66A 3HAMA 4YLJA 1OKVA 3QF9A 4NM3A 2YLFA 4KD1A 5AP7A 3BX5A 3NUPA 5J95A 5IH6A 1Z9XA 4BHZA 3GCPA 4C3RA 3FLYA 4OTPA 2GNGA 1QMZA 4CGAA 3JS2A 3NW7A 4E3CA 1Q8TA 5BUJA 3R9NA 1TQPA 2JAVA 4FK6A 5E4HA 2HY81 3K3IA 4Y5QA 4L53A 3OCSA 4S2ZA 2CMWA 2W4JA 3R7EA 2QHNA 4JBPA 5J9LA 2R2PA 4DA5A 2H8HA 4CKRA 2XJ1A 3ORLA 5HE2A 3NNWA 3AOXA 1FMOE 3VN9A 2HOGA 3AQVA 3A7HA 4IMYA 2A2AA 3B8QA 3EQFA 3LFBA 4WNOA 1KE7A 4BWXA 1J1CA 2BRHA 3DNEA 4E5WA 4DFBA 3FPMA 2BAKA 5A4TA 4OTRA 3WIKA 4ZTMA 2I0YA 3G0EA 5LVMA 4MXYA 4HGSA 5IMXA 4KS7A 3RWPA 3KF4A 3E88A 3V51A 4KBAA 1XKKA 4WG4A 2F49A 4LRKA 5EM7A 4XG4A 1SVEA 5J7BA 3EZRA 4G3CA 4DCAA 3Q60A 5JT2A 2O63A 1PKGA 5DMZA 4G6LA 4UYNA 3UNJA 2R5TA 4I5HA 2WIPA 2VO3A 1H8FA 1K9AA 5J79A 3VBWA 3F5UA 1BLXA 4WRSA 2WMWA 3W33A 1REJA 2IJMA 4ZIMA 1XBAA 3DB8A 1J7IA 4Q2AA 4WHZA 4FV0A 2XBJA 3KRWA 2C3IB 2UW7A 4IWOA 3RM6A 1YOMA 3NUYA 4XYFA 3FLQA 4ITJA 5EG3A 3OF0A 2PMNX 2F7EE 2YEXA 3CPCA 3H0YA 4FSWA 2WTVA 4JL9A 4IM2A 2O5KA 4IE9A 5M4IA 4DC2A 3FPQA 3F3ZA 3ZS5A 5CEQA 1DS5A 3TV6A 3TNPC 4O81A 3TI1A 3FMKA 3FQHA 1ZARA 2YM3A 3DBDA 3W16A 5I4NA 4J8NA 5LXMA 5M57A 4GUEA 4LV5A 4D1ZA 4JRNA 2CNVA 2WMTA 5DRBA 4CT1A 4O0YA 4E26A 5A4EA 5FTGA 4FKWA 4WA9A 3NSZA 5F20A 1H1SA 3QKMA 3AD6A 1GZOA 4N6ZA 4NW5A 5CSXA 4CRLA 2R3IA 4JQEA 2G15A 2ZM4A 4HJOA 1AD5A 1ZYDA 2BZJA 4JVGA 3A4PA 3HEGA 4RVMA 2B55A 4X6QC 3TZ8A 1J3HA 4FVRA 3ULZA 1R78A 5LWMA 5HO6A 5IUGA 3W2PA 1Q5KA 3BEGA 5CF8A 5G1XA 2PVNA 2V7OA 4CCBA 4WO5A 4F08A 5L4QA 3GFWA 3MFTA 3MFSA 2UW8A 4F6UA 2JKOA 3BGZA 2J0LA 2YISA 4Z9LA 1JSUA 3V5PA 1H24A 2UZNA 5HESA 4C4GA 3FXXA 3K3JA 3CTJA 4IADA 4ACMA 1LUFA 2X6EA 1EH4A 3CKWA 5KNJA 3E87A 2VUWA 4BCKA 4EOMA 5D12A 4YNOA 5CU0A 1R0EA 3EL8A 2VWXA 4XEYA 3FEGA 2DYLA 2OFVA 4M84A 4TPTA 3DJ7A 4NFMA 4CLIA 3C4CA 4D0WA 4F7JA 3U54A 2XJ0A 4X2JA 5I9WA 1YQJA 3QTUA 1PY5A 3HP5A 4IB0A 4FTTA 1M7QA 3DZOA 4X2GA 3R73A 2X4FA 5LMAA 5H8BA 4FTNA 1OI9A 3GQLA 2BALA 3NUSA 4I5CA 3ZYAA 4B8LA 3OMVA 2C0TA 2E9UA 1PHKA 4ANOA 4ZSGA 1IAHA 3QQGA 3V01A 2JDRA 4GCJA 2I7QA 4C62A 4FOBA 2ERKA 2J0KA 2X1NA 1Y91A 4EZ7A 3KEXA 3DTWA 3G33A 4RWLA 4TWCA 4UWYA 4O7RA 2GNLA 3DJ6A 1OM1A 2YZAA 4FVQA 3UVPA 3MH0A 3R0TA 3GEQA 3KRRA 3ZXZA 5HVJA 3NPCA 2QLQA 5K4IA 3QCYA 3ODYX 2GQSA 4AXAA 2IWIA 3R83A 3O8PA 4UY9A 4OTFA 1ZMVA 2NRUA 4HZRA 4DEDA 4OTHA 4BN1A 4HCUA 4A06A 3EQIA 4FZ6A 4AX8A 3RCJA 1JKTA 3AXWA 3ROCA 1BMKA 4BKJA 3GUBA 3MW1A 5GHVA 3HNGA 2XVDA 4JAJA 4W4XA 4CFUA 4FT0A 4QPAA 3EN7A 4IM0A 4R78A 2OICA 2IVVA 1UV5A 2X2KA 4I5MA 5HGIA 4Q5HA 3R7OA 4ZZOA 1P4OA 4V01A 3E8EA 4JG7A 2WKMA 4QQ5A 3AT3A 1UKIA 3EHAA 1OIRA 4KRCA 4RX7A 2O65A 2I1MA 3P7BA 5ETIA 2HZ4A 2OXDA 2WMSA 5CX9A 5DR6A 4E6CA 5C26A 2EXCX 2HXQA 3Q52A 3W55A 4FIHA 4JX7A 1JSVA 1RW8A 4QT1A 1W7HA 1OPKA 3G6GA 1NVQA 3DDPA 4PL3A 4DITA 5DT4A 5BMSA 4W4YA 4FT3A 4ZTRA 4FV2A 5I9VA 2VTAA 2R0UA 4QP4A 3HMMA 4W9WA 3UP2A 4FNZA 4BYJA 3PSCA 4QMQA 3QWJA 4RC2A 3UQGA 4YC8A 5M4FA 1ZMWA 2BRBA 4U80A 4QP6A 4OTDA 4B0GA 4EHVA 3TUDA 4JNWA 4NH1A 1OBDA 1VEBA 5HNGA 4FGRA 4H1MA 2VX1A 3TJDA 3NYOA 1BL6A 2BAJA 3TEIA 3ZOSA 3Q9WA 1YDRE 3SXSA 3QTWA 1BI8A 3KK8A 3UQFA 2UVYA 3H9OA 3E7VA 3EKNA 3MH2A 1ATPE 5HICA 2E9VA 3C0GA 3F5PA 3PIZA 5HVYA 4RJ4A 4QMNA 4K8AA 4ZSJA 4FTUA 3QZFA 3R9RA 2QO9A 2C1AA 3OFMA 5CF6A 4RQKA 2R7BA 3UP7A 2UZBA 3L9NA 5BVKA 4ENYA 4W8EA 5BPYA 3C9WA 4I0TA 2PE1A 4PY1A 3ZUUA 4DG3E 5AP4A 3LJ2A 3ZEPA 4A9TA 4AA0A 4G9CA 5LMBA 4O7VA 4DT8A 4GK3A 4QYFA 3POZA 3VS7A 4YTHA 3F2AA 3FXWA 1OKYA 2Y4IC 3ROYA 2YA9A 4CG8A 3ZLWA 5AUUA 3ID6C 2C69A 3NYVA 4C36A 1U5QA 3DOGA 4XMOA 5HLWA 2Z60A 5L2TA 1JKKA 3MS9A 2C1BA 3QZIA 4U9AA 2X7FA 3JY0A 3PFQA 2VTNA 4LQMA 4O0WA 5CEOA 5JMSA 4AAAA 4MYGA 4FT5A 3LFEA 5CXZA 3F61A 2WHBA 2O64A 3CEKA 4EHZA 3KREA 4RJ6A 3W2QA 2C6OA 2B53A 5FM2A 1IAJA 2W9ZB 2HWPA 2XUUA 3LMGA 4JLCA 4PMTA 3R2BA 1OITA 4TYIA 4YZ9A 4BCQA 5EYMA 4C34A 5BNJA 2YWPA 1UU8A 5M56A 4BF2A 2O8YA 2VTOA 3IPHA 4FV3A 4JJRA 3IDPA 3CQUA 4XV3A 5A54A 3R30A 3P0MA 4LGGA 5H3QA 5B2LA 3PZEA 4IFCA 1XR1A 3DK7A 4V0GA 5CAVA 2PUNA 3TDVA 5IMEA 3HRCA 1FGKA 5CVFA 5DR9A 3FI8A 2P2IA 3RPSA 1YHVA 3DQXA 1SNUA 2PE2A 3IDCA 5CZHA 4PPCA 5ANEA 3LLTA 4KIKA 4QRCA 5AV4A 2X8EA 3PE2A 4O21A 4FKIA 3C4XA 4JS8A 5A6NA 3HP2A 5JK3A 2A27A 3R21A 5M4UA 4XNEA 1J91A 4KNBA 4XH6A 4WG3A 5ACBC 2QHMA 3COIA 4D55A 2UZUE 4AUAA 1U46A 3DAKA 4EOKA 3TT0A 4JDIA 2X8IA 1WBNA 4IZ5A 4X21A 5A4QA 4O84A 4PMPA 4X2NA 1GNGA 2PULA 2W1DA 1RJBA 4TYJA 5DG5A 4TYEA 2KTYA 5IEYA 3GBZA 3WZEA 4R7IA 4O96A 5AR5A 5AIKA 3WZKA 1Q3WA 4EJ7A 4R7BA 3QQJA 4RFMA 3V8TA 4EH4A 4GRBA 3UZPA 3P7CA 4G16A 1WBWA 4FSQA 4U40A 2XEYA 3RZBA 3R2YA 2ZM3A 2XRWA 3F7WA 3LJ0A 4NCTC 2YJSA 3QC9A 3PJ3A 3BHYA 4GVJA 4M8TA 4AN9A 5J5SA 4FTCA 2AC5A 2VO0A 3UOJA 3VUKA 4U3YA 4V05A 4RGJA 3GC7A 4ALUA 2A4LA 3D14A 1XBCA 3H4JA 1V0OA 5IISA 4O7YA 5BVDA 2RFNA 4AT4A 3UJGA 1OIQA 4QPSA 3F3UA 2EUFB 3DBEA 4L44A 2YIRA 5C9CA 3T9IA 5E8VA 4J71A 4AACA 1ZOHA 3QZHA 3CIKA 4ARKA 4UB7A 3TZ9A 5C4LA 2O0UA 5E1SA 1NVSA 5HQ0A 3E93A 3GC0A 5EOBA 4NT4A 4DEAA 4IEBA 5A4CA 2QVSE 4BDKA 3BZ3A 4UX9A 1XO2B 4N4SA 4AW5A 5T3QA 2GNJA 3VUMA 3IDBA 2R9SA 3RTPA 5EHLA 2W1CA 3U87A 1FVRA 3VJOA 2WMQA 3ZRKA 4NKAA 1Y57A 4XG6A 4EOSA 2CKOA 5K9IA 3KU2A 2VTJA 3UTOA 3U4UA 3WZDA 5C1QB 4AZVA 4AF3A 1MQBA 2XKCA 4L46A 3QQKA 4F9CA 4USEA 4BGQA 4FKJA 4HCVA 3DLSA 2HYYA 4AP7A 4A4XA 3BWJA 1OKWA 4DGNA 4U44A 4GKHA 4EK4A 3ETAA 1Q3DA 5CAPA 2NRYA 1WBTA 4FIEA 4JR7A 2FA2A 5EM8A 4HZSA 3CXWA 4ID7A 2FYSA 5JZNA 4CZTA 5M09A 4C37A 4FSYA 3Q4ZA 4EOQA 3Q53A 4FV1A 4ZTNA 4L7FA 4CFMA 1YWVA 4AZTA 4Z7HA 4DT9A 3HMNA 3R00A 4ZLYA 4GU6A 5EQYA 3FMLA 3R01A 4WT6A 4UXQA 4ZTQA 3P86A 4AE9A 4EZ5A 4X3JA 5H8GA 4P5ZA 4CCUA 3KQ7A 4V0GB 5D10A 4ZSAA 3A7GA 3PA5A 1OUKA 4BI0A 3H9RA 4RQVA 3OCTA 3VUGA 4FNWA 2UVXA 3OUNB 3DAEA 4L8MA 4N70A 3UODA 4WUAA 2Y4PA 3MTFA 4QMMA 2KULA 4KIKB 4WKQA 4G1WA 4J52A 1NY3A 2PZIA 3EJ1A 2BDJA 3AG9A 3KN5A 3MVHA 2WQNA 4Z7GA 2ETRA 4R5SA 5CASA 3MESA 5L6OA 2WMXA 5AUWA 3AC5A 2YAKA 4KBCA 3W1FA 1UWJA 2BDWA 2QODA 2EVAA 2VU3A 2XK9A 4IQ6A 4LOQA 4DFNA 3FQSA 4EKKA 2C3LA 4IX5A 3S3IA 2QOHA 3SGCA 3VVHA 4RX5A 2CKEA 2HZNA 4M68A 4C35A 2V5QA 3NIZA 2UW0A 2WZJA 3C4EA 3BU5A 1AQ1A 2C47A 5C4KA 3ZSGA 4YJSA 5HLNA 4NK9A 3Q96A 4FF8A 3HX4A 5I5ZA 5JQ5A 3BGQA 3MPAA 4U41A 2IO6A 4FTKA 1URWA 2PWLA 4R7HA 2I0EA 4RWIA 5HHWA 1V1KA 3EFLA 2PVFA 3QGYA 2XKEA 3FYKX 3AD4A 3MV5A 3OZ6A 4FKOA 5BYZA 1YOLA 5CWZA 4YURA 4MNEA 5HTIA 3FYJX 1U4DA 4OTIA 5K5NA 5E8SA 4CVAA 1OKZA 3NVKI 4E8AA 4K9YA 3ZZEA 3GFEA 3TUCA 2X2LA 4DFLA 2PE0A 1YRPA 2RG5A 4AA4A 4I0SA 3HV7A 4W4VA 5HG9A 4ZY6A 2ZYBA 3V5JA 2ITVA 3ZONA 1E1XA 1BYGA 1SVHA 3QRUA 5LJJA 5KMLA 2PU8A 3QQUA 3S00A 4GFGA 2XK4A 4QQCA 4C33A 2R3QA 3AGMA 2WPAA 3SLSA 3GVUA 1CKPA 4U79A 3FKOA 3O17A 3V5WA 4EL9A 4UN0C 5C8KA 5CNNA 4C58A 2YM6A 3A7FA 3DXNA 1H25A 2B9HA 5FEQA 5HD4A 4G3GA 4L52A 5CENA 3R7YA 3FZPA 4TWPA 3VS4A 3ZUTA 4AZWA 3BHHA 5L2SA 3PP1A 1J7LA 5LMKC 3POOA 3HL7A 4TWNA 5J9YA 2XJ2A 3DDQA 4LI5A 3H3CA 5E92A 3PDTA 4H58A 3O0GA 1OZ1A 1QPJA 2ETKA 2DWBA 4YR8A 5HORA 5M08A 2QONA 4WNKA 4IFGA 3RK7A 4NZWB 4ASDA 4JIAA 3GC9A 3NWWA 1XQZA 3V3VA 2QG7A 4O27B 3OXIA 3N4UA 3PXFA 4QYYA 3QCSA 3BI6A 2OO8X 5CU4A 2PUPA 4FL3A 4G5JA 4BRXA 4DG0E 4PP7A 3ALNA 3VS3A 5FEEA 4KSQA 1A48A 4XLIA 3EL7A 4LL5A 3EFJA 1ZAOA 3LQ5A 3AC2A 4O2PA 5FDXA 1CKIA 3FJQE 2ZV9A 4LV8A 4ALVA 4CMUA 3A8WA 3MVLA 4HOKA 3ENMA 4JDKA 1JBPE 1S9IA 4AZEA 4CQGA 5ANOA 5KMKA 4BWKA 2HCKA 3NDMA 2W0JA 4Y83A 3CLYA 4XJ0A 5FGKA 1Q8ZA 2GFSA 4XG8A 4PMMA 4Z16A 5BVFA 2V7AA 5FXQA 3F6XA 5AP5A 4HVIA 2X39A 1ZOEA 3E8DA 3L1SA 3KCKA 4GV1A 3LMIA 4XP3A 3CE3A 4GW8A 4CZUA 4J1RA 2OJFE 5HOAA 3E3BX 4HYSA 3UNZA 1ZYCA 2JDVA 3JUHA 4FV9A 3UO6A 3LHJA 2JKKA 4PTCA 4XBUA 1UKHA 5ANJA 3CTQA 2RFDA 5ANGA 1M2PA 3FL4A 2Y7JA 5J7HA 3PWDA 3ORTA 4BYIA 3KC3A 1APME 3G90X 3QD3A 4EH7A 2G2HA 5CXHA 2P2HA 4EYMA 4PNKA 2IN6A 2WOTA 3PY1A 2WEVA 5EM6A 1QL6A 2IZTA 3FSFA 3LVPA 3OBJA 4IJ9A 4KIOA 3R9HA 4NTTA 3LFSA 4RIWA 4ZSLA 5CT0A 3PVGA 4DTBA 4U3ZA 4MNEB 3OD6X 2OF4A 4IANA 4OTQA 4FTOA 4II5A 3V8SA 3A8XA 5HLPA 1PXNA 4Q9ZA 1J7UA 1HOWA 2ZDTA 2G2IA 4CG9A 4FEUA 5HBHA 1ZYLA 5ACKA 3TTJA 3AMBA 4FKGA 3CD3A 5AP2A 4UMUA 3D2KA 4I41A 1H0WA 4ZMEA 3ZM4A 4DBXA 1PXJA 2B4SB 4MHAA 5AFVA 5AR3A 4YZCA 1YKRA 4XP0A 2OIBA 3OTVA 3HLLA 3MH1A 3VBTA 3VULA 4EOJA 4M14A 2I0HA 4FE2A 3LFAA 3RPVA 5IUHA 2GQRA 3FZTA 3QZGA 4RMZA 4IWPA 4X3FA 3V6RA 1DM2A 3DFCB 4ANBA 5M07A 5CS6A 3FLWA 3ZSIA 4CFNA 5K5XA 2LAVA 2XMYA 4FV5A 4IC7A 5BX0A 1IA8A 5E8YA 5KMIA 3OWJA 3MA3A 5IH5A 2R3OA 2XIKA 3R02A 4LGHA 2B7AA 2PVJA 5EYCA 4IACA 4R3RA 5CTPA 4ASXA 2OI4X 4JRVA 4QP7A 4CTBA 1ZZ2A 3ATTA 3TNQB 4F1TA 4KBKA 4DGOA 3VJNA 5DOSA 2P55A 4U97A 4ANSA 2FH9A 4RC4A 3PJCA 2WTIA 4WD5A 4NEUA 5AR7A 2F9GA 2CGUA 3EIDA 1Q61A 5EQEA 2XNPA 4DFXE 3TKUA 4IB3A 4OR5A 3V8WA 4FIFA 3MB6A 5HZNA 3ZM9A 1P4FA 1GOLA 1ZRZA 2C4GA 4YSMA 4O38A 4BI2A 5TOZA 1XH7A 3QHRA 4PMSA 4YTCA 4G6OA 2ITOA 3GB2A 1PJKA 2VZ6A 4CT2A 3VS2A 5LOHA 5C27A 4G34A 2J0IA 4ZY4A 4FSRA 2C5YA 2C6LA 1H27A 4L45A 4U81A 5FTQA 5JN2A 3HV5A 2FUMA 2UW5A 1YDSE 5CSHA 4D9UA 3OW4A 5L8LA 3FBVA 4PL4A 2I0VA 2VWBA 3C0IA 4XOYA 4QMVA 4GG5A 3HRFA 4B8MA 1JSTA 1IR3A 3T3VA 1NW1A 3VWAA 1WFCA 3MI9A 3FZ1A 3ORXA 4WSYA 5DRDA 5AUTA 4R77A 3EYHA 5CU6A 3QLFA 3ZEWA 3R6XA 3FMMA 3FZRA 2V0DA 4MWIA 2IW8A 5HBJA 4H3BA 5M4CA 3UZTA 4BR3A 4DH7A 1PXOA 1WMKA 2PY3A 1F0QA 3CP9A 4FV7A 3PA3A 4M0ZA 4UMTA 5KZ0A 1STCE 4Z3VA 4XCUA 3BLHA 4NTSA 4CMOA 4UWCA 3EQBA 1GIJA 4QPMA 1R0PA 1U5RA 3HMPA 4KSPA 4F99A 3MJ1A 3NGAA 4FZAB 4O91A 4ASZA 3UDBA 3CGOA 3QTZA 4O1PA 2V55A 3L9PA 3A7JA 3G2FA 3H30A 5DEWA 4O0VA 3QXPA 2Q83A 1P2AA 3F2NA 3W32A 3PXRA 5BVNA 3KFAA 2CHLA 3OWPA 1H1RA 3Q4UA 4C4HA 4IAFA 1FBNA 4C8BA 4DYMA 3BQRA 4RX9A 4RIWB 3OCGA 1WZYA 2GMXA 4AOIA 2ITTA 2WMUA 2PVHA 2Z7RA 4L43A 4BWPA 3DXQA 4ZZMA 4OT6A 3AC8A 2XK7A 2YCFA 1WBPA 4KIQA 5HE3A 4C2VA 1G3NA 2WMRA 4KKEA 4E6AA 2OF2A 2PK9A 3LE6A 2PZYA 2WO6A 3QTIA 4TYHA 4FKUA 4XHKB 3DV3A 4XRJA 2R3GA 3AC1A 2C5OA 4EOLA 4DGLC 3ZO3A 4ZJJA 3GU8A 3SVVA 2XM8A 5CVHA 2VRXA 4IB1A 3GQIA 1XHAA 3P5KA 4N6YA 5HX6A 2BRMA 2BAQA 3NZ0A 3O8UA 3PXZA 4TW9A 4D4SA 4IVDA 4X3FB 2F7XE 3DA6A 2VO6A 4TZRA 4PV0A 4X3FC 1Q8WA 2XH5A 1FPUA 3LM5A 3D2IA 5DWRA 1MRYA 3W10A 2WQEA 5L6WL 4D1XA 5CAUA 2BIYA 1YI6A 3MH3A 4FIGA 4JR3A 4LYNA 3LFCA 4OTGA 2W1FA 2GS6A 2QOKA 4BIEA 3ELJA 4AA5A 1M14A 3WYYA 4BBFA 1PMUA 2FB8A 3FI4A 2B0QA 3BYMA 3Q2MA 4FR4A 3QGWA 3II5A 3RINA 2C3KA 4O7TA 2JDSA 5CSVA 3HV6A 2XIZA 4AS0A 3VO3A 4DLIA 3UMXA 4I6QA 4YJQA 2J2IB 3TWJA 3MJ2A 4MCVA 5CEPA 1JOWB 1H0VA 3PY0A 2ONLA 4IIRA 4O22A 3N4TA 4O83A 4RIYA 4MD9E 2HZ0A 3CR0A 4L68A 4MVFA 3FI3A 2ZB0A 5DBXA 5GZ9A 3PXQA 4UMPA 3ATSA 3BELA 4IVAA 4M97A 4MXCA 3GGFA 2RFEA 3LFNA 4O86A 2Y6OA 3DT1A 4E5AX 1SVGA 1URCA 2WXVA 3C1XA 4O1OA 3F88A 2VNWA 1U54B 5JQ8A 1H28A 3NCGA 2GCDA 2GTMA 2Z8CA 2PYWA 2E9PA 1UWHA 5AADA 2BVAA 3PPJA 4JDJA 2YIWA 5GZAA 2W4KA 3NUNA 2VTLA 4OT5A 4FMQA 4AGWA 2XBAA 5DI1A 2EWAA 3THBA 4FZDB 5K3YA 3BV3A 3GXLA 5FBOA 3UGCA 4FT9A 4PQNA 3GC8A 4MXAA 3BYOA 1YWRA 2I40A 2VGOA 5KUPA 4O2ZA 4YJTA 4RLLA 2VTQA 3G51A 4EOIA 2G01A 4Y73A 2GNIA 5AV2A 3SW7A 2JC6A 3O7LD 3C5IA 2R3RA 3OOMA 1YVJA 4QYGA 3EN4A 2B9JA 5AX9A 2QCSA 2CLXA 4HW7A 4DLJA 4OBOA 4ZP5A 2EU9A 1PXKA 3CKXA 2XNOA 4I22A 5KHWA 1KWPA 4NSTA 2SRCA 3UIMA 4G31A 5EW3A 5D7AA 4E4MA 3DZQA 4LMUA 4GVAA 4HYUA 4EUUA 4EHEA 3GT8A 2QOLA 3FSKA 3UBDA 2R7IA 4EK8A 1XJDA 2UZLA 3DS6A 3VAPA 3TXOA 2V62A 1V0BA 3WI6A 2QURA 2YERA 4U43A 4HYHA 2C6KA 3LFDA 3K2LA 1NXKA 2EXEA 4IW0A 3EQHA 1OGUA 4R1VA 3TJCA 4CQEA 2PVRA 3UYSA 1OL7A 3VUTA 2WMAA 3HDNA 5IDNA 2YITA 1SYKA 2BKZA 2Y9QA 3I0QA 4QP8A 4TYHB 3RPRA 2QI8A 3QUDA 3FLZA 3UOKA 5FXRA 4BDIA 1OBGA 2XEZA 5F4NA 3SXRA 5EK7A 3EKKA 4DGMA 1HCLA 1YOJA 5LQFA 1ZZLA 4KA3A 4JIKA 4G17A 3BIZA 3LCOA 4I6FA 5TE0A 3WF8A 4FK3A 3DY7A 3U9NA 4O7WA 4CFXA 1PF8A 3F82A 1KOAA 4P2KA 5KMMA 4EKLA 4O7LA 3NNUA 3RAKA 4O0TA 5J87A 3EQRA 3EQDA 4LOOA 1B6CB 3PPKA 5D41A 3AT2A 2CNUA 2QOCA 2WOUA 2YIYA 5JGBA 2CN8A 3GU7A 2ITYA 3FLNC 4G3EA 1UU9A 2VD5A 1ZXEA 2YFXA 3JXWA 1Q99A 4RVKA 4XG2A 3PPZA 4YZBA 3TNHA 5DYJA 3C4ZA 4A7CA 2A0CX 3T8OA 3H0ZA 4IVCA 3GCUA 4KKGA 5DE2A 3RGFA 1R1WA 4C2WA 4L3PA 4E6QA 5IQGA 4QMYA 3MGYA 4LFIA 4UBAA 3R7GA 2E9NA 4RIYB 1M2QA 3BEAA 3EH9A 4U8ZA 2CGVA 3PJ1A 4CRSA 4YJPA 3BHVA 3ORKA 3VS0A 4XRLA 4FV6A 3KB7A 4NL0A 1H1QA 1X8BA 4BCMA 5BVOA 5IH4A 5KHXA 3NUXA 4NIFA 4QMXA 5AR4A 3OG7A 1BKXA 3KGAA 1OL6A 3ORNA 3FAAA 2HW7A 2VV9A 3D15A 4WIHA 3RPOA 3ALOA 5GIOE 3CGFA 3L8SA 1JKSA 3VRYA 3IO7A 1G8AA 1IASA 4TL0A 3RNYA 3UO4A 4IB5A 3CY2A 4WBOA 3NYNA 4C4FA 4CSVA 5EM5A 3Q9YA 4RC3A 4W9XA 4FKVA 4GSBA 4K77A 3D5UA 2OJ9A 4GK2A 5HE1A 3LFQA 3QRKA 2BMCA 3P78A 4LG4A 2J90A 5FG8A 5J1WA 2E2BA 2EB3A 1JVPP 3FMNA 5AX3A 2XCKA 1JLUE 4FTAA 1M7NA 5L3AA 3IW4A 2WQOA 4YHJA 5DT0A 3HECA 1IA9A 4F09A 3ET7A 2F2CB 4PP9A 3CY3A 5LCKA 2GS7A 2BFXA 3NVMB 4FC0A 2OZAA 4YJRA 4UXLA 1KUTA 3IK3A 3U6HA 5HO8A 4DF3A 1WBSA 5CAOA 3HMOA 4MF1A 2JD5A 1F3MC 2IPXA 3AD5A 3PJ8A 3QL8A 4U45A 1JPAA 2ZJWA 2HXLA 4GU9A 4F9WA 2IZUA 1IRKA 3OT3A 3QD4A 4S33A 4YC3A 2XKDA 4ZTLA 1E1VA 2XRUA 1A06A 2YDIA 4FKSA 3Q5ZA 5DT3A 5IF1A 3OUKA 2YIQA 3QWKA 5HCXA 4J53A 5E8WA 4YO6A 4AOJA 2R4BA 4FBXA 2X2MA 2PHKA 3UC3A 4HVGA 1KE8A 2C0OA 2YCSA 5I3RA 3HV4A 5J1VA 3ORIA 4GFMA 3PXKA 4QMPA 5IA0A 5J5TA 2JFMA 2CDZA 3EN9A 4ZOGA 5LARA 3RMFA 1R3CA 3UOLA 4DH5A 3BYVA 3EYGA 1Q8UA 3MVJA 4XBRA 4FEWA 4FL1A 1YDTE 1KV1A 2W4OA 2VWIA 2OXXA 3KRXA 1AGWA 1I09A 3RWQA 4QMTA 2IG7A 1SMHA 2ZMCA 3DPKA 4IZAA 1Y8GA 2OU7A 5K4JA 4JQ7A 1G8SA 5HU3A 4H3QA 2VTHA 5CVGA 5IEVA 1ZY4A 4NM7A 1R39A 2YDJA 4TWOA 3HUCA 3L9LA 3BHUA 3PWYA 4GMYA 4O0SA 5AA9A 2P33A 5BMMA 4YMJA 5AV0A 1KE9A 1H01A 3ITZA 3EFKA 2X81A 3NW5A 4PTEA 4D4VA 2UV2A 2YABA 2ZV7A 4B99A 3G9NA 4BB4A 1NA7A 4JT3A 5CEKA 5H2UA 3KY2A 5I3OA 4BZDA 4KAOA 4H36A 1GZNA 4Y46A 5A4LA 3NW6A 5DN3A 1YHSA 2OFUA 4HGEA 5KBRA 2QO7A 2Y8OA 2X9FA 2BTRA 3OEZA 3R9DA 4U42A 3FV8A 2BRNA 4NIFB 4YJUA 5KKRB 4ERWA 3IOPA 5KKRC 3SA0A 2FSLX 4BTFA 4QTDA 4U0IA 4YTIA 3S1HA 3FI2A 2UZVA 3OHTA 4MTAA 4IX6A 4QMOA 3PG1A 2Y0AA 3I5ZA 1B39A 4ENXA 3NNVA 1KE5A 5CU3A 3LLAA 4RVLA 3PVUA 4RWKA 4K1BA 4WSQA 5JFXA 3PA4A 4TNBA 5A9UA 4RA4A 2P0CA 3VS6A 3OT8A 4GT5A 4ZTHA 4USDA 4FTQA 4CFWA 4X6RA 4ANQA 3VS5A 4D2PA 3AMAA 3R28A 4D4RA 1OL1A 2NP8A 3WF9A 4APCA 2RIOA 2H34A 2GU8A 2JITA 1ZYSA 4Q5EA 5EKOA 4QMUA 4EOPA 3HAVA 2JIUA 2CCIA 2OZAB 4I1ZA 4EH8A 2JDTA 4MD7E 3ZO1A 2OG8A 3QQFA 4O7ZA 3HGKA 3ZDUA 2W1GA 4IZ7A 3IQ7A 4BTKA 2UZTA 4O82A 5L2IA 4PTGA 4BL1A 4CTCA 4PDPA 1PMEA 3OCBA 2HY0A 3BLRA 1KOBA 2H96A 1OPJA 3UNKA 4ALWA 5AAFA 3PXYA 5EW8A 2X8DA 3FMHA 4UYAA 2XKFA 2B9FA 3FE3A 4D2VA 1IEPA 2ACXA 3BBTB 1LEWA 4M66A 4TRLA 4O7NA 5DNRA 3HZTA 2ETMA 4FUXA 5FRIA 3TIZA 5CANA 4X0MA 2QD9A 5KMJA 4FODA 4L42A 4DHFA 4E4NA 4EWQA 1L8TA 5FUTA 3KN6A 3SD0A 5IQDA 2RGPA 5C8NA 2W7XA 3OTUA 5GIPE 4YGAA 2FSTX 3FHRA 4JQ8A 4A9UA 4QD6A 5ETAA 3E92A 3W2RA 4K6ZA 1H4LA 5HVKA 3F5GA 3KXZA 4QMSA 2YDKA 4UMQA 2GPHA 3QALE 4BDEA 4AOTA 3KA0A 2A1AB 2F2UA 4IXPA 4QO9A 2YAAA 4Y72A 5TR6A 4H39A 3QCXA 3BBWA 2ITXA 2W1HA 2JBOA 3A60A 1PYXA 5HG5A 5AUVA 3QYWA 5AR2A 3NUUA 3SHEA 4CKIA 4FA2A 4F7SA 4MQ1A 2BHEA 1Q8YA 2VWUA 4RZWA 3O71A 5I9YA 1YWNA 5IEXA 1FGIA 3MN3A 5CI6A 4L67A 3KXNA 4IJPA 2C6DA 5HG8A 3VC4A 4EH9A 4RFYA 3VHKA 3HA8A 3VUHA 2JBPA 1DAWA 4U6RA 5AAGA 5A46A 5I9UA 2PMLX 5A6OA 4DFZE 4FIIA 4OGRA 4EH2A 1Y6BA 4YZMA 2ZDUA 3FWQA 4R3CA 4IM3A 4BICA 1ZLTA 3FMEA 4IVBA 2YLEA 4E4XA 5KBQA 3SXFA 3S4QA 5LVLA 3WBLA 3ZH8A 4KINA 5L2QA 3Q9ZA 4JBOA 3QTXA 2UW4A 4QMWA 2PZPA 2REIA 4FIJA 1ERKA 4C61A 5FEDA 4UZHA 3KVXA 3FLSA 4EHGA 1P5EA 3DJ5A 4IZYA 4FTMA 1WBVA 3LIJA 2BILB 3LXLA 2VGPA 1YXVA 3SRVA 2XK6A 2CKPA 3BWFA 5ETFA 5I0BA 1UNLA 3A61A 4IH8A 3PRIA 3O96A 1OPLA 3ANRA 5KMOA 1A9UA 3TNIA 3EZVA 3UYTA 5JFVA 2WGJA 5BVWA 2W5HA 1Q41A 5IQHA 1G5SA 3VQUA 2WTKB 5IA4A 3BYSA 5BYLA 3KCFA 5LCJA 3FL5A 3UE4A 4BZNA 2PVKA 3GNIB 3QKLA 2VTMA 3QU0A 5FP5A 3R71A 2ZMDA 5KMNA 2R3NA 4RVTA 3PJ2A 1PXMA 2PVYA 3BPRA 3N51A 4AFEA 4AW2A 4MQ2A 2J9MA 3FY0A 3DXPA 4P90A 3MVMA 2Z02A 2BIKB 4MBLA 2GNHA 3P1AA 3QTSA 1M17A 2VWYA 4D9TA 5C01A 2ITPA 3QXOA 1GJOA 2DS1A 2IZRA 3QX4A 3ORMA 2JIVA 4XUFA 5FXSA 4GFOA 5B0XA 2IW9A 4E5BA 5M44A 5F1ZA 1XBBA 3U9CA 2X4ZA 4TYGA 4HYIA 5JRQA 3OROA 2C5NA 4YPSA 3KRLA 5HCZA 4RBLA 4G5PA 1Y8YA 2EXMA 2VWVA 4TN6A 3C4FA 3REPA 1OL5A 3D5WA 3TKHA 3GU6A 3O2MA 4RZVA 3VBVA 4I92A 4C57A 3RJCA 1OIUA 3NAYA 2PPQA 2UZDA 4J99A 3NIEA 3TTIA 2R3MA 3NR9A 4QTAA 2RF9A 2Z7SA 5KX8A 4CYJA 5HD7A 2Q0BA 4UZDA 1QPEA 2E9OA 3COMA 1PXIA 3RALA 4I94A 2J51A 2YM4A 4NFNA 3W18A 3L8XA 3R8MA 4I4EA 4QYEA 5IA5A 4U7ZA 3PZHA 4FTJA 4FX3A 5LVOA 5KE0A 3FHIA 2XNBA 2OXYA 2ITWA 3U55A 3D94A 4EUTA 2PSQA 5IQEA 1CSNA 3R7UA 4BDAA
chains in the Genus database with same CATH superfamily
3PIXA 4JXFA 2HELA 1K3AA 3SX9A 1UNHA 4PDOA 5I9ZA 4DEIA 3HKOA 4S30A 4I24A 5JKGA 3QRJA 2WD1A 4FT7A 3MWUA 2OH4A 3DKCA 2XZSA 3MB7A 3JR1A 2NNWB 3QUPA 3W8LA 3I7BA 2UZEA 3A2CA 3UIBA 3EN5A 1ZMUA 3FZSA 4X2KA 1YXXA 2WFYA 5DGZA 2FVDA 3VBYA 5AM7A 2XP2A 5CEMA 4FKQA 1UU3A 2G1TA 2R64A 4B7TA 2XS0A 2R3JA 4F64A 3ZLXA 5ITAA 2ZM1A 4BCFA 3R1QA 3PRFA 5IUIA 3F7ZA 4F0GA 3P08A 4EQCA 4EH6A 3TZMA 4CV8A 4JAIA 4LV7A 4MXOA 4AW0A 1VLRA 2YCQA 4L7SA 4TY1A 4FGBA 3QBNA 2P4IA 3LCSA 3QA8A 2PVMA 4B9DA 2RG6A 4MH7A 2IVTA 3BE9A 3K54A 3COKA 2BKKA 4J97A 3V6SA 3U6IA 4OTWA 3KXHA 3FKNA 3E5AA 5EYDA 5HI2A 4EBVA 1YXSA 4O7SA 4DH8A 2PZ5A 4BDDA 3SRVB 2QC6A 3Q5IA 2X7OA 3FDNA 5L8KA 2VN9A 3QCQA 1XH8A 5FTOA 3VBQA 1XH6A 3I79A 1O6YA 4G3DA 5H8EA 3WF6A 4ACHA 4CMTA 4MD8E 3UDSA 2X6DA 2OJJA 3PG3A 4QP9A 4ZK5A 3UG2A 3PSBA 5FD2A 5CF5A 4D0XA 3VS1A 3DBCA 4HPUE 1FVTA 5EHOA 4X2FA 2GQGA 4BZOA 3OC1A 3DKGA 4EC9A 2J7TA 3IOKA 1MQ4A 4GIHA 1YXTA 2C6EA 1FOTA 2JFLA 3O23A 4ZJIA 3L8VA 3NX8A 4FSMA 1SM2A 2QG5A 4FEXA 2W17A 3BU3A 3IW6A 3OOGA 4AT5A 1PXPA 5DR2A 3SC1A 4QQJA 4C02A 2GSFA 3E62A 3R8LA 5GZ8A 4I93A 5HNIX 5JGDA 4I4FA 4A9SA 4OUCA 1FQ1B 2RFSA 4EH5A 2XNNA 5TKDA 5E91A 4IAKA 4O0RA 4MUQA 3MIAA 1K2PA 1Q97A 2DUVA 2QOOA 3WIGA 2ZV8A 4DFUA 4Y85A 5IDPA 3WE8A 2YHVA 2IVSA 3CJGA 3IW5A 3OEFX 3UMWA 5AP3A 3KMMA 1U54A 3BCEA 4LL0A 3ZLSA 4EBWA 5B2MA 3EN6A 3TL8A 4E7WA 2UW3A 5DIAA 2VTPA 3BV2A 4PDSA 1YXUA 2JKQA 4LOPA 5TF9A 4L6QA 1W84A 2V22A 2IVUA 4EK5A 3QQLA 3WARA 2J5EA 3C13A 3Q4CA 4IX4A 3CJFA 3PSDA 3OY3A 3EWHA 4H3PA 3L8PA 4LRJA 4RJ8A 2QOIA 2OIDA 3LFFA 4N0SA 3ZMMA 1OB3A 4Y95A 5IA1A 4FICA 3V5QA 4MXZA 3PLAE 3R1SA 4L01A 3TACA 4HCTA 4PNIA 4FL2A 2UZWE 4EQUA 3E64A 5L6PA 4AZSA 4BDJA 5JEBA 1CMKE 2XF0A 4JX3A 5EQPA 1OUYA 3ZHPC 4KB8A 3F3TA 3EOCA 4YC6A 4NWMA 5HG7A 4DBNA 2JIIA 4UV0A 2CPKE 3E7OA 3T3UA 4F65A 3GCVA 2VNYA 1XH9A 4P5QA 1JAMA 2BFYA 3ULIA 3EB0A 2Z7QA 2VAGA 3LCKA 2VX3A 3DQWA 3I81A 4FKTA 3DKFA 3V04A 4C4JA 5HE0A 5HIBA 1WVWA 5DVRA 4A4LA 2ZV2A 2GHGA 4I20A 3PLSA 1TFFA 4B4LA 3QC4A 3ZRMA 5M51A 4AZFA 5GJFA 4BCJA 2X9EA 4E1ZA 2NO3A 4RT7A 4GK4A 3VIDA 1DI9A 1XH4A 5AEPA 5BUIA 2F57A 1GY3A 3MFRA 3OVVA 3CCNA 4J8MA 4DINA 5C03A 4M69A 5EDPA 3AGLA 3KMUA 5AJQA 5JSMA 2PL0A 4FV8A 3ZCLA 4ZZNA 3OP5A 4G3FA 4EJNA 3KL8A 1TKIA 3BGPA 3H10A 5HU9A 2YZLA 4D1SA 3MPMA 1WCCA 2YM8A 3F3VA 4M67A 5GNKA 2QR8A 2QOFA 4ZXTA 2FO0A 3QD0A 3GU5A 4K33A 3E8NA 4BDGA 3BKBA 4G9RA 2J50A 4XG9A 4BTMA 2XIXA 4OW8A 1VJYA 2GS2A 4LM5A 3AKLA 1JNKA 4ACDA 5IU2A 4USFA 3WZJA 4PRJA 3RP9A 2IEWA 3U4WA 4CXAA 5AV3A 5EOLA 1VZOA 1YHWA 2GNFA 4WNPA 1O6LA 1GZKA 4AN3A 4KRDA 5HBEA 3RCDA 4BI1A 5ANDA 4E4LA 4FI1A 4NKSA 5HX8A 3KXGA 2JEDA 4RA5A 5EDQA 5E1EA 5ICPA 4K11A 2QKWB 3W0RA 4ZEGA 4GJ3A 1QPCA 4PWNA 2ESMA 4EEVA 3E3PA 4AXCA 2AUHA 3KK9A 3CQEA 2I6LA 4J7BA 4X7QA 4AW1A 5DFPA 2OIQA 1MRVA 4FYNA 3PIYA 5GJGA 3I60A 1ND4A 3QAME 2W5AA 3QUEA 4BCOA 5CF4A 1MP8A 3AMYA 5HO7A 4B6LA 2YCRA 4FTRA 1E9HA 2CLQA 2WQBA 4F6SA 4FJVA 4K18A 4QDVA 2R3FA 3LKMA 4UWBA 4U5JA 4LRMA 4O0UA 4M0YA 4D4YA 2PZRA 3UIXA 3KF7A 3QHWA 4MBIA 3I6UA 3UO5A 2FSOX 3M1SA 5ANKA 4DE4A 3G0FA 4OAVB 2ITUA 4XV9A 5IKWA 3ZFMA 3DTCA 4MXXA 3GU4A 2GFCA 3R63A 5FLFA 3WILA 4BC6A 5BQ0A 5TO8A 5IQIA 4YLLA 1ZOGA 4XG3A 3Q6WA 5GJDA 2C6TA 4HNFA 3P79A 4GT3A 1Q62A 4BKZA 2AYPA 3BU6A 3O50A 2W1EA 3FKLA 4W4WA 4XG7A 3VBXA 4A4OA 3UZRA 3C5UA 3ACJA 3LXPA 4P4CA 4QTEA 3P9JA 3FMDA 5JGAA 5J9ZA 4FSNA 5BUEA 5AM6A 2QR7A 3LXNA 2C6IA 4FKRA 2BCJA 5EKNA 3NS9A 4IX3A 2WELA 2B52A 4RJ3A 3R7VA 4YZDA 3F69A 3M42A 2WQMA 1H08A 4WOVA 1WVXA 2CGXA 4DHZA 4K0YA 2YACA 1LR4A 3TG1A 1O6KA 4PUZA 4HGTA 5EYKA 4DEGA 3PVBA 2C0IA 4O6EA 3R8PA 3Q4TA 3RBWA 5B2KA 3UG1A 5KO1A 3PY3A 4FTIA 4DFYA 5AIRA 5FM3A 2W1ZA 3P4KA 5CQUA 4DEEA 3LAUA 3OWLA 2VWZA 4EWHA 3VF9A 5DH3A 2GTNA 3HYHA 3LMHA 3TDWA 3RVGA 4BHNA 3QTRA 3WE4A 3KMWA 4M69B 3ORZA 2OK1A 4L3JA 3QX2A 4R8QA 5FDPA 3ZDIA 4G6NA 1ZWSA 4BCIA 2UZOA 2JGZA 3LCTA 2WTWA 3OS3A 4FUYA 3BYUA 2WU7A 1KSWA 2GDOA 3QYZA 3ZFXA 2W5BA 2WTCA 4J96A 5AP1A 4TNDA 2VTTA 3OXTA 4CKJA 5BYYA 2W1IA 4C3PA 4QP2A 2XNGA 2C6MA 4OBPA 3E63A 4AFJA 5HIEA 2Q0NA 2CNQA 3DBQA 3GOKA 4ZJVA 4RX8A 4RIXA 3ML1A 3VRZA 3ZLYA 4QNAA 3HRBA 4M13A 4PF4A 2BR1A 1SNXA 4QOXA 2YJRA 3DCVA 4AGDA 3CD8A 2LGCA 2HW6A 3ODZX 5I9XA 4S34A 2AC3A 4E93A 2H6DA 3SAYA 3ANQA 3W2SA 4APPA 3D5VA 1JWHA 1JKLA 4GJ2A 4YNEA 5T68A 3RAHA 3TV7A 4ACCA 4HPTE 4TKSA 3ZRLA 4ANLA 4FZ7A 4C38A 3HUBA 2QNJA 2R3HA 3MSSA 3R8UA 3ZBFA 2CKQA 5AUYA 2ONLC 3NAXA 3GENA 4ERKA 2J4ZA 4CD0A 3BHTA 1ZY5A 4ZSEA 4F70A 5KCVA 5DLSA 4NCTA 2HZIA 3BLQA 2B54A 4YBJA 5ETCA 1W83A 1RDQE 4BCPA 4F0FA 4RLKA 2YN8A 4BIBA 2VWWA 3S95A 2W06A 2QOQA 2W99B 3K5UA 5DEYA 2BPMA 4KABA 4RPVA 4XV2A 3BL7A 4I21A 5ANIA 4F78A 2OBJA 4CZYB 3C0HA 1NT2A 3ZO2A 3U8WA 4QNYA 3UOHA 4BJJA 1S9JA 4IDVA 3G9LX 4F7NA 1PYEA 2XANA 4R3PA 3NUAA 1H07A 4JDHA 4EYJA 5IQBA 3JYAA 4AGCA 3R04A 4GH2A 3B2TA 3DFAA 3Q2JA 4RWJA 4F7LA 2Y4IB 5AR8A 2RKUA 3IKAA 1DI8A 2XK8A 3UQCA 3AC3A 4GYIA 4BCHA 2C5VA 3TCPA 4CNHA 2XNEA 5EI6A 3QLGA 1GIHA 5A3XA 4BGGA 1WAKA 1H1WA 3OWKA 4ITHA 2J6MA 5CQWA 5IG1A 1VYWA 4I23A 1TQIA 2XK3A 4K2RA 5D1JA 4LUDA 3I5NA 4FNXA 4OLIA 4GUBA 4C0TA 3N9XA 3EQCA 4I5PA 4JG8A 3RPYA 2QKRA 3PFYA 5CZIA 3CBLA 4G2FA 3P23A 4FKPA 2J0MB 5J8IA 4Z55A 3C4WA 4PL5A 3Q9XA 2VTSA 4IDTA 3RK9A 4YU2A 4FOCA 5DPVA 4JBQA 5HNBA 2BROA 3TN8A 4MK0A 3TUBA 3HV3A 2VX0A 3MY1A 1ZYJA 2OKRA 4YSJA 3TM0A 4JI9A 3Q32A 4AU8A 5EI2A 3CQWA 3FC2A 3OY1A 5AUZA 3E8CA 5HEZA 4ZMFA 3QRIA 4O0XA 4C4IA 3LW0A 2ITNA 2W05A 4D2RA 4DDGA 2C3JA 4IWDA 5E90A 5T6KA 3RI1A 2X7GA 5E7RA 3VW8A 4F9BA 2CJMA 1P14A 3GCSA 3R22A 4YHFA 4QP3A 3LJ1A 2OSCA 3D4QA 4MWHA 3EFWA 4D2TA 4AWIA 4EORA 4WNMA 4F0IA 5JZJA 3LQ8A 2WAJA 4FV4A 3RAWA 4OBQA 4CFVA 4BY9E 1YI4A 2Z7LA 4UALA 4RIXB 2ITQA 2PMOX 1VYZA 3UVRA 2XYUA 3H9FA 3CPBA 4RJ5A 3RZFA 2PUIA 5JFWA 4MF0A 4MX9A 2X0GA 4TT7A 5HTCA 4ZS4A 4IAIA 1GZ8A 2Z2WA 4HVDA 1IG1A 2XNMA 4XP2A 4ASEA 3IGOA 1UVRA 4YPDA 3CSVA 3I7CA 4XOZA 3LM0A 3FUPA 5AUXA 5AP0A 4FNYA 3WF5A 4I3ZA 5E8ZA 2R3PA 2Y6MA 4D58A 3ENHA 4BCGA 2BHHA 2A19B 3VNTA 3F9NA 5CU2A 4FG7A 5B7VA 4DAWA 5HKMA 2GHLA 4MNFA 4QP1A 3UPXA 1PXLA 3A62A 5F94A 2HIWA 3EQGA 4V04A 1XH5A 3JVRA 1PKDA 5CLPA 1RE8A 4CV9A 4DTAA 2JKMA 3MBLA 3QQHA 4FSTA 4MKCA 3COHA 4LMNA 2HK5A 3Q6UA 4CFFA 2WU6A 3NRMA 3R9OA 4ZAUA 5F9EA 5IZFA 3FMJA 4BJJB 4R6VA 2CCHA 4NJ3A 5CALA 4QTCA 2J5FA 2WEIA 3M11A 4DN5A 3GI3A 2FGIA 3PYYA 5CAQA 3QA0A 3I0OA 3MY5A 4E6DA 2B9IA 4RRVA 2C68A 5A14A 2WNTA 5JFSA 2R0IA 4IBMA 4A9YA 4AT3A 2W96B 4GG7A 3UPZA 4DEHA 3W2OA 3AT4A 2G9XA 3IS5A 4BDBA 3KULA 1W0XC 2OJIA 2BRGA 4DEBA 1O9UA 5LWNA 3SV0A 4CLJA 5M53A 1LEZA 5AP6A 1FVVA 4YHTA 2BDFA 4ANMA 3QTQA 4AXEA 5AMNA 3SOAA 3ZBXA 2UW6A 2PTKA 3EMGA 2WMVA 4MEDA 3Q04A 3O7LB 1CDKA 3DLZA 2WB8A 4M3QA 2YIXA 3B2WA 3K5VA 4FKLA 3VW6A 4DG2E 5IA3A 4JMQA 3GP0A 3G5DA 1Q24A 4NM5A 3VHEA 1L3RE 3SDJA 4YZNA 3VF8A 4AGUA 2ZB1A 2QU6A 4E73A 4PPBA 3ERKA 4YO4A 3MDYA 1FMKA 1REKA 3F3WA 3SG9A 1UA2A 3D83A 3A99A 4ZS0A 2YM5A 3PTGA 3KKVA 2OGVA 3R7IA 4YUQA 5LVPA 4NYEA 2QO2A 4FRFA 3MPTA 4I6BA 5HTBA 5IQAA 1BI7A 2VO7A 2JDOA 4C7TA 1J1BA 3WZUA 5CYIA 1BL7A 4TXCA 5E8UA 4F6WA 4IWQA 4EZ3A 2GHMA 3B8RA 1YW2A 3RK5A 4DCEA 4UMRA 4Y8DA 4F9AA 1RQQA 1QCFA 1UNGA 5AA8A 1KV2A 4KKHA 3BQCA 4HNIA 4L3LA 2WIHA 1PW2A 4ZTSA 4FEVA 3RHKA 3WOWA 3M2WA 5LMKA 2OZOA 4BVUA 4F1MA 4XS2A 4PX6A 3D9VA 4H1JA 3CS9A 1PMVA 4S31A 3DK3A 4F63A 5CSPA 4EQMA 3SQQA 4EK6A 4AQCA 2VTIA 2C5XA 3KRJA 3WYXA 3G15A 5E8XA 3G6HA 3KXMA 3C7QA 4IAAA 1U59A 4IAYA 4ITIA 4R1YA 5HIDA 3A4OX 1W8CA 3ZC6A 4A9RA 3ZFYA 1F5QA 5AAEA 2IW6A 2C30A 3U6JA 4YJNA 2PUUA 4MAOA 3D5XA 4H05A 2OLCA 4YLKA 2OWBA 3TNWA 5CT7A 4FG8A 3I1AA 4WBBB 4EK3A 2QQ7A 4FSZA 4NM0A 2R3KA 3FZOA 5FQDC 2XA4A 3FY2A 1TQMA 2PVLA 5G6VA 3D7TA 4WG5A 3RHXA 4GIIA 4D5KA 5EHYA 2XB7A 3FXZA 4BDHA 4EONA 1T45A 4Q9SA 2P3GX 1DAYA 4DTKA 4ZLOA 3MTLA 4L9IA 1WBOA 3UC4A 4EC8A 4FSUA 4DH1A 4JBVA 1PRYA 4YBKA 4ANNA 1CTPE 2NPQA 3JPVA 4E20A 3Q3BA 3RM7A 3TZ7A 4ZLZA 3LOKA 2PMIA 1SZMA 5CSWA 5E8TA 2XIYA 3KXXA 3QRTA 4W8DA 4M7IA 4BDFA 4D2WA 3KVWA 1OL2A 4CEGA 5GINE 1H00A 3LQ3A 2ZOQA 3FQEA 2BZHB 3IW8A 4HGLA 4RG0A 2ZAZA 3IW7A 5FP6A 2EB2A 3NEWA 1T46A 2UUEA 4FVPA 3RKBA 1YI3A 2OW3A 1WVYA 2WTKC 4AG8A 2XAOA 1UU7A 4BKYA 3QKKA 5JRSA 5E9EA 3MY0A 4M15A 4O6LA 4ORKA 2DQ7X 4NU1A 4BGHA 4ZY5A 2JLDA 4I6HA 3HA6A 3R8VA 3JVSA 3KULB 3HMIA 3ZXTA 5IQCA 2ITZA 3SOCA 4FG9A 4AE6A 3A7IA 3TIYA 2G2FA 2F4JA 1GIIA 4S32A 2QU5A 2UW9A 3F2RA 3V5TA 3MIYA 3C50A 3CC6A 3LZBA 5HCYA 3O8TA 2J0JA 4LDTA 1W98A 2VTRA 4L00A 1MRUA 3IG7A 4FEQA 3N4VA 3ACKA 5AV1A 4JOAA 4ACGA 5D7VA 5EW9A 5M55A 2YWVA 2CSNA 3NLBA 3L9MA 2CN5A 4NW6A 4HVHA 4OAUC 4QQTA 5CY3A 1OMWA 5IPJA 3FC1X 4Y5HA 5EDRA 3ZTXA 3DU8A 4BBMA 3PUPA 4XV1A 3NMUF 3ZO4A 4RFZA 2QOBA 4P7EA 4N57A 4IAZA 3W2CA 4R5YA 2XIRA 4QYHA 2BTSA 3P7AA 5D9HA 5DHJA 4GL9A 4IC8A 5EH0A 4BIDA 4EH3A 3CTHA 3GOPA 4YJVA 4YJOA 1Q4LA 4J98A 5LVNA 4KUJA 4CYIA 2BUJA 1FINA 3NCZA 1MUOA 5CEIA 4GYGA 3ZSHA 2O3PA 5EI8A 1H26A 4AN2A 1I44A 1M52A 4BBEA 1GAGA 3BRBA 3LPBA 1Z5MA 2UVZA 2OH0E 2HENA 2XM9A 3QFVA 1JQHA 4I0RA 4ONAA 3DNDA 5D11A 2WTDA 3RAIA 4F9YA 3R1YA 4NUSA 3UIUA 3V5LA 4GT4A 5FWKK 4GS6A 5L8JA 5L2WA 3NFFB 2HAKA 5TT7A 4DDIA 4EI4A 5CNOA 3NNXA 3ZC5A 3R1NA 3UVQA 4BDCA 4PDYA 4BFMA 3ZU7A 1BX6A 4M12A 2O2UA 3SKCA 3OXZA 2HWOA 3I6WA 4DHJA 4KWPA 4UEUA 3TKIA 5IA2A 3DK6A 3D0EA 3IONA 4KS8A 4MBJA 5K0XA 5AWMA 4F1OA 4D2SA 3MFUA 2BZKB 2B1PA 1V0PA 2YM7A 4C59A 3PVWA 4YTFA 2ERZE 1CKJA 4PPAA 3VQHA 4WRGA 5M06A 3D7ZA 3D7TB 3GCQA 3DGKA 3SG8A 1M2RA 2QLUA 1OECA 4LGDA 4O4BB 2WMBA 3OW3A 1TVOA 4DH3A 1XWSA 4QMLA 3PP0A 4D28A 4YP8A 3HDMA 3DBFA 3S2PA 2W9FB 4RJ7A 4FTLA 3OBGA 3MYGA 4F4PA 3I4BA 1OVEA 5BVEA 3T9TA 4BCNA 3EQPA 4DGGA 1QPDA 3RNIA 1Y6AA 2FSMX 2IZSA 3U51A 4C4EA 2XYNA 3IECA 5K0KA 3C51A 4FYOA 5H9BA 2CGWA 1W2FA 1Z57A 4GEOA 1ST0A 3AC4A 4LUEA 4QTBA 1KE6A 3IGGA 3F5XA 5CI7A 2R3LA 2JAMA 4FZFB 1OIYA 3W8QA 3DAJA 3ZUVA 1W82A 2WTJA 1HCKA 3WF7A 4NJDA 3QD2B 2XCHA 3BE2A 3S0OA 2RL5A 5F95A 3TV4A 5KZIA 5DA3A 3ZZWA 4A07A 3SW4A 1VR2A 4D5HA 5FBNC 2H9VA 3R8ZA 2OJGA 4XLVA 1H1PA 4BTJA 1G8KA 3HVCA 3MA6A 2BZIB 3VUIA 2F7ZE 3PE1A 4WUNA 1LPUA 3NYXA 4KIPA 4C3FA 5JH6A 1BUHA 4J95A 1LP4A 5EFQA 4XX9A 3VUDA 4GKIA 5IQFA 4JG6A 4QMZA 1NVRA 2ZVAA 4RIOA 5C8MA 1PMNA 3LCDA 1W2DA 2RSVA 1CM8A 4IHPA 3JY9A 3DB6A 3DKOA 4TTHB 4RSSA 4HVSA 3LXKA 4EOOA 3O51A 3ORPA 1B38A 3F66A 3HAMA 4YLJA 1OKVA 3QF9A 4NM3A 2YLFA 4KD1A 5AP7A 3BX5A 3NUPA 5J95A 5IH6A 1Z9XA 4BHZA 3GCPA 4C3RA 1ST4A 3FLYA 4OTPA 2GNGA 1QMZA 4CGAA 3JS2A 3NW7A 4E3CA 1Q8TA 5BUJA 3R9NA 1TQPA 2JAVA 4FK6A 5E4HA 2HY81 3K3IA 4Y5QA 4L53A 3OCSA 4S2ZA 2CMWA 2W4JA 3R7EA 2QHNA 4JBPA 5J9LA 2R2PA 4DA5A 2H8HA 4CKRA 2XJ1A 3ORLA 5HE2A 3NNWA 3AOXA 1FMOE 3VN9A 2HOGA 3AQVA 3A7HA 4IMYA 2AQXA 2A2AA 3B8QA 3EQFA 3LFBA 4WNOA 1KE7A 4BWXA 1J1CA 2BRHA 3DNEA 4E5WA 4DFBA 3FPMA 2BAKA 5A4TA 4OTRA 3WIKA 4ZTMA 2I0YA 3G0EA 5LVMA 4MXYA 4HGSA 5IMXA 4KS7A 3RWPA 3KF4A 3E88A 3V51A 4KBAA 1XKKA 4WG4A 2F49A 4LRKA 5EM7A 4XG4A 1SVEA 5J7BA 3EZRA 4G3CA 4DCAA 3Q60A 5JT2A 2O63A 1PKGA 5DMZA 4G6LA 4UYNA 3UNJA 3O5AA 2R5TA 4I5HA 2WIPA 2VO3A 1H8FA 1K9AA 5J79A 3VBWA 3F5UA 1BLXA 4WRSA 2WMWA 3W33A 1REJA 2IJMA 4ZIMA 1XBAA 3DB8A 1J7IA 4Q2AA 4WHZA 4FV0A 2XBJA 3KRWA 2C3IB 2UW7A 4IWOA 3RM6A 1YOMA 3NUYA 4XYFA 3FLQA 4ITJA 5EG3A 3OF0A 2PMNX 2F7EE 2YEXA 3CPCA 3H0YA 4FSWA 2WTVA 4JL9A 4IM2A 2O5KA 4IE9A 5M4IA 4DC2A 3FPQA 3F3ZA 3ZS5A 5CEQA 1DS5A 3TV6A 3TNPC 4O81A 3TI1A 3FMKA 3FQHA 1ZARA 2YM3A 3DBDA 3W16A 5I4NA 4J8NA 5LXMA 5M57A 4GUEA 4LV5A 4D1ZA 4JRNA 2CNVA 2WMTA 5DRBA 4CT1A 4O0YA 4E26A 5A4EA 5FTGA 4FKWA 4WA9A 3NSZA 5F20A 1H1SA 3QKMA 3AD6A 1GZOA 4N6ZA 4NW5A 5CSXA 4CRLA 2R3IA 4JQEA 2G15A 2ZM4A 4HJOA 1AD5A 1ZYDA 2BZJA 4JVGA 3A4PA 3HEGA 4RVMA 2B55A 4X6QC 3TZ8A 1J3HA 4FVRA 3ULZA 1R78A 5LWMA 5HO6A 5IUGA 3W2PA 1Q5KA 3BEGA 5CF8A 5G1XA 2PVNA 2V7OA 4CCBA 4WO5A 4F08A 5L4QA 3GFWA 3MFTA 3MFSA 2UW8A 4F6UA 2JKOA 3BGZA 2J0LA 2YISA 4Z9LA 1JSUA 3V5PA 1H24A 2UZNA 5HESA 4C4GA 3FXXA 3K3JA 3CTJA 4IADA 4ACMA 1LUFA 2X6EA 1EH4A 3CKWA 5KNJA 3E87A 2VUWA 4BCKA 4EOMA 5D12A 4YNOA 5CU0A 1R0EA 3EL8A 2VWXA 4XEYA 3FEGA 2DYLA 2OFVA 4M84A 4TPTA 3DJ7A 4NFMA 4CLIA 3C4CA 4D0WA 4F7JA 3U54A 2XJ0A 4X2JA 5I9WA 1YQJA 3QTUA 1PY5A 3HP5A 4IB0A 4FTTA 1M7QA 3DZOA 4X2GA 3R73A 2X4FA 5LMAA 5H8BA 4FTNA 1OI9A 3GQLA 2BALA 3NUSA 4I5CA 3ZYAA 4B8LA 3OMVA 2C0TA 2E9UA 1PHKA 4ANOA 4ZSGA 1IAHA 3QQGA 3V01A 2JDRA 4GCJA 2I7QA 4C62A 4FOBA 2ERKA 2J0KA 2X1NA 1Y91A 4EZ7A 3KEXA 3DTWA 3G33A 4RWLA 4TWCA 4UWYA 4O7RA 2GNLA 3DJ6A 1OM1A 2YZAA 4FVQA 3UVPA 3MH0A 3R0TA 3GEQA 3KRRA 3ZXZA 5HVJA 3NPCA 2QLQA 5K4IA 3QCYA 3ODYX 2GQSA 4AXAA 2IWIA 3R83A 3O8PA 4UY9A 4OTFA 1ZMVA 2NRUA 4HZRA 4DEDA 4OTHA 4BN1A 4HCUA 4A06A 3EQIA 4FZ6A 4AX8A 3RCJA 1JKTA 3AXWA 3ROCA 1BMKA 4BKJA 3GUBA 3MW1A 5GHVA 2AEGA 3HNGA 2XVDA 4JAJA 4W4XA 4CFUA 4FT0A 4QPAA 3EN7A 4IM0A 4R78A 2OICA 2IVVA 1UV5A 2X2KA 4I5MA 5HGIA 4Q5HA 3R7OA 4ZZOA 1P4OA 4V01A 3E8EA 4JG7A 2WKMA 4QQ5A 3AT3A 2XALA 1UKIA 3EHAA 1OIRA 4KRCA 4RX7A 2O65A 2I1MA 3P7BA 5ETIA 2HZ4A 2OXDA 2WMSA 5CX9A 5DR6A 4E6CA 5C26A 2EXCX 2HXQA 3Q52A 3W55A 4FIHA 4JX7A 1JSVA 2ZFYA 1RW8A 4QT1A 3UDTA 1W7HA 1OPKA 3G6GA 1NVQA 3DDPA 4PL3A 4DITA 5DT4A 5BMSA 4W4YA 4FT3A 4ZTRA 4FV2A 5I9VA 2VTAA 2R0UA 4QP4A 3HMMA 4W9WA 3UP2A 4FNZA 4BYJA 3PSCA 4QMQA 3QWJA 4RC2A 3UQGA 4YC8A 5M4FA 1ZMWA 2BRBA 4U80A 4QP6A 4OTDA 4B0GA 4EHVA 3TUDA 3VONA 4JNWA 4NH1A 1OBDA 1VEBA 5HNGA 4FGRA 4H1MA 2VX1A 3TJDA 3NYOA 1BL6A 2BAJA 3TEIA 3ZOSA 1W2CA 3Q9WA 1YDRE 3SXSA 3QTWA 1BI8A 3KK8A 3UQFA 2UVYA 3H9OA 3E7VA 3EKNA 3MH2A 1ATPE 5HICA 2E9VA 3C0GA 3F5PA 3PIZA 5HVYA 4RJ4A 4QMNA 4K8AA 4ZSJA 4FTUA 3QZFA 3R9RA 2QO9A 2C1AA 3OFMA 5CF6A 4RQKA 2R7BA 3UP7A 2UZBA 3L9NA 5BVKA 4ENYA 4W8EA 5BPYA 3C9WA 4I0TA 2PE1A 4PY1A 3ZUUA 4DG3E 5AP4A 3LJ2A 3ZEPA 4A9TA 4AA0A 4G9CA 5LMBA 4O7VA 4DT8A 4GK3A 4QYFA 3POZA 3VS7A 4YTHA 3F2AA 3FXWA 1OKYA 2Y4IC 3ROYA