4IB7A

Bovine beta-lactoglobulin (isoform a) in complex with dodecyltrimethylammonium (dtac)
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
162
structure length
157
Chain Sequence
b'LIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENDECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMENQSLVCQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQCHI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords beta-lactoglobulin
publication title The differences in binding 12-carbon aliphatic ligands by bovine beta-lactoglobulin isoform A and B studied by isothermal titration calorimetry and X-ray crystallography
pubmed doi rcsb
molecule tags Transport protein
total genus 37
structure length 157
sequence length 162
ec nomenclature
pdb deposition date 2012-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 4ib7A00
2HZRA 1QQSA 4HPCA 3WJEA 4Y0RA 5KHPA 2FT9A 1I06A 2CM9A 4HFOA 4O9SA 3D95A 5AQ6A 5K06A 1HMSA 1CBIA 3FENA 2FWVA 5EPQA 3U03A 1LPJA 1YIVA 4CK4A 2BLGA 1JYJA 1ADLA 3UEVA 1BJ7A 2RCQA 3TGBA 5KICA 1X8UA 1X89A 1ERXA 3WXQA 1X71A 2CM4A 4GETA 3UEXA 1U17A 3VG2A 5LJBA 3D97A 4XMGA 2FTBA 2WQAE 1ZNEA 1T8VA 1DF3A 1IKEA 5EDBA 2Q2MA 4IB7A 2GTFX 3BSZE 4YGZA 5HCEC 1YWBA 3L4RA 5L8IA 4YFPA 1YWDA 1OEKA 1FTPA 1GT1A 1IFBA 3P6HA 3FEKA 3HK1A 4DQ3A 2Q2PA 4RUNA 3FA7A 1HBQA 4ZJ0A 2L5PA 3EM0A 3P6EA 3DTQA 3FW4A 5HA1A 2L67A 4ORUA 3SAOA 5HCCC 2QO6A 3WBGA 1FELA 2WEWA 4LZUA 1MX7A 3EYCA 5B27A 3NPOA 1X8NA 1G74A 1GX9A 2OVAA 4IB9A 5BVSA 3WJDA 4GNWA 2W2AA 2FRSA 2JU8A 5EZ2A 5F58A 3KFIA 5HTDA 1SXUA 3IFBA 4M7MA 1DZMA 5LJHA 5HBSA 3CQRA 2KT4B 1IFCA 1HMTA 2O62A 1AQBA 1VPRA 3BLGA 4NP1A 1S44A 2X45A 3KQ0A 4IAXA 2P8GA 4XMDA 4QAEA 1KQXA 1ZNGA 2FS7A 2OFMX 4I3BA 1ERBA 1GGLA 4I3DA 1QY0A 3P6FA 2RA6A 1IKJA 3APWA 5LJKA 1D3SA 4YGHA 5IO7A 1B56A 2G79A 1ACDA 1BWYA 2OVDA 3WJFA 5LJDA 1X8PA 1YP7A 3RSWA 5L8NA 5DPQA 1ML7A 2IFBA 1EW3A 1GT5A 3G7XA 1JBHA 1OBUA 1OBPA 4IMNA 4GE1A 4I9RA 1OEEA 1EPBA 3VG6A 2F73A 4XMHA 1QY1A 1ZNHA 4I3CA 4YFRA 1IW2A 2WWPA 4ALOA 2XSTA 1BBPA 2OVEA 2CBRA 3C78X 3KFHA 3WJBA 1E00A 4ZFXA 4DQ4A 5H9LA 2EU7X 2HLVA 3JSQA 1HQPA 1RLBE 3FA6A 3PH6A 3OJYC 1EXSA 3QKGA 3T1DA 4OMWA 4YCHA 4A8ZA 3STKA 3FR5A 1TOUA 1JJJA 1QFTA 5EDCA 1FE3A 1XCAA 4AZRA 3HWGA 1P6PA 1TOWA 1JV4A 2DM5A 3O19A 5KIDA 3O2YA 1LIDA 3B2KA 1QABE 4ORSA 4QYNA 4Y0SA 1I4UA 2AT0X 1ZNKA 4IMOA 2QO5A 4NLIA 1AVGI 5D45A 3CBCA 1HN2A 2HZQA 4HPDA 4LKPA 1AELA 4GRJA 2AT3X 1QWDA 1GT4A 1IIUA 4AZMA 1CBRA 5H9KA 1YWAA 4GH7A 3I17A 1LIFA 4QGVA 4Y0QA 4YBUA 1PMPA 1KGLA 1LFOA 2QOSC 4XMFA 3U9PC 5HWZA 2FLJA 2MM3A 1LNMA 4MVIA 3FW5A 4HPBA 4NYRA 5DG4A 4ZHCA 1TW4A 1B4MA 1VYGA 1TVQA 3B2JA 1DV9A 2WQ9A 3PEDA 1GKAB 3FELA 1O1UA 2LB6A 3ZUIA 3AKMA 2G78A 2AMMX 4EEJA 1NP4A 3P6CA 3K3LA 4UU3A 1A3YA 1E06A 2A0AA 1QFVA 5D4AA 2RQ0A 1EQDA 1UREA 5F7GA 5BVQA 1MX8A 1ICMA 2AKQA 4YH0A 3CQNA 4WBKA 2JN3A 3TGCA 3MVFA 2NNQA 2KTDA 3BX7A 3F9DA 3B2IA 3HWDA 2FR3A 4TJZA 5HA0A 1B0OA 1SY3A 2HNXA 1JJXA 1AB0A 3JS1A 4I9SA 4TNNA 3FA8A 3NX1A 4YDBA 5IO5A 3STMX 1A57A 4M6SA 2HYSA 3EBWA 1TXLA 5F1EA 4AW8A 3BY0A 1S7DA 3WJGA 2LBVA 1EALA 1MDCA 4XMCA 1DZJA 2MO5A 1O1VA 3RZYA 5EEDA 1BM5A 1MVGA 2R73A 4ORXA 4TKBA 1BSYA 1HBPA 1UZ2X 4ORYA 1Z24A 4ZHDA 4ZHHA 4YBPA 1DZPA 2QM9A 3FEPA 2A2GA 2W2FA 1FEMA 1H91A 2FR2A 1U0XA 2NNDA 4LZVA 4AZQA 3CR6A 1QY2A 4QZTA 2Q39A 4YMYA 5HTEA 2ALLX 1RBPA 4TLJA 5HZ8A 1KT6A 3BU1A 2QO4A 3P6GA 5HCDC 3UEWA 4ES7A 1GX8A 3CMPA 2AL0X 3O22A 4WFUA 3IA8A 1SA8A 3HWEA 4ZH6A 1KT5A 5LKEA 1KT7A 1SXYA 3BDRA 5CE4A 4ZGUA 3PH5A 1X8QA 4ALBA 5D48A 1LIBA 4N7CA 5D8JA 5D47A 3VG7A 3NQ9A 4ZH9A 4NYQA 4ZHFA 2AT8X 2JOZA 1I04A 2LFOA 2PY1A 5HZQA 1YWCA 3VG5A 1G7NA 2WUTA 3GAQA 3FA9A 4ORRA 1SXXA 3TGAA 4AZOA 1EUOA 1A2DA 2AH7X 1QG5A 4AYHA 1GXAA 4YKMA 3VG4A 4NNSA 4AZNA 4TKHA 1ZRYA 3P6DA 4KIIA 1LIEA 3FR2A 4OS3A 4K19A 5FFHA 4QZUA 2WR6A 1KOIA 4IB6A 4TQ2A 1HMRA 5HZ5A 5L8OA 1BEBA 1FDQA 2A2UA 2YG2A 2RCTA 4N7DA 2RD7C 5JR8A 1KZWA 1ZNDA 3BU9A 5B29A 3TF6A 1CBQA 1XKIA 2WSJA 1EIOA 1NGLA 1L6MA 2OZQA 4OS0A 3FIQA 4D6AA 3FLLA 3STNA 2LKKA 1KZXA 1BSQA 5F6ZA 3HWFA 4YCEA 3DSZA 1ZNLA 3ZQ3A 1KQWA 5LJEA 2K62A 1BSOA 2MJIA 3AKNA 3EMMA 3WJCA 1GM6A 3PP6A 5FAZA 4BQUA 5H9NA 2GC9A 1R0UA 1U18A 4NNTA 2ACPX 3APUA 4QGXA 4A60A 1G85A 3KFFA 4EFGA 5LJCA 2ANSA 2WEXA 3C77X 3EBKA 4BOEA 1GKAA 1KT4A 1T68X 2Q4NA 1EIIA 1A18A 1B8EA 3UEUA 5IO6A 4UU2A 2X46A 4TKJA 3NADA 4MVKA 1E02A 1BLRA 4RUUA 3NR3A 1BRPA 1KT3A 1YP6A 1OPBA 2ASNX 2CZTA 2L9CA 5F6BA 1D2UA 3BS2A 1PM1X 5H8TA 2NNEA 1VYFA 3C76X 1SY0A 3CBSA 3CWKA 4ARHA 4ZHGA 3KZAA 1LKEA 2G7BA 1E5PA 4YDAA 4HPAA 1CBSA 2ACOA 2JU3A 2HMBA 1N0SA 2JU7A 2L68A 2OFRX 4YKOA 2A3FX 3MBTA 4GKCA 2K23A 2NP1A 4R0BA 4IB8A 1PEEA 3S26A 1FENA 3NQ3A 2XKLA 5C0NA 4OS8A 1BRQA 2LBAA 1NP1A 3I0AA 4YFQA 3ELXA 3Q6LA 3NP1A 1JZUA 4MVLA 3FMZA 1DFVA 4NLJA 3ZUOA 4Y0PA 2W2BA 4QYPA 1MUPA 3ELZA 1SY1A 3BX8A 1CJ5A 1JYDA 4ORWA 5HZ6A 4QGWA 1OEJA 4XMEA 2AT5X 4YGGA 2A13A 4AZPA 1PBOA 2CZUA 4EXZA 4OMXA 4ZR2A 4PSQA 1SY2A 2FS6A 4ZCBA 1ICNA 4ODDA 5HAEA 3APXA 1OBQA 5EEEA 3PPTA 3U0DA 2R56A 1KXOA 3F8AA 5LJGA 3KFGA 1I05A 2GJ5A 2E4JA 1DZKA 3B2LA 4BVMA 4A1HA 4EDEA 3FR4A 1GT3A 1OPAA 2N93A 4D6BA 1G5WA 5LKFA 1X8OA 3APVA 3TZSA 3D96A 4GNYA 3WVMA 1LF7A 2POAA 4LKTA 2AT6X 3BRNA 1DC9A 1LICA 2CBSA 5HZ9A 1ALBA 1S2PA 3PECA 1O8VA 3NX2A 1SXWA 1CRBA 4WFVA 5BVTA 2R74A 4IBAA 3B2HA 4IAWA 1T0VA 3VG3A 5FENA 1YUPA 1EPAA 5H9AA 4A1YA 2Q9SA
chains in the Genus database with same CATH superfamily
2HZRA 4I95A 1QQSA 4HPCA 2UZ2A 3WJEA 4Y0RA 4YVBA 5KHPA 2OFAA 2FT9A 1I06A 1RXKA 2RTAA 4KH8A 2CM9A 4HFOA 4FBRA 4O9SA 3D95A 1MM9A 5AQ6A 4Z2PA 5K06A 4CDDA 2X4MA 4I60A 3RDUA 1SWSA 1HMSA 1CBIA 3FENA 2FWVA 5EPQA 3U03A 1LPJA 1YIVA 4CK4A 2BLGA 1JYJA 1ADLA 3CKFA 4INNA 1BJ7A 1MEPA 2RCQA 4U46A 3UEVA 3TGBA 5KICA 1HXZA 1X8UA 1X89A 1ERXA 2IZAA 1X71A 2CM4A 4GETA 3WXQA 2C1QA 4NW4A 3SZIA 3UEXA 1U17A 3VG2A 5LJBA 3D97A 3OBLA 4XMGA 2FTBA 2WQAE 1ZNEA 1T8VA 1DF3A 1IKEA 1NDJA 5EDBA 2Q2MA 4ZGFA 4IB7A 1PTSA 2GTFX 3BSZE 4YGZA 4GD9A 1Y9TA 5HCEC 1YWBA 3L4RA 5L8IA 4YFPA 1YWDA 1OEKA 1FTPA 1GT1A 1LDOA 1IFBA 1SRHA 1GX3A 3FEKA 3HK1A 3P6HA 2Q2PA 1Y55X 3FA7A 1HBQA 4IABA 4NV8A 4RUNA 5D45A 4ZJ0A 3AEHA 2L5PA 1UYNX 4O3XB 3EM0A 3P6EA 3DTQA 3FW4A 1K3BA 2L67A 4HWMA 4ORUA 2RTFB 2QO6A 5HA1A 3SAOA 1N7YA 3NQKA 4LQZA 3WBGA 5HCCC 2FKJA 1FELA 4OELA 4JGLA 4DCBA 1K24A 2WEWA 4LZUA 1MX7A 2OL6O 4QNIA 3EYCA 5B27A 3NPOA 4GGTA 1X8NA 1G74A 4MISA 1GX9A 2IZCB 2OVAA 2RTLA 4IB9A 4CDEA 5BVSA 4L3RA 3SLJA 4DQ3A 1PBYA 3WJDA 1SLGB 1SRJA 4GNWA 2W2AA 4OKAA 2FRSA 2JU8A 5EZ2A 5F58A 3KFIA 5HTDA 1RAVA 1SXUA 3IFBA 3LV4A 1DZMA 4M7MA 3WZPA 5LJHA 5HBSA 3CQRA 2CAMA 2KD2A 2IZFB 1IFCA 1HMTA 2KT4B 2O62A 1AQBA 2AVIA 1VPRA 2PI3O 3BLGA 1S44A 4NP1A 2X45A 3KQ0A 4IAXA 2P8GA 2IZJA 2KTSA 4GDZA 4QAEA 4XMDA 3VU1A 1KQXA 2Z4HA 2VFBA 1SLEB 1ZNGA 2FS7A 4U8UN 4GUZA 2OFMX 4I3BA 1ERBA 1GGLA 4I3DA 1QY0A 3P6FA 2RA6A 1N4JA 1IKJA 2JW1A 3APWA 1JMZA 2RTGB 5LJKA 1D3SA 1NC9A 4YGHA 4Z2OA 1B56A 5IO7A 2X8TA 2G79A 1ACDA 4BX6A 1BWYA 2OVDA 3WJFA 1KL3A 3ZW1B 5LJDA 1X8PA 1YP7A 3RBYA 1W6FA 3UAQA 3RSWA 4Z27A 5L8NA 4QRLA 5DPQA 1ML7A 5AEOA 3Q34A 2IFBA 1EW3A 1GT5A 3G7XA 5IXGA 1KL5A 1JBHA 2I5VO 1DF8A 1OBUA 1OBPA 4IMNA 4GE1A 4DNEA 4MVEA 4I9RA 1VWKB 1OEEA 1EPBA 3VG6A 2F73A 2M4LA 4GJVA 4XMHA 1QY1A 1ZNHA 1LUQA 4NV7A 4I3CA 4YFRA 1VWEB 3EW2A 5B10O 1IW2A 2WWPA 4ALOA 2XSTA 3VHMA 2IZKA 2IZDB 2F09A 3RE5A 1BBPA 1N9MA 2OVEA 3NBXX 1VWCB 1VYOA 3LHNA 2CBRA 3C78X 3HPEA 3KFHA 3WJBA 1E00A 4ZFXA 4DQ4A 2X32A 5H9LA 5B2AO 2EU7X 2HLVA 3JSQA 4IRWA 1HQPA 1RLBE 3FA6A 3PH6A 4FBVA 3OJYC 1EXSA 3QKGA 3T1DA 4OMWA 4YCHA 4A8ZA 3STKA 3FR5A 1TOUA 2G5LA 2BHVA 1JJJA 1QFTA 1SWFA 3PQUA 5EDCA 2RTJA 1FE3A 1XCAA 4AZRA 3HWGA 1JQPA 1P6PA 1TOWA 2OF9A 2OL8O 1JV4A 4KT5A 2DM5A 3D9WA 3MX7A 3O19A 1MOYA 1W5RA 3O2YA 5KIDA 1LIDA 3B2KA 1QABE 4ORSA 4QYNA 4O4OA 4Y0SA 4Z2VA 1I4UA 2AT0X 3SLTA 1ZNKA 4IMOA 2QO5A 3EC5A 2X55A 1AVGI 4NLIA 3CBCA 1HN2A 2HZQA 2QOMA 2GTLM 2OY8A 4HPDA 2AF5A 4LKPA 1AELA 4GRJA 2DJGA 2AT3X 1QWDA 1Y52X 4O3ZA 1GT4A 1IIUA 5IRAA 4AZMA 1HQQA 1CBRA 4I6SA 5H9KA 1YWAA 4GH7A 5CHKA 3I17A 1SWQA 4CV7A 4CPHA 4COTA 3X00A 1LIFA 4GGRA 4QGVA 4Y0QA 4YBUA 3VE2A 3RE6A 1PMPA 4FBOA 2HKDA 1KGLA 1LFOA 2Z4IA 2QOSC 4ID2A 2IZEB 4XMFA 3U9PC 2FLJA 1E2TA 2MM3A 3SOTA 5HWZA 1LNMA 1N43A 3FW5A 4HPBA 4JNJA 4MVIA 4NYRA 4OEMA 5DG4A 3V8UA 1TW4A 2IZIA 3VGWA 4ZHCA 1B4MA 1VYGA 1TVQA 3B2JA 1DV9A 2WQ9A 3PEDA 1GKAB 3FELA 1O1UA 2A5BA 2LB6A 3ZUIA 3AKMA 3OD9A 2G78A 2AMMX 4EEJA 1NP4A 3P6CA 1SWBA 3K3LA 3HOEA 4UU3A 1A3YA 1E06A 1N9YA 2A0AA 2BSZA 1SMPI 1QFVA 2RTMA 1VWLB 5D4AA 2RQ0A 1EQDA 1UREA 3FDCA 4JHQA 5F7GA 1OSPO 1MX8A 1ICMA 5BVQA 2AKQA 4YH0A 3WZNA 3CQNA 4WBKA 2JN3A 3TGCA 1JJUA 3MVFA 4L1NA 1KFFA 4WHIA 2NNQA 2KTDA 3BX7A 3F9DA 1SLFB 3B2IA 3HWDA 1AVEA 2FR3A 4TJZA 1HXLA 3GE2A 5HA0A 1B0OA 5K68A 2X8SA 1SY3A 2HNXA 3S5VA 2ZSCA 1SWJA 1SWAA 1VWFB 1AB0A 1JJXA 5FQ6E 2BS6A 3JS1A 2VFCA 1SWEA 4Z6JA 3FIDA 4I9SA 4TNNA 3FA8A 4GZVA 2OL7A 5B5GA 3NX1A 1I9HA 3MG5A 4YDBA 5IO5A 3STMX 1A57A 4M6SA 2HYSA 3EBWA 4BX5B 1Y9LA 1TXLA 2RTIB 5F1EA 2UYWA 3ZZVA 4AW8A 1VWDB 3BY0A 1S7DA 3WJGA 2A8GA 2LBVA 1EALA 1MDCA 4Y59A 2C4IA 4XMCA 4U3QA 1DZJA 2BT9A 2MO5A 4KCAA 4BJ8A 1O1VA 3RZYA 5EEDA 1BM5A 2IZBA 4EQAC 1MVGA 2R73A 1RSUB 2YMSA 3PK2A 4ORXA 5JD2A 5CYBA 2OF8A 1BSYA 1HBPA 1UZ2X 4ORYA 1Z24A 4TKBA 4ZHDA 4ZHHA 4YBPA 1DZPA 2QM9A 3FEPA 3P02A 3T2WA 2A2GA 3HTYA 2W2FA 1FEMA 1LCWA 4MEEA 1H91A 2FR2A 1U0XA 2NNDA 4LZVA 1SWPA 4AZQA 3CR6A 1QY2A 1VWNB 2Q39A 4QZTA 4YMYA 4BBOA 2RTKA 5FQ8E 5HTEA 2ALLX 1RBPA 4TLJA 4KC8A 5HZ8A 1RXJA 1KT6A 3BU1A 2QO4A 3P6GA 5HCDC 3UEWA 4ES7A 1GX8A 1STRB 3CMPA 3WOVA 1SREA 2AL0X 3O22A 1UYOX 3IA8A 1SA8A 1LCVA 1SWDA 1KT5A 3HWEA 4WFUA 4ZH6A 5LKEA 4GK9A 1KT7A 1SXYA 3BDRA 5CE4A 2GTLO 2RTCB 4ZGUA 3PH5A 1X8QA 4ALBA 5D48A 1LIBA 4N7CA 3VPJE 5D8JA 5D47A 3VG7A 3NQ9A 4ZH9A 1SRIA 4NYQA 4ZHFA 2AT8X 2JOZA 3ZW1A 1I04A 2LFOA 2PY1A 3PDFA 1MK5A 5HZQA 4GU8A 1YWCA 1SWHA 3VG5A 1G7NA 2WUTA 3GAQA 1VWGB 2RTPB 1SXXA 3FA9A 4ORRA 3TGAA 3VE1A 4MIRA 4AZOA 1EUOA 2JMBA 1A2DA 2AH7X 1VWBB 1QG5A 4AYHA 4BCSA 5IRUA 2FKGA 1AVDA 1GXAA 1W4TA 4YKMA 4NNSA 3VG4A 4AZNA 1SLDB 2Y3EA 1ZRYA 4TKHA 3P6DA 4KIIA 1LIEA 2QCBA 1NBXA 3FR2A 4K19A 4OS3A 4QZUA 2WR6A 1I78A 2RTRB 4O3WA 5FFHA 1SWOA 1KOIA 1VWAB 2RTBB 1RXHA 4IB6A 4TQ2A 2A5CA 1HMRA 5HZ5A 1VWPB 5K67A 1VWQB 5L8OA 1BEBA 1FDQA 2A2UA 1STPA 2YG2A 5CSEA 2RCTA 4N7DA 3SLOA 3P24A 1FJ1E 2RD7C 5JR8A 1KZWA 1ZNDA 2BC3A 2X34A 3BU9A 5B29A 3TF6A 1CBQA 1XKIA 2IZHB 1SWTA 2LA7A 2WSJA 1SWKA 4FQBB 4Y5DA 1EIOA 1NGLA 1L6MA 2OZQA 4OS0A 3FIQA 3N91A 3WZOA 4D6AA 3FLLA 3STNA 2RTEB 2QMIA 2LKKA 1KZXA 1Y0GA 1BSQA 4O4SA 4U8UM 5F6ZA 3HWFA 4YCEA 3DSZA 1ZNLA 3ZQ3A 1KQWA 2GH7A 5LJEA 4BX7B 5IRWA 1SWCA 2K62A 1BSOA 2MJIA 2F01A 3AKNA 4GJSA 3EMMA 3WJCA 1GM6A 2FHLA 3PP6A 3WZQA 5FAZA 5B11O 4BQUA 5H9NA 2C1SA 2GC9A 3ZI8A 1R0UA 5B5FA 5BYPA 1U18A 4NNTA 2ACPX 3APUA 4QGXA 4A60A 1SWGA 2I5ZO 1G85A 1SWRA 3KFFA 4EFGA 4EKVA 5LJCA 1EI5A 5AJBA 2ANSA 2WEXA 4B55A 3C77X 3F6ZB 3EBKA 3OE3A 1GKAA 1KT4A 2G8CO 5FQ7E 4BOEA 1T68X 2Q4NA 3ZW2A 1EIIA 1A18A 1B8EA 2IZLB 2RTOB 3UEUA 5IO6A 4UU2A 2OY1O 2X46A 4TKJA 2X8FA 1Y53X 2RTHB 4CDCA 3NADA 5B3MO 4MVKA 4ON1A 1E02A 4BX7A 1BLRA 2MWHA 4RUUA 3NR3A 1BRPA 2ZAGA 1KT3A 1YP6A 3H3IA 1OPBA 2ASNX 3WYPA 2CZTA 2L9CA 5F6BA 1D2UA 1LCZA 1WUBA 3BS2A 3WYQA 3S5XA 3RDXA 2FGSA 1PM1X 5H8TA 2NNEA 1VYFA 1IJ8A 3C76X 1SY0A 3CBSA 3CWKA 4ARHA 4ZHGA 2KW1A 2RTNB 3KZAA 3D4RA 4CDFA 1LKEA 5H9AA 2G7BA 4CPEA 1SRFA 3SZJA 1E5PA 3RWXA 4YDAA 5AJCA 4HPAA 1CBSA 2ACOA 2JU3A 2GTLN 1LELA 2HMBA 4FGIB 1SWLA 4BX5A 1N0SA 2JU7A 2WPUA 3KVNA 2L68A 2OFRX 5L3YA 4YKOA 2A3FX 3MBTA 4GKCA 1RSTB 2K23A 2NP1A 2DJFA 1JMXA 4R0BA 2MHDA 4BX6B 4IB8A 1PEEA 3S26A 1FENA 1HY2A 3NQ3A 2XKLA 5C0NA 4OS8A 1BRQA 2LBAA 1NP1A 2IZGB 2Y32A 3I0AA 3RY2A 4YFQA 3MM0A 3ELXA 3Q6LA 4C5PA 2OVSA 3CKGA 3LTWA 2VDFA 3NP1A 3ZW0B 4CPFA 3T6FA 4O4XA 4GDAA 4MVLA 1JZUA 2BS5A 3FMZA 1DFVA 1VWJB 4NLJA 4Y0PA 4U9CA 2W2BA 3ZUOA 3ZWEA 4QYPA 1VWIB 2Y3FA 1MUPA 3ELZA 3FYFA 3RDQA 3VHIA 1SY1A 3QQ2A 3BX8A 4O49A 1CJ5A 1JYDA 4ORWA 1VWOB 2OFBA 4QGWA 5HZ6A 4O3YA 1OEJA 1NQMA 2RTDB 2AT5X 3E3CA 4XMEA 4YGGA 2A13A 4AZPA 1PBOA 2CZUA 4EXZA 4GGZA 4OMXA 4ZR2A 4PSQA 3T2XA 1SY2A 1KL4A 2FS6A 4ZCBA 3RDSA 1ICNA 4ML7B 4ODDA 4U8UO 3T6LA 3ZW0A 5HAEA 1SWUA 3APXA 1OBQA 5EEEA 4Z28A 3PPTA 1JIWI 3S60A 2OYBO 3RY1A 3U0DA 2R56A 1KXOA 3F8AA 3JQOA 5LJGA 1WBIA 1LDQA 1I05A 3KFGA 2JGSA 3EW1A 1VWHB 2E4JA 1DZKA 2GJ5A 2ZAIA 3B2LA 3SZHA 4A1HA 4BVMA 1VWRB 4EDEA 3FR4A 1GT3A 1OPAA 2X56A 2N93A 4CPIA 4D6BA 1G5WA 2RTQB 5LKFA 4BGFA 1X8OA 4KC7A 3APVA 3HOLA 2RN4A 1SRGA 3D96A 1VWMB 3TZSA 1NQNA 4GNYA 3WVMA 1LF7A 2POAA 4JO6A 2AT6X 4LKTA 3AUMO 3BRNA 1DC9A 1LICA 3RDMA 4PJ2A 2CBSA 5HZ9A 1ALBA 3RKGA 1S2PA 3PECA 1O8VA 3NX2A 1SXWA 4O4UA 1CRBA 4CPHB 1STSB 1SWNA 4WFVA 5BVTA 2FHNX 2R74A 4IBAA 3B2HA 4IAWA 1T0VA 3VG3A 3VHHA 4CSBA 4QQ1A 2OY5O 5FENA 1YUPA 3RDOA 2MF6A 3PQSA 2OY7A 1EPAA 5F2BA 4A1YA 2Q9SA
chains in the Genus database with same CATH topology
2HZRA 4I95A 1QQSA 4HPCA 3WJEA 4Y0RA 5KHPA 2FT9A 1I06A 4KH8A 2CM9A 4HFOA 4FBRA 4O9SA 3D95A 5AQ6A 5K06A 1HMSA 1CBIA 3FENA 2FWVA 5EPQA 3U03A 1LPJA 1YIVA 4CK4A 2BLGA 1JYJA 1ADLA 4INNA 3UEVA 1BJ7A 2RCQA 3TGBA 5KICA 1X8UA 1X89A 1ERXA 3WXQA 1X71A 2CM4A 4GETA 4NW4A 3UEXA 1U17A 3VG2A 5LJBA 3D97A 3OBLA 4XMGA 2FTBA 2WQAE 1ZNEA 1T8VA 1DF3A 1IKEA 5EDBA 4ZGFA 2Q2MA 4IB7A 2GTFX 3BSZE 4YGZA 1Y9TA 5HCEC 1YWBA 3L4RA 5L8IA 4YFPA 1YWDA 1OEKA 1FTPA 1GT1A 1IFBA 3P6HA 3FEKA 3HK1A 4IABA 2Q2PA 4RUNA 3FA7A 1HBQA 4DQ3A 4ZJ0A 2L5PA 4O3XB 3EM0A 3P6EA 3DTQA 3FW4A 4HWMA 2L67A 4ORUA 5HA1A 3SAOA 2QO6A 5HCCC 3WBGA 3NQKA 4LQZA 1FELA 4JGLA 2WEWA 4LZUA 1MX7A 4QNIA 3EYCA 5B27A 3NPOA 1X8NA 1G74A 4MISA 1GX9A 2OVAA 4IB9A 5BVSA 4L3RA 3WJDA 4GNWA 2W2AA 2FRSA 2JU8A 5EZ2A 5F58A 3KFIA 5HTDA 1SXUA 3IFBA 3LV4A 1DZMA 4M7MA 5LJHA 5HBSA 3CQRA 2KD2A 2KT4B 1IFCA 1HMTA 2O62A 1AQBA 1VPRA 3BLGA 4NP1A 1S44A 2X45A 3KQ0A 4IAXA 2P8GA 2KTSA 4GDZA 4XMDA 4QAEA 3VU1A 1KQXA 2Z4HA 1ZNGA 2FS7A 4U8UN 2OFMX 4I3BA 1ERBA 1GGLA 4I3DA 1QY0A 3P6FA 2RA6A 1IKJA 2JW1A 3APWA 5LJKA 1D3SA 4YGHA 5IO7A 1B56A 2X8TA 2G79A 1ACDA 1BWYA 2OVDA 3WJFA 3ZW1B 5LJDA 1X8PA 1YP7A 3RBYA 3UAQA 3RSWA 5L8NA 4QRLA 5DPQA 1ML7A 5AEOA 2IFBA 1EW3A 1GT5A 3G7XA 1JBHA 1OBUA 1OBPA 4IMNA 4GE1A 4MVEA 4I9RA 1OEEA 1EPBA 3VG6A 2F73A 2M4LA 4XMHA 1QY1A 1ZNHA 4I3CA 4YFRA 1IW2A 2WWPA 4ALOA 2XSTA 2F09A 1BBPA 2OVEA 3NBXX 3LHNA 2CBRA 3C78X 3KFHA 3WJBA 1E00A 4ZFXA 4DQ4A 5H9LA 2EU7X 2HLVA 3JSQA 1HQPA 1RLBE 3FA6A 3PH6A 4FBVA 3OJYC 1EXSA 3QKGA 3T1DA 4OMWA 4YCHA 4A8ZA 3STKA 3FR5A 1TOUA 2BHVA 1JJJA 1QFTA 3PQUA 5EDCA 1FE3A 1XCAA 4AZRA 3HWGA 1P6PA 1TOWA 4KT5A 1JV4A 2DM5A 3MX7A 3O19A 5KIDA 3O2YA 1LIDA 3B2KA 1QABE 4ORSA 4QYNA 4O4OA 4Y0SA 1I4UA 2AT0X 1ZNKA 4IMOA 2QO5A 4NLIA 1AVGI 5D45A 3CBCA 1HN2A 2HZQA 4HPDA 2GTLM 4LKPA 1AELA 4GRJA 2AT3X 1QWDA 4O3ZA 1GT4A 1IIUA 4AZMA 4I6SA 1CBRA 5H9KA 1YWAA 4GH7A 3I17A 4CV7A 4COTA 1LIFA 4QGVA 4Y0QA 4YBUA 3VE2A 1PMPA 4FBOA 1KGLA 1LFOA 2Z4IA 2QOSC 4ID2A 4XMFA 3U9PC 5HWZA 2FLJA 2MM3A 3SOTA 1LNMA 4MVIA 3FW5A 4HPBA 4NYRA 3V8UA 5DG4A 4ZHCA 1TW4A 1B4MA 1VYGA 1TVQA 3B2JA 1DV9A 2WQ9A 3PEDA 1GKAB 3FELA 1O1UA 2LB6A 3ZUIA 3AKMA 3OD9A 2G78A 2AMMX 4EEJA 1NP4A 3P6CA 3K3LA 4UU3A 3HOEA 1A3YA 1E06A 2A0AA 1SMPI 1QFVA 5D4AA 2RQ0A 1EQDA 1UREA 5F7GA 5BVQA 1MX8A 1ICMA 2AKQA 4YH0A 3CQNA 4WBKA 2JN3A 3TGCA 3MVFA 4L1NA 4WHIA 2NNQA 2KTDA 3BX7A 3F9DA 3B2IA 3HWDA 2FR3A 4TJZA 5HA0A 3GE2A 1B0OA 2X8SA 1SY3A 2HNXA 3S5VA 1JJXA 1AB0A 5FQ6E 2BS6A 3JS1A 4I9SA 4TNNA 3FA8A 4GZVA 3NX1A 4YDBA 5IO5A 3STMX 1A57A 4M6SA 2HYSA 3EBWA 1Y9LA 1TXLA 5F1EA 3ZZVA 4AW8A 3BY0A 1S7DA 3WJGA 2LBVA 1EALA 1MDCA 4XMCA 4U3QA 1DZJA 2BT9A 2MO5A 4KCAA 1O1VA 3RZYA 5EEDA 1BM5A 4EQAC 1MVGA 2R73A 2YMSA 4ORXA 5CYBA 4TKBA 1BSYA 1HBPA 1UZ2X 4ORYA 1Z24A 4ZHDA 4ZHHA 4YBPA 1DZPA 2QM9A 3FEPA 3P02A 2A2GA 3HTYA 2W2FA 1FEMA 1H91A 2FR2A 1U0XA 2NNDA 4LZVA 4AZQA 3CR6A 1QY2A 4QZTA 2Q39A 4YMYA 5FQ8E 5HTEA 2ALLX 1RBPA 4TLJA 4KC8A 5HZ8A 1KT6A 3BU1A 2QO4A 3P6GA 5HCDC 3UEWA 4ES7A 1GX8A 3CMPA 3WOVA 2AL0X 3O22A 4WFUA 3IA8A 1SA8A 3HWEA 4ZH6A 1KT5A 5LKEA 4GK9A 1KT7A 1SXYA 3BDRA 5CE4A 2GTLO 4ZGUA 3PH5A 1X8QA 4ALBA 5D48A 1LIBA 4N7CA 3VPJE 5D8JA 5D47A 3VG7A 3NQ9A 4ZH9A 4NYQA 4ZHFA 2AT8X 2JOZA 3ZW1A 1I04A 2LFOA 2PY1A 5HZQA 4GU8A 1YWCA 3VG5A 1G7NA 2WUTA 3GAQA 3FA9A 4ORRA 1SXXA 3TGAA 4AZOA 3VE1A 4MIRA 1EUOA 2JMBA 1A2DA 2AH7X 1QG5A 4AYHA 1GXAA 4YKMA 3VG4A 4NNSA 4AZNA 4TKHA 1ZRYA 3P6DA 4KIIA 1LIEA 3FR2A 4OS3A 4K19A 5FFHA 4QZUA 2WR6A 4O3WA 1KOIA 4IB6A 4TQ2A 1HMRA 5HZ5A 5L8OA 1BEBA 1FDQA 2A2UA 2YG2A 2RCTA 4N7DA 3P24A 2RD7C 5JR8A 1KZWA 1ZNDA 3BU9A 5B29A 3TF6A 1CBQA 1XKIA 2LA7A 2WSJA 4FQBB 1EIOA 1NGLA 1L6MA 2OZQA 4OS0A 3FIQA 3N91A 4D6AA 3FLLA 3STNA 2QMIA 2LKKA 1KZXA 1BSQA 4O4SA 4U8UM 5F6ZA 3HWFA 4YCEA 3DSZA 1ZNLA 3ZQ3A 1KQWA 5LJEA 2K62A 1BSOA 2MJIA 3AKNA 3EMMA 3WJCA 1GM6A 3PP6A 5FAZA 4BQUA 5H9NA 2GC9A 3ZI8A 5BYPA 1R0UA 1U18A 4NNTA 2ACPX 3APUA 4QGXA 4A60A 1G85A 3KFFA 4EFGA 5LJCA 1EI5A 5AJBA 2ANSA 2WEXA 3C77X 3F6ZB 3EBKA 3OE3A 1GKAA 1KT4A 5FQ7E 4BOEA 1T68X 2Q4NA 3ZW2A 1EIIA 1A18A 1B8EA 3UEUA 5IO6A 4UU2A 2X46A 4TKJA 2X8FA 3NADA 4MVKA 4ON1A 1E02A 1BLRA 2MWHA 4RUUA 3NR3A 1BRPA 2ZAGA 1KT3A 1YP6A 3H3IA 1OPBA 2ASNX 2CZTA 2L9CA 5F6BA 1D2UA 3BS2A 3S5XA 1PM1X 5H8TA 2NNEA 1VYFA 3C76X 1SY0A 3CBSA 3CWKA 4ARHA 4ZHGA 2KW1A 3KZAA 3D4RA 1LKEA 2G7BA 1E5PA 3RWXA 4YDAA 5AJCA 4HPAA 1CBSA 2ACOA 2JU3A 2GTLN 2HMBA 4FGIB 1N0SA 2JU7A 2L68A 2OFRX 4YKOA 2A3FX 3MBTA 4GKCA 2K23A 2NP1A 4R0BA 2MHDA 4IB8A 1PEEA 3S26A 1FENA 3NQ3A 2XKLA 5C0NA 4OS8A 1BRQA 2LBAA 1NP1A 3I0AA 4YFQA 3ELXA 3Q6LA 2OVSA 3NP1A 3ZW0B 4O4XA 1JZUA 4MVLA 2BS5A 3FMZA 1DFVA 4NLJA 3ZUOA 4Y0PA 4U9CA 2W2BA 3ZWEA 4QYPA 1MUPA 3ELZA 3FYFA 1SY1A 3BX8A 4O49A 1CJ5A 1JYDA 4ORWA 5HZ6A 4QGWA 4O3YA 1OEJA 4XMEA 2AT5X 3E3CA 4YGGA 2A13A 4AZPA 1PBOA 2CZUA 4EXZA 4OMXA 4ZR2A 4PSQA 1SY2A 2FS6A 4ZCBA 1ICNA 4ML7B 4ODDA 4U8UO 5HAEA 3ZW0A 3APXA 1OBQA 5EEEA 3PPTA 1JIWI 3S60A 3U0DA 2R56A 1KXOA 3F8AA 3JQOA 5LJGA 3KFGA 1I05A 2GJ5A 2E4JA 1DZKA 2ZAIA 3B2LA 4BVMA 4A1HA 4EDEA 3FR4A 1GT3A 1OPAA 2N93A 4D6BA 1G5WA 5LKFA 1X8OA 4KC7A 3APVA 3HOLA 2RN4A 3TZSA 3D96A 4GNYA 3WVMA 1LF7A 2POAA 4LKTA 2AT6X 3BRNA 1DC9A 1LICA 4PJ2A 2CBSA 5HZ9A 1ALBA 3RKGA 1S2PA 3PECA 1O8VA 3NX2A 1SXWA 4O4UA 1CRBA 4WFVA 5BVTA 2R74A 4IBAA 3B2HA 4IAWA 1T0VA 3VG3A 4CSBA 4QQ1A 5FENA 1YUPA 3PQSA 1EPAA 5H9AA 4A1YA 2Q9SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HZR A;  1QQS A;  4HPC A;  3WJE A;  4Y0R A;  5KHP A;  2FT9 A;  1I06 A;  2CM9 A;  4HFO A;  4O9S A;  3D95 A;  5AQ6 A;  5K06 A;  1HMS A;  1CBI A;  3FEN A;  2FWV A;  5EPQ A;  3U03 A;  1LPJ A;  1YIV A;  4CK4 A;  2BLG A;  1JYJ A;  1ADL A;  3UEV A;  1BJ7 A;  2RCQ A;  3TGB A;  5KIC A;  1X8U A;  1X89 A;  1ERX A;  3WXQ A;  1X71 A;  2CM4 A;  4GET A;  3UEX A;  1U17 A;  3VG2 A;  5LJB A;  3D97 A;  4XMG A;  2FTB A;  2WQA E;  1ZNE A;  1T8V A;  1DF3 A;  1IKE A;  5EDB A;  2Q2M A;  4IB7 A;  2GTF X;  3BSZ E;  4YGZ A;  5HCE C;  1YWB A;  3L4R A;  5L8I A;  4YFP A;  1YWD A;  1OEK A;  1FTP A;  1GT1 A;  1IFB A;  3P6H A;  3FEK A;  3HK1 A;  4DQ3 A;  2Q2P A;  4RUN A;  3FA7 A;  1HBQ A;  4ZJ0 A;  2L5P A;  3EM0 A;  3P6E A;  3DTQ A;  3FW4 A;  5HA1 A;  2L67 A;  4ORU A;  3SAO A;  5HCC C;  2QO6 A;  3WBG A;  1FEL A;  2WEW A;  4LZU A;  1MX7 A;  3EYC A;  5B27 A;  3NPO A;  1X8N A;  1G74 A;  1GX9 A;  2OVA A;  4IB9 A;  5BVS A;  3WJD A;  4GNW A;  2W2A A;  2FRS A;  2JU8 A;  5EZ2 A;  5F58 A;  3KFI A;  5HTD A;  1SXU A;  3IFB A;  4M7M A;  1DZM A;  5LJH A;  5HBS A;  3CQR A;  2KT4 B;  1IFC A;  1HMT A;  2O62 A;  1AQB A;  1VPR A;  3BLG A;  4NP1 A;  1S44 A;  2X45 A;  3KQ0 A;  4IAX A;  2P8G A;  4XMD A;  4QAE A;  1KQX A;  1ZNG A;  2FS7 A;  2OFM X;  4I3B A;  1ERB A;  1GGL A;  4I3D A;  1QY0 A;  3P6F A;  2RA6 A;  1IKJ A;  3APW A;  5LJK A;  1D3S A;  4YGH A;  5IO7 A;  1B56 A;  2G79 A;  1ACD A;  1BWY A;  2OVD A;  3WJF A;  5LJD A;  1X8P A;  1YP7 A;  3RSW A;  5L8N A;  5DPQ A;  1ML7 A;  2IFB A;  1EW3 A;  1GT5 A;  3G7X A;  1JBH A;  1OBU A;  1OBP A;  4IMN A;  4GE1 A;  4I9R A;  1OEE A;  1EPB A;  3VG6 A;  2F73 A;  4XMH A;  1QY1 A;  1ZNH A;  4I3C A;  4YFR A;  1IW2 A;  2WWP A;  4ALO A;  2XST A;  1BBP A;  2OVE A;  2CBR A;  3C78 X;  3KFH A;  3WJB A;  1E00 A;  4ZFX A;  4DQ4 A;  5H9L A;  2EU7 X;  2HLV A;  3JSQ A;  1HQP A;  1RLB E;  3FA6 A;  3PH6 A;  3OJY C;  1EXS A;  3QKG A;  3T1D A;  4OMW A;  4YCH A;  4A8Z A;  3STK A;  3FR5 A;  1TOU A;  1JJJ A;  1QFT A;  5EDC A;  1FE3 A;  1XCA A;  4AZR A;  3HWG A;  1P6P A;  1TOW A;  1JV4 A;  2DM5 A;  3O19 A;  5KID A;  3O2Y A;  1LID A;  3B2K A;  1QAB E;  4ORS A;  4QYN A;  4Y0S A;  1I4U A;  2AT0 X;  1ZNK A;  4IMO A;  2QO5 A;  4NLI A;  1AVG I;  5D45 A;  3CBC A;  1HN2 A;  2HZQ A;  4HPD A;  4LKP A;  1AEL A;  4GRJ A;  2AT3 X;  1QWD A;  1GT4 A;  1IIU A;  4AZM A;  1CBR A;  5H9K A;  1YWA A;  4GH7 A;  3I17 A;  1LIF A;  4QGV A;  4Y0Q A;  4YBU A;  1PMP A;  1KGL A;  1LFO A;  2QOS C;  4XMF A;  3U9P C;  5HWZ A;  2FLJ A;  2MM3 A;  1LNM A;  4MVI A;  3FW5 A;  4HPB A;  4NYR A;  5DG4 A;  4ZHC A;  1TW4 A;  1B4M A;  1VYG A;  1TVQ A;  3B2J A;  1DV9 A;  2WQ9 A;  3PED A;  1GKA B;  3FEL A;  1O1U A;  2LB6 A;  3ZUI A;  3AKM A;  2G78 A;  2AMM X;  4EEJ A;  1NP4 A;  3P6C A;  3K3L A;  4UU3 A;  1A3Y A;  1E06 A;  2A0A A;  1QFV A;  5D4A A;  2RQ0 A;  1EQD A;  1URE A;  5F7G A;  5BVQ A;  1MX8 A;  1ICM A;  2AKQ A;  4YH0 A;  3CQN A;  4WBK A;  2JN3 A;  3TGC A;  3MVF A;  2NNQ A;  2KTD A;  3BX7 A;  3F9D A;  3B2I A;  3HWD A;  2FR3 A;  4TJZ A;  5HA0 A;  1B0O A;  1SY3 A;  2HNX A;  1JJX A;  1AB0 A;  3JS1 A;  4I9S A;  4TNN A;  3FA8 A;  3NX1 A;  4YDB A;  5IO5 A;  3STM X;  1A57 A;  4M6S A;  2HYS A;  3EBW A;  1TXL A;  5F1E A;  4AW8 A;  3BY0 A;  1S7D A;  3WJG A;  2LBV A;  1EAL A;  1MDC A;  4XMC A;  1DZJ A;  2MO5 A;  1O1V A;  3RZY A;  5EED A;  1BM5 A;  1MVG A;  2R73 A;  4ORX A;  4TKB A;  1BSY A;  1HBP A;  1UZ2 X;  4ORY A;  1Z24 A;  4ZHD A;  4ZHH A;  4YBP A;  1DZP A;  2QM9 A;  3FEP A;  2A2G A;  2W2F A;  1FEM A;  1H91 A;  2FR2 A;  1U0X A;  2NND A;  4LZV A;  4AZQ A;  3CR6 A;  1QY2 A;  4QZT A;  2Q39 A;  4YMY A;  5HTE A;  2ALL X;  1RBP A;  4TLJ A;  5HZ8 A;  1KT6 A;  3BU1 A;  2QO4 A;  3P6G A;  5HCD C;  3UEW A;  4ES7 A;  1GX8 A;  3CMP A;  2AL0 X;  3O22 A;  4WFU A;  3IA8 A;  1SA8 A;  3HWE A;  4ZH6 A;  1KT5 A;  5LKE A;  1KT7 A;  1SXY A;  3BDR A;  5CE4 A;  4ZGU A;  3PH5 A;  1X8Q A;  4ALB A;  5D48 A;  1LIB A;  4N7C A;  5D8J A;  5D47 A;  3VG7 A;  3NQ9 A;  4ZH9 A;  4NYQ A;  4ZHF A;  2AT8 X;  2JOZ A;  1I04 A;  2LFO A;  2PY1 A;  5HZQ A;  1YWC A;  3VG5 A;  1G7N A;  2WUT A;  3GAQ A;  3FA9 A;  4ORR A;  1SXX A;  3TGA A;  4AZO A;  1EUO A;  1A2D A;  2AH7 X;  1QG5 A;  4AYH A;  1GXA A;  4YKM A;  3VG4 A;  4NNS A;  4AZN A;  4TKH A;  1ZRY A;  3P6D A;  4KII A;  1LIE A;  3FR2 A;  4OS3 A;  4K19 A;  5FFH A;  4QZU A;  2WR6 A;  1KOI A;  4IB6 A;  4TQ2 A;  1HMR A;  5HZ5 A;  5L8O A;  1BEB A;  1FDQ A;  2A2U A;  2YG2 A;  2RCT A;  4N7D A;  2RD7 C;  5JR8 A;  1KZW A;  1ZND A;  3BU9 A;  5B29 A;  3TF6 A;  1CBQ A;  1XKI A;  2WSJ A;  1EIO A;  1NGL A;  1L6M A;  2OZQ A;  4OS0 A;  3FIQ A;  4D6A A;  3FLL A;  3STN A;  2LKK A;  1KZX A;  1BSQ A;  5F6Z A;  3HWF A;  4YCE A;  3DSZ A;  1ZNL A;  3ZQ3 A;  1KQW A;  5LJE A;  2K62 A;  1BSO A;  2MJI A;  3AKN A;  3EMM A;  3WJC A;  1GM6 A;  3PP6 A;  5FAZ A;  4BQU A;  5H9N A;  2GC9 A;  1R0U A;  1U18 A;  4NNT A;  2ACP X;  3APU A;  4QGX A;  4A60 A;  1G85 A;  3KFF A;  4EFG A;  5LJC A;  2ANS A;  2WEX A;  3C77 X;  3EBK A;  4BOE A;  1GKA A;  1KT4 A;  1T68 X;  2Q4N A;  1EII A;  1A18 A;  1B8E A;  3UEU A;  5IO6 A;  4UU2 A;  2X46 A;  4TKJ A;  3NAD A;  4MVK A;  1E02 A;  1BLR A;  4RUU A;  3NR3 A;  1BRP A;  1KT3 A;  1YP6 A;  1OPB A;  2ASN X;  2CZT A;  2L9C A;  5F6B A;  1D2U A;  3BS2 A;  1PM1 X;  5H8T A;  2NNE A;  1VYF A;  3C76 X;  1SY0 A;  3CBS A;  3CWK A;  4ARH A;  4ZHG A;  3KZA A;  1LKE A;  2G7B A;  1E5P A;  4YDA A;  4HPA A;  1CBS A;  2ACO A;  2JU3 A;  2HMB A;  1N0S A;  2JU7 A;  2L68 A;  2OFR X;  4YKO A;  2A3F X;  3MBT A;  4GKC A;  2K23 A;  2NP1 A;  4R0B A;  4IB8 A;  1PEE A;  3S26 A;  1FEN A;  3NQ3 A;  2XKL A;  5C0N A;  4OS8 A;  1BRQ A;  2LBA A;  1NP1 A;  3I0A A;  4YFQ A;  3ELX A;  3Q6L A;  3NP1 A;  1JZU A;  4MVL A;  3FMZ A;  1DFV A;  4NLJ A;  3ZUO A;  4Y0P A;  2W2B A;  4QYP A;  1MUP A;  3ELZ A;  1SY1 A;  3BX8 A;  1CJ5 A;  1JYD A;  4ORW A;  5HZ6 A;  4QGW A;  1OEJ A;  4XME A;  2AT5 X;  4YGG A;  2A13 A;  4AZP A;  1PBO A;  2CZU A;  4EXZ A;  4OMX A;  4ZR2 A;  4PSQ A;  1SY2 A;  2FS6 A;  4ZCB A;  1ICN A;  4ODD A;  5HAE A;  3APX A;  1OBQ A;  5EEE A;  3PPT A;  3U0D A;  2R56 A;  1KXO A;  3F8A A;  5LJG A;  3KFG A;  1I05 A;  2GJ5 A;  2E4J A;  1DZK A;  3B2L A;  4BVM A;  4A1H A;  4EDE A;  3FR4 A;  1GT3 A;  1OPA A;  2N93 A;  4D6B A;  1G5W A;  5LKF A;  1X8O A;  3APV A;  3TZS A;  3D96 A;  4GNY A;  3WVM A;  1LF7 A;  2POA A;  4LKT A;  2AT6 X;  3BRN A;  1DC9 A;  1LIC A;  2CBS A;  5HZ9 A;  1ALB A;  1S2P A;  3PEC A;  1O8V A;  3NX2 A;  1SXW A;  1CRB A;  4WFV A;  5BVT A;  2R74 A;  4IBA A;  3B2H A;  4IAW A;  1T0V A;  3VG3 A;  5FEN A;  1YUP A;  1EPA A;  5H9A A;  4A1Y A;  2Q9S A; 
#chains in the Genus database with same CATH topology
 2HZR A;  4I95 A;  1QQS A;  4HPC A;  2UZ2 A;  3WJE A;  4Y0R A;  4YVB A;  5KHP A;  2OFA A;  2FT9 A;  1I06 A;  1RXK A;  2RTA A;  4KH8 A;  2CM9 A;  4HFO A;  4FBR A;  4O9S A;  3D95 A;  1MM9 A;  5AQ6 A;  4Z2P A;  5K06 A;  4CDD A;  2X4M A;  4I60 A;  3RDU A;  1SWS A;  1HMS A;  1CBI A;  3FEN A;  2FWV A;  5EPQ A;  3U03 A;  1LPJ A;  1YIV A;  4CK4 A;  2BLG A;  1JYJ A;  1ADL A;  3CKF A;  4INN A;  1BJ7 A;  1MEP A;  2RCQ A;  4U46 A;  3UEV A;  3TGB A;  5KIC A;  1HXZ A;  1X8U A;  1X89 A;  1ERX A;  2IZA A;  1X71 A;  2CM4 A;  4GET A;  3WXQ A;  2C1Q A;  4NW4 A;  3SZI A;  3UEX A;  1U17 A;  3VG2 A;  5LJB A;  3D97 A;  3OBL A;  4XMG A;  2FTB A;  2WQA E;  1ZNE A;  1T8V A;  1DF3 A;  1IKE A;  1NDJ A;  5EDB A;  2Q2M A;  4ZGF A;  4IB7 A;  1PTS A;  2GTF X;  3BSZ E;  4YGZ A;  4GD9 A;  1Y9T A;  5HCE C;  1YWB A;  3L4R A;  5L8I A;  4YFP A;  1YWD A;  1OEK A;  1FTP A;  1GT1 A;  1LDO A;  1IFB A;  1SRH A;  1GX3 A;  3FEK A;  3HK1 A;  3P6H A;  2Q2P A;  1Y55 X;  3FA7 A;  1HBQ A;  4IAB A;  4NV8 A;  4RUN A;  5D45 A;  4ZJ0 A;  3AEH A;  2L5P A;  1UYN X;  4O3X B;  3EM0 A;  3P6E A;  3DTQ A;  3FW4 A;  1K3B A;  2L67 A;  4HWM A;  4ORU A;  2RTF B;  2QO6 A;  5HA1 A;  3SAO A;  1N7Y A;  3NQK A;  4LQZ A;  3WBG A;  5HCC C;  2FKJ A;  1FEL A;  4OEL A;  4JGL A;  4DCB A;  1K24 A;  2WEW A;  4LZU A;  1MX7 A;  2OL6 O;  4QNI A;  3EYC A;  5B27 A;  3NPO A;  4GGT A;  1X8N A;  1G74 A;  4MIS A;  1GX9 A;  2IZC B;  2OVA A;  2RTL A;  4IB9 A;  4CDE A;  5BVS A;  4L3R A;  3SLJ A;  4DQ3 A;  1PBY A;  3WJD A;  1SLG B;  1SRJ A;  4GNW A;  2W2A A;  4OKA A;  2FRS A;  2JU8 A;  5EZ2 A;  5F58 A;  3KFI A;  5HTD A;  1RAV A;  1SXU A;  3IFB A;  3LV4 A;  1DZM A;  4M7M A;  3WZP A;  5LJH A;  5HBS A;  3CQR A;  2CAM A;  2KD2 A;  2IZF B;  1IFC A;  1HMT A;  2KT4 B;  2O62 A;  1AQB A;  2AVI A;  1VPR A;  2PI3 O;  3BLG A;  1S44 A;  4NP1 A;  2X45 A;  3KQ0 A;  4IAX A;  2P8G A;  2IZJ A;  2KTS A;  4GDZ A;  4QAE A;  4XMD A;  3VU1 A;  1KQX A;  2Z4H A;  2VFB A;  1SLE B;  1ZNG A;  2FS7 A;  4U8U N;  4GUZ A;  2OFM X;  4I3B A;  1ERB A;  1GGL A;  4I3D A;  1QY0 A;  3P6F A;  2RA6 A;  1N4J A;  1IKJ A;  2JW1 A;  3APW A;  1JMZ A;  2RTG B;  5LJK A;  1D3S A;  1NC9 A;  4YGH A;  4Z2O A;  1B56 A;  5IO7 A;  2X8T A;  2G79 A;  1ACD A;  4BX6 A;  1BWY A;  2OVD A;  3WJF A;  1KL3 A;  3ZW1 B;  5LJD A;  1X8P A;  1YP7 A;  3RBY A;  1W6F A;  3UAQ A;  3RSW A;  4Z27 A;  5L8N A;  4QRL A;  5DPQ A;  1ML7 A;  5AEO A;  3Q34 A;  2IFB A;  1EW3 A;  1GT5 A;  3G7X A;  5IXG A;  1KL5 A;  1JBH A;  2I5V O;  1DF8 A;  1OBU A;  1OBP A;  4IMN A;  4GE1 A;  4DNE A;  4MVE A;  4I9R A;  1VWK B;  1OEE A;  1EPB A;  3VG6 A;  2F73 A;  2M4L A;  4GJV A;  4XMH A;  1QY1 A;  1ZNH A;  1LUQ A;  4NV7 A;  4I3C A;  4YFR A;  1VWE B;  3EW2 A;  5B10 O;  1IW2 A;  2WWP A;  4ALO A;  2XST A;  3VHM A;  2IZK A;  2IZD B;  2F09 A;  3RE5 A;  1BBP A;  1N9M A;  2OVE A;  3NBX X;  1VWC B;  1VYO A;  3LHN A;  2CBR A;  3C78 X;  3HPE A;  3KFH A;  3WJB A;  1E00 A;  4ZFX A;  4DQ4 A;  2X32 A;  5H9L A;  5B2A O;  2EU7 X;  2HLV A;  3JSQ A;  4IRW A;  1HQP A;  1RLB E;  3FA6 A;  3PH6 A;  4FBV A;  3OJY C;  1EXS A;  3QKG A;  3T1D A;  4OMW A;  4YCH A;  4A8Z A;  3STK A;  3FR5 A;  1TOU A;  2G5L A;  2BHV A;  1JJJ A;  1QFT A;  1SWF A;  3PQU A;  5EDC A;  2RTJ A;  1FE3 A;  1XCA A;  4AZR A;  3HWG A;  1JQP A;  1P6P A;  1TOW A;  2OF9 A;  2OL8 O;  1JV4 A;  4KT5 A;  2DM5 A;  3D9W A;  3MX7 A;  3O19 A;  1MOY A;  1W5R A;  3O2Y A;  5KID A;  1LID A;  3B2K A;  1QAB E;  4ORS A;  4QYN A;  4O4O A;  4Y0S A;  4Z2V A;  1I4U A;  2AT0 X;  3SLT A;  1ZNK A;  4IMO A;  2QO5 A;  3EC5 A;  2X55 A;  1AVG I;  4NLI A;  3CBC A;  1HN2 A;  2HZQ A;  2QOM A;  2GTL M;  2OY8 A;  4HPD A;  2AF5 A;  4LKP A;  1AEL A;  4GRJ A;  2DJG A;  2AT3 X;  1QWD A;  1Y52 X;  4O3Z A;  1GT4 A;  1IIU A;  5IRA A;  4AZM A;  1HQQ A;  1CBR A;  4I6S A;  5H9K A;  1YWA A;  4GH7 A;  5CHK A;  3I17 A;  1SWQ A;  4CV7 A;  4CPH A;  4COT A;  3X00 A;  1LIF A;  4GGR A;  4QGV A;  4Y0Q A;  4YBU A;  3VE2 A;  3RE6 A;  1PMP A;  4FBO A;  2HKD A;  1KGL A;  1LFO A;  2Z4I A;  2QOS C;  4ID2 A;  2IZE B;  4XMF A;  3U9P C;  2FLJ A;  1E2T A;  2MM3 A;  3SOT A;  5HWZ A;  1LNM A;  1N43 A;  3FW5 A;  4HPB A;  4JNJ A;  4MVI A;  4NYR A;  4OEM A;  5DG4 A;  3V8U A;  1TW4 A;  2IZI A;  3VGW A;  4ZHC A;  1B4M A;  1VYG A;  1TVQ A;  3B2J A;  1DV9 A;  2WQ9 A;  3PED A;  1GKA B;  3FEL A;  1O1U A;  2A5B A;  2LB6 A;  3ZUI A;  3AKM A;  3OD9 A;  2G78 A;  2AMM X;  4EEJ A;  1NP4 A;  3P6C A;  1SWB A;  3K3L A;  3HOE A;  4UU3 A;  1A3Y A;  1E06 A;  1N9Y A;  2A0A A;  2BSZ A;  1SMP I;  1QFV A;  2RTM A;  1VWL B;  5D4A A;  2RQ0 A;  1EQD A;  1URE A;  3FDC A;  4JHQ A;  5F7G A;  1OSP O;  1MX8 A;  1ICM A;  5BVQ A;  2AKQ A;  4YH0 A;  3WZN A;  3CQN A;  4WBK A;  2JN3 A;  3TGC A;  1JJU A;  3MVF A;  4L1N A;  1KFF A;  4WHI A;  2NNQ A;  2KTD A;  3BX7 A;  3F9D A;  1SLF B;  3B2I A;  3HWD A;  1AVE A;  2FR3 A;  4TJZ A;  1HXL A;  3GE2 A;  5HA0 A;  1B0O A;  5K68 A;  2X8S A;  1SY3 A;  2HNX A;  3S5V A;  2ZSC A;  1SWJ A;  1SWA A;  1VWF B;  1AB0 A;  1JJX A;  5FQ6 E;  2BS6 A;  3JS1 A;  2VFC A;  1SWE A;  4Z6J A;  3FID A;  4I9S A;  4TNN A;  3FA8 A;  4GZV A;  2OL7 A;  5B5G A;  3NX1 A;  1I9H A;  3MG5 A;  4YDB A;  5IO5 A;  3STM X;  1A57 A;  4M6S A;  2HYS A;  3EBW A;  4BX5 B;  1Y9L A;  1TXL A;  2RTI B;  5F1E A;  2UYW A;  3ZZV A;  4AW8 A;  1VWD B;  3BY0 A;  1S7D A;  3WJG A;  2A8G A;  2LBV A;  1EAL A;  1MDC A;  4Y59 A;  2C4I A;  4XMC A;  4U3Q A;  1DZJ A;  2BT9 A;  2MO5 A;  4KCA A;  4BJ8 A;  1O1V A;  3RZY A;  5EED A;  1BM5 A;  2IZB A;  4EQA C;  1MVG A;  2R73 A;  1RSU B;  2YMS A;  3PK2 A;  4ORX A;  5JD2 A;  5CYB A;  2OF8 A;  1BSY A;  1HBP A;  1UZ2 X;  4ORY A;  1Z24 A;  4TKB A;  4ZHD A;  4ZHH A;  4YBP A;  1DZP A;  2QM9 A;  3FEP A;  3P02 A;  3T2W A;  2A2G A;  3HTY A;  2W2F A;  1FEM A;  1LCW A;  4MEE A;  1H91 A;  2FR2 A;  1U0X A;  2NND A;  4LZV A;  1SWP A;  4AZQ A;  3CR6 A;  1QY2 A;  1VWN B;  2Q39 A;  4QZT A;  4YMY A;  4BBO A;  2RTK A;  5FQ8 E;  5HTE A;  2ALL X;  1RBP A;  4TLJ A;  4KC8 A;  5HZ8 A;  1RXJ A;  1KT6 A;  3BU1 A;  2QO4 A;  3P6G A;  5HCD C;  3UEW A;  4ES7 A;  1GX8 A;  1STR B;  3CMP A;  3WOV A;  1SRE A;  2AL0 X;  3O22 A;  1UYO X;  3IA8 A;  1SA8 A;  1LCV A;  1SWD A;  1KT5 A;  3HWE A;  4WFU A;  4ZH6 A;  5LKE A;  4GK9 A;  1KT7 A;  1SXY A;  3BDR A;  5CE4 A;  2GTL O;  2RTC B;  4ZGU A;  3PH5 A;  1X8Q A;  4ALB A;  5D48 A;  1LIB A;  4N7C A;  3VPJ E;  5D8J A;  5D47 A;  3VG7 A;  3NQ9 A;  4ZH9 A;  1SRI A;  4NYQ A;  4ZHF A;  2AT8 X;  2JOZ A;  3ZW1 A;  1I04 A;  2LFO A;  2PY1 A;  3PDF A;  1MK5 A;  5HZQ A;  4GU8 A;  1YWC A;  1SWH A;  3VG5 A;  1G7N A;  2WUT A;  3GAQ A;  1VWG B;  2RTP B;  1SXX A;  3FA9 A;  4ORR A;  3TGA A;  3VE1 A;  4MIR A;  4AZO A;  1EUO A;  2JMB A;  1A2D A;  2AH7 X;  1VWB B;  1QG5 A;  4AYH A;  4BCS A;  5IRU A;  2FKG A;  1AVD A;  1GXA A;  1W4T A;  4YKM A;  4NNS A;  3VG4 A;  4AZN A;  1SLD B;  2Y3E A;  1ZRY A;  4TKH A;  3P6D A;  4KII A;  1LIE A;  2QCB A;  1NBX A;  3FR2 A;  4K19 A;  4OS3 A;  4QZU A;  2WR6 A;  1I78 A;  2RTR B;  4O3W A;  5FFH A;  1SWO A;  1KOI A;  1VWA B;  2RTB B;  1RXH A;  4IB6 A;  4TQ2 A;  2A5C A;  1HMR A;  5HZ5 A;  1VWP B;  5K67 A;  1VWQ B;  5L8O A;  1BEB A;  1FDQ A;  2A2U A;  1STP A;  2YG2 A;  5CSE A;  2RCT A;  4N7D A;  3SLO A;  3P24 A;  1FJ1 E;  2RD7 C;  5JR8 A;  1KZW A;  1ZND A;  2BC3 A;  2X34 A;  3BU9 A;  5B29 A;  3TF6 A;  1CBQ A;  1XKI A;  2IZH B;  1SWT A;  2LA7 A;  2WSJ A;  1SWK A;  4FQB B;  4Y5D A;  1EIO A;  1NGL A;  1L6M A;  2OZQ A;  4OS0 A;  3FIQ A;  3N91 A;  3WZO A;  4D6A A;  3FLL A;  3STN A;  2RTE B;  2QMI A;  2LKK A;  1KZX A;  1Y0G A;  1BSQ A;  4O4S A;  4U8U M;  5F6Z A;  3HWF A;  4YCE A;  3DSZ A;  1ZNL A;  3ZQ3 A;  1KQW A;  2GH7 A;  5LJE A;  4BX7 B;  5IRW A;  1SWC A;  2K62 A;  1BSO A;  2MJI A;  2F01 A;  3AKN A;  4GJS A;  3EMM A;  3WJC A;  1GM6 A;  2FHL A;  3PP6 A;  3WZQ A;  5FAZ A;  5B11 O;  4BQU A;  5H9N A;  2C1S A;  2GC9 A;  3ZI8 A;  1R0U A;  5B5F A;  5BYP A;  1U18 A;  4NNT A;  2ACP X;  3APU A;  4QGX A;  4A60 A;  1SWG A;  2I5Z O;  1G85 A;  1SWR A;  3KFF A;  4EFG A;  4EKV A;  5LJC A;  1EI5 A;  5AJB A;  2ANS A;  2WEX A;  4B55 A;  3C77 X;  3F6Z B;  3EBK A;  3OE3 A;  1GKA A;  1KT4 A;  2G8C O;  5FQ7 E;  4BOE A;  1T68 X;  2Q4N A;  3ZW2 A;  1EII A;  1A18 A;  1B8E A;  2IZL B;  2RTO B;  3UEU A;  5IO6 A;  4UU2 A;  2OY1 O;  2X46 A;  4TKJ A;  2X8F A;  1Y53 X;  2RTH B;  4CDC A;  3NAD A;  5B3M O;  4MVK A;  4ON1 A;  1E02 A;  4BX7 A;  1BLR A;  2MWH A;  4RUU A;  3NR3 A;  1BRP A;  2ZAG A;  1KT3 A;  1YP6 A;  3H3I A;  1OPB A;  2ASN X;  3WYP A;  2CZT A;  2L9C A;  5F6B A;  1D2U A;  1LCZ A;  1WUB A;  3BS2 A;  3WYQ A;  3S5X A;  3RDX A;  2FGS A;  1PM1 X;  5H8T A;  2NNE A;  1VYF A;  1IJ8 A;  3C76 X;  1SY0 A;  3CBS A;  3CWK A;  4ARH A;  4ZHG A;  2KW1 A;  2RTN B;  3KZA A;  3D4R A;  4CDF A;  1LKE A;  5H9A A;  2G7B A;  4CPE A;  1SRF A;  3SZJ A;  1E5P A;  3RWX A;  4YDA A;  5AJC A;  4HPA A;  1CBS A;  2ACO A;  2JU3 A;  2GTL N;  1LEL A;  2HMB A;  4FGI B;  1SWL A;  4BX5 A;  1N0S A;  2JU7 A;  2WPU A;  3KVN A;  2L68 A;  2OFR X;  5L3Y A;  4YKO A;  2A3F X;  3MBT A;  4GKC A;  1RST B;  2K23 A;  2NP1 A;  2DJF A;  1JMX A;  4R0B A;  2MHD A;  4BX6 B;  4IB8 A;  1PEE A;  3S26 A;  1FEN A;  1HY2 A;  3NQ3 A;  2XKL A;  5C0N A;  4OS8 A;  1BRQ A;  2LBA A;  1NP1 A;  2IZG B;  2Y32 A;  3I0A A;  3RY2 A;  4YFQ A;  3MM0 A;  3ELX A;  3Q6L A;  4C5P A;  2OVS A;  3CKG A;  3LTW A;  2VDF A;  3NP1 A;  3ZW0 B;  4CPF A;  3T6F A;  4O4X A;  4GDA A;  4MVL A;  1JZU A;  2BS5 A;  3FMZ A;  1DFV A;  1VWJ B;  4NLJ A;  4Y0P A;  4U9C A;  2W2B A;  3ZUO A;  3ZWE A;  4QYP A;  1VWI B;  2Y3F A;  1MUP A;  3ELZ A;  3FYF A;  3RDQ A;  3VHI A;  1SY1 A;  3QQ2 A;  3BX8 A;  4O49 A;  1CJ5 A;  1JYD A;  4ORW A;  1VWO B;  2OFB A;  4QGW A;  5HZ6 A;  4O3Y A;  1OEJ A;  1NQM A;  2RTD B;  2AT5 X;  3E3C A;  4XME A;  4YGG A;  2A13 A;  4AZP A;  1PBO A;  2CZU A;  4EXZ A;  4GGZ A;  4OMX A;  4ZR2 A;  4PSQ A;  3T2X A;  1SY2 A;  1KL4 A;  2FS6 A;  4ZCB A;  3RDS A;  1ICN A;  4ML7 B;  4ODD A;  4U8U O;  3T6L A;  3ZW0 A;  5HAE A;  1SWU A;  3APX A;  1OBQ A;  5EEE A;  4Z28 A;  3PPT A;  1JIW I;  3S60 A;  2OYB O;  3RY1 A;  3U0D A;  2R56 A;  1KXO A;  3F8A A;  3JQO A;  5LJG A;  1WBI A;  1LDQ A;  1I05 A;  3KFG A;  2JGS A;  3EW1 A;  1VWH B;  2E4J A;  1DZK A;  2GJ5 A;  2ZAI A;  3B2L A;  3SZH A;  4A1H A;  4BVM A;  1VWR B;  4EDE A;  3FR4 A;  1GT3 A;  1OPA A;  2X56 A;  2N93 A;  4CPI A;  4D6B A;  1G5W A;  2RTQ B;  5LKF A;  4BGF A;  1X8O A;  4KC7 A;  3APV A;  3HOL A;  2RN4 A;  1SRG A;  3D96 A;  1VWM B;  3TZS A;  1NQN A;  4GNY A;  3WVM A;  1LF7 A;  2POA A;  4JO6 A;  2AT6 X;  4LKT A;  3AUM O;  3BRN A;  1DC9 A;  1LIC A;  3RDM A;  4PJ2 A;  2CBS A;  5HZ9 A;  1ALB A;  3RKG A;  1S2P A;  3PEC A;  1O8V A;  3NX2 A;  1SXW A;  4O4U A;  1CRB A;  4CPH B;  1STS B;  1SWN A;  4WFV A;  5BVT A;  2FHN X;  2R74 A;  4IBA A;  3B2H A;  4IAW A;  1T0V A;  3VG3 A;  3VHH A;  4CSB A;  4QQ1 A;  2OY5 O;  5FEN A;  1YUP A;  3RDO A;  2MF6 A;  3PQS A;  2OY7 A;  1EPA A;  5F2B A;  4A1Y A;  2Q9S A; 
#chains in the Genus database with same CATH homology
 2HZR A;  4I95 A;  1QQS A;  4HPC A;  3WJE A;  4Y0R A;  5KHP A;  2FT9 A;  1I06 A;  4KH8 A;  2CM9 A;  4HFO A;  4FBR A;  4O9S A;  3D95 A;  5AQ6 A;  5K06 A;  1HMS A;  1CBI A;  3FEN A;  2FWV A;  5EPQ A;  3U03 A;  1LPJ A;  1YIV A;  4CK4 A;  2BLG A;  1JYJ A;  1ADL A;  4INN A;  3UEV A;  1BJ7 A;  2RCQ A;  3TGB A;  5KIC A;  1X8U A;  1X89 A;  1ERX A;  3WXQ A;  1X71 A;  2CM4 A;  4GET A;  4NW4 A;  3UEX A;  1U17 A;  3VG2 A;  5LJB A;  3D97 A;  3OBL A;  4XMG A;  2FTB A;  2WQA E;  1ZNE A;  1T8V A;  1DF3 A;  1IKE A;  5EDB A;  4ZGF A;  2Q2M A;  4IB7 A;  2GTF X;  3BSZ E;  4YGZ A;  1Y9T A;  5HCE C;  1YWB A;  3L4R A;  5L8I A;  4YFP A;  1YWD A;  1OEK A;  1FTP A;  1GT1 A;  1IFB A;  3P6H A;  3FEK A;  3HK1 A;  4IAB A;  2Q2P A;  4RUN A;  3FA7 A;  1HBQ A;  4DQ3 A;  4ZJ0 A;  2L5P A;  4O3X B;  3EM0 A;  3P6E A;  3DTQ A;  3FW4 A;  4HWM A;  2L67 A;  4ORU A;  5HA1 A;  3SAO A;  2QO6 A;  5HCC C;  3WBG A;  3NQK A;  4LQZ A;  1FEL A;  4JGL A;  2WEW A;  4LZU A;  1MX7 A;  4QNI A;  3EYC A;  5B27 A;  3NPO A;  1X8N A;  1G74 A;  4MIS A;  1GX9 A;  2OVA A;  4IB9 A;  5BVS A;  4L3R A;  3WJD A;  4GNW A;  2W2A A;  2FRS A;  2JU8 A;  5EZ2 A;  5F58 A;  3KFI A;  5HTD A;  1SXU A;  3IFB A;  3LV4 A;  1DZM A;  4M7M A;  5LJH A;  5HBS A;  3CQR A;  2KD2 A;  2KT4 B;  1IFC A;  1HMT A;  2O62 A;  1AQB A;  1VPR A;  3BLG A;  4NP1 A;  1S44 A;  2X45 A;  3KQ0 A;  4IAX A;  2P8G A;  2KTS A;  4GDZ A;  4XMD A;  4QAE A;  3VU1 A;  1KQX A;  2Z4H A;  1ZNG A;  2FS7 A;  4U8U N;  2OFM X;  4I3B A;  1ERB A;  1GGL A;  4I3D A;  1QY0 A;  3P6F A;  2RA6 A;  1IKJ A;  2JW1 A;  3APW A;  5LJK A;  1D3S A;  4YGH A;  5IO7 A;  1B56 A;  2X8T A;  2G79 A;  1ACD A;  1BWY A;  2OVD A;  3WJF A;  3ZW1 B;  5LJD A;  1X8P A;  1YP7 A;  3RBY A;  3UAQ A;  3RSW A;  5L8N A;  4QRL A;  5DPQ A;  1ML7 A;  5AEO A;  2IFB A;  1EW3 A;  1GT5 A;  3G7X A;  1JBH A;  1OBU A;  1OBP A;  4IMN A;  4GE1 A;  4MVE A;  4I9R A;  1OEE A;  1EPB A;  3VG6 A;  2F73 A;  2M4L A;  4XMH A;  1QY1 A;  1ZNH A;  4I3C A;  4YFR A;  1IW2 A;  2WWP A;  4ALO A;  2XST A;  2F09 A;  1BBP A;  2OVE A;  3NBX X;  3LHN A;  2CBR A;  3C78 X;  3KFH A;  3WJB A;  1E00 A;  4ZFX A;  4DQ4 A;  5H9L A;  2EU7 X;  2HLV A;  3JSQ A;  1HQP A;  1RLB E;  3FA6 A;  3PH6 A;  4FBV A;  3OJY C;  1EXS A;  3QKG A;  3T1D A;  4OMW A;  4YCH A;  4A8Z A;  3STK A;  3FR5 A;  1TOU A;  2BHV A;  1JJJ A;  1QFT A;  3PQU A;  5EDC A;  1FE3 A;  1XCA A;  4AZR A;  3HWG A;  1P6P A;  1TOW A;  4KT5 A;  1JV4 A;  2DM5 A;  3MX7 A;  3O19 A;  5KID A;  3O2Y A;  1LID A;  3B2K A;  1QAB E;  4ORS A;  4QYN A;  4O4O A;  4Y0S A;  1I4U A;  2AT0 X;  1ZNK A;  4IMO A;  2QO5 A;  4NLI A;  1AVG I;  5D45 A;  3CBC A;  1HN2 A;  2HZQ A;  4HPD A;  2GTL M;  4LKP A;  1AEL A;  4GRJ A;  2AT3 X;  1QWD A;  4O3Z A;  1GT4 A;  1IIU A;  4AZM A;  4I6S A;  1CBR A;  5H9K A;  1YWA A;  4GH7 A;  3I17 A;  4CV7 A;  4COT A;  1LIF A;  4QGV A;  4Y0Q A;  4YBU A;  3VE2 A;  1PMP A;  4FBO A;  1KGL A;  1LFO A;  2Z4I A;  2QOS C;  4ID2 A;  4XMF A;  3U9P C;  5HWZ A;  2FLJ A;  2MM3 A;  3SOT A;  1LNM A;  4MVI A;  3FW5 A;  4HPB A;  4NYR A;  3V8U A;  5DG4 A;  4ZHC A;  1TW4 A;  1B4M A;  1VYG A;  1TVQ A;  3B2J A;  1DV9 A;  2WQ9 A;  3PED A;  1GKA B;  3FEL A;  1O1U A;  2LB6 A;  3ZUI A;  3AKM A;  3OD9 A;  2G78 A;  2AMM X;  4EEJ A;  1NP4 A;  3P6C A;  3K3L A;  4UU3 A;  3HOE A;  1A3Y A;  1E06 A;  2A0A A;  1SMP I;  1QFV A;  5D4A A;  2RQ0 A;  1EQD A;  1URE A;  5F7G A;  5BVQ A;  1MX8 A;  1ICM A;  2AKQ A;  4YH0 A;  3CQN A;  4WBK A;  2JN3 A;  3TGC A;  3MVF A;  4L1N A;  4WHI A;  2NNQ A;  2KTD A;  3BX7 A;  3F9D A;  3B2I A;  3HWD A;  2FR3 A;  4TJZ A;  5HA0 A;  3GE2 A;  1B0O A;  2X8S A;  1SY3 A;  2HNX A;  3S5V A;  1JJX A;  1AB0 A;  5FQ6 E;  2BS6 A;  3JS1 A;  4I9S A;  4TNN A;  3FA8 A;  4GZV A;  3NX1 A;  4YDB A;  5IO5 A;  3STM X;  1A57 A;  4M6S A;  2HYS A;  3EBW A;  1Y9L A;  1TXL A;  5F1E A;  3ZZV A;  4AW8 A;  3BY0 A;  1S7D A;  3WJG A;  2LBV A;  1EAL A;  1MDC A;  4XMC A;  4U3Q A;  1DZJ A;  2BT9 A;  2MO5 A;  4KCA A;  1O1V A;  3RZY A;  5EED A;  1BM5 A;  4EQA C;  1MVG A;  2R73 A;  2YMS A;  4ORX A;  5CYB A;  4TKB A;  1BSY A;  1HBP A;  1UZ2 X;  4ORY A;  1Z24 A;  4ZHD A;  4ZHH A;  4YBP A;  1DZP A;  2QM9 A;  3FEP A;  3P02 A;  2A2G A;  3HTY A;  2W2F A;  1FEM A;  1H91 A;  2FR2 A;  1U0X A;  2NND A;  4LZV A;  4AZQ A;  3CR6 A;  1QY2 A;  4QZT A;  2Q39 A;  4YMY A;  5FQ8 E;  5HTE A;  2ALL X;  1RBP A;  4TLJ A;  4KC8 A;  5HZ8 A;  1KT6 A;  3BU1 A;  2QO4 A;  3P6G A;  5HCD C;  3UEW A;  4ES7 A;  1GX8 A;  3CMP A;  3WOV A;  2AL0 X;  3O22 A;  4WFU A;  3IA8 A;  1SA8 A;  3HWE A;  4ZH6 A;  1KT5 A;  5LKE A;  4GK9 A;  1KT7 A;  1SXY A;  3BDR A;  5CE4 A;  2GTL O;  4ZGU A;  3PH5 A;  1X8Q A;  4ALB A;  5D48 A;  1LIB A;  4N7C A;  3VPJ E;  5D8J A;  5D47 A;  3VG7 A;  3NQ9 A;  4ZH9 A;  4NYQ A;  4ZHF A;  2AT8 X;  2JOZ A;  3ZW1 A;  1I04 A;  2LFO A;  2PY1 A;  5HZQ A;  4GU8 A;  1YWC A;  3VG5 A;  1G7N A;  2WUT A;  3GAQ A;  3FA9 A;  4ORR A;  1SXX A;  3TGA A;  4AZO A;  3VE1 A;  4MIR A;  1EUO A;  2JMB A;  1A2D A;  2AH7 X;  1QG5 A;  4AYH A;  1GXA A;  4YKM A;  3VG4 A;  4NNS A;  4AZN A;  4TKH A;  1ZRY A;  3P6D A;  4KII A;  1LIE A;  3FR2 A;  4OS3 A;  4K19 A;  5FFH A;  4QZU A;  2WR6 A;  4O3W A;  1KOI A;  4IB6 A;  4TQ2 A;  1HMR A;  5HZ5 A;  5L8O A;  1BEB A;  1FDQ A;  2A2U A;  2YG2 A;  2RCT A;  4N7D A;  3P24 A;  2RD7 C;  5JR8 A;  1KZW A;  1ZND A;  3BU9 A;  5B29 A;  3TF6 A;  1CBQ A;  1XKI A;  2LA7 A;  2WSJ A;  4FQB B;  1EIO A;  1NGL A;  1L6M A;  2OZQ A;  4OS0 A;  3FIQ A;  3N91 A;  4D6A A;  3FLL A;  3STN A;  2QMI A;  2LKK A;  1KZX A;  1BSQ A;  4O4S A;  4U8U M;  5F6Z A;  3HWF A;  4YCE A;  3DSZ A;  1ZNL A;  3ZQ3 A;  1KQW A;  5LJE A;  2K62 A;  1BSO A;  2MJI A;  3AKN A;  3EMM A;  3WJC A;  1GM6 A;  3PP6 A;  5FAZ A;  4BQU A;  5H9N A;  2GC9 A;  3ZI8 A;  5BYP A;  1R0U A;  1U18 A;  4NNT A;  2ACP X;  3APU A;  4QGX A;  4A60 A;  1G85 A;  3KFF A;  4EFG A;  5LJC A;  1EI5 A;  5AJB A;  2ANS A;  2WEX A;  3C77 X;  3F6Z B;  3EBK A;  3OE3 A;  1GKA A;  1KT4 A;  5FQ7 E;  4BOE A;  1T68 X;  2Q4N A;  3ZW2 A;  1EII A;  1A18 A;  1B8E A;  3UEU A;  5IO6 A;  4UU2 A;  2X46 A;  4TKJ A;  2X8F A;  3NAD A;  4MVK A;  4ON1 A;  1E02 A;  1BLR A;  2MWH A;  4RUU A;  3NR3 A;  1BRP A;  2ZAG A;  1KT3 A;  1YP6 A;  3H3I A;  1OPB A;  2ASN X;  2CZT A;  2L9C A;  5F6B A;  1D2U A;  3BS2 A;  3S5X A;  1PM1 X;  5H8T A;  2NNE A;  1VYF A;  3C76 X;  1SY0 A;  3CBS A;  3CWK A;  4ARH A;  4ZHG A;  2KW1 A;  3KZA A;  3D4R A;  1LKE A;  2G7B A;  1E5P A;  3RWX A;  4YDA A;  5AJC A;  4HPA A;  1CBS A;  2ACO A;  2JU3 A;  2GTL N;  2HMB A;  4FGI B;  1N0S A;  2JU7 A;  2L68 A;  2OFR X;  4YKO A;  2A3F X;  3MBT A;  4GKC A;  2K23 A;  2NP1 A;  4R0B A;  2MHD A;  4IB8 A;  1PEE A;  3S26 A;  1FEN A;  3NQ3 A;  2XKL A;  5C0N A;  4OS8 A;  1BRQ A;  2LBA A;  1NP1 A;  3I0A A;  4YFQ A;  3ELX A;  3Q6L A;  2OVS A;  3NP1 A;  3ZW0 B;  4O4X A;  1JZU A;  4MVL A;  2BS5 A;  3FMZ A;  1DFV A;  4NLJ A;  3ZUO A;  4Y0P A;  4U9C A;  2W2B A;  3ZWE A;  4QYP A;  1MUP A;  3ELZ A;  3FYF A;  1SY1 A;  3BX8 A;  4O49 A;  1CJ5 A;  1JYD A;  4ORW A;  5HZ6 A;  4QGW A;  4O3Y A;  1OEJ A;  4XME A;  2AT5 X;  3E3C A;  4YGG A;  2A13 A;  4AZP A;  1PBO A;  2CZU A;  4EXZ A;  4OMX A;  4ZR2 A;  4PSQ A;  1SY2 A;  2FS6 A;  4ZCB A;  1ICN A;  4ML7 B;  4ODD A;  4U8U O;  5HAE A;  3ZW0 A;  3APX A;  1OBQ A;  5EEE A;  3PPT A;  1JIW I;  3S60 A;  3U0D A;  2R56 A;  1KXO A;  3F8A A;  3JQO A;  5LJG A;  3KFG A;  1I05 A;  2GJ5 A;  2E4J A;  1DZK A;  2ZAI A;  3B2L A;  4BVM A;  4A1H A;  4EDE A;  3FR4 A;  1GT3 A;  1OPA A;  2N93 A;  4D6B A;  1G5W A;  5LKF A;  1X8O A;  4KC7 A;  3APV A;  3HOL A;  2RN4 A;  3TZS A;  3D96 A;  4GNY A;  3WVM A;  1LF7 A;  2POA A;  4LKT A;  2AT6 X;  3BRN A;  1DC9 A;  1LIC A;  4PJ2 A;  2CBS A;  5HZ9 A;  1ALB A;  3RKG A;  1S2P A;  3PEC A;  1O8V A;  3NX2 A;  1SXW A;  4O4U A;  1CRB A;  4WFV A;  5BVT A;  2R74 A;  4IBA A;  3B2H A;  4IAW A;  1T0V A;  3VG3 A;  4CSB A;  4QQ1 A;  5FEN A;  1YUP A;  3PQS A;  1EPA A;  5H9A A;  4A1Y A;  2Q9S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...