4IB9A

Bovine beta-lactoglobulin (isoform b) in complex with dodecyltrimethylammonium (dtac)
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
162
structure length
160
Chain Sequence
b'LIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENGECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEQSLACQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQCHI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords beta-lactoglobulin
publication title The differences in binding 12-carbon aliphatic ligands by bovine beta-lactoglobulin isoform A and B studied by isothermal titration calorimetry and X-ray crystallography
pubmed doi rcsb
molecule tags Transport protein
total genus 39
structure length 160
sequence length 162
ec nomenclature
pdb deposition date 2012-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 4ib9A00
2WEXA 4RUUA 3K3LA 1PEEA 2WQ9A 1NGLA 2AH7X 2AT3X 4ZCBA 1OEEA 4YFQA 4OMXA 2AL0X 5LKFA 4TKBA 1O1UA 3ELZA 1YWDA 1I05A 2AT5X 3FW4A 2WWPA 2A2UA 1ZNLA 1CJ5A 1GX8A 1G7NA 3O2YA 1QY0A 1SY3A 4GNYA 4XMDA 3AKMA 1TVQA 1BBPA 3APXA 3KQ0A 3PEDA 2E4JA 2KTDA 3BX8A 2AT8X 4NP1A 5BVSA 1FEMA 3STKA 1IFBA 4MVIA 2ASNX 5EPQA 1EALA 3FR2A 1BEBA 2OFRX 2IFBA 1B8EA 3EM0A 4Y0SA 1ICNA 1EW3A 1GT1A 2A0AA 2WQAE 3D95A 3HWGA 5IO5A 1A18A 5CE4A 4ZHGA 3STMX 4QAEA 2R56A 1G5WA 1QABE 2X45A 1HMTA 1AQBA 3O19A 4YGZA 1HBQA 4YFPA 5B27A 2WEWA 3NX1A 4EEJA 5KHPA 3CWKA 3HWFA 5B29A 5F1EA 1BSYA 3BU9A 1BRQA 5LJGA 4AW8A 4AZNA 3ELXA 3VG5A 1HQPA 4HPCA 3NR3A 4OS8A 4UU3A 3I17A 3KFIA 1X8OA 1U18A 3KFGA 4YGHA 5HA0A 1LPJA 5F6BA 4EXZA 1EPAA 3P6GA 1IFCA 4K19A 2ALLX 4A1HA 3UEXA 1HBPA 4UU2A 5H9NA 1DC9A 2JU3A 1DZKA 5AQ6A 3WJDA 1EXSA 3APVA 5DPQA 1QY1A 3D96A 3FEPA 1S44A 4A60A 3NQ3A 3CR6A 3FEKA 3MVFA 5C0NA 5F58A 1CBIA 2JU7A 3BS2A 1KT6A 1RBPA 3BRNA 2OFMX 4GNWA 2FS6A 4ZJ0A 3VG3A 4GE1A 4CK4A 3NADA 1FELA 3F8AA 1LF7A 2EU7X 4NNSA 1X71A 1GM6A 1BRPA 2LKKA 1DF3A 4I9SA 3VG7A 2HYSA 3ZUIA 3FIQA 2A3FX 3TF6A 1SY2A 3PP6A 3UEUA 4ORRA 1B0OA 2ANSA 2L67A 2QO6A 4ZHHA 1DV9A 4QYPA 4XMCA 1PBOA 4AZPA 4IB6A 1QFTA 3FA6A 3TGBA 3WJBA 1KXOA 1YP6A 3NPOA 5BVTA 2NNDA 1QY2A 2NP1A 1U17A 4ZR2A 4ZH9A 1YUPA 4A1YA 2O62A 4ORXA 4IAWA 1D3SA 2ACOA 1YIVA 3BY0A 3U03A 2G79A 1X8PA 2FR3A 1ERXA 3DSZA 3WJFA 2CZUA 1OEKA 3CBCA 3BU1A 3PPTA 3F9DA 2FLJA 3SAOA 1SXYA 2W2AA 5LKEA 2PY1A 3WBGA 1QFVA 3EMMA 1ZNDA 4BOEA 1E00A 1P6PA 1MDCA 4LKPA 2A2GA 2R73A 5FENA 4MVKA 4DQ4A 1KQXA 3TGCA 2MM3A 5L8NA 4NLIA 1TW4A 5D45A 4TQ2A 1KOIA 1Z24A 2K23A 1HN2A 3WJGA 1T8VA 4ORYA 4YDBA 4M6SA 5HZQA 3FENA 1QQSA 1A3YA 1YWBA 1EIIA 3CMPA 2Q2MA 4YBPA 1ZNHA 5H9AA 5HTDA 4OMWA 3AKNA 1ACDA 3WXQA 3G7XA 5HWZA 1LIEA 5HCEC 5HZ5A 1BSOA 4XMEA 1ZRYA 3HWDA 2QOSC 4YCEA 3VG6A 1GXAA 1SA8A 4Y0PA 2LB6A 4QYNA 4NYRA 4AZMA 5EEEA 4IB7A 3ZQ3A 3P6CA 1KQWA 1GGLA 4ORSA 1GX9A 3EBKA 5KIDA 2NNQA 1EPBA 1SXXA 1OEJA 2FT9A 3KFHA 4IAXA 2Q39A 3APWA 4LKTA 2QO5A 1X8QA 1DZMA 1GKAA 1ZNKA 3NP1A 5L8OA 3MBTA 4ZH6A 3P6FA 1LIDA 1ML7A 2MO5A 1SY0A 4IMOA 3U9PC 2CBSA 4NYQA 1KT3A 4RUNA 3C77X 2FRSA 3B2IA 5EDBA 1EUOA 1JYDA 1NP1A 2POAA 1B4MA 4ZHFA 5HA1A 2OVAA 2Q4NA 4ZHCA 3FMZA 2AKQA 1ICMA 4O9SA 1LFOA 3NQ9A 1PMPA 4YKOA 2FWVA 4I3CA 3VG2A 1BJ7A 1UZ2X 3FA8A 1EIOA 5HBSA 3FW5A 3WJEA 4ALBA 4ZHDA 2FTBA 3PH5A 5D47A 4YGGA 4AZOA 1G74A 1ZNEA 4Y0QA 3I0AA 2LFOA 3B2KA 4TKJA 1BLRA 1OPAA 1E5PA 4OS3A 5D4AA 3CBSA 2CZTA 4YMYA 1E06A 4HPDA 5DG4A 3Q6LA 4D6AA 1PM1X 1XCAA 2GTFX 1CRBA 2A13A 5EDCA 1GT3A 1G85A 1KT4A 1E02A 2HZRA 1CBQA 2L5PA 3TGAA 1NP4A 4I3DA 4XMHA 2HZQA 2RCTA 4IBAA 2G78A 3FR5A 1KT7A 1LKEA 2QO4A 1MX7A 1KZWA 4YH0A 3VG4A 5IO7A 2RQ0A 1SXWA 4YFRA 2WR6A 3GAQA 3STNA 1YWCA 5H8TA 4ARHA 1OBUA 4XMGA 2Q9SA 2F73A 4AZRA 1D2UA 4EFGA 2K62A 1IW2A 3UEWA 5D48A 1A57A 1HMRA 1FENA 4TKHA 3BX7A 3FR4A 1CBRA 4YBUA 1LIBA 2AT6X 2GC9A 4TJZA 1DZJA 3L4RA 2HNXA 4GETA 5L8IA 1VYGA 4WBKA 4YKMA 4KIIA 4N7DA 4QGXA 1MVGA 3P6DA 4ZGUA 3IFBA 1BM5A 4GH7A 5LJEA 3WJCA 5HAEA 1MX8A 2GJ5A 3DTQA 2XKLA 1EQDA 3JS1A 4M7MA 3BDRA 2AMMX 3OJYC 4EDEA 3C78X 1GT4A 3FA9A 1DZPA 1JV4A 3NX2A 1ADLA 3HK1A 1OPBA 4IB9A 4HPBA 1VYFA 1OBQA 2LBVA 2XSTA 1T0VA 1KGLA 4TNNA 4R0BA 1ERBA 1FTPA 1LICA 1X8UA 2L68A 4BVMA 1JJXA 4MVLA 3U0DA 2CBRA 4QZTA 1JBHA 4ODDA 1LIFA 4TLJA 1R0UA 1ALBA 4WFVA 4BQUA 3APUA 1UREA 2OVEA 5LJKA 1KT5A 2DM5A 2QM9A 2YG2A 3BLGA 1ZNGA 1JJJA 2FR2A 1JYJA 1T68X 2CM4A 2OVDA 5H9KA 3CQRA 2N93A 3B2HA 5D8JA 3FA7A 5HCCC 2RCQA 1I4UA 1X8NA 1MUPA 3IA8A 4HPAA 3UEVA 5F7GA 2R74A 2W2FA 3O22A 4DQ3A 1XKIA 4YDAA 5K06A 5EEDA 3B2LA 2W2BA 1A2DA 4I3BA 3ZUOA 3PH6A 2JOZA 2LBAA 1S7DA 4AYHA 1H91A 1CBSA 3EYCA 3EBWA 2RA6A 1RLBE 5HZ9A 1IKJA 2WUTA 4PSQA 4OS0A 3P6EA 5FFHA 5HZ8A 4NNTA 3FLLA 1AVGI 2G7BA 2JU8A 3D97A 5EZ2A 1JZUA 2L9CA 5HCDC 3P6HA 5LJBA 2FS7A 2NNEA 3PECA 1S2PA 1L6MA 1VPRA 4ES7A 5LJHA 3BSZE 3T1DA 5H9LA 1KZXA 4Y0RA 3HWEA 4LZVA 1AELA 4NLJA 1TXLA 2ACPX 2JN3A 4GKCA 5LJDA 2BLGA 2RD7C 5JR8A 1AB0A 3QKGA 4I9RA 4ALOA 4ORUA 4XMFA 1FDQA 1B56A 4QZUA 1SY1A 5KICA 2CM9A 1BWYA 1FE3A 3B2JA 1O8VA 1I04A 4QGVA 1YWAA 1LNMA 2X46A 3FELA 4ZFXA 5HZ6A 3CQNA 4IB8A 5HTEA 3S26A 5FAZA 2OZQA 1BSQA 4ORWA 3RSWA 1DFVA 1OBPA 2P8GA 3KFFA 2MJIA 1IIUA 2Q2PA 4IMNA 2KT4B 5F6ZA 4A8ZA 5LJCA 4AZQA 2HLVA 3WVMA 4GRJA 2AT0X 2HMBA 1GKAB 2WSJA 4WFUA 3C76X 1HMSA 5BVQA 1QG5A 1GT5A 4YCHA 4HFOA 4D6BA 1IKEA 4N7CA 4QGWA 1TOUA 1QWDA 1O1VA 1N0SA 1I06A 3TZSA 1YP7A 1TOWA 3KZAA 4LZUA 1SXUA 5IO6A 3JSQA 1U0XA 3RZYA 1X89A
chains in the Genus database with same CATH superfamily
3EW1A 2WEXA 4RUUA 1SWHA 3K3LA 2RTKA 1PEEA 4FQBB 2RTQB 2WQ9A 2ZSCA 1NGLA 1VWQB 2AH7X 2AT3X 1RAVA 2C4IA 4ZCBA 1OEEA 1KL4A 4YFQA 4BX5B 4DNEA 1K24A 4OMXA 2AL0X 5LKFA 4TKBA 2OVSA 1O1UA 3ELZA 3WBGA 4ZGFA 1VWMB 1YWDA 1I05A 2AT5X 3RDSA 1N9YA 3FW4A 2A5BA 2WWPA 2A2UA 1ZNLA 1CJ5A 1UYOX 2MHDA 1HXLA 5F2BA 1GX8A 2GTLN 1SWQA 1G7NA 4BX6A 3O2YA 3SZJA 1QY0A 1WBIA 1SY3A 4GNYA 4XMDA 3AKMA 1TVQA 1BBPA 3APXA 3KQ0A 1SWKA 3S5XA 3PEDA 2E4JA 2KTDA 3BX8A 2AT8X 4NP1A 5BVSA 2OFBA 1FEMA 4Z2OA 2G5LA 3STKA 1IFBA 1LUQA 5KIDA 4JNJA 4MVIA 4U8UO 1SWFA 2ASNX 5EPQA 1EALA 3FR2A 1BEBA 2OFRX 2IFBA 1B8EA 2JMBA 2IZEB 2X34A 4O4OA 4Y5DA 3ZW0B 4YVBA 3EM0A 3PQUA 1SWGA 2F09A 4Y0SA 3KVNA 1ICNA 1EW3A 1GT1A 2A0AA 2WQAE 3D95A 3HWGA 5IO5A 1A18A 5CE4A 4BGFA 4ZHGA 3STMX 4QAEA 2R56A 1G5WA 1QABE 2X45A 3WZOA 1HMTA 1AQBA 1SLGB 3O19A 4YGZA 2RTHB 4O3YA 1HBQA 1N9MA 4YFPA 1JMXA 2WEWA 3NX1A 5CHKA 5B27A 5K68A 4EEJA 4FBOA 5KHPA 1OSPO 3CWKA 2OYBO 3WZQA 3HWFA 5B29A 4CV7A 5F1EA 4BCSA 1BSYA 3BU9A 3HTYA 1BRQA 5LJGA 3SOTA 4AW8A 2IZCB 3ELXA 3VG5A 4AZNA 1HQPA 1KL5A 1MK5A 1VWPB 2OY8A 4CSBA 3RDQA 4HPCA 3WYQA 3NR3A 5HZ6A 4OS8A 4UU3A 2Y32A 3I17A 3KFIA 1X8OA 1U18A 3KFGA 4GK9A 4YGHA 5HA0A 1LPJA 3WYPA 3ZI8A 5CYBA 5F6BA 4EXZA 1EPAA 3P6GA 1IFCA 3RY1A 4K19A 2ALLX 4A1HA 3RY2A 2OY7A 3UEXA 1HBPA 3T6LA 3FIDA 1SWTA 3NQKA 4UU2A 4Z2PA 5H9NA 1DC9A 2RTLA 4BX7A 2JU3A 3ZW1A 1DZKA 2FGSA 5AQ6A 3WJDA 1EXSA 3APVA 5DPQA 1QY1A 3D96A 3FEPA 1S44A 4A60A 2OF9A 3NQ3A 3ZW2A 4KC7A 3CR6A 3FEKA 3MVFA 4GJSA 5C0NA 5F58A 1CBIA 2JU7A 3BS2A 1KT6A 1RBPA 3OBLA 1SWOA 2OFMX 3BRNA 4GNWA 3S60A 2FS6A 4ZJ0A 3VG3A 4GE1A 1E2TA 4CK4A 3NADA 1FELA 3D4RA 3F8AA 1LF7A 4BX6B 2FHLA 3MG5A 2EU7X 3VPJE 4NNSA 3HOLA 1X71A 4O4XA 4IRWA 4GJVA 1GM6A 3UAQA 1BRPA 4O4SA 2LKKA 1DF3A 1JQPA 4I9SA 2HYSA 3VG7A 3ZUIA 3FIQA 2A3FX 3TF6A 2X4MA 4KC8A 1SY2A 1VWEB 3PP6A 4ORRA 4PJ2A 2RTBB 4JHQA 1B0OA 3UEUA 2ANSA 2L67A 2QO6A 4QRLA 2YMSA 4ZHHA 3E3CA 3RE5A 1DV9A 4QYPA 4XMCA 1PBOA 1VWRB 4AZPA 4IB6A 1QFTA 1SWAA 1LDOA 3FA6A 3TGBA 3WJBA 4HWMA 4CDCA 1KXOA 1YP6A 2KTSA 3SLTA 1LCZA 2A5CA 4U8UN 3NPOA 5BVTA 1AVEA 1NBXA 2NNDA 1QY2A 2NP1A 1U17A 4ZR2A 2RTEB 4ZH9A 1LDQA 1YUPA 1SRGA 4A1YA 2RTIB 2O62A 4ORXA 1W4TA 4IAWA 3VE2A 1D3SA 2ACOA 2ZAGA 1UYNX 1YIVA 3BY0A 4O49A 5B11O 5LJHA 3U03A 4BJ8A 2G79A 1Y0GA 1X8PA 2FR3A 1ERXA 3DSZA 4I95A 1SWUA 1VWGB 3RDMA 1JJUA 1OEKA 1Y52X 2CZUA 3CBCA 3WJFA 3V8UA 3BU1A 3PPTA 3F9DA 2FLJA 3SAOA 1SXYA 1VWFB 2AVIA 2OL7A 2W2AA 2PY1A 3OD9A 1QFVA 3EMMA 3OE3A 1ZNDA 4MISA 2OL6O 1E00A 1SWCA 4BOEA 2HKDA 5L3YA 3RWXA 1P6PA 1GX3A 1MDCA 1N7YA 4JO6A 3CKGA 4LKPA 5AJBA 2A2GA 2R73A 3MX7A 4MVKA 1STPA 4CPFA 4DQ4A 5FENA 1KQXA 1HXZA 3TGCA 1RSTB 1SRHA 2MF6A 2MM3A 5L8NA 4NLIA 4FBRA 1TW4A 5D45A 3ZW1B 4BX7B 4TQ2A 1KL3A 1KOIA 1Z24A 1SWNA 1HN2A 2K23A 2RTAA 3WJGA 4MVEA 4KT5A 5BYPA 1T8VA 4ORYA 4YDBA 4M6SA 5HZQA 1NQMA 1SLFB 1QQSA 3FENA 5D4AA 4MEEA 1W6FA 3LHNA 1A3YA 1YWBA 5AEOA 5IXGA 1EIIA 3CMPA 1SRIA 2Q2MA 2M4LA 4KCAA 4YBPA 1ZNHA 1SWJA 5H9AA 5HTDA 4OMWA 3AKNA 1ACDA 3WXQA 1SMPI 3G7XA 1LIEA 5HWZA 1W5RA 5HCEC 5HZ5A 2RTCB 1BSOA 4XMEA 1ZRYA 3HWDA 2QOSC 4YCEA 3VG6A 1GXAA 2KD2A 4IABA 1VWIB 1SA8A 4Y0PA 2LB6A 4QYNA 4NYRA 4AZMA 4GDZA 4IB7A 5EEEA 3ZQ3A 3PK2A 3P6CA 2IZGB 2WPUA 2QCBA 1KQWA 1GGLA 4ORSA 1GX9A 2CAMA 5IRUA 1RXHA 3EBKA 2NNQA 1EPBA 4LQZA 1SXXA 3VHHA 2QMIA 1OEJA 2FT9A 3KFHA 4IAXA 2Q39A 3APWA 4LKTA 2QOMA 3RKGA 3T2XA 4GGZA 1JIWI 2QO5A 4JGLA 1X8QA 1DZMA 1SWEA 1GKAA 1ZNKA 1NDJA 3NP1A 5L8OA 3MBTA 4ZH6A 3P6FA 1LIDA 1ML7A 1I78A 1SY0A 2MO5A 4IMOA 3U9PC 1VWJB 2CBSA 4U3QA 3VHMA 5B5FA 4NYQA 1PTSA 5CSEA 1KT3A 2UYWA 4RUNA 3C77X 2FRSA 3B2IA 5EDBA 1EUOA 1JYDA 1NP1A 2POAA 3VGWA 1B4MA 4ZHFA 5HA1A 2OVAA 2Q4NA 4ZHCA 3FMZA 2AKQA 4COTA 1ICMA 4O9SA 1LFOA 1SWRA 3NQ9A 2IZJA 3FYFA 1PMPA 3WZNA 3T2WA 4YKOA 2FWVA 4I3CA 1SWBA 4O3XB 3VG2A 1BJ7A 1UZ2X 3FA8A 1EIOA 2RTJA 1SWLA 3FW5A 3QQ2A 5HBSA 4NV8A 4U8UM 3RDUA 3WJEA 2FTBA 3VE1A 3PH5A 4ALBA 5D47A 4YGGA 4AZOA 1G74A 4I6SA 4MIRA 3SLOA 2Y3EA 1ZNEA 4Y0QA 3MM0A 3I0AA 2LFOA 3B2KA 4TKJA 2RTGB 1BLRA 1OPAA 1E5PA 1SRFA 2RTPB 4OEMA 3CBSA 1NQNA 2CZTA 4GGRA 4NW4A 4OS3A 4YMYA 1E06A 1SWSA 4HPDA 5DG4A 2RTRB 3Q6LA 1EI5A 1RXKA 4D6AA 1PM1X 1XCAA 2GTFX 4GD9A 2IZBA 1CRBA 2A13A 5EDCA 3WZPA 1GT3A 1AVDA 1G85A 1E02A 1KT4A 1CBQA 2BS6A 2HZRA 1NP4A 2L5PA 3TGAA 4I3DA 4XMHA 2HZQA 2RCTA 2I5VO 4CDFA 5LKEA 1NC9A 4IBAA 1VWNB 1VWOB 2G78A 3D9WA 3FR5A 2UZ2A 1KT7A 4L1NA 1LKEA 2QO4A 1MX7A 1KZWA 4YH0A 3H3IA 3VG4A 1JMZA 4ML7B 3VU1A 2RQ0A 4L3RA 2PI3O 1SREA 1SXWA 3CKFA 5IO7A 4YFRA 2WR6A 3GAQA 4O3WA 4Y59A 3STNA 1YWCA 2GTLM 5H8TA 4ARHA 2BSZA 1OBUA 2LA7A 4XMGA 2Q9SA 2F73A 4CDEA 4AZRA 1D2UA 4EFGA 2K62A 1IW2A 2C1QA 3UEWA 5B5GA 5D48A 1A57A 1HMRA 2IZAA 3GE2A 1FENA 3PQSA 4TKHA 3BX7A 3FR4A 3RDOA 4Z27A 1CBRA 1HY2A 4YBUA 1LIBA 2A8GA 2IZFB 3PDFA 2AT6X 2AF5A 2GC9A 4TJZA 1DZJA 4ZHDA 3L4RA 5AJCA 2HNXA 4GETA 5L8IA 1VYGA 4WBKA 2RN4A 4YKMA 4KIIA 4N7DA 4QGXA 1MVGA 3P6DA 4ZGUA 1VWKB 3IFBA 1BM5A 4GH7A 5LJEA 3WJCA 5HAEA 1MX8A 3VHIA 4INNA 1SWDA 2GJ5A 1SRJA 3DTQA 2XKLA 4ID2A 1EQDA 3JS1A 2OF8A 2IZKA 2AMMX 3BDRA 3OJYC 4M7MA 5B3MO 1WUBA 3C78X 1GT4A 3FA9A 3RE6A 5K67A 1DZPA 4CPHA 1JV4A 3NX2A 1ADLA 3HK1A 4GU8A 5B2AO 4B55A 1OPBA 4IB9A 4HPBA 2VFCA 1VYFA 3P24A 4EKVA 1OBQA 2BT9A 2LBVA 2XSTA 1T0VA 1KGLA 4DCBA 4TNNA 4I60A 4R0BA 1ERBA 3AEHA 1FTPA 1LICA 4QNIA 1X8UA 2L68A 4BVMA 1RXJA 4OKAA 1JJXA 2GH7A 4EQAC 4MVLA 3U0DA 4CPIA 2CBRA 4QZTA 1JBHA 1DF8A 1STSB 1MOYA 1VWCB 4ODDA 2I5ZO 2DJFA 1LIFA 4TLJA 4KH8A 3T6FA 1R0UA 1ALBA 4WFVA 4BQUA 1IJ8A 3APUA 1UREA 2KW1A 2OVEA 5LJKA 1KT5A 2DM5A 2QM9A 2YG2A 3EC5A 3BLGA 3S5VA 1ZNGA 3WOVA 3LV4A 1JJJA 1VWLB 2FR2A 1JYJA 1FJ1E 3SLJA 1I9HA 3ZWEA 1T68X 2CM4A 2OVDA 3HPEA 2X8FA 3CQRA 3FDCA 1SWPA 5H9KA 2N93A 3B2HA 5D8JA 3SZIA 2OY5O 3FA7A 5HCCC 4CPEA 2RCQA 1I4UA 3F6ZB 5FQ6E 1X8NA 1SLEB 2FHNX 1MUPA 3IA8A 2G8CO 3Q34A 4HPAA 3UEVA 2F01A 1VYOA 5F7GA 2R74A 1K3BA 2W2FA 3O22A 1XKIA 4YDAA 4DQ3A 4GZVA 5EEDA 5K06A 2C1SA 2X8TA 3B2LA 2W2BA 1A2DA 4I3BA 4EDEA 4GDAA 3NBXX 3ZUOA 3PH6A 2JOZA 2IZHB 2LBAA 1S7DA 5B10O 4AYHA 1H91A 1CBSA 3EYCA 1RSUB 4Z6JA 3EBWA 2RA6A 2Z4HA 1RLBE 5HZ9A 5FQ8E 4CDDA 1IKJA 1VWDB 5FQ7E 2RTMA 2WUTA 4PSQA 4OS0A 3P6EA 5FFHA 5HZ8A 4NNTA 3FLLA 1AVGI 2G7BA 2JU8A 3D97A 5EZ2A 4ON1A 1JZUA 1LELA 2Y3FA 2BC3A 2L9CA 3ZZVA 2IZDB 5HCDC 3P6HA 5LJBA 4BX5A 2FS7A 2NNEA 3PECA 1S2PA 1L6MA 1VPRA 1VWHB 4U9CA 3BSZE 1N4JA 4CPHB 2GTLO 3T1DA 4ES7A 4QQ1A 1VWBB 2BHVA 2X56A 2OY1O 3AUMO 5H9LA 1KZXA 4Y0RA 3HWEA 4LZVA 2IZIA 1AELA 4NLJA 1TXLA 4FBVA 2ACPX 2JN3A 2X32A 4GKCA 3LTWA 5LJDA 4BBOA 4U46A 1KFFA 1STRB 2BLGA 2RD7C 5JR8A 4FGIB 2OL8O 1Y9TA 1MM9A 4O3ZA 1AB0A 3QKGA 3X00A 4I9RA 4ALOA 5JD2A 4ORUA 4XMFA 2IZLB 1LCVA 1FDQA 2RTOB 1B56A 2VDFA 1N43A 1SLDB 2RTFB 4QZUA 1SY1A 5KICA 3RDXA 2CM9A 1BWYA 1FE3A 3B2JA 1O8VA 1I04A 4GGTA 1YWAA 4QGVA 1LCWA 1LNMA 2X46A 3P02A 3FELA 4Z28A 1Y53X 1PBYA 1MEPA 3SZHA 2BS5A 3ZW0A 3CQNA 4C5PA 4IB8A 4ZFXA 5HTEA 1VWAB 3N91A 3S26A 5FAZA 2OZQA 1BSQA 4ORWA 2VFBA 3RSWA 1DFVA 2JW1A 4Z2VA 1OBPA 2P8GA 3KFFA 2MJIA 1IIUA 2Q2PA 4IMNA 2KT4B 4O4UA 5F6ZA 4A8ZA 5LJCA 4AZQA 2HLVA 3WVMA 4GRJA 2AT0X 2HMBA 1GKAB 4GUZA 4OELA 5IRWA 2WSJA 4WFUA 3C76X 1HMSA 1Y55X 4NV7A 5BVQA 2ZAIA 2Z4IA 2FKGA 2RTNB 2RTDB 3HOEA 1QG5A 1GT5A 4YCHA 2X55A 4HFOA 2MWHA 4D6BA 3RBYA 2DJGA 2OFAA 1HQQA 1IKEA 2JGSA 2FKJA 4N7CA 2X8SA 4QGWA 1TOUA 1QWDA 1O1VA 4WHIA 5IRAA 1N0SA 1Y9LA 1I06A 3TZSA 1YP7A 1TOWA 3KZAA 3JQOA 1SXUA 4LZUA 5IO6A 3EW2A 3JSQA 1U0XA 3RZYA 1X89A
chains in the Genus database with same CATH topology
2WEXA 4RUUA 3K3LA 1PEEA 4FQBB 2WQ9A 1NGLA 2AH7X 2AT3X 4ZCBA 1OEEA 4YFQA 4OMXA 2AL0X 5LKFA 4TKBA 2OVSA 1O1UA 3ELZA 4ZGFA 1YWDA 1I05A 2AT5X 3FW4A 2WWPA 2A2UA 1ZNLA 1CJ5A 2MHDA 1GX8A 2GTLN 1G7NA 3O2YA 1QY0A 1SY3A 4GNYA 4XMDA 3AKMA 1TVQA 1BBPA 3APXA 3KQ0A 3S5XA 3PEDA 2E4JA 2KTDA 3BX8A 2AT8X 4NP1A 5BVSA 1FEMA 3STKA 1IFBA 4MVIA 4U8UO 2ASNX 5EPQA 1EALA 3FR2A 1BEBA 2OFRX 2IFBA 1B8EA 2JMBA 4O4OA 3ZW0B 3EM0A 3PQUA 2F09A 4Y0SA 1ICNA 1EW3A 1GT1A 2A0AA 2WQAE 3D95A 3HWGA 5IO5A 1A18A 5CE4A 4ZHGA 3STMX 4QAEA 2R56A 1G5WA 1QABE 2X45A 1HMTA 1AQBA 3O19A 4YGZA 4O3YA 1HBQA 4YFPA 5B27A 2WEWA 3NX1A 4EEJA 5KHPA 4FBOA 3CWKA 3HWFA 5B29A 4CV7A 5F1EA 1BSYA 3BU9A 3HTYA 1BRQA 5LJGA 3SOTA 4AW8A 4AZNA 3ELXA 3VG5A 1HQPA 4CSBA 4HPCA 3NR3A 4OS8A 4UU3A 3I17A 3KFIA 1X8OA 1U18A 3KFGA 4GK9A 4YGHA 5HA0A 1LPJA 3ZI8A 5CYBA 5F6BA 4EXZA 1EPAA 3P6GA 1IFCA 4K19A 2ALLX 4A1HA 3UEXA 1HBPA 3NQKA 4UU2A 5H9NA 1DC9A 2JU3A 3ZW1A 1DZKA 5AQ6A 3WJDA 1EXSA 3APVA 5DPQA 1QY1A 3D96A 3FEPA 1S44A 4A60A 3NQ3A 3ZW2A 4KC7A 3CR6A 3FEKA 3MVFA 5C0NA 5F58A 1CBIA 2JU7A 3BS2A 1KT6A 1RBPA 3OBLA 3BRNA 2OFMX 4GNWA 3S60A 2FS6A 4ZJ0A 3VG3A 4GE1A 4CK4A 3NADA 1FELA 3D4RA 3F8AA 1LF7A 2EU7X 3VPJE 4NNSA 3HOLA 1X71A 4O4XA 1GM6A 3UAQA 1BRPA 4O4SA 2LKKA 1DF3A 4I9SA 3VG7A 2HYSA 3ZUIA 3FIQA 2A3FX 3TF6A 4KC8A 1SY2A 3PP6A 4PJ2A 4ORRA 3UEUA 1B0OA 2ANSA 2L67A 2QO6A 4QRLA 2YMSA 4ZHHA 3E3CA 1DV9A 4QYPA 4XMCA 1PBOA 4AZPA 4IB6A 1QFTA 3FA6A 3TGBA 3WJBA 4HWMA 1KXOA 1YP6A 2KTSA 4U8UN 3NPOA 5BVTA 2NNDA 1QY2A 2NP1A 1U17A 4ZR2A 4ZH9A 1YUPA 4A1YA 2O62A 4ORXA 4IAWA 3VE2A 1D3SA 2ACOA 2ZAGA 4O49A 1YIVA 3BY0A 3U03A 2G79A 1X8PA 2FR3A 1ERXA 3DSZA 4I95A 3WJFA 2CZUA 1OEKA 3CBCA 3V8UA 3BU1A 3PPTA 3F9DA 2FLJA 3SAOA 1SXYA 3OD9A 3OE3A 2W2AA 4MISA 2PY1A 3WBGA 1QFVA 3EMMA 5LKEA 1ZNDA 4BOEA 1E00A 3RWXA 1P6PA 1MDCA 4LKPA 5AJBA 2A2GA 2R73A 3MX7A 4MVKA 4DQ4A 5FENA 1KQXA 3TGCA 2MM3A 5L8NA 4NLIA 4FBRA 1TW4A 5D45A 3ZW1B 4TQ2A 1KOIA 1Z24A 2K23A 1HN2A 5BYPA 3WJGA 4MVEA 4KT5A 1T8VA 4ORYA 4YDBA 4M6SA 5HZQA 3FENA 1QQSA 5AEOA 3LHNA 1A3YA 1YWBA 1EIIA 3CMPA 2Q2MA 2M4LA 4KCAA 4YBPA 1ZNHA 5H9AA 5HTDA 4OMWA 3AKNA 1ACDA 3WXQA 1SMPI 3G7XA 1LIEA 5HWZA 5HCEC 5HZ5A 1BSOA 4XMEA 1ZRYA 3HWDA 2QOSC 4YCEA 3VG6A 1GXAA 2KD2A 4IABA 1SA8A 4Y0PA 2LB6A 4QYNA 4NYRA 4AZMA 4GDZA 4IB7A 5EEEA 3ZQ3A 3P6CA 1KQWA 1GGLA 4ORSA 1GX9A 3EBKA 5KIDA 2NNQA 1EPBA 4LQZA 1SXXA 2QMIA 1OEJA 2FT9A 3KFHA 4IAXA 2Q39A 3APWA 4LKTA 3RKGA 1JIWI 2QO5A 4JGLA 1X8QA 1DZMA 1GKAA 1ZNKA 3NP1A 5L8OA 3MBTA 4ZH6A 3P6FA 1LIDA 1ML7A 2MO5A 1SY0A 4IMOA 3U9PC 2CBSA 4U3QA 4NYQA 1KT3A 4RUNA 3C77X 2FRSA 3B2IA 5EDBA 1EUOA 1JYDA 1NP1A 2POAA 1B4MA 4ZHFA 5HA1A 2OVAA 2Q4NA 4ZHCA 3FMZA 2AKQA 4COTA 1ICMA 4O9SA 1LFOA 3NQ9A 3FYFA 1PMPA 4YKOA 2FWVA 4I3CA 4O3XB 3VG2A 1BJ7A 1UZ2X 3FA8A 1EIOA 5HBSA 3FW5A 3WJEA 4ALBA 4U8UM 4ZHDA 2FTBA 3VE1A 3PH5A 5D47A 4YGGA 4AZOA 1G74A 4I6SA 4MIRA 1ZNEA 4Y0QA 3I0AA 2LFOA 3B2KA 4TKJA 1BLRA 1OPAA 1E5PA 4OS3A 5D4AA 3CBSA 4NW4A 2CZTA 4YMYA 1E06A 4HPDA 5DG4A 3Q6LA 1EI5A 4D6AA 1PM1X 1XCAA 2GTFX 1CRBA 2A13A 5EDCA 1GT3A 1G85A 1KT4A 1E02A 2HZRA 1CBQA 2BS6A 2L5PA 1NP4A 3TGAA 4I3DA 4XMHA 2HZQA 2RCTA 4IBAA 2G78A 3FR5A 1KT7A 4L1NA 1LKEA 2QO4A 1MX7A 1KZWA 4YH0A 3H3IA 3VG4A 4ML7B 3VU1A 2RQ0A 4L3RA 5IO7A 1SXWA 4YFRA 2WR6A 3GAQA 4O3WA 3STNA 1YWCA 2GTLM 5H8TA 4ARHA 1OBUA 2LA7A 4XMGA 2Q9SA 2F73A 4AZRA 1D2UA 4EFGA 2K62A 1IW2A 3UEWA 5D48A 1A57A 1HMRA 3GE2A 3PQSA 1FENA 4TKHA 3BX7A 3FR4A 1CBRA 4YBUA 1LIBA 2AT6X 2GC9A 4TJZA 1DZJA 3L4RA 5AJCA 2HNXA 4GETA 5L8IA 1VYGA 4WBKA 2RN4A 4YKMA 4KIIA 4N7DA 4QGXA 1MVGA 3P6DA 4ZGUA 3IFBA 1BM5A 4GH7A 5LJEA 3WJCA 5HAEA 1MX8A 4INNA 2GJ5A 3DTQA 2XKLA 4ID2A 1EQDA 3JS1A 4M7MA 3BDRA 2AMMX 3OJYC 4EDEA 3C78X 1GT4A 3FA9A 1DZPA 1JV4A 3NX2A 1ADLA 3HK1A 4GU8A 1OPBA 4IB9A 4HPBA 1VYFA 3P24A 1OBQA 2BT9A 2LBVA 2XSTA 1T0VA 1KGLA 4TNNA 4R0BA 1ERBA 1FTPA 1LICA 4QNIA 1X8UA 2L68A 4BVMA 1JJXA 4EQAC 4MVLA 3U0DA 2CBRA 4QZTA 1JBHA 4ODDA 1LIFA 4TLJA 4KH8A 1R0UA 1ALBA 4WFVA 4BQUA 3APUA 2OVEA 1UREA 2KW1A 5LJKA 1KT5A 2DM5A 2QM9A 2YG2A 3S5VA 3BLGA 3WOVA 1ZNGA 3LV4A 1JJJA 2FR2A 1JYJA 3ZWEA 1T68X 2CM4A 2OVDA 5H9KA 2X8FA 3CQRA 2N93A 3B2HA 5D8JA 3FA7A 5HCCC 2RCQA 1I4UA 3F6ZB 5FQ6E 1X8NA 1MUPA 3IA8A 4HPAA 3UEVA 5F7GA 2R74A 2W2FA 3O22A 4DQ3A 1XKIA 4YDAA 5K06A 4GZVA 5EEDA 3B2LA 2X8TA 2W2BA 1A2DA 4I3BA 3NBXX 3ZUOA 3PH6A 2JOZA 2LBAA 1S7DA 4AYHA 1H91A 1CBSA 3EYCA 3EBWA 2RA6A 2Z4HA 1RLBE 5HZ9A 5FQ8E 1IKJA 5FQ7E 2WUTA 4PSQA 4OS0A 3P6EA 5FFHA 5HZ8A 4NNTA 3FLLA 1AVGI 2G7BA 2JU8A 3D97A 5EZ2A 4ON1A 1JZUA 2L9CA 3ZZVA 5HCDC 3P6HA 5LJBA 2FS7A 2NNEA 3PECA 1S2PA 1L6MA 1VPRA 4U9CA 4ES7A 3BSZE 5LJHA 2GTLO 3T1DA 4QQ1A 2BHVA 5H9LA 1KZXA 4Y0RA 3HWEA 4LZVA 1AELA 4NLJA 1TXLA 4FBVA 2ACPX 2JN3A 4GKCA 5LJDA 2BLGA 2RD7C 5JR8A 4FGIB 1Y9TA 4O3ZA 1AB0A 3QKGA 4I9RA 4ALOA 4ORUA 4XMFA 1FDQA 1B56A 4QZUA 1SY1A 5KICA 2CM9A 1BWYA 1FE3A 3B2JA 1O8VA 1I04A 4QGVA 1YWAA 1LNMA 2X46A 3P02A 3FELA 3ZW0A 4ZFXA 5HZ6A 2BS5A 3CQNA 4IB8A 5HTEA 3N91A 3S26A 5FAZA 2OZQA 1BSQA 4ORWA 3RSWA 1DFVA 2JW1A 1OBPA 2P8GA 3KFFA 2MJIA 1IIUA 2Q2PA 4IMNA 2KT4B 4O4UA 5F6ZA 4A8ZA 5LJCA 4AZQA 2HLVA 3WVMA 4GRJA 2AT0X 2HMBA 1GKAB 2WSJA 4WFUA 3C76X 1HMSA 5BVQA 2ZAIA 2Z4IA 3HOEA 1QG5A 1GT5A 4YCHA 4HFOA 2MWHA 4D6BA 3RBYA 1IKEA 4N7CA 2X8SA 4QGWA 1TOUA 1QWDA 1O1VA 4WHIA 1N0SA 1Y9LA 1I06A 3TZSA 1YP7A 1TOWA 3KZAA 3JQOA 1SXUA 4LZUA 5IO6A 3JSQA 1U0XA 3RZYA 1X89A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WEX A;  4RUU A;  3K3L A;  1PEE A;  2WQ9 A;  1NGL A;  2AH7 X;  2AT3 X;  4ZCB A;  1OEE A;  4YFQ A;  4OMX A;  2AL0 X;  5LKF A;  4TKB A;  1O1U A;  3ELZ A;  1YWD A;  1I05 A;  2AT5 X;  3FW4 A;  2WWP A;  2A2U A;  1ZNL A;  1CJ5 A;  1GX8 A;  1G7N A;  3O2Y A;  1QY0 A;  1SY3 A;  4GNY A;  4XMD A;  3AKM A;  1TVQ A;  1BBP A;  3APX A;  3KQ0 A;  3PED A;  2E4J A;  2KTD A;  3BX8 A;  2AT8 X;  4NP1 A;  5BVS A;  1FEM A;  3STK A;  1IFB A;  4MVI A;  2ASN X;  5EPQ A;  1EAL A;  3FR2 A;  1BEB A;  2OFR X;  2IFB A;  1B8E A;  3EM0 A;  4Y0S A;  1ICN A;  1EW3 A;  1GT1 A;  2A0A A;  2WQA E;  3D95 A;  3HWG A;  5IO5 A;  1A18 A;  5CE4 A;  4ZHG A;  3STM X;  4QAE A;  2R56 A;  1G5W A;  1QAB E;  2X45 A;  1HMT A;  1AQB A;  3O19 A;  4YGZ A;  1HBQ A;  4YFP A;  5B27 A;  2WEW A;  3NX1 A;  4EEJ A;  5KHP A;  3CWK A;  3HWF A;  5B29 A;  5F1E A;  1BSY A;  3BU9 A;  1BRQ A;  5LJG A;  4AW8 A;  4AZN A;  3ELX A;  3VG5 A;  1HQP A;  4HPC A;  3NR3 A;  4OS8 A;  4UU3 A;  3I17 A;  3KFI A;  1X8O A;  1U18 A;  3KFG A;  4YGH A;  5HA0 A;  1LPJ A;  5F6B A;  4EXZ A;  1EPA A;  3P6G A;  1IFC A;  4K19 A;  2ALL X;  4A1H A;  3UEX A;  1HBP A;  4UU2 A;  5H9N A;  1DC9 A;  2JU3 A;  1DZK A;  5AQ6 A;  3WJD A;  1EXS A;  3APV A;  5DPQ A;  1QY1 A;  3D96 A;  3FEP A;  1S44 A;  4A60 A;  3NQ3 A;  3CR6 A;  3FEK A;  3MVF A;  5C0N A;  5F58 A;  1CBI A;  2JU7 A;  3BS2 A;  1KT6 A;  1RBP A;  3BRN A;  2OFM X;  4GNW A;  2FS6 A;  4ZJ0 A;  3VG3 A;  4GE1 A;  4CK4 A;  3NAD A;  1FEL A;  3F8A A;  1LF7 A;  2EU7 X;  4NNS A;  1X71 A;  1GM6 A;  1BRP A;  2LKK A;  1DF3 A;  4I9S A;  3VG7 A;  2HYS A;  3ZUI A;  3FIQ A;  2A3F X;  3TF6 A;  1SY2 A;  3PP6 A;  3UEU A;  4ORR A;  1B0O A;  2ANS A;  2L67 A;  2QO6 A;  4ZHH A;  1DV9 A;  4QYP A;  4XMC A;  1PBO A;  4AZP A;  4IB6 A;  1QFT A;  3FA6 A;  3TGB A;  3WJB A;  1KXO A;  1YP6 A;  3NPO A;  5BVT A;  2NND A;  1QY2 A;  2NP1 A;  1U17 A;  4ZR2 A;  4ZH9 A;  1YUP A;  4A1Y A;  2O62 A;  4ORX A;  4IAW A;  1D3S A;  2ACO A;  1YIV A;  3BY0 A;  3U03 A;  2G79 A;  1X8P A;  2FR3 A;  1ERX A;  3DSZ A;  3WJF A;  2CZU A;  1OEK A;  3CBC A;  3BU1 A;  3PPT A;  3F9D A;  2FLJ A;  3SAO A;  1SXY A;  2W2A A;  5LKE A;  2PY1 A;  3WBG A;  1QFV A;  3EMM A;  1ZND A;  4BOE A;  1E00 A;  1P6P A;  1MDC A;  4LKP A;  2A2G A;  2R73 A;  5FEN A;  4MVK A;  4DQ4 A;  1KQX A;  3TGC A;  2MM3 A;  5L8N A;  4NLI A;  1TW4 A;  5D45 A;  4TQ2 A;  1KOI A;  1Z24 A;  2K23 A;  1HN2 A;  3WJG A;  1T8V A;  4ORY A;  4YDB A;  4M6S A;  5HZQ A;  3FEN A;  1QQS A;  1A3Y A;  1YWB A;  1EII A;  3CMP A;  2Q2M A;  4YBP A;  1ZNH A;  5H9A A;  5HTD A;  4OMW A;  3AKN A;  1ACD A;  3WXQ A;  3G7X A;  5HWZ A;  1LIE A;  5HCE C;  5HZ5 A;  1BSO A;  4XME A;  1ZRY A;  3HWD A;  2QOS C;  4YCE A;  3VG6 A;  1GXA A;  1SA8 A;  4Y0P A;  2LB6 A;  4QYN A;  4NYR A;  4AZM A;  5EEE A;  4IB7 A;  3ZQ3 A;  3P6C A;  1KQW A;  1GGL A;  4ORS A;  1GX9 A;  3EBK A;  5KID A;  2NNQ A;  1EPB A;  1SXX A;  1OEJ A;  2FT9 A;  3KFH A;  4IAX A;  2Q39 A;  3APW A;  4LKT A;  2QO5 A;  1X8Q A;  1DZM A;  1GKA A;  1ZNK A;  3NP1 A;  5L8O A;  3MBT A;  4ZH6 A;  3P6F A;  1LID A;  1ML7 A;  2MO5 A;  1SY0 A;  4IMO A;  3U9P C;  2CBS A;  4NYQ A;  1KT3 A;  4RUN A;  3C77 X;  2FRS A;  3B2I A;  5EDB A;  1EUO A;  1JYD A;  1NP1 A;  2POA A;  1B4M A;  4ZHF A;  5HA1 A;  2OVA A;  2Q4N A;  4ZHC A;  3FMZ A;  2AKQ A;  1ICM A;  4O9S A;  1LFO A;  3NQ9 A;  1PMP A;  4YKO A;  2FWV A;  4I3C A;  3VG2 A;  1BJ7 A;  1UZ2 X;  3FA8 A;  1EIO A;  5HBS A;  3FW5 A;  3WJE A;  4ALB A;  4ZHD A;  2FTB A;  3PH5 A;  5D47 A;  4YGG A;  4AZO A;  1G74 A;  1ZNE A;  4Y0Q A;  3I0A A;  2LFO A;  3B2K A;  4TKJ A;  1BLR A;  1OPA A;  1E5P A;  4OS3 A;  5D4A A;  3CBS A;  2CZT A;  4YMY A;  1E06 A;  4HPD A;  5DG4 A;  3Q6L A;  4D6A A;  1PM1 X;  1XCA A;  2GTF X;  1CRB A;  2A13 A;  5EDC A;  1GT3 A;  1G85 A;  1KT4 A;  1E02 A;  2HZR A;  1CBQ A;  2L5P A;  3TGA A;  1NP4 A;  4I3D A;  4XMH A;  2HZQ A;  2RCT A;  4IBA A;  2G78 A;  3FR5 A;  1KT7 A;  1LKE A;  2QO4 A;  1MX7 A;  1KZW A;  4YH0 A;  3VG4 A;  5IO7 A;  2RQ0 A;  1SXW A;  4YFR A;  2WR6 A;  3GAQ A;  3STN A;  1YWC A;  5H8T A;  4ARH A;  1OBU A;  4XMG A;  2Q9S A;  2F73 A;  4AZR A;  1D2U A;  4EFG A;  2K62 A;  1IW2 A;  3UEW A;  5D48 A;  1A57 A;  1HMR A;  1FEN A;  4TKH A;  3BX7 A;  3FR4 A;  1CBR A;  4YBU A;  1LIB A;  2AT6 X;  2GC9 A;  4TJZ A;  1DZJ A;  3L4R A;  2HNX A;  4GET A;  5L8I A;  1VYG A;  4WBK A;  4YKM A;  4KII A;  4N7D A;  4QGX A;  1MVG A;  3P6D A;  4ZGU A;  3IFB A;  1BM5 A;  4GH7 A;  5LJE A;  3WJC A;  5HAE A;  1MX8 A;  2GJ5 A;  3DTQ A;  2XKL A;  1EQD A;  3JS1 A;  4M7M A;  3BDR A;  2AMM X;  3OJY C;  4EDE A;  3C78 X;  1GT4 A;  3FA9 A;  1DZP A;  1JV4 A;  3NX2 A;  1ADL A;  3HK1 A;  1OPB A;  4IB9 A;  4HPB A;  1VYF A;  1OBQ A;  2LBV A;  2XST A;  1T0V A;  1KGL A;  4TNN A;  4R0B A;  1ERB A;  1FTP A;  1LIC A;  1X8U A;  2L68 A;  4BVM A;  1JJX A;  4MVL A;  3U0D A;  2CBR A;  4QZT A;  1JBH A;  4ODD A;  1LIF A;  4TLJ A;  1R0U A;  1ALB A;  4WFV A;  4BQU A;  3APU A;  1URE A;  2OVE A;  5LJK A;  1KT5 A;  2DM5 A;  2QM9 A;  2YG2 A;  3BLG A;  1ZNG A;  1JJJ A;  2FR2 A;  1JYJ A;  1T68 X;  2CM4 A;  2OVD A;  5H9K A;  3CQR A;  2N93 A;  3B2H A;  5D8J A;  3FA7 A;  5HCC C;  2RCQ A;  1I4U A;  1X8N A;  1MUP A;  3IA8 A;  4HPA A;  3UEV A;  5F7G A;  2R74 A;  2W2F A;  3O22 A;  4DQ3 A;  1XKI A;  4YDA A;  5K06 A;  5EED A;  3B2L A;  2W2B A;  1A2D A;  4I3B A;  3ZUO A;  3PH6 A;  2JOZ A;  2LBA A;  1S7D A;  4AYH A;  1H91 A;  1CBS A;  3EYC A;  3EBW A;  2RA6 A;  1RLB E;  5HZ9 A;  1IKJ A;  2WUT A;  4PSQ A;  4OS0 A;  3P6E A;  5FFH A;  5HZ8 A;  4NNT A;  3FLL A;  1AVG I;  2G7B A;  2JU8 A;  3D97 A;  5EZ2 A;  1JZU A;  2L9C A;  5HCD C;  3P6H A;  5LJB A;  2FS7 A;  2NNE A;  3PEC A;  1S2P A;  1L6M A;  1VPR A;  4ES7 A;  5LJH A;  3BSZ E;  3T1D A;  5H9L A;  1KZX A;  4Y0R A;  3HWE A;  4LZV A;  1AEL A;  4NLJ A;  1TXL A;  2ACP X;  2JN3 A;  4GKC A;  5LJD A;  2BLG A;  2RD7 C;  5JR8 A;  1AB0 A;  3QKG A;  4I9R A;  4ALO A;  4ORU A;  4XMF A;  1FDQ A;  1B56 A;  4QZU A;  1SY1 A;  5KIC A;  2CM9 A;  1BWY A;  1FE3 A;  3B2J A;  1O8V A;  1I04 A;  4QGV A;  1YWA A;  1LNM A;  2X46 A;  3FEL A;  4ZFX A;  5HZ6 A;  3CQN A;  4IB8 A;  5HTE A;  3S26 A;  5FAZ A;  2OZQ A;  1BSQ A;  4ORW A;  3RSW A;  1DFV A;  1OBP A;  2P8G A;  3KFF A;  2MJI A;  1IIU A;  2Q2P A;  4IMN A;  2KT4 B;  5F6Z A;  4A8Z A;  5LJC A;  4AZQ A;  2HLV A;  3WVM A;  4GRJ A;  2AT0 X;  2HMB A;  1GKA B;  2WSJ A;  4WFU A;  3C76 X;  1HMS A;  5BVQ A;  1QG5 A;  1GT5 A;  4YCH A;  4HFO A;  4D6B A;  1IKE A;  4N7C A;  4QGW A;  1TOU A;  1QWD A;  1O1V A;  1N0S A;  1I06 A;  3TZS A;  1YP7 A;  1TOW A;  3KZA A;  4LZU A;  1SXU A;  5IO6 A;  3JSQ A;  1U0X A;  3RZY A;  1X89 A; 
#chains in the Genus database with same CATH topology
 3EW1 A;  2WEX A;  4RUU A;  1SWH A;  3K3L A;  2RTK A;  1PEE A;  4FQB B;  2RTQ B;  2WQ9 A;  2ZSC A;  1NGL A;  1VWQ B;  2AH7 X;  2AT3 X;  1RAV A;  2C4I A;  4ZCB A;  1OEE A;  1KL4 A;  4YFQ A;  4BX5 B;  4DNE A;  1K24 A;  4OMX A;  2AL0 X;  5LKF A;  4TKB A;  2OVS A;  1O1U A;  3ELZ A;  3WBG A;  4ZGF A;  1VWM B;  1YWD A;  1I05 A;  2AT5 X;  3RDS A;  1N9Y A;  3FW4 A;  2A5B A;  2WWP A;  2A2U A;  1ZNL A;  1CJ5 A;  1UYO X;  2MHD A;  1HXL A;  5F2B A;  1GX8 A;  2GTL N;  1SWQ A;  1G7N A;  4BX6 A;  3O2Y A;  3SZJ A;  1QY0 A;  1WBI A;  1SY3 A;  4GNY A;  4XMD A;  3AKM A;  1TVQ A;  1BBP A;  3APX A;  3KQ0 A;  1SWK A;  3S5X A;  3PED A;  2E4J A;  2KTD A;  3BX8 A;  2AT8 X;  4NP1 A;  5BVS A;  2OFB A;  1FEM A;  4Z2O A;  2G5L A;  3STK A;  1IFB A;  1LUQ A;  5KID A;  4JNJ A;  4MVI A;  4U8U O;  1SWF A;  2ASN X;  5EPQ A;  1EAL A;  3FR2 A;  1BEB A;  2OFR X;  2IFB A;  1B8E A;  2JMB A;  2IZE B;  2X34 A;  4O4O A;  4Y5D A;  3ZW0 B;  4YVB A;  3EM0 A;  3PQU A;  1SWG A;  2F09 A;  4Y0S A;  3KVN A;  1ICN A;  1EW3 A;  1GT1 A;  2A0A A;  2WQA E;  3D95 A;  3HWG A;  5IO5 A;  1A18 A;  5CE4 A;  4BGF A;  4ZHG A;  3STM X;  4QAE A;  2R56 A;  1G5W A;  1QAB E;  2X45 A;  3WZO A;  1HMT A;  1AQB A;  1SLG B;  3O19 A;  4YGZ A;  2RTH B;  4O3Y A;  1HBQ A;  1N9M A;  4YFP A;  1JMX A;  2WEW A;  3NX1 A;  5CHK A;  5B27 A;  5K68 A;  4EEJ A;  4FBO A;  5KHP A;  1OSP O;  3CWK A;  2OYB O;  3WZQ A;  3HWF A;  5B29 A;  4CV7 A;  5F1E A;  4BCS A;  1BSY A;  3BU9 A;  3HTY A;  1BRQ A;  5LJG A;  3SOT A;  4AW8 A;  2IZC B;  3ELX A;  3VG5 A;  4AZN A;  1HQP A;  1KL5 A;  1MK5 A;  1VWP B;  2OY8 A;  4CSB A;  3RDQ A;  4HPC A;  3WYQ A;  3NR3 A;  5HZ6 A;  4OS8 A;  4UU3 A;  2Y32 A;  3I17 A;  3KFI A;  1X8O A;  1U18 A;  3KFG A;  4GK9 A;  4YGH A;  5HA0 A;  1LPJ A;  3WYP A;  3ZI8 A;  5CYB A;  5F6B A;  4EXZ A;  1EPA A;  3P6G A;  1IFC A;  3RY1 A;  4K19 A;  2ALL X;  4A1H A;  3RY2 A;  2OY7 A;  3UEX A;  1HBP A;  3T6L A;  3FID A;  1SWT A;  3NQK A;  4UU2 A;  4Z2P A;  5H9N A;  1DC9 A;  2RTL A;  4BX7 A;  2JU3 A;  3ZW1 A;  1DZK A;  2FGS A;  5AQ6 A;  3WJD A;  1EXS A;  3APV A;  5DPQ A;  1QY1 A;  3D96 A;  3FEP A;  1S44 A;  4A60 A;  2OF9 A;  3NQ3 A;  3ZW2 A;  4KC7 A;  3CR6 A;  3FEK A;  3MVF A;  4GJS A;  5C0N A;  5F58 A;  1CBI A;  2JU7 A;  3BS2 A;  1KT6 A;  1RBP A;  3OBL A;  1SWO A;  2OFM X;  3BRN A;  4GNW A;  3S60 A;  2FS6 A;  4ZJ0 A;  3VG3 A;  4GE1 A;  1E2T A;  4CK4 A;  3NAD A;  1FEL A;  3D4R A;  3F8A A;  1LF7 A;  4BX6 B;  2FHL A;  3MG5 A;  2EU7 X;  3VPJ E;  4NNS A;  3HOL A;  1X71 A;  4O4X A;  4IRW A;  4GJV A;  1GM6 A;  3UAQ A;  1BRP A;  4O4S A;  2LKK A;  1DF3 A;  1JQP A;  4I9S A;  2HYS A;  3VG7 A;  3ZUI A;  3FIQ A;  2A3F X;  3TF6 A;  2X4M A;  4KC8 A;  1SY2 A;  1VWE B;  3PP6 A;  4ORR A;  4PJ2 A;  2RTB B;  4JHQ A;  1B0O A;  3UEU A;  2ANS A;  2L67 A;  2QO6 A;  4QRL A;  2YMS A;  4ZHH A;  3E3C A;  3RE5 A;  1DV9 A;  4QYP A;  4XMC A;  1PBO A;  1VWR B;  4AZP A;  4IB6 A;  1QFT A;  1SWA A;  1LDO A;  3FA6 A;  3TGB A;  3WJB A;  4HWM A;  4CDC A;  1KXO A;  1YP6 A;  2KTS A;  3SLT A;  1LCZ A;  2A5C A;  4U8U N;  3NPO A;  5BVT A;  1AVE A;  1NBX A;  2NND A;  1QY2 A;  2NP1 A;  1U17 A;  4ZR2 A;  2RTE B;  4ZH9 A;  1LDQ A;  1YUP A;  1SRG A;  4A1Y A;  2RTI B;  2O62 A;  4ORX A;  1W4T A;  4IAW A;  3VE2 A;  1D3S A;  2ACO A;  2ZAG A;  1UYN X;  1YIV A;  3BY0 A;  4O49 A;  5B11 O;  5LJH A;  3U03 A;  4BJ8 A;  2G79 A;  1Y0G A;  1X8P A;  2FR3 A;  1ERX A;  3DSZ A;  4I95 A;  1SWU A;  1VWG B;  3RDM A;  1JJU A;  1OEK A;  1Y52 X;  2CZU A;  3CBC A;  3WJF A;  3V8U A;  3BU1 A;  3PPT A;  3F9D A;  2FLJ A;  3SAO A;  1SXY A;  1VWF B;  2AVI A;  2OL7 A;  2W2A A;  2PY1 A;  3OD9 A;  1QFV A;  3EMM A;  3OE3 A;  1ZND A;  4MIS A;  2OL6 O;  1E00 A;  1SWC A;  4BOE A;  2HKD A;  5L3Y A;  3RWX A;  1P6P A;  1GX3 A;  1MDC A;  1N7Y A;  4JO6 A;  3CKG A;  4LKP A;  5AJB A;  2A2G A;  2R73 A;  3MX7 A;  4MVK A;  1STP A;  4CPF A;  4DQ4 A;  5FEN A;  1KQX A;  1HXZ A;  3TGC A;  1RST B;  1SRH A;  2MF6 A;  2MM3 A;  5L8N A;  4NLI A;  4FBR A;  1TW4 A;  5D45 A;  3ZW1 B;  4BX7 B;  4TQ2 A;  1KL3 A;  1KOI A;  1Z24 A;  1SWN A;  1HN2 A;  2K23 A;  2RTA A;  3WJG A;  4MVE A;  4KT5 A;  5BYP A;  1T8V A;  4ORY A;  4YDB A;  4M6S A;  5HZQ A;  1NQM A;  1SLF B;  1QQS A;  3FEN A;  5D4A A;  4MEE A;  1W6F A;  3LHN A;  1A3Y A;  1YWB A;  5AEO A;  5IXG A;  1EII A;  3CMP A;  1SRI A;  2Q2M A;  2M4L A;  4KCA A;  4YBP A;  1ZNH A;  1SWJ A;  5H9A A;  5HTD A;  4OMW A;  3AKN A;  1ACD A;  3WXQ A;  1SMP I;  3G7X A;  1LIE A;  5HWZ A;  1W5R A;  5HCE C;  5HZ5 A;  2RTC B;  1BSO A;  4XME A;  1ZRY A;  3HWD A;  2QOS C;  4YCE A;  3VG6 A;  1GXA A;  2KD2 A;  4IAB A;  1VWI B;  1SA8 A;  4Y0P A;  2LB6 A;  4QYN A;  4NYR A;  4AZM A;  4GDZ A;  4IB7 A;  5EEE A;  3ZQ3 A;  3PK2 A;  3P6C A;  2IZG B;  2WPU A;  2QCB A;  1KQW A;  1GGL A;  4ORS A;  1GX9 A;  2CAM A;  5IRU A;  1RXH A;  3EBK A;  2NNQ A;  1EPB A;  4LQZ A;  1SXX A;  3VHH A;  2QMI A;  1OEJ A;  2FT9 A;  3KFH A;  4IAX A;  2Q39 A;  3APW A;  4LKT A;  2QOM A;  3RKG A;  3T2X A;  4GGZ A;  1JIW I;  2QO5 A;  4JGL A;  1X8Q A;  1DZM A;  1SWE A;  1GKA A;  1ZNK A;  1NDJ A;  3NP1 A;  5L8O A;  3MBT A;  4ZH6 A;  3P6F A;  1LID A;  1ML7 A;  1I78 A;  1SY0 A;  2MO5 A;  4IMO A;  3U9P C;  1VWJ B;  2CBS A;  4U3Q A;  3VHM A;  5B5F A;  4NYQ A;  1PTS A;  5CSE A;  1KT3 A;  2UYW A;  4RUN A;  3C77 X;  2FRS A;  3B2I A;  5EDB A;  1EUO A;  1JYD A;  1NP1 A;  2POA A;  3VGW A;  1B4M A;  4ZHF A;  5HA1 A;  2OVA A;  2Q4N A;  4ZHC A;  3FMZ A;  2AKQ A;  4COT A;  1ICM A;  4O9S A;  1LFO A;  1SWR A;  3NQ9 A;  2IZJ A;  3FYF A;  1PMP A;  3WZN A;  3T2W A;  4YKO A;  2FWV A;  4I3C A;  1SWB A;  4O3X B;  3VG2 A;  1BJ7 A;  1UZ2 X;  3FA8 A;  1EIO A;  2RTJ A;  1SWL A;  3FW5 A;  3QQ2 A;  5HBS A;  4NV8 A;  4U8U M;  3RDU A;  3WJE A;  2FTB A;  3VE1 A;  3PH5 A;  4ALB A;  5D47 A;  4YGG A;  4AZO A;  1G74 A;  4I6S A;  4MIR A;  3SLO A;  2Y3E A;  1ZNE A;  4Y0Q A;  3MM0 A;  3I0A A;  2LFO A;  3B2K A;  4TKJ A;  2RTG B;  1BLR A;  1OPA A;  1E5P A;  1SRF A;  2RTP B;  4OEM A;  3CBS A;  1NQN A;  2CZT A;  4GGR A;  4NW4 A;  4OS3 A;  4YMY A;  1E06 A;  1SWS A;  4HPD A;  5DG4 A;  2RTR B;  3Q6L A;  1EI5 A;  1RXK A;  4D6A A;  1PM1 X;  1XCA A;  2GTF X;  4GD9 A;  2IZB A;  1CRB A;  2A13 A;  5EDC A;  3WZP A;  1GT3 A;  1AVD A;  1G85 A;  1E02 A;  1KT4 A;  1CBQ A;  2BS6 A;  2HZR A;  1NP4 A;  2L5P A;  3TGA A;  4I3D A;  4XMH A;  2HZQ A;  2RCT A;  2I5V O;  4CDF A;  5LKE A;  1NC9 A;  4IBA A;  1VWN B;  1VWO B;  2G78 A;  3D9W A;  3FR5 A;  2UZ2 A;  1KT7 A;  4L1N A;  1LKE A;  2QO4 A;  1MX7 A;  1KZW A;  4YH0 A;  3H3I A;  3VG4 A;  1JMZ A;  4ML7 B;  3VU1 A;  2RQ0 A;  4L3R A;  2PI3 O;  1SRE A;  1SXW A;  3CKF A;  5IO7 A;  4YFR A;  2WR6 A;  3GAQ A;  4O3W A;  4Y59 A;  3STN A;  1YWC A;  2GTL M;  5H8T A;  4ARH A;  2BSZ A;  1OBU A;  2LA7 A;  4XMG A;  2Q9S A;  2F73 A;  4CDE A;  4AZR A;  1D2U A;  4EFG A;  2K62 A;  1IW2 A;  2C1Q A;  3UEW A;  5B5G A;  5D48 A;  1A57 A;  1HMR A;  2IZA A;  3GE2 A;  1FEN A;  3PQS A;  4TKH A;  3BX7 A;  3FR4 A;  3RDO A;  4Z27 A;  1CBR A;  1HY2 A;  4YBU A;  1LIB A;  2A8G A;  2IZF B;  3PDF A;  2AT6 X;  2AF5 A;  2GC9 A;  4TJZ A;  1DZJ A;  4ZHD A;  3L4R A;  5AJC A;  2HNX A;  4GET A;  5L8I A;  1VYG A;  4WBK A;  2RN4 A;  4YKM A;  4KII A;  4N7D A;  4QGX A;  1MVG A;  3P6D A;  4ZGU A;  1VWK B;  3IFB A;  1BM5 A;  4GH7 A;  5LJE A;  3WJC A;  5HAE A;  1MX8 A;  3VHI A;  4INN A;  1SWD A;  2GJ5 A;  1SRJ A;  3DTQ A;  2XKL A;  4ID2 A;  1EQD A;  3JS1 A;  2OF8 A;  2IZK A;  2AMM X;  3BDR A;  3OJY C;  4M7M A;  5B3M O;  1WUB A;  3C78 X;  1GT4 A;  3FA9 A;  3RE6 A;  5K67 A;  1DZP A;  4CPH A;  1JV4 A;  3NX2 A;  1ADL A;  3HK1 A;  4GU8 A;  5B2A O;  4B55 A;  1OPB A;  4IB9 A;  4HPB A;  2VFC A;  1VYF A;  3P24 A;  4EKV A;  1OBQ A;  2BT9 A;  2LBV A;  2XST A;  1T0V A;  1KGL A;  4DCB A;  4TNN A;  4I60 A;  4R0B A;  1ERB A;  3AEH A;  1FTP A;  1LIC A;  4QNI A;  1X8U A;  2L68 A;  4BVM A;  1RXJ A;  4OKA A;  1JJX A;  2GH7 A;  4EQA C;  4MVL A;  3U0D A;  4CPI A;  2CBR A;  4QZT A;  1JBH A;  1DF8 A;  1STS B;  1MOY A;  1VWC B;  4ODD A;  2I5Z O;  2DJF A;  1LIF A;  4TLJ A;  4KH8 A;  3T6F A;  1R0U A;  1ALB A;  4WFV A;  4BQU A;  1IJ8 A;  3APU A;  1URE A;  2KW1 A;  2OVE A;  5LJK A;  1KT5 A;  2DM5 A;  2QM9 A;  2YG2 A;  3EC5 A;  3BLG A;  3S5V A;  1ZNG A;  3WOV A;  3LV4 A;  1JJJ A;  1VWL B;  2FR2 A;  1JYJ A;  1FJ1 E;  3SLJ A;  1I9H A;  3ZWE A;  1T68 X;  2CM4 A;  2OVD A;  3HPE A;  2X8F A;  3CQR A;  3FDC A;  1SWP A;  5H9K A;  2N93 A;  3B2H A;  5D8J A;  3SZI A;  2OY5 O;  3FA7 A;  5HCC C;  4CPE A;  2RCQ A;  1I4U A;  3F6Z B;  5FQ6 E;  1X8N A;  1SLE B;  2FHN X;  1MUP A;  3IA8 A;  2G8C O;  3Q34 A;  4HPA A;  3UEV A;  2F01 A;  1VYO A;  5F7G A;  2R74 A;  1K3B A;  2W2F A;  3O22 A;  1XKI A;  4YDA A;  4DQ3 A;  4GZV A;  5EED A;  5K06 A;  2C1S A;  2X8T A;  3B2L A;  2W2B A;  1A2D A;  4I3B A;  4EDE A;  4GDA A;  3NBX X;  3ZUO A;  3PH6 A;  2JOZ A;  2IZH B;  2LBA A;  1S7D A;  5B10 O;  4AYH A;  1H91 A;  1CBS A;  3EYC A;  1RSU B;  4Z6J A;  3EBW A;  2RA6 A;  2Z4H A;  1RLB E;  5HZ9 A;  5FQ8 E;  4CDD A;  1IKJ A;  1VWD B;  5FQ7 E;  2RTM A;  2WUT A;  4PSQ A;  4OS0 A;  3P6E A;  5FFH A;  5HZ8 A;  4NNT A;  3FLL A;  1AVG I;  2G7B A;  2JU8 A;  3D97 A;  5EZ2 A;  4ON1 A;  1JZU A;  1LEL A;  2Y3F A;  2BC3 A;  2L9C A;  3ZZV A;  2IZD B;  5HCD C;  3P6H A;  5LJB A;  4BX5 A;  2FS7 A;  2NNE A;  3PEC A;  1S2P A;  1L6M A;  1VPR A;  1VWH B;  4U9C A;  3BSZ E;  1N4J A;  4CPH B;  2GTL O;  3T1D A;  4ES7 A;  4QQ1 A;  1VWB B;  2BHV A;  2X56 A;  2OY1 O;  3AUM O;  5H9L A;  1KZX A;  4Y0R A;  3HWE A;  4LZV A;  2IZI A;  1AEL A;  4NLJ A;  1TXL A;  4FBV A;  2ACP X;  2JN3 A;  2X32 A;  4GKC A;  3LTW A;  5LJD A;  4BBO A;  4U46 A;  1KFF A;  1STR B;  2BLG A;  2RD7 C;  5JR8 A;  4FGI B;  2OL8 O;  1Y9T A;  1MM9 A;  4O3Z A;  1AB0 A;  3QKG A;  3X00 A;  4I9R A;  4ALO A;  5JD2 A;  4ORU A;  4XMF A;  2IZL B;  1LCV A;  1FDQ A;  2RTO B;  1B56 A;  2VDF A;  1N43 A;  1SLD B;  2RTF B;  4QZU A;  1SY1 A;  5KIC A;  3RDX A;  2CM9 A;  1BWY A;  1FE3 A;  3B2J A;  1O8V A;  1I04 A;  4GGT A;  1YWA A;  4QGV A;  1LCW A;  1LNM A;  2X46 A;  3P02 A;  3FEL A;  4Z28 A;  1Y53 X;  1PBY A;  1MEP A;  3SZH A;  2BS5 A;  3ZW0 A;  3CQN A;  4C5P A;  4IB8 A;  4ZFX A;  5HTE A;  1VWA B;  3N91 A;  3S26 A;  5FAZ A;  2OZQ A;  1BSQ A;  4ORW A;  2VFB A;  3RSW A;  1DFV A;  2JW1 A;  4Z2V A;  1OBP A;  2P8G A;  3KFF A;  2MJI A;  1IIU A;  2Q2P A;  4IMN A;  2KT4 B;  4O4U A;  5F6Z A;  4A8Z A;  5LJC A;  4AZQ A;  2HLV A;  3WVM A;  4GRJ A;  2AT0 X;  2HMB A;  1GKA B;  4GUZ A;  4OEL A;  5IRW A;  2WSJ A;  4WFU A;  3C76 X;  1HMS A;  1Y55 X;  4NV7 A;  5BVQ A;  2ZAI A;  2Z4I A;  2FKG A;  2RTN B;  2RTD B;  3HOE A;  1QG5 A;  1GT5 A;  4YCH A;  2X55 A;  4HFO A;  2MWH A;  4D6B A;  3RBY A;  2DJG A;  2OFA A;  1HQQ A;  1IKE A;  2JGS A;  2FKJ A;  4N7C A;  2X8S A;  4QGW A;  1TOU A;  1QWD A;  1O1V A;  4WHI A;  5IRA A;  1N0S A;  1Y9L A;  1I06 A;  3TZS A;  1YP7 A;  1TOW A;  3KZA A;  3JQO A;  1SXU A;  4LZU A;  5IO6 A;  3EW2 A;  3JSQ A;  1U0X A;  3RZY A;  1X89 A; 
#chains in the Genus database with same CATH homology
 2WEX A;  4RUU A;  3K3L A;  1PEE A;  4FQB B;  2WQ9 A;  1NGL A;  2AH7 X;  2AT3 X;  4ZCB A;  1OEE A;  4YFQ A;  4OMX A;  2AL0 X;  5LKF A;  4TKB A;  2OVS A;  1O1U A;  3ELZ A;  4ZGF A;  1YWD A;  1I05 A;  2AT5 X;  3FW4 A;  2WWP A;  2A2U A;  1ZNL A;  1CJ5 A;  2MHD A;  1GX8 A;  2GTL N;  1G7N A;  3O2Y A;  1QY0 A;  1SY3 A;  4GNY A;  4XMD A;  3AKM A;  1TVQ A;  1BBP A;  3APX A;  3KQ0 A;  3S5X A;  3PED A;  2E4J A;  2KTD A;  3BX8 A;  2AT8 X;  4NP1 A;  5BVS A;  1FEM A;  3STK A;  1IFB A;  4MVI A;  4U8U O;  2ASN X;  5EPQ A;  1EAL A;  3FR2 A;  1BEB A;  2OFR X;  2IFB A;  1B8E A;  2JMB A;  4O4O A;  3ZW0 B;  3EM0 A;  3PQU A;  2F09 A;  4Y0S A;  1ICN A;  1EW3 A;  1GT1 A;  2A0A A;  2WQA E;  3D95 A;  3HWG A;  5IO5 A;  1A18 A;  5CE4 A;  4ZHG A;  3STM X;  4QAE A;  2R56 A;  1G5W A;  1QAB E;  2X45 A;  1HMT A;  1AQB A;  3O19 A;  4YGZ A;  4O3Y A;  1HBQ A;  4YFP A;  5B27 A;  2WEW A;  3NX1 A;  4EEJ A;  5KHP A;  4FBO A;  3CWK A;  3HWF A;  5B29 A;  4CV7 A;  5F1E A;  1BSY A;  3BU9 A;  3HTY A;  1BRQ A;  5LJG A;  3SOT A;  4AW8 A;  4AZN A;  3ELX A;  3VG5 A;  1HQP A;  4CSB A;  4HPC A;  3NR3 A;  4OS8 A;  4UU3 A;  3I17 A;  3KFI A;  1X8O A;  1U18 A;  3KFG A;  4GK9 A;  4YGH A;  5HA0 A;  1LPJ A;  3ZI8 A;  5CYB A;  5F6B A;  4EXZ A;  1EPA A;  3P6G A;  1IFC A;  4K19 A;  2ALL X;  4A1H A;  3UEX A;  1HBP A;  3NQK A;  4UU2 A;  5H9N A;  1DC9 A;  2JU3 A;  3ZW1 A;  1DZK A;  5AQ6 A;  3WJD A;  1EXS A;  3APV A;  5DPQ A;  1QY1 A;  3D96 A;  3FEP A;  1S44 A;  4A60 A;  3NQ3 A;  3ZW2 A;  4KC7 A;  3CR6 A;  3FEK A;  3MVF A;  5C0N A;  5F58 A;  1CBI A;  2JU7 A;  3BS2 A;  1KT6 A;  1RBP A;  3OBL A;  3BRN A;  2OFM X;  4GNW A;  3S60 A;  2FS6 A;  4ZJ0 A;  3VG3 A;  4GE1 A;  4CK4 A;  3NAD A;  1FEL A;  3D4R A;  3F8A A;  1LF7 A;  2EU7 X;  3VPJ E;  4NNS A;  3HOL A;  1X71 A;  4O4X A;  1GM6 A;  3UAQ A;  1BRP A;  4O4S A;  2LKK A;  1DF3 A;  4I9S A;  3VG7 A;  2HYS A;  3ZUI A;  3FIQ A;  2A3F X;  3TF6 A;  4KC8 A;  1SY2 A;  3PP6 A;  4PJ2 A;  4ORR A;  3UEU A;  1B0O A;  2ANS A;  2L67 A;  2QO6 A;  4QRL A;  2YMS A;  4ZHH A;  3E3C A;  1DV9 A;  4QYP A;  4XMC A;  1PBO A;  4AZP A;  4IB6 A;  1QFT A;  3FA6 A;  3TGB A;  3WJB A;  4HWM A;  1KXO A;  1YP6 A;  2KTS A;  4U8U N;  3NPO A;  5BVT A;  2NND A;  1QY2 A;  2NP1 A;  1U17 A;  4ZR2 A;  4ZH9 A;  1YUP A;  4A1Y A;  2O62 A;  4ORX A;  4IAW A;  3VE2 A;  1D3S A;  2ACO A;  2ZAG A;  4O49 A;  1YIV A;  3BY0 A;  3U03 A;  2G79 A;  1X8P A;  2FR3 A;  1ERX A;  3DSZ A;  4I95 A;  3WJF A;  2CZU A;  1OEK A;  3CBC A;  3V8U A;  3BU1 A;  3PPT A;  3F9D A;  2FLJ A;  3SAO A;  1SXY A;  3OD9 A;  3OE3 A;  2W2A A;  4MIS A;  2PY1 A;  3WBG A;  1QFV A;  3EMM A;  5LKE A;  1ZND A;  4BOE A;  1E00 A;  3RWX A;  1P6P A;  1MDC A;  4LKP A;  5AJB A;  2A2G A;  2R73 A;  3MX7 A;  4MVK A;  4DQ4 A;  5FEN A;  1KQX A;  3TGC A;  2MM3 A;  5L8N A;  4NLI A;  4FBR A;  1TW4 A;  5D45 A;  3ZW1 B;  4TQ2 A;  1KOI A;  1Z24 A;  2K23 A;  1HN2 A;  5BYP A;  3WJG A;  4MVE A;  4KT5 A;  1T8V A;  4ORY A;  4YDB A;  4M6S A;  5HZQ A;  3FEN A;  1QQS A;  5AEO A;  3LHN A;  1A3Y A;  1YWB A;  1EII A;  3CMP A;  2Q2M A;  2M4L A;  4KCA A;  4YBP A;  1ZNH A;  5H9A A;  5HTD A;  4OMW A;  3AKN A;  1ACD A;  3WXQ A;  1SMP I;  3G7X A;  1LIE A;  5HWZ A;  5HCE C;  5HZ5 A;  1BSO A;  4XME A;  1ZRY A;  3HWD A;  2QOS C;  4YCE A;  3VG6 A;  1GXA A;  2KD2 A;  4IAB A;  1SA8 A;  4Y0P A;  2LB6 A;  4QYN A;  4NYR A;  4AZM A;  4GDZ A;  4IB7 A;  5EEE A;  3ZQ3 A;  3P6C A;  1KQW A;  1GGL A;  4ORS A;  1GX9 A;  3EBK A;  5KID A;  2NNQ A;  1EPB A;  4LQZ A;  1SXX A;  2QMI A;  1OEJ A;  2FT9 A;  3KFH A;  4IAX A;  2Q39 A;  3APW A;  4LKT A;  3RKG A;  1JIW I;  2QO5 A;  4JGL A;  1X8Q A;  1DZM A;  1GKA A;  1ZNK A;  3NP1 A;  5L8O A;  3MBT A;  4ZH6 A;  3P6F A;  1LID A;  1ML7 A;  2MO5 A;  1SY0 A;  4IMO A;  3U9P C;  2CBS A;  4U3Q A;  4NYQ A;  1KT3 A;  4RUN A;  3C77 X;  2FRS A;  3B2I A;  5EDB A;  1EUO A;  1JYD A;  1NP1 A;  2POA A;  1B4M A;  4ZHF A;  5HA1 A;  2OVA A;  2Q4N A;  4ZHC A;  3FMZ A;  2AKQ A;  4COT A;  1ICM A;  4O9S A;  1LFO A;  3NQ9 A;  3FYF A;  1PMP A;  4YKO A;  2FWV A;  4I3C A;  4O3X B;  3VG2 A;  1BJ7 A;  1UZ2 X;  3FA8 A;  1EIO A;  5HBS A;  3FW5 A;  3WJE A;  4ALB A;  4U8U M;  4ZHD A;  2FTB A;  3VE1 A;  3PH5 A;  5D47 A;  4YGG A;  4AZO A;  1G74 A;  4I6S A;  4MIR A;  1ZNE A;  4Y0Q A;  3I0A A;  2LFO A;  3B2K A;  4TKJ A;  1BLR A;  1OPA A;  1E5P A;  4OS3 A;  5D4A A;  3CBS A;  4NW4 A;  2CZT A;  4YMY A;  1E06 A;  4HPD A;  5DG4 A;  3Q6L A;  1EI5 A;  4D6A A;  1PM1 X;  1XCA A;  2GTF X;  1CRB A;  2A13 A;  5EDC A;  1GT3 A;  1G85 A;  1KT4 A;  1E02 A;  2HZR A;  1CBQ A;  2BS6 A;  2L5P A;  1NP4 A;  3TGA A;  4I3D A;  4XMH A;  2HZQ A;  2RCT A;  4IBA A;  2G78 A;  3FR5 A;  1KT7 A;  4L1N A;  1LKE A;  2QO4 A;  1MX7 A;  1KZW A;  4YH0 A;  3H3I A;  3VG4 A;  4ML7 B;  3VU1 A;  2RQ0 A;  4L3R A;  5IO7 A;  1SXW A;  4YFR A;  2WR6 A;  3GAQ A;  4O3W A;  3STN A;  1YWC A;  2GTL M;  5H8T A;  4ARH A;  1OBU A;  2LA7 A;  4XMG A;  2Q9S A;  2F73 A;  4AZR A;  1D2U A;  4EFG A;  2K62 A;  1IW2 A;  3UEW A;  5D48 A;  1A57 A;  1HMR A;  3GE2 A;  3PQS A;  1FEN A;  4TKH A;  3BX7 A;  3FR4 A;  1CBR A;  4YBU A;  1LIB A;  2AT6 X;  2GC9 A;  4TJZ A;  1DZJ A;  3L4R A;  5AJC A;  2HNX A;  4GET A;  5L8I A;  1VYG A;  4WBK A;  2RN4 A;  4YKM A;  4KII A;  4N7D A;  4QGX A;  1MVG A;  3P6D A;  4ZGU A;  3IFB A;  1BM5 A;  4GH7 A;  5LJE A;  3WJC A;  5HAE A;  1MX8 A;  4INN A;  2GJ5 A;  3DTQ A;  2XKL A;  4ID2 A;  1EQD A;  3JS1 A;  4M7M A;  3BDR A;  2AMM X;  3OJY C;  4EDE A;  3C78 X;  1GT4 A;  3FA9 A;  1DZP A;  1JV4 A;  3NX2 A;  1ADL A;  3HK1 A;  4GU8 A;  1OPB A;  4IB9 A;  4HPB A;  1VYF A;  3P24 A;  1OBQ A;  2BT9 A;  2LBV A;  2XST A;  1T0V A;  1KGL A;  4TNN A;  4R0B A;  1ERB A;  1FTP A;  1LIC A;  4QNI A;  1X8U A;  2L68 A;  4BVM A;  1JJX A;  4EQA C;  4MVL A;  3U0D A;  2CBR A;  4QZT A;  1JBH A;  4ODD A;  1LIF A;  4TLJ A;  4KH8 A;  1R0U A;  1ALB A;  4WFV A;  4BQU A;  3APU A;  2OVE A;  1URE A;  2KW1 A;  5LJK A;  1KT5 A;  2DM5 A;  2QM9 A;  2YG2 A;  3S5V A;  3BLG A;  3WOV A;  1ZNG A;  3LV4 A;  1JJJ A;  2FR2 A;  1JYJ A;  3ZWE A;  1T68 X;  2CM4 A;  2OVD A;  5H9K A;  2X8F A;  3CQR A;  2N93 A;  3B2H A;  5D8J A;  3FA7 A;  5HCC C;  2RCQ A;  1I4U A;  3F6Z B;  5FQ6 E;  1X8N A;  1MUP A;  3IA8 A;  4HPA A;  3UEV A;  5F7G A;  2R74 A;  2W2F A;  3O22 A;  4DQ3 A;  1XKI A;  4YDA A;  5K06 A;  4GZV A;  5EED A;  3B2L A;  2X8T A;  2W2B A;  1A2D A;  4I3B A;  3NBX X;  3ZUO A;  3PH6 A;  2JOZ A;  2LBA A;  1S7D A;  4AYH A;  1H91 A;  1CBS A;  3EYC A;  3EBW A;  2RA6 A;  2Z4H A;  1RLB E;  5HZ9 A;  5FQ8 E;  1IKJ A;  5FQ7 E;  2WUT A;  4PSQ A;  4OS0 A;  3P6E A;  5FFH A;  5HZ8 A;  4NNT A;  3FLL A;  1AVG I;  2G7B A;  2JU8 A;  3D97 A;  5EZ2 A;  4ON1 A;  1JZU A;  2L9C A;  3ZZV A;  5HCD C;  3P6H A;  5LJB A;  2FS7 A;  2NNE A;  3PEC A;  1S2P A;  1L6M A;  1VPR A;  4U9C A;  4ES7 A;  3BSZ E;  5LJH A;  2GTL O;  3T1D A;  4QQ1 A;  2BHV A;  5H9L A;  1KZX A;  4Y0R A;  3HWE A;  4LZV A;  1AEL A;  4NLJ A;  1TXL A;  4FBV A;  2ACP X;  2JN3 A;  4GKC A;  5LJD A;  2BLG A;  2RD7 C;  5JR8 A;  4FGI B;  1Y9T A;  4O3Z A;  1AB0 A;  3QKG A;  4I9R A;  4ALO A;  4ORU A;  4XMF A;  1FDQ A;  1B56 A;  4QZU A;  1SY1 A;  5KIC A;  2CM9 A;  1BWY A;  1FE3 A;  3B2J A;  1O8V A;  1I04 A;  4QGV A;  1YWA A;  1LNM A;  2X46 A;  3P02 A;  3FEL A;  3ZW0 A;  4ZFX A;  5HZ6 A;  2BS5 A;  3CQN A;  4IB8 A;  5HTE A;  3N91 A;  3S26 A;  5FAZ A;  2OZQ A;  1BSQ A;  4ORW A;  3RSW A;  1DFV A;  2JW1 A;  1OBP A;  2P8G A;  3KFF A;  2MJI A;  1IIU A;  2Q2P A;  4IMN A;  2KT4 B;  4O4U A;  5F6Z A;  4A8Z A;  5LJC A;  4AZQ A;  2HLV A;  3WVM A;  4GRJ A;  2AT0 X;  2HMB A;  1GKA B;  2WSJ A;  4WFU A;  3C76 X;  1HMS A;  5BVQ A;  2ZAI A;  2Z4I A;  3HOE A;  1QG5 A;  1GT5 A;  4YCH A;  4HFO A;  2MWH A;  4D6B A;  3RBY A;  1IKE A;  4N7C A;  2X8S A;  4QGW A;  1TOU A;  1QWD A;  1O1V A;  4WHI A;  1N0S A;  1Y9L A;  1I06 A;  3TZS A;  1YP7 A;  1TOW A;  3KZA A;  3JQO A;  1SXU A;  4LZU A;  5IO6 A;  3JSQ A;  1U0X A;  3RZY A;  1X89 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...