4IBBA

Ebola virus vp35 bound to small molecule
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
123
structure length
123
Chain Sequence
DISAKDLRNIMYDHLPGFGTAFHQLVQVICKLGKDSNSLDIIHAEFQASLAEGDSPQCALIQITKRVPIFQDAAPPVIHIRSRGDIPRACQKSLRPVPPSPKIDRGWVCVFQLQDGKTLGLKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title In Silico Derived Small Molecules Bind the Filovirus VP35 Protein and Inhibit Its Polymerase Cofactor Activity.
pubmed doi rcsb
source organism Ebola virus
molecule tags Transcription/transcription inhibitor
molecule keywords Polymerase cofactor VP35
total genus 42
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-12-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.950 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4ibbA01
2.10.10.70 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 4ibbA02
4IBGA 4IBDA 4IJEA 3L2AA 4IBKA 4IBJA 3L29A 3FKEA 4IBCA 3KS4A 4GHAA 4IBFA 4GHLA 3KS8A 4GH9A 3L26A 4IBBA 3L28A 4IBEA 3L25A 5BPVA 4IJFA 3L27A 4IBIA 4LG2A
chains in the Genus database with same CATH superfamily
2KA6B 4DR3M 2M5ZA 4MGZE 4DR7M 1J5EM 4I8OA 2KEBA 1GJSA 4ZPXA 3KFUG 1PJIA 2L09A 3MQLA 2QZ4A 1GO5A 1PJQA 2JA2A 3TWKA 2LXEA 1E88A 2QHOB 3CF0A 2WZJA 2DHRA 2JE5A 3LQRA 4GKJM 4GHAA 2X49A 2C99A 5FTKA 3T6PA 3GLIB 4AI6A 2A5YB 2EJSA 3GP1A 1PJTA 3GLIA 3HSHA 3SMSA 2RGOA 3KP1E 2R65A 4JI7M 1BVSA 4B08A 3UJNA 4JXJA 4LZZA 3U60A 3IG5A 3R8FA 1L2BA 1N32M 1J7KA 4I4LA 3GPYA 4NRVA 4X62M 2ZBKB 2W82A 4X65M 3C3DA 1R5LA 1QO6A 2YFQA 2MROB 2D7EA 1OIPA 3MHVC 2JWSA 3QAUA 2F5SA 1TH2A 1XXHA 4RNAA 4LRSA 4AG5A 3IG8A 3GLFA 1XC8A 2JXNA 2JZ0A 3BBZA 2MH8A 2FE8A 3I04M 2BWBA 2EA0A 2CHVA 2L6OA 5ITYA 1AIWA 2UU9M 1EFUB 4NRWA 4GKKM 1KYIA 5FLXS 1GLNA 1D0LA 1IN5A 3DA1A 3LCVB 4GHLA 3VFDA 1IXZA 2H5XA 2F5NA 2VIIA 1QVRA 2K0BX 1JQJC 2QQ8A 5FTJA 1G4AE 1K82A 1WHCA 2RTSA 1PGYA 2HCBA 1Z5BA 3HKPA 4IBEA 2OPFA 3GLGE 2JY7A 1PDCA 2QSFX 1YLAA 5FSWA 4DR5M 3J7BA 1NSFA 4L4UA 3JR4A 2C98A 1R6BX 1SG9A 3TWMA 4KO8A 3SHGB 1N77A 2XSZD 3VLFB 3WD2A 2UXCM 1YU1A 2LTUA 3HU1A 3LCUA 2XD1A 3U5ZA 2DXIA 4NYUA 2R4JA 3DZDA 1PM5A 4B7FA 1ZQ9A 1X37A 4LFBM 1YU4A 2CRUA 2M60A 3HHZA 3F92A 2UXBM 4Y28F 1SXJE 1PJJA 5EQTA 3HHWA 3MK6A 2CV1A 5LMNM 4L6V6 1IFYA 3FTCA 4DV0M 3FTDA 1L1ZA 1HT1E 4L15A 1ZMUA 4M0DA 3SAVA 2C96A 1C1KA 4GEWA 1J09A 5IT9S 3ZH9B 3B89A 1NJGA 2Y0QA 3U6QA 2XZUA 1OAOC 4FWHA 4LF9M 2LVPC 2CEAA 1WGNA 4MGYE 3WX7A 3HX3A 4GITA 3FKEA 1I4WA 4IBCA 4JN6A 4M9ZA 2VQFM 2OQ4A 4LGYA 1JR3A 3CGWA 3J2PB 3N3FA 3GLGA 4I5SA 3U60B 4NY2A 3NBXX 4LY6A 2R45A 1IY0A 5DNYA 4NSOB 4IIWA 7CATA 4G4QA 1TDZA 2JY6B 4DV5M 3L28A 4EIWA 3U6PA 3TWLA 3K1JA 2BNKA 4MGIE 1OAIA 1SXJC 1DO2A 4OJOA 1UM8A 2L4FA 3AOEA 3U61A 3AKZA 1GOIA 2D7GA 4IBIA 2Y2QA 4AKHA 2XFTA 1H0GA 3K2LA 1EE8A 1LTMA 1QQWA 2LHCA 3NWLA 1OKSA 1GKIA 4IBGA 3SMPA 5KPZA 3GQ3A 4Z2HA 4MGKE 3L2AA 2XF3A 2DAMA 2CHQA 5EP1A 1RU3A 4DV6M 3C58A 1IXRC 2R6FA 1FJGM 2BWEA 1ZMVA 5EXSA 3RE8A 3UGJA 4KHPM 1FNNA 4JYAM 2VDBB 4F2LA 2XD5A 4OVZA 4FCVA 1IXSA 4JI8M 4X64M 4LFAM 1UR9A 1PJSA 1XHBA 2UUAM 2F5OA 4NZ4A 5C18A 2DWLA 3KOZE 2JCHA 4PDGA 3T1HM 2QENA 3WD4A 2JY8A 3L25A 4AW4A 2RKOA 3M7GA 4B3TM 3CF6E 1NV8A 4FD2A 5FTNA 1JR3E 1E15A 1YU3A 4Z2GA 4DV4M 1NO1A 2FOIC 5IREB 4JI5M 1HNWM 2APLA 2G5GX 2UUBM 3FTFA 1E32A 4BBAA 3LQQA 1OTRA 4DR2M 1IN7A 3HHXA 2K9DA 1IN8A 1NY5A 4LF8M 5JI3E 2AHMA 1Z5CA 3FUXA 4NL4H 4QHTA 3HJSA 5A2QS 1R2YA 4DR4M 3J81S 2L7IA 4MB5A 2DI0A 5KQDA 4OU7A 3KOYE 2JNHA 2R46A 1QUTA 2CUZA 1K3XA 1WJ7A 5KPRA 3TQSA 3E9SA 3AFHA 4QNRA 1V33A 3GRVA 1XNRM 5EP2A 1IY2A 4K0KM 5DYIA 5DYGA 2L2DA 3WD0A 2UXDM 4DV7M 5ITXA 3GLFE 1QAOA 3UMMA 4JI1M 4CHTB 3KVWA 4L16A 2LWXA 3FUVA 3BOSA 3WHKA 4G4RA 2DWMA 4NZ5A 1KS0A 3SAWA 1QZMA 2I7NA 3Q8XA 4NZ3A 3K92A 4FVMA 5JI2E 3WD3A 4LJAA 3A98B 1Y8GA 1H0IA 1D2NA 1E9RA 2D7HA 3OTOM 4TUWA 2E5LM 3HWSA 3TL4X 3GQ5A 1GXDA 3GLHB 4NXNM 2LVAA 2D49A 2DZLA 1W5TA 3ZQJA 1SXJA 3FE3A 2KHHA 2Z4RA 2BJWA 1VG5A 3KOWE 1L8QA 3LMMA 4QOSA 4R71A 4IBBA 2FFFB 2H1RA 2O5RA 2IOUA 1NHWC 2KRUA 3HGIA 4FCTA 2ZTCA 3GPUA 1XMQM 2Z7JA 2Z4SA 3QYEA 2KZSA 1G8PA 2DKLA 1ORYB 4IJFA 4DR1M 3E46A 2WSCF 3KXEC 1R7RA 3FRIA 3SHFA 2VF8A 3UZUA 1GL6A 4HMEA 1QANA 3FYDA 3HY5A 1WXQA 2O01F 2Y2JA 4P16A 1NHGC 2QBYA 1CUKA 3SASA 2CV0A 4AKGA 4RF1A 4HLQA 3SFZA 4GC9A 3PNVA 4AZFA 4R3DA 1WR1B 3M6AA 4WW0A 3M0EA 2R4EA 4M9XA 3W68A 1N78A 4IBFA 1OFHA 2CWBA 2GQFA 4LJ5A 4P17A 5ITQA 3HJ8A 3KDSE 3GRRA 4LFCM 2QCUA 2HKJA 4D81A 5F3WA 3KW6A 1GL7A 2KW0A 3U6CA 2V6ZM 3LVWA 3GPXA 2G3QA 3PVSA 3FUTA 4L8RC 1QUSA 4DV3M 1AIPC 1Q02A 1D0KA 4AG6A 4NXMM 4IBKA 4IBJA 4WP2A 2DNAA 4LCBA 4RF0A 4NC6A 2DWZB 3B74A 3U6SA 3RGPA 3U61B 1L2DA 3AV0A 2C5RA 4M9SA 1ZAEA 2LNHC 4B3RM 3AOGA 1OFIA 1YSYA 1KFVA 4AKIA 2EO2A 4YY3M 2DAEA 1IY1A 4LJ7A 1OJLA 2V1CA 4DR6M 3V76A 3B7NA 1XWIA 3A45A 1OGBA 5ITRA 2MGWA 2Y2KA 1L6JA 1YUBA 3WHLA 5KQ8A 4X66M 5BR8M 3T1YM 1VDLA 5FTMA 1IN4A 3GPPA 2YR0A 2ZAMA 3KOXE 4GC5A 3GLGB 4G4NA 1D0MA 1VQ1A 4PCZA 2FN2A 5ITUA 4D80A 1LV7A 2FH0A 1Z6TA 1YE9A 4FW9A 4M0WA 3KP0E 4OJ5A 4WURA 1P3QQ 4RKUF 3FYCA 5H37D 3AOEC 3HJQA 3JAMS 4BLCA 2Y2MA 3L29A 1E6NA 2KNAA 3CTWB 3U6DA 2KXEA 4GRIA 3C9PA 2EKKA 2CFOA 4MB7A 4NSRA 4W5WA 1CK7A 1ZMWA 2DZOB 2G8LA 2X4AA 1OIZA 2QP9X 3EIHA 1XXHE 4II7A 4XBOA 3FTEA 2WSEF 2HWJA 3TE6A 1IBMM 2J7NA 4MM3B 2Y2IA 3WD1A 3B9PA 1YUEA 4BB9A 1MX0A 2Y2LA 2DAIA 2Y2GA 2Y0TA 2OO9A 4KODA 4NOOB 2R62A 4AQYM 3I51A 1QDRA 4CIZA 2YNMD 4ANRA 2Z3XA 3DFZA 1DGFA 2XSZA 3U6OA 3U5ZB 2GNOA 4G6ZA 2Z8YM 1V34A 5KO3A 4A3VB 2QBYB 1MU5A 2LVQD 3EIEA 2FNAA 1WGLA 2FS1A 5EP3A 1E9SA 3PFIA 4I81A 4F1IA 4FWGA 4MB4A 1YU0A 2F5PA 1IN6A 2R0IA 2VF7A 3RGSA 3GLIE 4DV2M 1EIJA 1K3WA 4NZ1A 4PT5A 4JI0M 1AUAA 2KNZA 3NBIA 3U6EA 1TDHA 4D82A 4GIPA 1QYRA 4OW0A 1TTEA 3MJ5A 1R2ZA 4HMCA 3ZC7B 1SXJB 1N33M 1UFZA 1E94E 2DAKA 3CF2A 3Q8GA 2CHGA 3HONA 3GLHA 2K47A 2F5QA 2BG1A 1DO0A 4XK8F 3H4MA 3ILKA 2FFJA 1KSFX 4LF5M 5FTLA 1J7MA 4OJPA 1TR8A 2OOBA 5BPVA 1UR8A 1JR3D 3L27A 4LJ8A 3W0FA 1N36M 3UK6A 4TX8A 3GLFB 1XXHB 1NVMA 3J27B 3K9PA 5E26A 4OX9M 4DV1M 1C7YA 5IZ7D 3I01M 4Z2KA 3D8BA 4HL4A 3K8ZA 1R4GA 1XB2B 1GPFA 2DVWB 3HHYA 4QNLA 3DOAA 1Q3BA 1VEKA 3K9OA 1G59A 4XGIA 3T38A 4LF4M 3KS4A 4LZJA 5EJCA 2C9CA 1V92A 4CISA 1IM2A 1E6PA 5C1BA 4DUZM 4B3MM 1HQYE 1GABA 3JR5A 2J7OA 1CXWA 4OJ6A 4QHSA 1HR0M 1GJTA 1SXJD 2KDLA 1TF0B 3SARA 3FUWA 1QAQA 4UN2B 2JUJA 5EXXA 3GO8A 4CJ6A 4JI4M 1W1YA 3KSXA 2EKFA 3T15A 4LRTA 2QPAA 3C3EA 2XLJA 3HU2A 5LMUM 2CV2A 2VQEM 2LHGA 3VK8A 1E6RA 1VEJA 3BXWA 1NNJA 5E6JA 1ED7A 2JY5A 1A5TA 3AJIB 3PXGA 4KLNA 3GQ4A 1T43A 2L7HA 5L8RF 1DGBA 4LGMA 4L78A 1MJGM 2KNVA 2XH9A 2Y2OA 1XNQM 2LVNC 1W1PA 3LVVA 2XFSA 3GRYA 1DGGA 3ZCBB 1TH4A 3VKGA 4JV5M 2Y21A 1QZEA 4Z2JA 2HHHM 4DUYM 1Z59A 4PD2A 2WSFF 1IXSB 3HU3A 2R18A 3B7ZA 3KSJA 3TPZA 2CP8A 2B3TA 4OVZB 3SYLA 4B7GA 1E8BA 3VKHA 3I4YA 3J80S 3W0LB 3IHPA 1G41A 4R7GA 2RRUA 3VK7A 1G3IA 2Y2HA 3W67A 4G4OA 3SAUA 1IQPA 1Z5AA 2V5OA 3A42A 4Z2IA 1W1VA 4HMDA 2XEPA 2LH0A 4Z8XA 1JB0F 1G71A 5DFLA 4PDIA 4JI3M 3U6LA 1DV0A 1E6ZA 1EAKA 3E21A 3FRHA 4LJ4A 4B3SM 2DZNB 3SBJA 2ZM6M 4ITQA 1TGUA 1W1TA 1T3TA 1I94M 1HNZM 3J7AS 2MR9A 4LF7M 4Z6YA 2V1UA 1F4IA 1OGGA 2XZFA 4FCWA 1NY6A 1HT2E 1NNUC 3PNYA 1Q3CA 3A46A 1DGHA 3KS8A 1OQYA 4MB3A 4MGHA 4CGYB 2R44A 3L26A 2ZAOA 4KT0F 2BJVA 1VDDA 2DENA 2HL7A 4FWDA 2UWXA 2P5TA 3VDUA 3HZJA 3GLHE 2LBCA 3AL0C 3E4RA 2Y20A 4G3OA 4IBDA 4B7HA 1XMOM 1QDTA 2O25A 2CE7A 3QYBA 1PRBA 4IJEA 3SYKA 4DBGB 1H8PA 3M7PA 2QNJA 4Z2LA 2ERCA 4YHHM 4NYYA 4OUIA 2DHYA 1VEGA 2J5YA 5IWAM 3I4VA 3MMPA 5EXTA 3IECA 5ITTA 2DWNA 4LF6M 1L1TA 3GRUA 2KRKA 4MH0E 3FUUA 3R9XB 1QAMA 1DGHB 4GH9A 1H6UA 1W5SA 1WIVA 3B7QA 3LW5F 3THGA 1Q39A 5ITXE 5EP4A 5GKNA 2UUCM 2L4EA 1HJPA 2JZ1A 2F4VM 2N35A 1NJFA 1HNXM 1GVNA 3U6MA 4OJLA 4LG2A 3VDPA 1NV9A 3D8LA 2Y2PA 1IBLM 3H4JA 4Q7JA 2EUCA 2JP7A 4LJ9A 1O6IA 1MN3A 2LVOC 2RGHA 2YQZA 2MJ5B 2ZANA 4REZA 2OOAA 2K6BA 2HAKA 2C9OA 2NQ8C 1L2CA 2Y2NA 1N75A 1TH3A 1HQCA 3QWLA 2X8AA 1IBKM 1T6OA 1YU2A 2Q2EB 1S3SA 4LJ6A 2I7PA 8CATA 2DAGA 4GMQA 3SC3A 2ZTDA 4JI2M 4QOZC 3RFWA 1N34M 4HEOA 5KPTA 1ZV1A 5EXPA 4JI6M 4QNMA 3SATA 2KZUA 3FD9A 2XGNA 4S12A
chains in the Genus database with same CATH topology
2KA6B 4DR3M 2M5ZA 4MGZE 4DR7M 1J5EM 4I8OA 2KEBA 4ZPXA 3KFUG 1PJIA 2L09A 2QZ4A 2JA2A 3TWKA 2LXEA 3CF0A 2DHRA 2JE5A 3LQRA 4GKJM 4GHAA 2X49A 2C99A 5FTKA 3GLIB 4AI6A 2A5YB 3GP1A 3HSHA 3GLIA 3SMSA 2RGOA 3KP1E 2R65A 4JI7M 4B08A 3UJNA 4JXJA 4LZZA 3U60A 3IG5A 3R8FA 1L2BA 1N32M 1J7KA 4I4LA 3GPYA 4NRVA 4X62M 2ZBKB 2W82A 4X65M 2YFQA 2D7EA 3MHVC 3QAUA 2F5SA 1TH2A 1XXHA 4RNAA 4LRSA 4AG5A 3IG8A 3GLFA 1XC8A 2FE8A 2EA0A 2CHVA 2L6OA 5ITYA 2UU9M 4NRWA 4GKKM 1KYIA 5FLXS 1GLNA 1IN5A 3DA1A 4GHLA 3VFDA 1IXZA 2F5NA 2VIIA 1QVRA 1JQJC 5FTJA 1G4AE 1K82A 2HCBA 1Z5BA 3HKPA 4IBEA 2OPFA 5FSWA 4DR5M 3J7BA 1NSFA 4L4UA 3JR4A 2C98A 1R6BX 3TWMA 4KO8A 3SHGB 1N77A 2XSZD 3VLFB 2UXCM 1YU1A 3HU1A 2XD1A 4NYUA 3U5ZA 2DXIA 2R4JA 3DZDA 1PM5A 4B7FA 1ZQ9A 1X37A 4LFBM 1YU4A 3HHZA 2M60A 2UXBM 1SXJE 1PJJA 5EQTA 3HHWA 3MK6A 2CV1A 5LMNM 3FTCA 4DV0M 3FTDA 1L1ZA 1HT1E 4L15A 3SAVA 4M0DA 2C96A 1C1KA 1J09A 5IT9S 3ZH9B 1NJGA 2Y0QA 3U6QA 2XZUA 4FWHA 4LF9M 2CEAA 4MGYE 3WX7A 4GITA 3FKEA 1I4WA 4IBCA 4JN6A 4M9ZA 2VQFM 2OQ4A 4LGYA 1JR3A 3J2PB 3N3FA 3GLGA 4I5SA 3U60B 4NY2A 4LY6A 2R45A 1IY0A 5DNYA 4NSOB 4IIWA 7CATA 4G4QA 1TDZA 4DV5M 3L28A 4EIWA 3U6PA 3TWLA 3K1JA 2BNKA 4MGIE 1SXJC 4OJOA 1DO2A 1UM8A 3AOEA 3U61A 3AKZA 2D7GA 4IBIA 2Y2QA 4AKHA 2XFTA 3K2LA 1EE8A 1QQWA 3NWLA 4IBGA 3SMPA 5KPZA 1GKIA 3GQ3A 4MGKE 3L2AA 2XF3A 2CHQA 5EP1A 4DV6M 3C58A 1IXRC 1FJGM 3UGJA 5EXSA 3RE8A 4JYAM 4KHPM 1FNNA 2XD5A 4OVZA 4FCVA 4JI8M 4X64M 4LFAM 1XHBA 2UUAM 2F5OA 4NZ4A 5C18A 2DWLA 3KOZE 2JCHA 4PDGA 3T1HM 2QENA 3L25A 4AW4A 2RKOA 3M7GA 4B3TM 3CF6E 4FD2A 5FTNA 1YU3A 4DV4M 2FOIC 5IREB 4JI5M 1HNWM 2UUBM 2G5GX 3FTFA 1E32A 4BBAA 3LQQA 4DR2M 1IN7A 3HHXA 1IN8A 1NY5A 4LF8M 5JI3E 2AHMA 1Z5CA 3FUXA 4NL4H 4QHTA 3HJSA 5A2QS 1R2YA 4DR4M 3J81S 2L7IA 5KQDA 4OU7A 3KOYE 2R46A 2CUZA 1K3XA 5KPRA 3TQSA 3E9SA 3AFHA 4QNRA 3GRVA 1XNRM 5EP2A 1IY2A 4K0KM 5DYIA 5DYGA 2UXDM 4DV7M 5ITXA 1QAOA 3UMMA 4JI1M 4CHTB 3KVWA 4L16A 2LWXA 3FUVA 3BOSA 3WHKA 4G4RA 2DWMA 4NZ5A 3SAWA 1QZMA 2I7NA 3Q8XA 4NZ3A 3K92A 4FVMA 5JI2E 4LJAA 3A98B 1D2NA 1E9RA 2D7HA 3OTOM 4TUWA 2E5LM 3HWSA 3TL4X 3GQ5A 3GLHB 4NXNM 1W5TA 1SXJA 3LMMA 2Z4RA 2BJWA 3KOWE 1L8QA 4QOSA 4IBBA 2FFFB 2H1RA 2O5RA 2IOUA 1NHWC 2KRUA 3HGIA 4FCTA 3GPUA 1XMQM 2Z7JA 2Z4SA 2KZSA 1G8PA 4IJFA 1ORYB 4DR1M 3SHFA 3KXEC 1R7RA 3UZUA 1GL6A 1QANA 3FYDA 1WXQA 2Y2JA 4P16A 1NHGC 2QBYA 3SASA 2CV0A 4AKGA 4RF1A 4HLQA 3SFZA 4GC9A 3PNVA 4AZFA 4R3DA 3M6AA 4WW0A 3M0EA 2R4EA 4M9XA 1N78A 4IBFA 1OFHA 4LJ5A 5ITQA 3HJ8A 3KDSE 3GRRA 4LFCM 2QCUA 2HKJA 4D81A 5F3WA 3KW6A 1GL7A 2KW0A 3U6CA 2V6ZM 3LVWA 3GPXA 3PVSA 3FUTA 4L8RC 4DV3M 4NXMM 4AG6A 4IBKA 4IBJA 4LCBA 4RF0A 2DWZB 3U6SA 3RGPA 3U61B 1L2DA 3AV0A 2C5RA 4M9SA 1ZAEA 2LNHC 4B3RM 3AOGA 1OFIA 1YSYA 1KFVA 4AKIA 2EO2A 4YY3M 1IY1A 4LJ7A 1OJLA 2V1CA 4DR6M 1XWIA 3A45A 5ITRA 1YUBA 3WHLA 5KQ8A 4X66M 5BR8M 3T1YM 5FTMA 1IN4A 3GPPA 2YR0A 2ZAMA 3KOXE 4GC5A 3GLGB 4G4NA 4PCZA 5ITUA 4D80A 1LV7A 4FW9A 1Z6TA 1YE9A 4M0WA 3KP0E 4OJ5A 4WURA 3FYCA 5H37D 3AOEC 3HJQA 3JAMS 4BLCA 2Y2MA 3L29A 3CTWB 3U6DA 2KXEA 4GRIA 4MB7A 4W5WA 2CFOA 4NSRA 4OJ6A 2X4AA 2DZOB 2G8LA 3EIHA 2QP9X 4II7A 4XBOA 3FTEA 3TE6A 1IBMM 2J7NA 4MM3B 2Y2IA 3B9PA 1YUEA 4BB9A 1MX0A 2Y2LA 2Y2GA 2Y0TA 4KODA 4NOOB 2R62A 4AQYM 3I51A 2YNMD 2Z3XA 3DFZA 1DGFA 2XSZA 3U6OA 3U5ZB 5KO3A 4G6ZA 4A3VB 2QBYB 1MU5A 3EIEA 5EP3A 2FNAA 2Y2KA 4OUIA 1E9SA 3PFIA 4I81A 4FWGA 1YU0A 2F5PA 1IN6A 4DV2M 3RGSA 4NZ1A 1K3WA 4PT5A 4JI0M 3NBIA 3U6EA 1TDHA 4D82A 4GIPA 1QYRA 4OW0A 3MJ5A 1R2ZA 3ZC7B 1SXJB 1N33M 1E94E 3CF2A 2CHGA 3HONA 3GLHA 2K47A 2F5QA 2BG1A 1DO0A 3H4MA 3ILKA 2FFJA 1KSFX 4LF5M 5FTLA 4OJPA 5BPVA 1JR3D 3L27A 4LJ8A 3W0FA 1N36M 3UK6A 3GLFB 1XXHB 1NVMA 3J27B 5E26A 4OX9M 4DV1M 5IZ7D 3D8BA 4HL4A 3K8ZA 2DVWB 3HHYA 4QNLA 3DOAA 1Q3BA 1G59A 4XGIA 3T38A 4LF4M 3KS4A 4LZJA 5EJCA 2C9CA 4CISA 1IM2A 5C1BA 4DUZM 4B3MM 1HQYE 3JR5A 2J7OA 4QHSA 1HR0M 1SXJD 3SARA 3FUWA 1QAQA 5EXXA 3GO8A 4JI4M 3KSXA 3T15A 4LRTA 2QPAA 2XLJA 3HU2A 5LMUM 2CV2A 2VQEM 3VK8A 1NNJA 5E6JA 3AJIB 3PXGA 4KLNA 3GQ4A 2L7HA 1DGBA 4LGMA 4L78A 2XH9A 2Y2OA 1XNQM 3LVVA 2XFSA 3GRYA 1DGGA 3ZCBB 1TH4A 3VKGA 4JV5M 2Y21A 2HHHM 4DUYM 1Z59A 4PD2A 1IXSB 3HU3A 2R18A 3KSJA 3TPZA 4OVZB 3SYLA 4B7GA 3VKHA 3I4YA 3J80S 3W0LB 4R7GA 1G41A 3VK7A 1G3IA 2Y2HA 4G4OA 3SAUA 1IQPA 1Z5AA 3A42A 2XEPA 2LH0A 4Z8XA 4PDIA 3U6LA 4JI3M 4LJ4A 4B3SM 2DZNB 3SBJA 2ZM6M 4ITQA 1TGUA 1T3TA 1I94M 1HNZM 3J7AS 4LF7M 4Z6YA 2V1UA 2XZFA 4FCWA 1NY6A 3PNYA 1HT2E 1NNUC 1Q3CA 3A46A 1DGHA 3KS8A 4MGHA 4CGYB 3L26A 2ZAOA 2BJVA 1VDDA 2HL7A 4FWDA 2UWXA 2P5TA 3VDUA 3AL0C 3E4RA 2Y20A 4IBDA 4B7HA 1XMOM 4IJEA 2CE7A 3SYKA 2ERCA 4YHHM 4NYYA 5IWAM 3I4VA 5EXTA 5ITTA 2DWNA 4LF6M 1L1TA 3GRUA 2KRKA 4MH0E 3FUUA 3R9XB 1QAMA 1DGHB 4GH9A 1H6UA 1W5SA 3THGA 5ITXE 1Q39A 5EP4A 5GKNA 2UUCM 2F4VM 1NJFA 1HNXM 1GVNA 3U6MA 4OJLA 4LG2A 3VDPA 3D8LA 2Y2PA 1IBLM 2EUCA 4LJ9A 2RGHA 2YQZA 2ZANA 4REZA 2C9OA 2NQ8C 1L2CA 2Y2NA 1N75A 1TH3A 1HQCA 3QWLA 2X8AA 1IBKM 1YU2A 2Q2EB 1S3SA 4LJ6A 2I7PA 8CATA 4JI2M 4GMQA 3SC3A 4QOZC 3RFWA 1N34M 5KPTA 5EXPA 4JI6M 4QNMA 3SATA 2KZUA 3FD9A 2XGNA 4S12A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IBG A;  4IBD A;  4IJE A;  3L2A A;  4IBK A;  4IBJ A;  3L29 A;  3FKE A;  4IBC A;  3KS4 A;  4GHA A;  4IBF A;  4GHL A;  3KS8 A;  4GH9 A;  3L26 A;  4IBB A;  3L28 A;  4IBE A;  3L25 A;  5BPV A;  4IJF A;  3L27 A;  4IBI A;  4LG2 A; 
#chains in the Genus database with same CATH topology
 2KA6 B;  4DR3 M;  2M5Z A;  4MGZ E;  4DR7 M;  1J5E M;  4I8O A;  2KEB A;  1GJS A;  4ZPX A;  3KFU G;  1PJI A;  2L09 A;  3MQL A;  2QZ4 A;  1GO5 A;  1PJQ A;  2JA2 A;  3TWK A;  2LXE A;  1E88 A;  2QHO B;  3CF0 A;  2WZJ A;  2DHR A;  2JE5 A;  3LQR A;  4GKJ M;  4GHA A;  2X49 A;  2C99 A;  5FTK A;  3T6P A;  3GLI B;  4AI6 A;  2A5Y B;  2EJS A;  3GP1 A;  1PJT A;  3GLI A;  3HSH A;  3SMS A;  2RGO A;  3KP1 E;  2R65 A;  4JI7 M;  1BVS A;  4B08 A;  3UJN A;  4JXJ A;  4LZZ A;  3U60 A;  3IG5 A;  3R8F A;  1L2B A;  1N32 M;  1J7K A;  4I4L A;  3GPY A;  4NRV A;  4X62 M;  2ZBK B;  2W82 A;  4X65 M;  3C3D A;  1R5L A;  1QO6 A;  2YFQ A;  2MRO B;  2D7E A;  1OIP A;  3MHV C;  2JWS A;  3QAU A;  2F5S A;  1TH2 A;  1XXH A;  4RNA A;  4LRS A;  4AG5 A;  3IG8 A;  3GLF A;  1XC8 A;  2JXN A;  2JZ0 A;  3BBZ A;  2MH8 A;  2FE8 A;  3I04 M;  2BWB A;  2EA0 A;  2CHV A;  2L6O A;  5ITY A;  1AIW A;  2UU9 M;  1EFU B;  4NRW A;  4GKK M;  1KYI A;  5FLX S;  1GLN A;  1D0L A;  1IN5 A;  3DA1 A;  3LCV B;  4GHL A;  3VFD A;  1IXZ A;  2H5X A;  2F5N A;  2VII A;  1QVR A;  2K0B X;  1JQJ C;  2QQ8 A;  5FTJ A;  1G4A E;  1K82 A;  1WHC A;  2RTS A;  1PGY A;  2HCB A;  1Z5B A;  3HKP A;  4IBE A;  2OPF A;  3GLG E;  2JY7 A;  1PDC A;  2QSF X;  1YLA A;  5FSW A;  4DR5 M;  3J7B A;  1NSF A;  4L4U A;  3JR4 A;  2C98 A;  1R6B X;  1SG9 A;  3TWM A;  4KO8 A;  3SHG B;  1N77 A;  2XSZ D;  3VLF B;  3WD2 A;  2UXC M;  1YU1 A;  2LTU A;  3HU1 A;  3LCU A;  2XD1 A;  3U5Z A;  2DXI A;  4NYU A;  2R4J A;  3DZD A;  1PM5 A;  4B7F A;  1ZQ9 A;  1X37 A;  4LFB M;  1YU4 A;  2CRU A;  2M60 A;  3HHZ A;  3F92 A;  2UXB M;  4Y28 F;  1SXJ E;  1PJJ A;  5EQT A;  3HHW A;  3MK6 A;  2CV1 A;  5LMN M;  4L6V 6;  1IFY A;  3FTC A;  4DV0 M;  3FTD A;  1L1Z A;  1HT1 E;  4L15 A;  1ZMU A;  4M0D A;  3SAV A;  2C96 A;  1C1K A;  4GEW A;  1J09 A;  5IT9 S;  3ZH9 B;  3B89 A;  1NJG A;  2Y0Q A;  3U6Q A;  2XZU A;  1OAO C;  4FWH A;  4LF9 M;  2LVP C;  2CEA A;  1WGN A;  4MGY E;  3WX7 A;  3HX3 A;  4GIT A;  3FKE A;  1I4W A;  4IBC A;  4JN6 A;  4M9Z A;  2VQF M;  2OQ4 A;  4LGY A;  1JR3 A;  3CGW A;  3J2P B;  3N3F A;  3GLG A;  4I5S A;  3U60 B;  4NY2 A;  3NBX X;  4LY6 A;  2R45 A;  1IY0 A;  5DNY A;  4NSO B;  4IIW A;  7CAT A;  4G4Q A;  1TDZ A;  2JY6 B;  4DV5 M;  3L28 A;  4EIW A;  3U6P A;  3TWL A;  3K1J A;  2BNK A;  4MGI E;  1OAI A;  1SXJ C;  1DO2 A;  4OJO A;  1UM8 A;  2L4F A;  3AOE A;  3U61 A;  3AKZ A;  1GOI A;  2D7G A;  4IBI A;  2Y2Q A;  4AKH A;  2XFT A;  1H0G A;  3K2L A;  1EE8 A;  1LTM A;  1QQW A;  2LHC A;  3NWL A;  1OKS A;  1GKI A;  4IBG A;  3SMP A;  5KPZ A;  3GQ3 A;  4Z2H A;  4MGK E;  3L2A A;  2XF3 A;  2DAM A;  2CHQ A;  5EP1 A;  1RU3 A;  4DV6 M;  3C58 A;  1IXR C;  2R6F A;  1FJG M;  2BWE A;  1ZMV A;  5EXS A;  3RE8 A;  3UGJ A;  4KHP M;  1FNN A;  4JYA M;  2VDB B;  4F2L A;  2XD5 A;  4OVZ A;  4FCV A;  1IXS A;  4JI8 M;  4X64 M;  4LFA M;  1UR9 A;  1PJS A;  1XHB A;  2UUA M;  2F5O A;  4NZ4 A;  5C18 A;  2DWL A;  3KOZ E;  2JCH A;  4PDG A;  3T1H M;  2QEN A;  3WD4 A;  2JY8 A;  3L25 A;  4AW4 A;  2RKO A;  3M7G A;  4B3T M;  3CF6 E;  1NV8 A;  4FD2 A;  5FTN A;  1JR3 E;  1E15 A;  1YU3 A;  4Z2G A;  4DV4 M;  1NO1 A;  2FOI C;  5IRE B;  4JI5 M;  1HNW M;  2APL A;  2G5G X;  2UUB M;  3FTF A;  1E32 A;  4BBA A;  3LQQ A;  1OTR A;  4DR2 M;  1IN7 A;  3HHX A;  2K9D A;  1IN8 A;  1NY5 A;  4LF8 M;  5JI3 E;  2AHM A;  1Z5C A;  3FUX A;  4NL4 H;  4QHT A;  3HJS A;  5A2Q S;  1R2Y A;  4DR4 M;  3J81 S;  2L7I A;  4MB5 A;  2DI0 A;  5KQD A;  4OU7 A;  3KOY E;  2JNH A;  2R46 A;  1QUT A;  2CUZ A;  1K3X A;  1WJ7 A;  5KPR A;  3TQS A;  3E9S A;  3AFH A;  4QNR A;  1V33 A;  3GRV A;  1XNR M;  5EP2 A;  1IY2 A;  4K0K M;  5DYI A;  5DYG A;  2L2D A;  3WD0 A;  2UXD M;  4DV7 M;  5ITX A;  3GLF E;  1QAO A;  3UMM A;  4JI1 M;  4CHT B;  3KVW A;  4L16 A;  2LWX A;  3FUV A;  3BOS A;  3WHK A;  4G4R A;  2DWM A;  4NZ5 A;  1KS0 A;  3SAW A;  1QZM A;  2I7N A;  3Q8X A;  4NZ3 A;  3K92 A;  4FVM A;  5JI2 E;  3WD3 A;  4LJA A;  3A98 B;  1Y8G A;  1H0I A;  1D2N A;  1E9R A;  2D7H A;  3OTO M;  4TUW A;  2E5L M;  3HWS A;  3TL4 X;  3GQ5 A;  1GXD A;  3GLH B;  4NXN M;  2LVA A;  2D49 A;  2DZL A;  1W5T A;  3ZQJ A;  1SXJ A;  3FE3 A;  2KHH A;  2Z4R A;  2BJW A;  1VG5 A;  3KOW E;  1L8Q A;  3LMM A;  4QOS A;  4R71 A;  4IBB A;  2FFF B;  2H1R A;  2O5R A;  2IOU A;  1NHW C;  2KRU A;  3HGI A;  4FCT A;  2ZTC A;  3GPU A;  1XMQ M;  2Z7J A;  2Z4S A;  3QYE A;  2KZS A;  1G8P A;  2DKL A;  1ORY B;  4IJF A;  4DR1 M;  3E46 A;  2WSC F;  3KXE C;  1R7R A;  3FRI A;  3SHF A;  2VF8 A;  3UZU A;  1GL6 A;  4HME A;  1QAN A;  3FYD A;  3HY5 A;  1WXQ A;  2O01 F;  2Y2J A;  4P16 A;  1NHG C;  2QBY A;  1CUK A;  3SAS A;  2CV0 A;  4AKG A;  4RF1 A;  4HLQ A;  3SFZ A;  4GC9 A;  3PNV A;  4AZF A;  4R3D A;  1WR1 B;  3M6A A;  4WW0 A;  3M0E A;  2R4E A;  4M9X A;  3W68 A;  1N78 A;  4IBF A;  1OFH A;  2CWB A;  2GQF A;  4LJ5 A;  4P17 A;  5ITQ A;  3HJ8 A;  3KDS E;  3GRR A;  4LFC M;  2QCU A;  2HKJ A;  4D81 A;  5F3W A;  3KW6 A;  1GL7 A;  2KW0 A;  3U6C A;  2V6Z M;  3LVW A;  3GPX A;  2G3Q A;  3PVS A;  3FUT A;  4L8R C;  1QUS A;  4DV3 M;  1AIP C;  1Q02 A;  1D0K A;  4AG6 A;  4NXM M;  4IBK A;  4IBJ A;  4WP2 A;  2DNA A;  4LCB A;  4RF0 A;  4NC6 A;  2DWZ B;  3B74 A;  3U6S A;  3RGP A;  3U61 B;  1L2D A;  3AV0 A;  2C5R A;  4M9S A;  1ZAE A;  2LNH C;  4B3R M;  3AOG A;  1OFI A;  1YSY A;  1KFV A;  4AKI A;  2EO2 A;  4YY3 M;  2DAE A;  1IY1 A;  4LJ7 A;  1OJL A;  2V1C A;  4DR6 M;  3V76 A;  3B7N A;  1XWI A;  3A45 A;  1OGB A;  5ITR A;  2MGW A;  2Y2K A;  1L6J A;  1YUB A;  3WHL A;  5KQ8 A;  4X66 M;  5BR8 M;  3T1Y M;  1VDL A;  5FTM A;  1IN4 A;  3GPP A;  2YR0 A;  2ZAM A;  3KOX E;  4GC5 A;  3GLG B;  4G4N A;  1D0M A;  1VQ1 A;  4PCZ A;  2FN2 A;  5ITU A;  4D80 A;  1LV7 A;  2FH0 A;  1Z6T A;  1YE9 A;  4FW9 A;  4M0W A;  3KP0 E;  4OJ5 A;  4WUR A;  1P3Q Q;  4RKU F;  3FYC A;  5H37 D;  3AOE C;  3HJQ A;  3JAM S;  4BLC A;  2Y2M A;  3L29 A;  1E6N A;  2KNA A;  3CTW B;  3U6D A;  2KXE A;  4GRI A;  3C9P A;  2EKK A;  2CFO A;  4MB7 A;  4NSR A;  4W5W A;  1CK7 A;  1ZMW A;  2DZO B;  2G8L A;  2X4A A;  1OIZ A;  2QP9 X;  3EIH A;  1XXH E;  4II7 A;  4XBO A;  3FTE A;  2WSE F;  2HWJ A;  3TE6 A;  1IBM M;  2J7N A;  4MM3 B;  2Y2I A;  3WD1 A;  3B9P A;  1YUE A;  4BB9 A;  1MX0 A;  2Y2L A;  2DAI A;  2Y2G A;  2Y0T A;  2OO9 A;  4KOD A;  4NOO B;  2R62 A;  4AQY M;  3I51 A;  1QDR A;  4CIZ A;  2YNM D;  4ANR A;  2Z3X A;  3DFZ A;  1DGF A;  2XSZ A;  3U6O A;  3U5Z B;  2GNO A;  4G6Z A;  2Z8Y M;  1V34 A;  5KO3 A;  4A3V B;  2QBY B;  1MU5 A;  2LVQ D;  3EIE A;  2FNA A;  1WGL A;  2FS1 A;  5EP3 A;  1E9S A;  3PFI A;  4I81 A;  4F1I A;  4FWG A;  4MB4 A;  1YU0 A;  2F5P A;  1IN6 A;  2R0I A;  2VF7 A;  3RGS A;  3GLI E;  4DV2 M;  1EIJ A;  1K3W A;  4NZ1 A;  4PT5 A;  4JI0 M;  1AUA A;  2KNZ A;  3NBI A;  3U6E A;  1TDH A;  4D82 A;  4GIP A;  1QYR A;  4OW0 A;  1TTE A;  3MJ5 A;  1R2Z A;  4HMC A;  3ZC7 B;  1SXJ B;  1N33 M;  1UFZ A;  1E94 E;  2DAK A;  3CF2 A;  3Q8G A;  2CHG A;  3HON A;  3GLH A;  2K47 A;  2F5Q A;  2BG1 A;  1DO0 A;  4XK8 F;  3H4M A;  3ILK A;  2FFJ A;  1KSF X;  4LF5 M;  5FTL A;  1J7M A;  4OJP A;  1TR8 A;  2OOB A;  5BPV A;  1UR8 A;  1JR3 D;  3L27 A;  4LJ8 A;  3W0F A;  1N36 M;  3UK6 A;  4TX8 A;  3GLF B;  1XXH B;  1NVM A;  3J27 B;  3K9P A;  5E26 A;  4OX9 M;  4DV1 M;  1C7Y A;  5IZ7 D;  3I01 M;  4Z2K A;  3D8B A;  4HL4 A;  3K8Z A;  1R4G A;  1XB2 B;  1GPF A;  2DVW B;  3HHY A;  4QNL A;  3DOA A;  1Q3B A;  1VEK A;  3K9O A;  1G59 A;  4XGI A;  3T38 A;  4LF4 M;  3KS4 A;  4LZJ A;  5EJC A;  2C9C A;  1V92 A;  4CIS A;  1IM2 A;  1E6P A;  5C1B A;  4DUZ M;  4B3M M;  1HQY E;  1GAB A;  3JR5 A;  2J7O A;  1CXW A;  4OJ6 A;  4QHS A;  1HR0 M;  1GJT A;  1SXJ D;  2KDL A;  1TF0 B;  3SAR A;  3FUW A;  1QAQ A;  4UN2 B;  2JUJ A;  5EXX A;  3GO8 A;  4CJ6 A;  4JI4 M;  1W1Y A;  3KSX A;  2EKF A;  3T15 A;  4LRT A;  2QPA A;  3C3E A;  2XLJ A;  3HU2 A;  5LMU M;  2CV2 A;  2VQE M;  2LHG A;  3VK8 A;  1E6R A;  1VEJ A;  3BXW A;  1NNJ A;  5E6J A;  1ED7 A;  2JY5 A;  1A5T A;  3AJI B;  3PXG A;  4KLN A;  3GQ4 A;  1T43 A;  2L7H A;  5L8R F;  1DGB A;  4LGM A;  4L78 A;  1MJG M;  2KNV A;  2XH9 A;  2Y2O A;  1XNQ M;  2LVN C;  1W1P A;  3LVV A;  2XFS A;  3GRY A;  1DGG A;  3ZCB B;  1TH4 A;  3VKG A;  4JV5 M;  2Y21 A;  1QZE A;  4Z2J A;  2HHH M;  4DUY M;  1Z59 A;  4PD2 A;  2WSF F;  1IXS B;  3HU3 A;  2R18 A;  3B7Z A;  3KSJ A;  3TPZ A;  2CP8 A;  2B3T A;  4OVZ B;  3SYL A;  4B7G A;  1E8B A;  3VKH A;  3I4Y A;  3J80 S;  3W0L B;  3IHP A;  1G41 A;  4R7G A;  2RRU A;  3VK7 A;  1G3I A;  2Y2H A;  3W67 A;  4G4O A;  3SAU A;  1IQP A;  1Z5A A;  2V5O A;  3A42 A;  4Z2I A;  1W1V A;  4HMD A;  2XEP A;  2LH0 A;  4Z8X A;  1JB0 F;  1G71 A;  5DFL A;  4PDI A;  4JI3 M;  3U6L A;  1DV0 A;  1E6Z A;  1EAK A;  3E21 A;  3FRH A;  4LJ4 A;  4B3S M;  2DZN B;  3SBJ A;  2ZM6 M;  4ITQ A;  1TGU A;  1W1T A;  1T3T A;  1I94 M;  1HNZ M;  3J7A S;  2MR9 A;  4LF7 M;  4Z6Y A;  2V1U A;  1F4I A;  1OGG A;  2XZF A;  4FCW A;  1NY6 A;  1HT2 E;  1NNU C;  3PNY A;  1Q3C A;  3A46 A;  1DGH A;  3KS8 A;  1OQY A;  4MB3 A;  4MGH A;  4CGY B;  2R44 A;  3L26 A;  2ZAO A;  4KT0 F;  2BJV A;  1VDD A;  2DEN A;  2HL7 A;  4FWD A;  2UWX A;  2P5T A;  3VDU A;  3HZJ A;  3GLH E;  2LBC A;  3AL0 C;  3E4R A;  2Y20 A;  4G3O A;  4IBD A;  4B7H A;  1XMO M;  1QDT A;  2O25 A;  2CE7 A;  3QYB A;  1PRB A;  4IJE A;  3SYK A;  4DBG B;  1H8P A;  3M7P A;  2QNJ A;  4Z2L A;  2ERC A;  4YHH M;  4NYY A;  4OUI A;  2DHY A;  1VEG A;  2J5Y A;  5IWA M;  3I4V A;  3MMP A;  5EXT A;  3IEC A;  5ITT A;  2DWN A;  4LF6 M;  1L1T A;  3GRU A;  2KRK A;  4MH0 E;  3FUU A;  3R9X B;  1QAM A;  1DGH B;  4GH9 A;  1H6U A;  1W5S A;  1WIV A;  3B7Q A;  3LW5 F;  3THG A;  1Q39 A;  5ITX E;  5EP4 A;  5GKN A;  2UUC M;  2L4E A;  1HJP A;  2JZ1 A;  2F4V M;  2N35 A;  1NJF A;  1HNX M;  1GVN A;  3U6M A;  4OJL A;  4LG2 A;  3VDP A;  1NV9 A;  3D8L A;  2Y2P A;  1IBL M;  3H4J A;  4Q7J A;  2EUC A;  2JP7 A;  4LJ9 A;  1O6I A;  1MN3 A;  2LVO C;  2RGH A;  2YQZ A;  2MJ5 B;  2ZAN A;  4REZ A;  2OOA A;  2K6B A;  2HAK A;  2C9O A;  2NQ8 C;  1L2C A;  2Y2N A;  1N75 A;  1TH3 A;  1HQC A;  3QWL A;  2X8A A;  1IBK M;  1T6O A;  1YU2 A;  2Q2E B;  1S3S A;  4LJ6 A;  2I7P A;  8CAT A;  2DAG A;  4GMQ A;  3SC3 A;  2ZTD A;  4JI2 M;  4QOZ C;  3RFW A;  1N34 M;  4HEO A;  5KPT A;  1ZV1 A;  5EXP A;  4JI6 M;  4QNM A;  3SAT A;  2KZU A;  3FD9 A;  2XGN A;  4S12 A; 
#chains in the Genus database with same CATH homology
 2KA6 B;  4DR3 M;  2M5Z A;  4MGZ E;  4DR7 M;  1J5E M;  4I8O A;  2KEB A;  4ZPX A;  3KFU G;  1PJI A;  2L09 A;  2QZ4 A;  2JA2 A;  3TWK A;  2LXE A;  3CF0 A;  2DHR A;  2JE5 A;  3LQR A;  4GKJ M;  4GHA A;  2X49 A;  2C99 A;  5FTK A;  3GLI B;  4AI6 A;  2A5Y B;  3GP1 A;  3HSH A;  3GLI A;  3SMS A;  2RGO A;  3KP1 E;  2R65 A;  4JI7 M;  4B08 A;  3UJN A;  4JXJ A;  4LZZ A;  3U60 A;  3IG5 A;  3R8F A;  1L2B A;  1N32 M;  1J7K A;  4I4L A;  3GPY A;  4NRV A;  4X62 M;  2ZBK B;  2W82 A;  4X65 M;  2YFQ A;  2D7E A;  3MHV C;  3QAU A;  2F5S A;  1TH2 A;  1XXH A;  4RNA A;  4LRS A;  4AG5 A;  3IG8 A;  3GLF A;  1XC8 A;  2FE8 A;  2EA0 A;  2CHV A;  2L6O A;  5ITY A;  2UU9 M;  4NRW A;  4GKK M;  1KYI A;  5FLX S;  1GLN A;  1IN5 A;  3DA1 A;  4GHL A;  3VFD A;  1IXZ A;  2F5N A;  2VII A;  1QVR A;  1JQJ C;  5FTJ A;  1G4A E;  1K82 A;  2HCB A;  1Z5B A;  3HKP A;  4IBE A;  2OPF A;  5FSW A;  4DR5 M;  3J7B A;  1NSF A;  4L4U A;  3JR4 A;  2C98 A;  1R6B X;  3TWM A;  4KO8 A;  3SHG B;  1N77 A;  2XSZ D;  3VLF B;  2UXC M;  1YU1 A;  3HU1 A;  2XD1 A;  4NYU A;  3U5Z A;  2DXI A;  2R4J A;  3DZD A;  1PM5 A;  4B7F A;  1ZQ9 A;  1X37 A;  4LFB M;  1YU4 A;  3HHZ A;  2M60 A;  2UXB M;  1SXJ E;  1PJJ A;  5EQT A;  3HHW A;  3MK6 A;  2CV1 A;  5LMN M;  3FTC A;  4DV0 M;  3FTD A;  1L1Z A;  1HT1 E;  4L15 A;  3SAV A;  4M0D A;  2C96 A;  1C1K A;  1J09 A;  5IT9 S;  3ZH9 B;  1NJG A;  2Y0Q A;  3U6Q A;  2XZU A;  4FWH A;  4LF9 M;  2CEA A;  4MGY E;  3WX7 A;  4GIT A;  3FKE A;  1I4W A;  4IBC A;  4JN6 A;  4M9Z A;  2VQF M;  2OQ4 A;  4LGY A;  1JR3 A;  3J2P B;  3N3F A;  3GLG A;  4I5S A;  3U60 B;  4NY2 A;  4LY6 A;  2R45 A;  1IY0 A;  5DNY A;  4NSO B;  4IIW A;  7CAT A;  4G4Q A;  1TDZ A;  4DV5 M;  3L28 A;  4EIW A;  3U6P A;  3TWL A;  3K1J A;  2BNK A;  4MGI E;  1SXJ C;  4OJO A;  1DO2 A;  1UM8 A;  3AOE A;  3U61 A;  3AKZ A;  2D7G A;  4IBI A;  2Y2Q A;  4AKH A;  2XFT A;  3K2L A;  1EE8 A;  1QQW A;  3NWL A;  4IBG A;  3SMP A;  5KPZ A;  1GKI A;  3GQ3 A;  4MGK E;  3L2A A;  2XF3 A;  2CHQ A;  5EP1 A;  4DV6 M;  3C58 A;  1IXR C;  1FJG M;  3UGJ A;  5EXS A;  3RE8 A;  4JYA M;  4KHP M;  1FNN A;  2XD5 A;  4OVZ A;  4FCV A;  4JI8 M;  4X64 M;  4LFA M;  1XHB A;  2UUA M;  2F5O A;  4NZ4 A;  5C18 A;  2DWL A;  3KOZ E;  2JCH A;  4PDG A;  3T1H M;  2QEN A;  3L25 A;  4AW4 A;  2RKO A;  3M7G A;  4B3T M;  3CF6 E;  4FD2 A;  5FTN A;  1YU3 A;  4DV4 M;  2FOI C;  5IRE B;  4JI5 M;  1HNW M;  2UUB M;  2G5G X;  3FTF A;  1E32 A;  4BBA A;  3LQQ A;  4DR2 M;  1IN7 A;  3HHX A;  1IN8 A;  1NY5 A;  4LF8 M;  5JI3 E;  2AHM A;  1Z5C A;  3FUX A;  4NL4 H;  4QHT A;  3HJS A;  5A2Q S;  1R2Y A;  4DR4 M;  3J81 S;  2L7I A;  5KQD A;  4OU7 A;  3KOY E;  2R46 A;  2CUZ A;  1K3X A;  5KPR A;  3TQS A;  3E9S A;  3AFH A;  4QNR A;  3GRV A;  1XNR M;  5EP2 A;  1IY2 A;  4K0K M;  5DYI A;  5DYG A;  2UXD M;  4DV7 M;  5ITX A;  1QAO A;  3UMM A;  4JI1 M;  4CHT B;  3KVW A;  4L16 A;  2LWX A;  3FUV A;  3BOS A;  3WHK A;  4G4R A;  2DWM A;  4NZ5 A;  3SAW A;  1QZM A;  2I7N A;  3Q8X A;  4NZ3 A;  3K92 A;  4FVM A;  5JI2 E;  4LJA A;  3A98 B;  1D2N A;  1E9R A;  2D7H A;  3OTO M;  4TUW A;  2E5L M;  3HWS A;  3TL4 X;  3GQ5 A;  3GLH B;  4NXN M;  1W5T A;  1SXJ A;  3LMM A;  2Z4R A;  2BJW A;  3KOW E;  1L8Q A;  4QOS A;  4IBB A;  2FFF B;  2H1R A;  2O5R A;  2IOU A;  1NHW C;  2KRU A;  3HGI A;  4FCT A;  3GPU A;  1XMQ M;  2Z7J A;  2Z4S A;  2KZS A;  1G8P A;  4IJF A;  1ORY B;  4DR1 M;  3SHF A;  3KXE C;  1R7R A;  3UZU A;  1GL6 A;  1QAN A;  3FYD A;  1WXQ A;  2Y2J A;  4P16 A;  1NHG C;  2QBY A;  3SAS A;  2CV0 A;  4AKG A;  4RF1 A;  4HLQ A;  3SFZ A;  4GC9 A;  3PNV A;  4AZF A;  4R3D A;  3M6A A;  4WW0 A;  3M0E A;  2R4E A;  4M9X A;  1N78 A;  4IBF A;  1OFH A;  4LJ5 A;  5ITQ A;  3HJ8 A;  3KDS E;  3GRR A;  4LFC M;  2QCU A;  2HKJ A;  4D81 A;  5F3W A;  3KW6 A;  1GL7 A;  2KW0 A;  3U6C A;  2V6Z M;  3LVW A;  3GPX A;  3PVS A;  3FUT A;  4L8R C;  4DV3 M;  4NXM M;  4AG6 A;  4IBK A;  4IBJ A;  4LCB A;  4RF0 A;  2DWZ B;  3U6S A;  3RGP A;  3U61 B;  1L2D A;  3AV0 A;  2C5R A;  4M9S A;  1ZAE A;  2LNH C;  4B3R M;  3AOG A;  1OFI A;  1YSY A;  1KFV A;  4AKI A;  2EO2 A;  4YY3 M;  1IY1 A;  4LJ7 A;  1OJL A;  2V1C A;  4DR6 M;  1XWI A;  3A45 A;  5ITR A;  1YUB A;  3WHL A;  5KQ8 A;  4X66 M;  5BR8 M;  3T1Y M;  5FTM A;  1IN4 A;  3GPP A;  2YR0 A;  2ZAM A;  3KOX E;  4GC5 A;  3GLG B;  4G4N A;  4PCZ A;  5ITU A;  4D80 A;  1LV7 A;  4FW9 A;  1Z6T A;  1YE9 A;  4M0W A;  3KP0 E;  4OJ5 A;  4WUR A;  3FYC A;  5H37 D;  3AOE C;  3HJQ A;  3JAM S;  4BLC A;  2Y2M A;  3L29 A;  3CTW B;  3U6D A;  2KXE A;  4GRI A;  4MB7 A;  4W5W A;  2CFO A;  4NSR A;  4OJ6 A;  2X4A A;  2DZO B;  2G8L A;  3EIH A;  2QP9 X;  4II7 A;  4XBO A;  3FTE A;  3TE6 A;  1IBM M;  2J7N A;  4MM3 B;  2Y2I A;  3B9P A;  1YUE A;  4BB9 A;  1MX0 A;  2Y2L A;  2Y2G A;  2Y0T A;  4KOD A;  4NOO B;  2R62 A;  4AQY M;  3I51 A;  2YNM D;  2Z3X A;  3DFZ A;  1DGF A;  2XSZ A;  3U6O A;  3U5Z B;  5KO3 A;  4G6Z A;  4A3V B;  2QBY B;  1MU5 A;  3EIE A;  5EP3 A;  2FNA A;  2Y2K A;  4OUI A;  1E9S A;  3PFI A;  4I81 A;  4FWG A;  1YU0 A;  2F5P A;  1IN6 A;  4DV2 M;  3RGS A;  4NZ1 A;  1K3W A;  4PT5 A;  4JI0 M;  3NBI A;  3U6E A;  1TDH A;  4D82 A;  4GIP A;  1QYR A;  4OW0 A;  3MJ5 A;  1R2Z A;  3ZC7 B;  1SXJ B;  1N33 M;  1E94 E;  3CF2 A;  2CHG A;  3HON A;  3GLH A;  2K47 A;  2F5Q A;  2BG1 A;  1DO0 A;  3H4M A;  3ILK A;  2FFJ A;  1KSF X;  4LF5 M;  5FTL A;  4OJP A;  5BPV A;  1JR3 D;  3L27 A;  4LJ8 A;  3W0F A;  1N36 M;  3UK6 A;  3GLF B;  1XXH B;  1NVM A;  3J27 B;  5E26 A;  4OX9 M;  4DV1 M;  5IZ7 D;  3D8B A;  4HL4 A;  3K8Z A;  2DVW B;  3HHY A;  4QNL A;  3DOA A;  1Q3B A;  1G59 A;  4XGI A;  3T38 A;  4LF4 M;  3KS4 A;  4LZJ A;  5EJC A;  2C9C A;  4CIS A;  1IM2 A;  5C1B A;  4DUZ M;  4B3M M;  1HQY E;  3JR5 A;  2J7O A;  4QHS A;  1HR0 M;  1SXJ D;  3SAR A;  3FUW A;  1QAQ A;  5EXX A;  3GO8 A;  4JI4 M;  3KSX A;  3T15 A;  4LRT A;  2QPA A;  2XLJ A;  3HU2 A;  5LMU M;  2CV2 A;  2VQE M;  3VK8 A;  1NNJ A;  5E6J A;  3AJI B;  3PXG A;  4KLN A;  3GQ4 A;  2L7H A;  1DGB A;  4LGM A;  4L78 A;  2XH9 A;  2Y2O A;  1XNQ M;  3LVV A;  2XFS A;  3GRY A;  1DGG A;  3ZCB B;  1TH4 A;  3VKG A;  4JV5 M;  2Y21 A;  2HHH M;  4DUY M;  1Z59 A;  4PD2 A;  1IXS B;  3HU3 A;  2R18 A;  3KSJ A;  3TPZ A;  4OVZ B;  3SYL A;  4B7G A;  3VKH A;  3I4Y A;  3J80 S;  3W0L B;  4R7G A;  1G41 A;  3VK7 A;  1G3I A;  2Y2H A;  4G4O A;  3SAU A;  1IQP A;  1Z5A A;  3A42 A;  2XEP A;  2LH0 A;  4Z8X A;  4PDI A;  3U6L A;  4JI3 M;  4LJ4 A;  4B3S M;  2DZN B;  3SBJ A;  2ZM6 M;  4ITQ A;  1TGU A;  1T3T A;  1I94 M;  1HNZ M;  3J7A S;  4LF7 M;  4Z6Y A;  2V1U A;  2XZF A;  4FCW A;  1NY6 A;  3PNY A;  1HT2 E;  1NNU C;  1Q3C A;  3A46 A;  1DGH A;  3KS8 A;  4MGH A;  4CGY B;  3L26 A;  2ZAO A;  2BJV A;  1VDD A;  2HL7 A;  4FWD A;  2UWX A;  2P5T A;  3VDU A;  3AL0 C;  3E4R A;  2Y20 A;  4IBD A;  4B7H A;  1XMO M;  4IJE A;  2CE7 A;  3SYK A;  2ERC A;  4YHH M;  4NYY A;  5IWA M;  3I4V A;  5EXT A;  5ITT A;  2DWN A;  4LF6 M;  1L1T A;  3GRU A;  2KRK A;  4MH0 E;  3FUU A;  3R9X B;  1QAM A;  1DGH B;  4GH9 A;  1H6U A;  1W5S A;  3THG A;  5ITX E;  1Q39 A;  5EP4 A;  5GKN A;  2UUC M;  2F4V M;  1NJF A;  1HNX M;  1GVN A;  3U6M A;  4OJL A;  4LG2 A;  3VDP A;  3D8L A;  2Y2P A;  1IBL M;  2EUC A;  4LJ9 A;  2RGH A;  2YQZ A;  2ZAN A;  4REZ A;  2C9O A;  2NQ8 C;  1L2C A;  2Y2N A;  1N75 A;  1TH3 A;  1HQC A;  3QWL A;  2X8A A;  1IBK M;  1YU2 A;  2Q2E B;  1S3S A;  4LJ6 A;  2I7P A;  8CAT A;  4JI2 M;  4GMQ A;  3SC3 A;  4QOZ C;  3RFW A;  1N34 M;  5KPT A;  5EXP A;  4JI6 M;  4QNM A;  3SAT A;  2KZU A;  3FD9 A;  2XGN A;  4S12 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...