4IBBA

Ebola virus vp35 bound to small molecule
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
123
structure length
123
Chain Sequence
DISAKDLRNIMYDHLPGFGTAFHQLVQVICKLGKDSNSLDIIHAEFQASLAEGDSPQCALIQITKRVPIFQDAAPPVIHIRSRGDIPRACQKSLRPVPPSPKIDRGWVCVFQLQDGKTLGLKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title In Silico Derived Small Molecules Bind the Filovirus VP35 Protein and Inhibit Its Polymerase Cofactor Activity.
pubmed doi rcsb
source organism Ebola virus
molecule tags Transcription/transcription inhibitor
molecule keywords Polymerase cofactor VP35
total genus 42
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-12-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.950 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4ibbA01
2.10.10.70 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 4ibbA02
4IBEA 4GHLA 4GH9A 3L27A 4IBBA 4LG2A 4IBKA 3L2AA 3KS8A 4IBIA 4IBDA 3L26A 4IBGA 3KS4A 3FKEA 5BPVA 4IBJA 4IBFA 4IBCA 4IJEA 3L25A 3L29A 4IJFA 4GHAA 3L28A
chains in the Genus database with same CATH superfamily
1T43A 5IREB 3AOEC 1IM2A 2G8LA 4II7A 3GQ3A 3M6AA 2K47A 4G6ZA 4R71A 3AJIB 2NQ8C 2DI0A 3SYLA 3L2AA 4LJ5A 3U6QA 1K3WA 2C98A 4MGYE 3V76A 2E5LM 4LGMA 3MQLA 4IBDA 4GC9A 1Q3BA 4ANRA 4F1IA 2XSZD 4TUWA 1H8PA 4JI1M 1W5TA 4X62M 4FD2A 1PDCA 3IECA 1V34A 3FRHA 3AOGA 3K92A 1AIPC 1ORYB 3CF6E 4B08A 1TH2A 5EP4A 1JR3D 2LTUA 4LGYA 4XK8F 3VDPA 5DNYA 4AQYM 1XNQM 4LJ4A 3L25A 3B9PA 3Q8XA 1G71A 4JI4M 1KS0A 4LJ8A 2MR9A 2Z7JA 2R45A 3K9OA 1IXRC 2YNMD 1W5SA 2DAGA 1K82A 3KDSE 5BR8M 3A42A 3WD2A 1DGGA 3N3FA 1TH3A 5FTNA 1WHCA 3SHGB 3GPXA 1L1TA 2CHVA 4LJ9A 5EP1A 5ITRA 1IXSB 2YR0A 3HSHA 4IIWA 1OAOC 4OJ6A 1Z59A 4LZJA 5KQDA 1R7RA 4GC5A 4ZPXA 3B7ZA 2J5YA 3ZCBB 1YU1A 2XEPA 1GL6A 4NYYA 2UUBM 1T6OA 1VEGA 1GLNA 3BXWA 5KQ8A 3U5ZA 1H0IA 4K0KM 3KFUG 1UM8A 1ZQ9A 1EE8A 1XB2B 2CHQA 2VF8A 2W82A 4DR2M 1L1ZA 2KNAA 3GO8A 4R3DA 1N32M 1W1VA 1VEJA 3FRIA 3U61B 2EJSA 1E9RA 4W5WA 4D81A 2UWXA 1R2YA 1W1TA 4AZFA 1YU4A 1N34M 3HHWA 4FVMA 4GKKM 3GLHE 4JV5M 3U6OA 2QENA 2OO9A 2VDBB 2VIIA 4IBKA 4LFCM 4HL4A 2C9CA 1ZMVA 2KEBA 4GIPA 3SATA 2D49A 2XZUA 3A46A 3SAVA 4P16A 2R4EA 2HCBA 2ZTCA 3HWSA 4L8RC 2LNHC 4X65M 4I81A 4B3TM 3SC3A 1YUBA 3GPUA 1NVMA 1N33M 2EA0A 3LCUA 4MM3B 3FUVA 3UGJA 1QZMA 3WX7A 4RKUF 4KO8A 3LCVB 3FTFA 3LQQA 1XWIA 3THGA 1L6JA 3MMPA 4B3MM 1XNRM 2DVWB 4LRTA 3TWKA 2Y2MA 4PDIA 4G3OA 4CISA 4NRWA 1IN4A 2N35A 4WP2A 2OOAA 4DUZM 2RRUA 1IY2A 1JR3A 4KT0F 3LMMA 1TF0B 3HU2A 3WD3A 4BB9A 4YHHM 3GLFA 3I04M 2D7EA 1NSFA 2JZ0A 2L2DA 4LF5M 1DGHA 3CTWB 3KOXE 5EXXA 4LF9M 1Q02A 3BBZA 4Z2JA 1G3IA 3C3DA 2OOBA 3KOZE 4M0WA 3FTDA 4LZZA 4OU7A 3TE6A 2Y2NA 4PCZA 4DR3M 1QDRA 3U61A 2Y2HA 4PD2A 4JYAM 3B74A 4CJ6A 1N77A 1SG9A 2JXNA 2Y21A 1T3TA 4QOSA 3K2LA 2A5YB 2L6OA 2JY6B 1WGNA 2ZAOA 1YU3A 2R62A 3ILKA 3SAWA 1DO2A 1HQYE 2UUCM 1GABA 1ED7A 2FOIC 2ZTDA 3KOYE 3SYKA 2Y2OA 4LF8M 4MGIE 1XHBA 3QWLA 3PNYA 4MGKE 4RF0A 3UK6A 2XGNA 4NOOB 2QSFX 1IY1A 3HX3A 2Y2PA 1DGFA 3FYDA 3GLHB 5L8RF 4QHSA 3VK7A 3WHLA 4ITQA 2M60A 3A98B 5ITYA 1XXHA 3KVWA 2DWMA 4G4OA 3WD4A 4JI5M 3W0FA 2DWLA 2BNKA 2Y20A 3NBIA 2O25A 4LJ6A 5A2QS 2VQFM 1TH4A 3SFZA 1E88A 3J81S 4YY3M 3GLFB 1NNJA 4DV5M 2BWEA 4GH9A 3J7BA 5DYGA 2FS1A 4Z2KA 2Z3XA 3AV0A 2Z4RA 3KS8A 4B3RM 4FCVA 3DOAA 4G4NA 3TPZA 3E9SA 8CATA 1WXQA 2WSCF 4NRVA 4QNRA 5DFLA 1GO5A 1GOIA 2RKOA 4B3SM 4AKHA 1QZEA 3ZQJA 1E94E 3RGPA 3HJ8A 2LVAA 3AOEA 1IN6A 1J7KA 4G4QA 3U6CA 3E46A 3HU1A 3F92A 4GHAA 1CXWA 1OIPA 2DZNB 2G3QA 1PJQA 2BJVA 1OIZA 1DO0A 5DYIA 4CGYB 3KOWE 4LRSA 1GL7A 4CHTB 4I5SA 2OPFA 3U6SA 3C9PA 2GQFA 3T38A 3U6PA 5KPRA 1PM5A 2APLA 4NY2A 1PJTA 3CF2A 3GLHA 4AI6A 4WURA 2XFSA 7CATA 3I51A 3I01M 1GPFA 1BVSA 1VEKA 1EFUB 2LVPC 4DR5M 5IT9S 3C58A 4LF7M 3VKHA 4LJAA 4JI2M 3GRVA 2F5SA 1O6IA 4GMQA 1IQPA 2R65A 2X49A 4Z6YA 2FFFB 1IFYA 1I94M 3SMPA 3IG8A 2LH0A 1QYRA 1GJTA 2KZSA 2V1CA 2XSZA 4JN6A 4NSRA 3QYEA 3GPPA 3T1YM 2UUAM 1E6NA 4DV7M 1QAMA 4LFAM 3SAUA 3U6MA 2F5OA 1G59A 2CUZA 2JA2A 2VF7A 2O01F 3M0EA 1N78A 3JR4A 1K3XA 2FFJA 3JR5A 5EXSA 1TDZA 1IXZA 1WIVA 4B7HA 4XBOA 4KHPM 1YLAA 1OFHA 4FCTA 3FUXA 2K6BA 2Z4SA 1OJLA 1J5EM 1DV0A 1MJGM 4G4RA 1E6PA 1NJGA 1E8BA 3BOSA 4GEWA 3R8FA 3TQSA 4DUYM 3VFDA 3FE3A 4NC6A 1PJSA 3FYCA 4AG6A 4FCWA 4IBCA 3B89A 5FSWA 3VK8A 2MROB 1Z5BA 2FNAA 2CP8A 2WSFF 3L29A 4I4LA 4IJFA 5C18A 4DR4M 1NHWC 1C7YA 1NJFA 3CF0A 2G5GX 1HT1E 2QBYB 2EO2A 2MGWA 5FTMA 3HHYA 4GHLA 1FJGM 1VQ1A 2QQ8A 1OAIA 1H6UA 2KHHA 4M9ZA 2R46A 4RNAA 1HR0M 3L27A 1ZMUA 1XC8A 3Q8GA 3SASA 1NO1A 2DAKA 1XXHE 3J27B 1OTRA 1EIJA 2Y0TA 1YU2A 1JR3E 4NL4H 1R4GA 1ZAEA 2JE5A 1TTEA 2F4VM 3B7QA 3GRUA 4OUIA 2ZM6M 3WHKA 3VDUA 2RTSA 4NZ3A 3ZH9B 2KNVA 3U6DA 5IZ7D 2UU9M 3UJNA 2D7GA 4BBAA 2R0IA 1V33A 2I7PA 3D8BA 4FW9A 4LJ7A 4Z8XA 1KFVA 2LXEA 4AG5A 1FNNA 3GP1A 1OGGA 4Z2GA 1QAOA 2M5ZA 4MGHA 2K0BX 3GLGA 1P3QQ 1OQYA 2LBCA 4FWGA 4L4UA 3GLIE 3FUWA 1HQCA 2L09A 3E21A 5ITQA 1NHGC 2Z8YM 2UXDM 2HL7A 3IG5A 1H0GA 1Q39A 4DV3M 1R6BX 1G41A 3AKZA 2J7NA 5GKNA 2DHRA 3QYBA 2DXIA 3HHXA 3KSJA 4EIWA 2J7OA 2F5NA 3OTOM 2OQ4A 1NNUC 1UFZA 1OKSA 4MB7A 4P17A 3K8ZA 3LQRA 2BWBA 4M9XA 3JAMS 3FKEA 3KXEC 5FLXS 4DV1M 2JZ1A 1Z5CA 4NXMM 2P5TA 1D0LA 1TDHA 2CEAA 3HZJA 2ERCA 4GRIA 4MB4A 4NXNM 5IWAM 3GLFE 2FE8A 3RGSA 4BLCA 1WGLA 3AFHA 4I8OA 3VKGA 1V92A 1NY6A 4GITA 3J80S 5EXTA 3FD9A 1KSFX 3H4MA 4OVZA 4HEOA 2MJ5B 2DHYA 5EXPA 1AUAA 4NZ5A 2KXEA 4M0DA 1J7MA 1WJ7A 2KNZA 3I4YA 3W67A 2BJWA 2DAEA 3CGWA 5C1BA 1Q3CA 5ITUA 2KZUA 3W68A 1HNXM 2LVNC 1NV8A 4X66M 2Q2EB 1MX0A 2DWZB 4DV6M 4TX8A 1E32A 3UMMA 4GKJM 4D82A 2Y2IA 3KS4A 4LFBM 3W0LB 3FUUA 1QQWA 4S12A 3RE8A 3VLFB 1VDLA 2CE7A 4IBJA 1SXJB 3SHFA 2KRUA 3U6EA 4OX9M 1CK7A 1GXDA 4R7GA 4IJEA 1JQJC 1SXJD 2KRKA 4MH0E 3C3EA 2DKLA 3HU3A 5EJCA 4JI0M 2LVQD 2EKFA 1QAQA 2R4JA 2X8AA 1L8QA 3HJSA 3LVVA 2LHCA 3DA1A 3AL0C 5F3WA 1AIWA 2Y0QA 2O5RA 2CRUA 1HNWM 1LV7A 4HMDA 2B3TA 3ZC7B 3R9XB 4LG2A 2HWJA 2C9OA 2L4EA 2WSEF 2QBYA 2QPAA 3T15A 3SMSA 2HKJA 2DZOB 5H37D 4DV0M 1N75A 2DWNA 3LVWA 4IBGA 2Y2LA 3U5ZB 1VDDA 1QVRA 1HJPA 3GRYA 3FTEA 5KO3A 1DGBA 1GKIA 5BPVA 4PT5A 2YQZA 3M7GA 3HJQA 1I4WA 2CWBA 2RGHA 4OJ5A 2V5OA 2DAIA 2KDLA 5ITXA 4XGIA 4QHTA 1VG5A 1E6RA 1L2CA 3HONA 4JXJA 4WW0A 4REZA 1IBKM 2JNHA 2MH8A 2R18A 2C5RA 5KPZA 1PGYA 1RU3A 3DFZA 2L7IA 5EP2A 1XMQM 4HMEA 4MB5A 1HT2E 1SXJE 3PNVA 1MN3A 1OGBA 2C99A 1QANA 2ZBKB 4QNLA 4IBIA 2L4FA 3B7NA 1SXJA 3GQ4A 3T1HM 3NWLA 3SBJA 4OJLA 1OFIA 4Z2LA 3GRRA 1L2DA 1IBMM 3EIHA 2EUCA 3I4VA 3WD1A 1GVNA 3E4RA 3PXGA 2JWSA 4IBFA 4FWHA 2CHGA 1F4IA 4X64M 4NYUA 3U60B 2JY8A 2K9DA 3TL4X 2D7HA 4L15A 1NV9A 5KPTA 5JI2E 1QDTA 3RFWA 2HHHM 1NY5A 1A5TA 4MB3A 3HKPA 1EAKA 4DV4M 1IY0A 2XD1A 1QUTA 5ITTA 2IOUA 1G4AE 5FTJA 2VQEM 5FTLA 4OJPA 4Z2HA 2KW0A 2ZAMA 1WR1B 2Y2QA 1CUKA 3FUTA 2JP7A 1DGHB 1XMOM 2ZANA 4IBBA 4OVZB 2BG1A 2LVOC 2CV1A 4F2LA 1HNZM 4L6V6 2XZFA 3MJ5A 2DNAA 4KLNA 5E6JA 4OJOA 2RGOA 1L2BA 1J09A 1YSYA 2C96A 2LHGA 3KSXA 4Y28F 1E6ZA 1LTMA 4D80A 2WZJA 2QP9X 3SARA 3J2PB 4KODA 4NZ1A 2X4AA 3GLIB 2GNOA 4Q7JA 3H4JA 3U6LA 3WD0A 1IBLM 4QOZC 2FH0A 3PVSA 2V6ZM 4LY6A 2JY7A 2KA6B 1D0MA 3KW6A 3A45A 1X37A 2EKKA 4NSOB 3IHPA 1W1PA 4IBEA 1N36M 4LF4M 2XF3A 1E15A 2AHMA 3QAUA 5FTKA 4UN2B 1Y8GA 3HY5A 1S3SA 4DV2M 4JI6M 5ITXE 4LCBA 3KP1E 4AW4A 3M7PA 2UXBM 2JY5A 2H1RA 3U60A 1Z6TA 4HLQA 1XXHB 4FWDA 4HMCA 3TWLA 2CFOA 1TGUA 3DZDA 4PDGA 4DR1M 2F5QA 3D8LA 2QZ4A 4DR7M 2CV2A 3KP0E 2QNJA 4CIZA 2LWXA 1QO6A 3HHZA 1D2NA 1JB0F 2XFTA 3K1JA 3T6PA 3GQ5A 4DBGB 4AKGA 1ZMWA 4QNMA 2DENA 3L28A 3NBXX 2QCUA 4M9SA 4JI8M 4B7GA 4RF1A 1UR8A 3LW5F 1PJJA 4DR6M 4Z2IA 3J7AS 2UXCM 1YU0A 4NZ4A 2JCHA 3PFIA 1D0KA 4JI3M 1R2ZA 1C1KA 1Z5AA 2XH9A 1GJSA 3GLGB 1IN5A 3EIEA 5JI3E 4AKIA 1KYIA 1PRBA 2I7NA 3HGIA 5LMUM 2FN2A 2Y2JA 3L26A 3FTCA 1UR9A 2HAKA 1W1YA 1MU5A 3MHVC 1E9SA 2R6FA 3GLIA 3GLGE 2V1UA 2H5XA 2XD5A 4JI7M 1IXSA 2L7HA 2YFQA 2QHOB 1YE9A 3TWMA 5E26A 1YUEA 2DAMA 1SXJC 4A3VB 4L78A 4B7FA 1ZV1A 3MK6A 4OW0A 3K9PA 5EQTA 3UZUA 3GPYA 5LMNM 1PJIA 1IN7A 2F5PA 2Y2KA 5EP3A 2Y2GA 1IN8A 1TR8A 2DZLA 4LF6M 2JUJA 2R44A 1G8PA 1QUSA 2XLJA 4L16A 2CV0A 1R5LA 4MGZE
chains in the Genus database with same CATH topology
5IREB 3AOEC 1IM2A 2G8LA 4II7A 3GQ3A 3M6AA 2K47A 4G6ZA 3AJIB 2NQ8C 3SYLA 3U6QA 3L2AA 4LJ5A 1K3WA 2C98A 4MGYE 2E5LM 4LGMA 4IBDA 4GC9A 1Q3BA 2XSZD 4TUWA 4JI1M 1W5TA 4X62M 4FD2A 3AOGA 3K92A 1ORYB 3CF6E 4B08A 1TH2A 5EP4A 1JR3D 3L25A 4LGYA 3VDPA 5DNYA 1XNQM 4AQYM 4LJ4A 3B9PA 3Q8XA 4JI4M 4LJ8A 2Z7JA 2R45A 1IXRC 2YNMD 1W5SA 1K82A 3KDSE 5BR8M 3A42A 1DGGA 3N3FA 1TH3A 5FTNA 1L1TA 3SHGB 3GPXA 2CHVA 4LJ9A 5EP1A 5ITRA 1IXSB 2YR0A 3HSHA 4IIWA 4OJ6A 1Z59A 4LZJA 5KQDA 1R7RA 4GC5A 4ZPXA 3ZCBB 1YU1A 2XEPA 1GL6A 4NYYA 2UUBM 1GLNA 5KQ8A 3U5ZA 4K0KM 3KFUG 1UM8A 1ZQ9A 1EE8A 2CHQA 2W82A 4DR2M 1L1ZA 3GO8A 4R3DA 1N32M 3U61B 1E9RA 4W5WA 4D81A 2UWXA 1R2YA 1YU4A 4AZFA 1N34M 3HHWA 4FVMA 4GKKM 4JV5M 3U6OA 2QENA 2VIIA 4LFCM 4IBKA 4HL4A 2C9CA 2KEBA 4GIPA 3SATA 2XZUA 3A46A 3SAVA 4P16A 2R4EA 2HCBA 3HWSA 4L8RC 2LNHC 4X65M 4I81A 4B3TM 3SC3A 1YUBA 3GPUA 1NVMA 1N33M 2EA0A 3WX7A 4MM3B 3FUVA 3UGJA 1QZMA 3FTFA 4KO8A 3LQQA 1XWIA 3THGA 4B3MM 1XNRM 2DVWB 4LRTA 3TWKA 2Y2MA 4PDIA 4CISA 4NRWA 1IN4A 4DUZM 1IY2A 1JR3A 3LMMA 3HU2A 4BB9A 4YHHM 3GLFA 2D7EA 1NSFA 4LF5M 1DGHA 3CTWB 3KOXE 5EXXA 4LF9M 1G3IA 3KOZE 4M0WA 4LZZA 4OU7A 3FTDA 2Y2NA 3TE6A 4PCZA 4DR3M 3U61A 2Y2HA 4PD2A 4JYAM 1N77A 2Y21A 1T3TA 4QOSA 3K2LA 2A5YB 2L6OA 2ZAOA 1YU3A 2R62A 3ILKA 3SAWA 1DO2A 1HQYE 2UUCM 2FOIC 3KOYE 3SYKA 2Y2OA 4LF8M 4MGIE 1XHBA 3QWLA 3PNYA 4MGKE 4RF0A 3UK6A 2XGNA 4NOOB 1IY1A 2Y2PA 1DGFA 3FYDA 3GLHB 4QHSA 3VK7A 3WHLA 4ITQA 2M60A 3A98B 5ITYA 1XXHA 3KVWA 4G4OA 4JI5M 3W0FA 2DWLA 2BNKA 2Y20A 3NBIA 4LJ6A 5A2QS 2VQFM 1TH4A 3SFZA 3J81S 4YY3M 3GLFB 1NNJA 4DV5M 4GH9A 3J7BA 5DYGA 2Z3XA 3AV0A 2Z4RA 3KS8A 4B3RM 4FCVA 3DOAA 4G4NA 3TPZA 3E9SA 8CATA 1WXQA 4NRVA 4QNRA 2RKOA 4B3SM 4AKHA 1E94E 3RGPA 3HJ8A 3AOEA 1IN6A 1J7KA 4G4QA 3U6CA 3HU1A 4GHAA 2DZNB 2BJVA 1DO0A 5DYIA 4CGYB 3KOWE 4LRSA 1GL7A 4CHTB 4I5SA 2OPFA 3U6SA 3T38A 3U6PA 5KPRA 1PM5A 4NY2A 3CF2A 3GLHA 4AI6A 4WURA 2XFSA 7CATA 3I51A 5IT9S 4DR5M 3C58A 4LF7M 3VKHA 4LJAA 4JI2M 3GRVA 2F5SA 4GMQA 1IQPA 2R65A 2X49A 4Z6YA 1I94M 3SMPA 3IG8A 2LH0A 1QYRA 2KZSA 2XSZA 2V1CA 4JN6A 4NSRA 3GPPA 3T1YM 2UUAM 4DV7M 1QAMA 4LFAM 3SAUA 3U6MA 2F5OA 1G59A 2CUZA 2JA2A 3M0EA 1N78A 3JR4A 1K3XA 2FFJA 3JR5A 5EXSA 1TDZA 1IXZA 4B7HA 4KHPM 4XBOA 4FCTA 1OFHA 3FUXA 2Z4SA 1OJLA 1J5EM 4G4RA 1NJGA 3BOSA 3R8FA 3TQSA 4DUYM 3VFDA 3FYCA 4AG6A 4FCWA 4IBCA 5FSWA 3VK8A 1Z5BA 2FNAA 4DR4M 3L29A 4I4LA 4IJFA 5C18A 1NHWC 1NJFA 3CF0A 2G5GX 1HT1E 2QBYB 2EO2A 5FTMA 3HHYA 4GHLA 1FJGM 4M9ZA 1HR0M 1H6UA 2R46A 4RNAA 3L27A 1XC8A 3SASA 3J27B 2Y0TA 1YU2A 4NL4H 1ZAEA 2JE5A 2F4VM 3GRUA 4OUIA 2ZM6M 3WHKA 3VDUA 4NZ3A 3ZH9B 3U6DA 5IZ7D 2UU9M 3UJNA 2D7GA 4BBAA 3D8BA 2I7PA 4FW9A 4LJ7A 4Z8XA 1KFVA 2LXEA 4AG5A 1FNNA 3GP1A 1QAOA 2M5ZA 4MGHA 3GLGA 4L4UA 4FWGA 3FUWA 1HQCA 2L09A 5ITQA 1NHGC 2UXDM 2HL7A 3IG5A 1Q39A 4DV3M 1R6BX 1G41A 3AKZA 2J7NA 5GKNA 2DHRA 2DXIA 3HHXA 3KSJA 4EIWA 2J7OA 2F5NA 3OTOM 2OQ4A 1NNUC 4MB7A 2DWMA 3K8ZA 3LQRA 4M9XA 3JAMS 5FLXS 3FKEA 3KXEC 4DV1M 2FFFB 1Z5CA 4NXMM 2P5TA 1TDHA 2CEAA 4GRIA 2ERCA 4NXNM 5IWAM 2FE8A 3RGSA 4BLCA 3AFHA 4I8OA 3VKGA 4GITA 1NY6A 3J80S 5EXTA 3FD9A 1KSFX 3H4MA 4OVZA 5EXPA 4NZ5A 2KXEA 4M0DA 3I4YA 2BJWA 5C1BA 1Q3CA 5ITUA 2KZUA 1HNXM 4DV6M 4X66M 2Q2EB 1MX0A 2DWZB 1E32A 3UMMA 4GKJM 4D82A 2Y2IA 3KS4A 4LFBM 3W0LB 3FUUA 1QQWA 4S12A 3RE8A 3VLFB 2CE7A 4IBJA 1SXJB 3SHFA 2KRUA 3U6EA 4OX9M 4R7GA 4IJEA 1JQJC 1SXJD 2KRKA 4MH0E 3HU3A 5EJCA 4JI0M 1QAQA 2R4JA 2X8AA 1L8QA 3HJSA 3LVVA 3AL0C 3DA1A 5F3WA 2Y0QA 2O5RA 1HNWM 1LV7A 3ZC7B 3R9XB 4LG2A 2C9OA 2QBYA 2QPAA 3T15A 3SMSA 2HKJA 2DZOB 5H37D 4DV0M 1N75A 2DWNA 3LVWA 4IBGA 2Y2LA 3U5ZB 1VDDA 1QVRA 3GRYA 3FTEA 5KO3A 1DGBA 1GKIA 5BPVA 4PT5A 2YQZA 3M7GA 3HJQA 1I4WA 2RGHA 4OJ5A 5ITXA 4XGIA 4QHTA 1L2CA 3HONA 4JXJA 4WW0A 4REZA 1IBKM 2R18A 2C5RA 5KPZA 3DFZA 5EP2A 1XMQM 2L7IA 1HT2E 1SXJE 3PNVA 2C99A 1QANA 2ZBKB 4QNLA 4IBIA 1SXJA 3GQ4A 3T1HM 3NWLA 3SBJA 4OJLA 1OFIA 3GRRA 1L2DA 1IBMM 3EIHA 2EUCA 3I4VA 1GVNA 3E4RA 3PXGA 4IBFA 4FWHA 2CHGA 4X64M 4NYUA 3U60B 3TL4X 2D7HA 4L15A 5KPTA 5JI2E 3RFWA 2HHHM 1NY5A 3HKPA 4DV4M 1IY0A 2XD1A 5ITTA 2IOUA 1G4AE 5FTJA 2VQEM 5FTLA 4OJPA 2KW0A 2ZAMA 2Y2QA 3FUTA 1DGHB 1XMOM 2ZANA 4IBBA 4OVZB 2BG1A 2CV1A 1HNZM 2XZFA 3MJ5A 4KLNA 5E6JA 4OJOA 2RGOA 1L2BA 1J09A 1YSYA 2C96A 3KSXA 4D80A 2QP9X 3SARA 3J2PB 4KODA 4NZ1A 2X4AA 3GLIB 3U6LA 1IBLM 4QOZC 3PVSA 2V6ZM 4LY6A 2KA6B 3KW6A 3A45A 1X37A 4NSOB 4IBEA 1N36M 4LF4M 2XF3A 2AHMA 3QAUA 5FTKA 4JI6M 1S3SA 5ITXE 4LCBA 3KP1E 4AW4A 2UXBM 2H1RA 3U60A 1Z6TA 4HLQA 1XXHB 4FWDA 3TWLA 2CFOA 1TGUA 3DZDA 4PDGA 4DR1M 2F5QA 3D8LA 2QZ4A 4DR7M 2CV2A 3KP0E 2LWXA 3HHZA 1D2NA 2XFTA 3K1JA 3GQ5A 4AKGA 4QNMA 3L28A 2QCUA 4M9SA 4JI8M 4B7GA 4RF1A 1PJJA 4DR6M 3J7AS 2UXCM 1YU0A 4NZ4A 2JCHA 3PFIA 4JI3M 1R2ZA 1C1KA 1Z5AA 2XH9A 3GLGB 1IN5A 3EIEA 5JI3E 4AKIA 1KYIA 2I7NA 3HGIA 5LMUM 2Y2JA 3L26A 3FTCA 1MU5A 3MHVC 1E9SA 3GLIA 2V1UA 2XD5A 4JI7M 2L7HA 2YFQA 1YE9A 3TWMA 5E26A 1YUEA 1SXJC 4A3VB 4L78A 4B7FA 3MK6A 4OW0A 5EQTA 3UZUA 3GPYA 5LMNM 1PJIA 2F5PA 2Y2KA 1IN7A 2Y2GA 5EP3A 1IN8A 4LF6M 1G8PA 2XLJA 4DV2M 4L16A 2CV0A 4MGZE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IBE A;  4GHL A;  4GH9 A;  3L27 A;  4IBB A;  4LG2 A;  4IBK A;  3L2A A;  3KS8 A;  4IBI A;  4IBD A;  3L26 A;  4IBG A;  3KS4 A;  3FKE A;  5BPV A;  4IBJ A;  4IBF A;  4IBC A;  4IJE A;  3L25 A;  3L29 A;  4IJF A;  4GHA A;  3L28 A; 
#chains in the Genus database with same CATH topology
 1T43 A;  5IRE B;  3AOE C;  1IM2 A;  2G8L A;  4II7 A;  3GQ3 A;  3M6A A;  2K47 A;  4G6Z A;  4R71 A;  3AJI B;  2NQ8 C;  2DI0 A;  3SYL A;  3L2A A;  4LJ5 A;  3U6Q A;  1K3W A;  2C98 A;  4MGY E;  3V76 A;  2E5L M;  4LGM A;  3MQL A;  4IBD A;  4GC9 A;  1Q3B A;  4ANR A;  4F1I A;  2XSZ D;  4TUW A;  1H8P A;  4JI1 M;  1W5T A;  4X62 M;  4FD2 A;  1PDC A;  3IEC A;  1V34 A;  3FRH A;  3AOG A;  3K92 A;  1AIP C;  1ORY B;  3CF6 E;  4B08 A;  1TH2 A;  5EP4 A;  1JR3 D;  2LTU A;  4LGY A;  4XK8 F;  3VDP A;  5DNY A;  4AQY M;  1XNQ M;  4LJ4 A;  3L25 A;  3B9P A;  3Q8X A;  1G71 A;  4JI4 M;  1KS0 A;  4LJ8 A;  2MR9 A;  2Z7J A;  2R45 A;  3K9O A;  1IXR C;  2YNM D;  1W5S A;  2DAG A;  1K82 A;  3KDS E;  5BR8 M;  3A42 A;  3WD2 A;  1DGG A;  3N3F A;  1TH3 A;  5FTN A;  1WHC A;  3SHG B;  3GPX A;  1L1T A;  2CHV A;  4LJ9 A;  5EP1 A;  5ITR A;  1IXS B;  2YR0 A;  3HSH A;  4IIW A;  1OAO C;  4OJ6 A;  1Z59 A;  4LZJ A;  5KQD A;  1R7R A;  4GC5 A;  4ZPX A;  3B7Z A;  2J5Y A;  3ZCB B;  1YU1 A;  2XEP A;  1GL6 A;  4NYY A;  2UUB M;  1T6O A;  1VEG A;  1GLN A;  3BXW A;  5KQ8 A;  3U5Z A;  1H0I A;  4K0K M;  3KFU G;  1UM8 A;  1ZQ9 A;  1EE8 A;  1XB2 B;  2CHQ A;  2VF8 A;  2W82 A;  4DR2 M;  1L1Z A;  2KNA A;  3GO8 A;  4R3D A;  1N32 M;  1W1V A;  1VEJ A;  3FRI A;  3U61 B;  2EJS A;  1E9R A;  4W5W A;  4D81 A;  2UWX A;  1R2Y A;  1W1T A;  4AZF A;  1YU4 A;  1N34 M;  3HHW A;  4FVM A;  4GKK M;  3GLH E;  4JV5 M;  3U6O A;  2QEN A;  2OO9 A;  2VDB B;  2VII A;  4IBK A;  4LFC M;  4HL4 A;  2C9C A;  1ZMV A;  2KEB A;  4GIP A;  3SAT A;  2D49 A;  2XZU A;  3A46 A;  3SAV A;  4P16 A;  2R4E A;  2HCB A;  2ZTC A;  3HWS A;  4L8R C;  2LNH C;  4X65 M;  4I81 A;  4B3T M;  3SC3 A;  1YUB A;  3GPU A;  1NVM A;  1N33 M;  2EA0 A;  3LCU A;  4MM3 B;  3FUV A;  3UGJ A;  1QZM A;  3WX7 A;  4RKU F;  4KO8 A;  3LCV B;  3FTF A;  3LQQ A;  1XWI A;  3THG A;  1L6J A;  3MMP A;  4B3M M;  1XNR M;  2DVW B;  4LRT A;  3TWK A;  2Y2M A;  4PDI A;  4G3O A;  4CIS A;  4NRW A;  1IN4 A;  2N35 A;  4WP2 A;  2OOA A;  4DUZ M;  2RRU A;  1IY2 A;  1JR3 A;  4KT0 F;  3LMM A;  1TF0 B;  3HU2 A;  3WD3 A;  4BB9 A;  4YHH M;  3GLF A;  3I04 M;  2D7E A;  1NSF A;  2JZ0 A;  2L2D A;  4LF5 M;  1DGH A;  3CTW B;  3KOX E;  5EXX A;  4LF9 M;  1Q02 A;  3BBZ A;  4Z2J A;  1G3I A;  3C3D A;  2OOB A;  3KOZ E;  4M0W A;  3FTD A;  4LZZ A;  4OU7 A;  3TE6 A;  2Y2N A;  4PCZ A;  4DR3 M;  1QDR A;  3U61 A;  2Y2H A;  4PD2 A;  4JYA M;  3B74 A;  4CJ6 A;  1N77 A;  1SG9 A;  2JXN A;  2Y21 A;  1T3T A;  4QOS A;  3K2L A;  2A5Y B;  2L6O A;  2JY6 B;  1WGN A;  2ZAO A;  1YU3 A;  2R62 A;  3ILK A;  3SAW A;  1DO2 A;  1HQY E;  2UUC M;  1GAB A;  1ED7 A;  2FOI C;  2ZTD A;  3KOY E;  3SYK A;  2Y2O A;  4LF8 M;  4MGI E;  1XHB A;  3QWL A;  3PNY A;  4MGK E;  4RF0 A;  3UK6 A;  2XGN A;  4NOO B;  2QSF X;  1IY1 A;  3HX3 A;  2Y2P A;  1DGF A;  3FYD A;  3GLH B;  5L8R F;  4QHS A;  3VK7 A;  3WHL A;  4ITQ A;  2M60 A;  3A98 B;  5ITY A;  1XXH A;  3KVW A;  2DWM A;  4G4O A;  3WD4 A;  4JI5 M;  3W0F A;  2DWL A;  2BNK A;  2Y20 A;  3NBI A;  2O25 A;  4LJ6 A;  5A2Q S;  2VQF M;  1TH4 A;  3SFZ A;  1E88 A;  3J81 S;  4YY3 M;  3GLF B;  1NNJ A;  4DV5 M;  2BWE A;  4GH9 A;  3J7B A;  5DYG A;  2FS1 A;  4Z2K A;  2Z3X A;  3AV0 A;  2Z4R A;  3KS8 A;  4B3R M;  4FCV A;  3DOA A;  4G4N A;  3TPZ A;  3E9S A;  8CAT A;  1WXQ A;  2WSC F;  4NRV A;  4QNR A;  5DFL A;  1GO5 A;  1GOI A;  2RKO A;  4B3S M;  4AKH A;  1QZE A;  3ZQJ A;  1E94 E;  3RGP A;  3HJ8 A;  2LVA A;  3AOE A;  1IN6 A;  1J7K A;  4G4Q A;  3U6C A;  3E46 A;  3HU1 A;  3F92 A;  4GHA A;  1CXW A;  1OIP A;  2DZN B;  2G3Q A;  1PJQ A;  2BJV A;  1OIZ A;  1DO0 A;  5DYI A;  4CGY B;  3KOW E;  4LRS A;  1GL7 A;  4CHT B;  4I5S A;  2OPF A;  3U6S A;  3C9P A;  2GQF A;  3T38 A;  3U6P A;  5KPR A;  1PM5 A;  2APL A;  4NY2 A;  1PJT A;  3CF2 A;  3GLH A;  4AI6 A;  4WUR A;  2XFS A;  7CAT A;  3I51 A;  3I01 M;  1GPF A;  1BVS A;  1VEK A;  1EFU B;  2LVP C;  4DR5 M;  5IT9 S;  3C58 A;  4LF7 M;  3VKH A;  4LJA A;  4JI2 M;  3GRV A;  2F5S A;  1O6I A;  4GMQ A;  1IQP A;  2R65 A;  2X49 A;  4Z6Y A;  2FFF B;  1IFY A;  1I94 M;  3SMP A;  3IG8 A;  2LH0 A;  1QYR A;  1GJT A;  2KZS A;  2V1C A;  2XSZ A;  4JN6 A;  4NSR A;  3QYE A;  3GPP A;  3T1Y M;  2UUA M;  1E6N A;  4DV7 M;  1QAM A;  4LFA M;  3SAU A;  3U6M A;  2F5O A;  1G59 A;  2CUZ A;  2JA2 A;  2VF7 A;  2O01 F;  3M0E A;  1N78 A;  3JR4 A;  1K3X A;  2FFJ A;  3JR5 A;  5EXS A;  1TDZ A;  1IXZ A;  1WIV A;  4B7H A;  4XBO A;  4KHP M;  1YLA A;  1OFH A;  4FCT A;  3FUX A;  2K6B A;  2Z4S A;  1OJL A;  1J5E M;  1DV0 A;  1MJG M;  4G4R A;  1E6P A;  1NJG A;  1E8B A;  3BOS A;  4GEW A;  3R8F A;  3TQS A;  4DUY M;  3VFD A;  3FE3 A;  4NC6 A;  1PJS A;  3FYC A;  4AG6 A;  4FCW A;  4IBC A;  3B89 A;  5FSW A;  3VK8 A;  2MRO B;  1Z5B A;  2FNA A;  2CP8 A;  2WSF F;  3L29 A;  4I4L A;  4IJF A;  5C18 A;  4DR4 M;  1NHW C;  1C7Y A;  1NJF A;  3CF0 A;  2G5G X;  1HT1 E;  2QBY B;  2EO2 A;  2MGW A;  5FTM A;  3HHY A;  4GHL A;  1FJG M;  1VQ1 A;  2QQ8 A;  1OAI A;  1H6U A;  2KHH A;  4M9Z A;  2R46 A;  4RNA A;  1HR0 M;  3L27 A;  1ZMU A;  1XC8 A;  3Q8G A;  3SAS A;  1NO1 A;  2DAK A;  1XXH E;  3J27 B;  1OTR A;  1EIJ A;  2Y0T A;  1YU2 A;  1JR3 E;  4NL4 H;  1R4G A;  1ZAE A;  2JE5 A;  1TTE A;  2F4V M;  3B7Q A;  3GRU A;  4OUI A;  2ZM6 M;  3WHK A;  3VDU A;  2RTS A;  4NZ3 A;  3ZH9 B;  2KNV A;  3U6D A;  5IZ7 D;  2UU9 M;  3UJN A;  2D7G A;  4BBA A;  2R0I A;  1V33 A;  2I7P A;  3D8B A;  4FW9 A;  4LJ7 A;  4Z8X A;  1KFV A;  2LXE A;  4AG5 A;  1FNN A;  3GP1 A;  1OGG A;  4Z2G A;  1QAO A;  2M5Z A;  4MGH A;  2K0B X;  3GLG A;  1P3Q Q;  1OQY A;  2LBC A;  4FWG A;  4L4U A;  3GLI E;  3FUW A;  1HQC A;  2L09 A;  3E21 A;  5ITQ A;  1NHG C;  2Z8Y M;  2UXD M;  2HL7 A;  3IG5 A;  1H0G A;  1Q39 A;  4DV3 M;  1R6B X;  1G41 A;  3AKZ A;  2J7N A;  5GKN A;  2DHR A;  3QYB A;  2DXI A;  3HHX A;  3KSJ A;  4EIW A;  2J7O A;  2F5N A;  3OTO M;  2OQ4 A;  1NNU C;  1UFZ A;  1OKS A;  4MB7 A;  4P17 A;  3K8Z A;  3LQR A;  2BWB A;  4M9X A;  3JAM S;  3FKE A;  3KXE C;  5FLX S;  4DV1 M;  2JZ1 A;  1Z5C A;  4NXM M;  2P5T A;  1D0L A;  1TDH A;  2CEA A;  3HZJ A;  2ERC A;  4GRI A;  4MB4 A;  4NXN M;  5IWA M;  3GLF E;  2FE8 A;  3RGS A;  4BLC A;  1WGL A;  3AFH A;  4I8O A;  3VKG A;  1V92 A;  1NY6 A;  4GIT A;  3J80 S;  5EXT A;  3FD9 A;  1KSF X;  3H4M A;  4OVZ A;  4HEO A;  2MJ5 B;  2DHY A;  5EXP A;  1AUA A;  4NZ5 A;  2KXE A;  4M0D A;  1J7M A;  1WJ7 A;  2KNZ A;  3I4Y A;  3W67 A;  2BJW A;  2DAE A;  3CGW A;  5C1B A;  1Q3C A;  5ITU A;  2KZU A;  3W68 A;  1HNX M;  2LVN C;  1NV8 A;  4X66 M;  2Q2E B;  1MX0 A;  2DWZ B;  4DV6 M;  4TX8 A;  1E32 A;  3UMM A;  4GKJ M;  4D82 A;  2Y2I A;  3KS4 A;  4LFB M;  3W0L B;  3FUU A;  1QQW A;  4S12 A;  3RE8 A;  3VLF B;  1VDL A;  2CE7 A;  4IBJ A;  1SXJ B;  3SHF A;  2KRU A;  3U6E A;  4OX9 M;  1CK7 A;  1GXD A;  4R7G A;  4IJE A;  1JQJ C;  1SXJ D;  2KRK A;  4MH0 E;  3C3E A;  2DKL A;  3HU3 A;  5EJC A;  4JI0 M;  2LVQ D;  2EKF A;  1QAQ A;  2R4J A;  2X8A A;  1L8Q A;  3HJS A;  3LVV A;  2LHC A;  3DA1 A;  3AL0 C;  5F3W A;  1AIW A;  2Y0Q A;  2O5R A;  2CRU A;  1HNW M;  1LV7 A;  4HMD A;  2B3T A;  3ZC7 B;  3R9X B;  4LG2 A;  2HWJ A;  2C9O A;  2L4E A;  2WSE F;  2QBY A;  2QPA A;  3T15 A;  3SMS A;  2HKJ A;  2DZO B;  5H37 D;  4DV0 M;  1N75 A;  2DWN A;  3LVW A;  4IBG A;  2Y2L A;  3U5Z B;  1VDD A;  1QVR A;  1HJP A;  3GRY A;  3FTE A;  5KO3 A;  1DGB A;  1GKI A;  5BPV A;  4PT5 A;  2YQZ A;  3M7G A;  3HJQ A;  1I4W A;  2CWB A;  2RGH A;  4OJ5 A;  2V5O A;  2DAI A;  2KDL A;  5ITX A;  4XGI A;  4QHT A;  1VG5 A;  1E6R A;  1L2C A;  3HON A;  4JXJ A;  4WW0 A;  4REZ A;  1IBK M;  2JNH A;  2MH8 A;  2R18 A;  2C5R A;  5KPZ A;  1PGY A;  1RU3 A;  3DFZ A;  2L7I A;  5EP2 A;  1XMQ M;  4HME A;  4MB5 A;  1HT2 E;  1SXJ E;  3PNV A;  1MN3 A;  1OGB A;  2C99 A;  1QAN A;  2ZBK B;  4QNL A;  4IBI A;  2L4F A;  3B7N A;  1SXJ A;  3GQ4 A;  3T1H M;  3NWL A;  3SBJ A;  4OJL A;  1OFI A;  4Z2L A;  3GRR A;  1L2D A;  1IBM M;  3EIH A;  2EUC A;  3I4V A;  3WD1 A;  1GVN A;  3E4R A;  3PXG A;  2JWS A;  4IBF A;  4FWH A;  2CHG A;  1F4I A;  4X64 M;  4NYU A;  3U60 B;  2JY8 A;  2K9D A;  3TL4 X;  2D7H A;  4L15 A;  1NV9 A;  5KPT A;  5JI2 E;  1QDT A;  3RFW A;  2HHH M;  1NY5 A;  1A5T A;  4MB3 A;  3HKP A;  1EAK A;  4DV4 M;  1IY0 A;  2XD1 A;  1QUT A;  5ITT A;  2IOU A;  1G4A E;  5FTJ A;  2VQE M;  5FTL A;  4OJP A;  4Z2H A;  2KW0 A;  2ZAM A;  1WR1 B;  2Y2Q A;  1CUK A;  3FUT A;  2JP7 A;  1DGH B;  1XMO M;  2ZAN A;  4IBB A;  4OVZ B;  2BG1 A;  2LVO C;  2CV1 A;  4F2L A;  1HNZ M;  4L6V 6;  2XZF A;  3MJ5 A;  2DNA A;  4KLN A;  5E6J A;  4OJO A;  2RGO A;  1L2B A;  1J09 A;  1YSY A;  2C96 A;  2LHG A;  3KSX A;  4Y28 F;  1E6Z A;  1LTM A;  4D80 A;  2WZJ A;  2QP9 X;  3SAR A;  3J2P B;  4KOD A;  4NZ1 A;  2X4A A;  3GLI B;  2GNO A;  4Q7J A;  3H4J A;  3U6L A;  3WD0 A;  1IBL M;  4QOZ C;  2FH0 A;  3PVS A;  2V6Z M;  4LY6 A;  2JY7 A;  2KA6 B;  1D0M A;  3KW6 A;  3A45 A;  1X37 A;  2EKK A;  4NSO B;  3IHP A;  1W1P A;  4IBE A;  1N36 M;  4LF4 M;  2XF3 A;  1E15 A;  2AHM A;  3QAU A;  5FTK A;  4UN2 B;  1Y8G A;  3HY5 A;  1S3S A;  4DV2 M;  4JI6 M;  5ITX E;  4LCB A;  3KP1 E;  4AW4 A;  3M7P A;  2UXB M;  2JY5 A;  2H1R A;  3U60 A;  1Z6T A;  4HLQ A;  1XXH B;  4FWD A;  4HMC A;  3TWL A;  2CFO A;  1TGU A;  3DZD A;  4PDG A;  4DR1 M;  2F5Q A;  3D8L A;  2QZ4 A;  4DR7 M;  2CV2 A;  3KP0 E;  2QNJ A;  4CIZ A;  2LWX A;  1QO6 A;  3HHZ A;  1D2N A;  1JB0 F;  2XFT A;  3K1J A;  3T6P A;  3GQ5 A;  4DBG B;  4AKG A;  1ZMW A;  4QNM A;  2DEN A;  3L28 A;  3NBX X;  2QCU A;  4M9S A;  4JI8 M;  4B7G A;  4RF1 A;  1UR8 A;  3LW5 F;  1PJJ A;  4DR6 M;  4Z2I A;  3J7A S;  2UXC M;  1YU0 A;  4NZ4 A;  2JCH A;  3PFI A;  1D0K A;  4JI3 M;  1R2Z A;  1C1K A;  1Z5A A;  2XH9 A;  1GJS A;  3GLG B;  1IN5 A;  3EIE A;  5JI3 E;  4AKI A;  1KYI A;  1PRB A;  2I7N A;  3HGI A;  5LMU M;  2FN2 A;  2Y2J A;  3L26 A;  3FTC A;  1UR9 A;  2HAK A;  1W1Y A;  1MU5 A;  3MHV C;  1E9S A;  2R6F A;  3GLI A;  3GLG E;  2V1U A;  2H5X A;  2XD5 A;  4JI7 M;  1IXS A;  2L7H A;  2YFQ A;  2QHO B;  1YE9 A;  3TWM A;  5E26 A;  1YUE A;  2DAM A;  1SXJ C;  4A3V B;  4L78 A;  4B7F A;  1ZV1 A;  3MK6 A;  4OW0 A;  3K9P A;  5EQT A;  3UZU A;  3GPY A;  5LMN M;  1PJI A;  1IN7 A;  2F5P A;  2Y2K A;  5EP3 A;  2Y2G A;  1IN8 A;  1TR8 A;  2DZL A;  4LF6 M;  2JUJ A;  2R44 A;  1G8P A;  1QUS A;  2XLJ A;  4L16 A;  2CV0 A;  1R5L A;  4MGZ E; 
#chains in the Genus database with same CATH homology
 5IRE B;  3AOE C;  1IM2 A;  2G8L A;  4II7 A;  3GQ3 A;  3M6A A;  2K47 A;  4G6Z A;  3AJI B;  2NQ8 C;  3SYL A;  3U6Q A;  3L2A A;  4LJ5 A;  1K3W A;  2C98 A;  4MGY E;  2E5L M;  4LGM A;  4IBD A;  4GC9 A;  1Q3B A;  2XSZ D;  4TUW A;  4JI1 M;  1W5T A;  4X62 M;  4FD2 A;  3AOG A;  3K92 A;  1ORY B;  3CF6 E;  4B08 A;  1TH2 A;  5EP4 A;  1JR3 D;  3L25 A;  4LGY A;  3VDP A;  5DNY A;  1XNQ M;  4AQY M;  4LJ4 A;  3B9P A;  3Q8X A;  4JI4 M;  4LJ8 A;  2Z7J A;  2R45 A;  1IXR C;  2YNM D;  1W5S A;  1K82 A;  3KDS E;  5BR8 M;  3A42 A;  1DGG A;  3N3F A;  1TH3 A;  5FTN A;  1L1T A;  3SHG B;  3GPX A;  2CHV A;  4LJ9 A;  5EP1 A;  5ITR A;  1IXS B;  2YR0 A;  3HSH A;  4IIW A;  4OJ6 A;  1Z59 A;  4LZJ A;  5KQD A;  1R7R A;  4GC5 A;  4ZPX A;  3ZCB B;  1YU1 A;  2XEP A;  1GL6 A;  4NYY A;  2UUB M;  1GLN A;  5KQ8 A;  3U5Z A;  4K0K M;  3KFU G;  1UM8 A;  1ZQ9 A;  1EE8 A;  2CHQ A;  2W82 A;  4DR2 M;  1L1Z A;  3GO8 A;  4R3D A;  1N32 M;  3U61 B;  1E9R A;  4W5W A;  4D81 A;  2UWX A;  1R2Y A;  1YU4 A;  4AZF A;  1N34 M;  3HHW A;  4FVM A;  4GKK M;  4JV5 M;  3U6O A;  2QEN A;  2VII A;  4LFC M;  4IBK A;  4HL4 A;  2C9C A;  2KEB A;  4GIP A;  3SAT A;  2XZU A;  3A46 A;  3SAV A;  4P16 A;  2R4E A;  2HCB A;  3HWS A;  4L8R C;  2LNH C;  4X65 M;  4I81 A;  4B3T M;  3SC3 A;  1YUB A;  3GPU A;  1NVM A;  1N33 M;  2EA0 A;  3WX7 A;  4MM3 B;  3FUV A;  3UGJ A;  1QZM A;  3FTF A;  4KO8 A;  3LQQ A;  1XWI A;  3THG A;  4B3M M;  1XNR M;  2DVW B;  4LRT A;  3TWK A;  2Y2M A;  4PDI A;  4CIS A;  4NRW A;  1IN4 A;  4DUZ M;  1IY2 A;  1JR3 A;  3LMM A;  3HU2 A;  4BB9 A;  4YHH M;  3GLF A;  2D7E A;  1NSF A;  4LF5 M;  1DGH A;  3CTW B;  3KOX E;  5EXX A;  4LF9 M;  1G3I A;  3KOZ E;  4M0W A;  4LZZ A;  4OU7 A;  3FTD A;  2Y2N A;  3TE6 A;  4PCZ A;  4DR3 M;  3U61 A;  2Y2H A;  4PD2 A;  4JYA M;  1N77 A;  2Y21 A;  1T3T A;  4QOS A;  3K2L A;  2A5Y B;  2L6O A;  2ZAO A;  1YU3 A;  2R62 A;  3ILK A;  3SAW A;  1DO2 A;  1HQY E;  2UUC M;  2FOI C;  3KOY E;  3SYK A;  2Y2O A;  4LF8 M;  4MGI E;  1XHB A;  3QWL A;  3PNY A;  4MGK E;  4RF0 A;  3UK6 A;  2XGN A;  4NOO B;  1IY1 A;  2Y2P A;  1DGF A;  3FYD A;  3GLH B;  4QHS A;  3VK7 A;  3WHL A;  4ITQ A;  2M60 A;  3A98 B;  5ITY A;  1XXH A;  3KVW A;  4G4O A;  4JI5 M;  3W0F A;  2DWL A;  2BNK A;  2Y20 A;  3NBI A;  4LJ6 A;  5A2Q S;  2VQF M;  1TH4 A;  3SFZ A;  3J81 S;  4YY3 M;  3GLF B;  1NNJ A;  4DV5 M;  4GH9 A;  3J7B A;  5DYG A;  2Z3X A;  3AV0 A;  2Z4R A;  3KS8 A;  4B3R M;  4FCV A;  3DOA A;  4G4N A;  3TPZ A;  3E9S A;  8CAT A;  1WXQ A;  4NRV A;  4QNR A;  2RKO A;  4B3S M;  4AKH A;  1E94 E;  3RGP A;  3HJ8 A;  3AOE A;  1IN6 A;  1J7K A;  4G4Q A;  3U6C A;  3HU1 A;  4GHA A;  2DZN B;  2BJV A;  1DO0 A;  5DYI A;  4CGY B;  3KOW E;  4LRS A;  1GL7 A;  4CHT B;  4I5S A;  2OPF A;  3U6S A;  3T38 A;  3U6P A;  5KPR A;  1PM5 A;  4NY2 A;  3CF2 A;  3GLH A;  4AI6 A;  4WUR A;  2XFS A;  7CAT A;  3I51 A;  5IT9 S;  4DR5 M;  3C58 A;  4LF7 M;  3VKH A;  4LJA A;  4JI2 M;  3GRV A;  2F5S A;  4GMQ A;  1IQP A;  2R65 A;  2X49 A;  4Z6Y A;  1I94 M;  3SMP A;  3IG8 A;  2LH0 A;  1QYR A;  2KZS A;  2XSZ A;  2V1C A;  4JN6 A;  4NSR A;  3GPP A;  3T1Y M;  2UUA M;  4DV7 M;  1QAM A;  4LFA M;  3SAU A;  3U6M A;  2F5O A;  1G59 A;  2CUZ A;  2JA2 A;  3M0E A;  1N78 A;  3JR4 A;  1K3X A;  2FFJ A;  3JR5 A;  5EXS A;  1TDZ A;  1IXZ A;  4B7H A;  4KHP M;  4XBO A;  4FCT A;  1OFH A;  3FUX A;  2Z4S A;  1OJL A;  1J5E M;  4G4R A;  1NJG A;  3BOS A;  3R8F A;  3TQS A;  4DUY M;  3VFD A;  3FYC A;  4AG6 A;  4FCW A;  4IBC A;  5FSW A;  3VK8 A;  1Z5B A;  2FNA A;  4DR4 M;  3L29 A;  4I4L A;  4IJF A;  5C18 A;  1NHW C;  1NJF A;  3CF0 A;  2G5G X;  1HT1 E;  2QBY B;  2EO2 A;  5FTM A;  3HHY A;  4GHL A;  1FJG M;  4M9Z A;  1HR0 M;  1H6U A;  2R46 A;  4RNA A;  3L27 A;  1XC8 A;  3SAS A;  3J27 B;  2Y0T A;  1YU2 A;  4NL4 H;  1ZAE A;  2JE5 A;  2F4V M;  3GRU A;  4OUI A;  2ZM6 M;  3WHK A;  3VDU A;  4NZ3 A;  3ZH9 B;  3U6D A;  5IZ7 D;  2UU9 M;  3UJN A;  2D7G A;  4BBA A;  3D8B A;  2I7P A;  4FW9 A;  4LJ7 A;  4Z8X A;  1KFV A;  2LXE A;  4AG5 A;  1FNN A;  3GP1 A;  1QAO A;  2M5Z A;  4MGH A;  3GLG A;  4L4U A;  4FWG A;  3FUW A;  1HQC A;  2L09 A;  5ITQ A;  1NHG C;  2UXD M;  2HL7 A;  3IG5 A;  1Q39 A;  4DV3 M;  1R6B X;  1G41 A;  3AKZ A;  2J7N A;  5GKN A;  2DHR A;  2DXI A;  3HHX A;  3KSJ A;  4EIW A;  2J7O A;  2F5N A;  3OTO M;  2OQ4 A;  1NNU C;  4MB7 A;  2DWM A;  3K8Z A;  3LQR A;  4M9X A;  3JAM S;  5FLX S;  3FKE A;  3KXE C;  4DV1 M;  2FFF B;  1Z5C A;  4NXM M;  2P5T A;  1TDH A;  2CEA A;  4GRI A;  2ERC A;  4NXN M;  5IWA M;  2FE8 A;  3RGS A;  4BLC A;  3AFH A;  4I8O A;  3VKG A;  4GIT A;  1NY6 A;  3J80 S;  5EXT A;  3FD9 A;  1KSF X;  3H4M A;  4OVZ A;  5EXP A;  4NZ5 A;  2KXE A;  4M0D A;  3I4Y A;  2BJW A;  5C1B A;  1Q3C A;  5ITU A;  2KZU A;  1HNX M;  4DV6 M;  4X66 M;  2Q2E B;  1MX0 A;  2DWZ B;  1E32 A;  3UMM A;  4GKJ M;  4D82 A;  2Y2I A;  3KS4 A;  4LFB M;  3W0L B;  3FUU A;  1QQW A;  4S12 A;  3RE8 A;  3VLF B;  2CE7 A;  4IBJ A;  1SXJ B;  3SHF A;  2KRU A;  3U6E A;  4OX9 M;  4R7G A;  4IJE A;  1JQJ C;  1SXJ D;  2KRK A;  4MH0 E;  3HU3 A;  5EJC A;  4JI0 M;  1QAQ A;  2R4J A;  2X8A A;  1L8Q A;  3HJS A;  3LVV A;  3AL0 C;  3DA1 A;  5F3W A;  2Y0Q A;  2O5R A;  1HNW M;  1LV7 A;  3ZC7 B;  3R9X B;  4LG2 A;  2C9O A;  2QBY A;  2QPA A;  3T15 A;  3SMS A;  2HKJ A;  2DZO B;  5H37 D;  4DV0 M;  1N75 A;  2DWN A;  3LVW A;  4IBG A;  2Y2L A;  3U5Z B;  1VDD A;  1QVR A;  3GRY A;  3FTE A;  5KO3 A;  1DGB A;  1GKI A;  5BPV A;  4PT5 A;  2YQZ A;  3M7G A;  3HJQ A;  1I4W A;  2RGH A;  4OJ5 A;  5ITX A;  4XGI A;  4QHT A;  1L2C A;  3HON A;  4JXJ A;  4WW0 A;  4REZ A;  1IBK M;  2R18 A;  2C5R A;  5KPZ A;  3DFZ A;  5EP2 A;  1XMQ M;  2L7I A;  1HT2 E;  1SXJ E;  3PNV A;  2C99 A;  1QAN A;  2ZBK B;  4QNL A;  4IBI A;  1SXJ A;  3GQ4 A;  3T1H M;  3NWL A;  3SBJ A;  4OJL A;  1OFI A;  3GRR A;  1L2D A;  1IBM M;  3EIH A;  2EUC A;  3I4V A;  1GVN A;  3E4R A;  3PXG A;  4IBF A;  4FWH A;  2CHG A;  4X64 M;  4NYU A;  3U60 B;  3TL4 X;  2D7H A;  4L15 A;  5KPT A;  5JI2 E;  3RFW A;  2HHH M;  1NY5 A;  3HKP A;  4DV4 M;  1IY0 A;  2XD1 A;  5ITT A;  2IOU A;  1G4A E;  5FTJ A;  2VQE M;  5FTL A;  4OJP A;  2KW0 A;  2ZAM A;  2Y2Q A;  3FUT A;  1DGH B;  1XMO M;  2ZAN A;  4IBB A;  4OVZ B;  2BG1 A;  2CV1 A;  1HNZ M;  2XZF A;  3MJ5 A;  4KLN A;  5E6J A;  4OJO A;  2RGO A;  1L2B A;  1J09 A;  1YSY A;  2C96 A;  3KSX A;  4D80 A;  2QP9 X;  3SAR A;  3J2P B;  4KOD A;  4NZ1 A;  2X4A A;  3GLI B;  3U6L A;  1IBL M;  4QOZ C;  3PVS A;  2V6Z M;  4LY6 A;  2KA6 B;  3KW6 A;  3A45 A;  1X37 A;  4NSO B;  4IBE A;  1N36 M;  4LF4 M;  2XF3 A;  2AHM A;  3QAU A;  5FTK A;  4JI6 M;  1S3S A;  5ITX E;  4LCB A;  3KP1 E;  4AW4 A;  2UXB M;  2H1R A;  3U60 A;  1Z6T A;  4HLQ A;  1XXH B;  4FWD A;  3TWL A;  2CFO A;  1TGU A;  3DZD A;  4PDG A;  4DR1 M;  2F5Q A;  3D8L A;  2QZ4 A;  4DR7 M;  2CV2 A;  3KP0 E;  2LWX A;  3HHZ A;  1D2N A;  2XFT A;  3K1J A;  3GQ5 A;  4AKG A;  4QNM A;  3L28 A;  2QCU A;  4M9S A;  4JI8 M;  4B7G A;  4RF1 A;  1PJJ A;  4DR6 M;  3J7A S;  2UXC M;  1YU0 A;  4NZ4 A;  2JCH A;  3PFI A;  4JI3 M;  1R2Z A;  1C1K A;  1Z5A A;  2XH9 A;  3GLG B;  1IN5 A;  3EIE A;  5JI3 E;  4AKI A;  1KYI A;  2I7N A;  3HGI A;  5LMU M;  2Y2J A;  3L26 A;  3FTC A;  1MU5 A;  3MHV C;  1E9S A;  3GLI A;  2V1U A;  2XD5 A;  4JI7 M;  2L7H A;  2YFQ A;  1YE9 A;  3TWM A;  5E26 A;  1YUE A;  1SXJ C;  4A3V B;  4L78 A;  4B7F A;  3MK6 A;  4OW0 A;  5EQT A;  3UZU A;  3GPY A;  5LMN M;  1PJI A;  2F5P A;  2Y2K A;  1IN7 A;  2Y2G A;  5EP3 A;  1IN8 A;  4LF6 M;  1G8P A;  2XLJ A;  4DV2 M;  4L16 A;  2CV0 A;  4MGZ E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...