4IBBA

Ebola virus vp35 bound to small molecule
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
123
structure length
123
Chain Sequence
b'DISAKDLRNIMYDHLPGFGTAFHQLVQVICKLGKDSNSLDIIHAEFQASLAEGDSPQCALIQITKRVPIFQDAAPPVIHIRSRGDIPRACQKSLRPVPPSPKIDRGWVCVFQLQDGKTLGLKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Polymerase cofactor VP35
publication title In Silico Derived Small Molecules Bind the Filovirus VP35 Protein and Inhibit Its Polymerase Cofactor Activity.
pubmed doi rcsb
source organism Ebola virus
molecule tags Transcription/transcription inhibitor
total genus 42
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-12-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.950 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4ibbA01
2.10.10.70 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 4ibbA02
4IJFA 4GH9A 3L28A 4IBDA 4GHAA 4IBBA 4IBFA 3FKEA 3L25A 4LG2A 3L29A 3L27A 4IBKA 4IBIA 4IJEA 3L26A 3L2AA 4IBEA 4GHLA 3KS4A 4IBJA 4IBGA 5BPVA 3KS8A 4IBCA
chains in the Genus database with same CATH superfamily
5JI2E 2KZUA 2ZAMA 1D0KA 2EKKA 2R44A 1Q3BA 2G8LA 2LTUA 1OFHA 3I51A 4LJAA 5A2QS 2XLJA 1VG5A 3GP1A 1WR1B 5FSWA 3PNVA 1MU5A 1YUBA 2FN2A 1XB2B 1IBLM 4LF6M 5ITXE 4AZFA 2BWEA 2KHHA 1XXHA 4LG2A 2QP9X 5EP4A 1XMQM 2V1UA 4B3MM 2LHCA 1PJSA 2CHVA 2JWSA 1J09A 3K1JA 3CF6E 3SMPA 4LF9M 4FCVA 1VDDA 3FD9A 1KYIA 3GLIB 4CISA 4D80A 4NYYA 3IHPA 4LY6A 1UM8A 4NY2A 1DGHB 2Z4RA 1GKIA 2A5YB 3LCVB 4F2LA 1GPFA 4OVZA 2BNKA 1ZMVA 5EQTA 3HKPA 3VDPA 4DV1M 4GMQA 1R2YA 3K2LA 4WURA 1VDLA 4L4UA 3VFDA 3VK7A 2XSZA 2FOIC 4YHHM 1I94M 1QYRA 2F5PA 2QBYB 4IBFA 1XNQM 1XXHE 1AIWA 3KOXE 1E6NA 3HJQA 4LJ7A 4DUZM 3SAVA 1L2BA 1D0MA 3AOGA 1R5LA 2P5TA 2R0IA 4RF0A 2ZTCA 4G4NA 4CHTB 3H4MA 2CHGA 3U6OA 3HU1A 2IOUA 3KVWA 3PVSA 2EKFA 5ITUA 3ZH9B 4AKHA 4LF7M 1Z6TA 2Y2NA 1AUAA 1Z5AA 2VQEM 2N35A 1FNNA 4LRSA 1R6BX 5L8RF 3UMMA 1QUTA 2CHQA 3RFWA 2Y2QA 1L8QA 3A46A 4R7GA 3PXGA 5JI3E 1VQ1A 2VF7A 2CWBA 3KSJA 1EAKA 2WSEF 4DR3M 4QNMA 1E8BA 5KPZA 1GOIA 3THGA 1PDCA 3KDSE 3E9SA 1S3SA 1IN7A 5KQ8A 2XF3A 3HX3A 5KPRA 4JI0M 5EXSA 2LBCA 4LJ5A 3SC3A 1H6UA 3LQRA 3VLFB 4QOSA 1SXJE 2K0BX 3U61B 2KZSA 1KS0A 4I4LA 2M60A 4DR2M 3I01M 4M9ZA 1IN4A 2R4EA 3FUXA 3U6DA 1QZEA 3LW5F 5EP1A 3WD2A 2K6BA 3FUVA 4JYAM 2LVNC 4TUWA 4FWGA 4IBGA 2KA6B 1IM2A 2Y2GA 3LVWA 1E15A 1E32A 2R62A 2JY6B 3GPXA 3KFUG 2LVAA 2CV0A 1PJTA 2Y2KA 2XFSA 1HT1E 3SAWA 1OJLA 3IG8A 1V34A 2RKOA 4Z6YA 3TL4X 5C18A 1G8PA 3C9PA 2QCUA 1GL7A 2QENA 2V6ZM 5FTLA 4NL4H 4DR5M 2QPAA 4NRVA 1MN3A 1V92A 1QAQA 2RGOA 3IECA 1E6RA 4OW0A 2DXIA 2H1RA 1NV9A 1NY5A 1XC8A 4K0KM 4DUYM 4IJEA 4KO8A 4P17A 3VKGA 3K92A 4L15A 3KW6A 2JCHA 3AKZA 2YFQA 4Z2GA 2QNJA 1FJGM 1PJQA 3KXEC 4AW4A 2DWZB 3T15A 1ZMUA 3IG5A 4JI6M 1Q3CA 1SXJB 1PGYA 2WSFF 3GQ3A 1MJGM 1TTEA 4LJ6A 1IY1A 5IZ7D 1WGNA 1DO0A 4CIZA 1N33M 2ZBKB 4KODA 2Y2PA 4DR1M 1DO2A 2OOAA 3FTCA 3TWKA 4NZ5A 1OTRA 3GLFA 2C9OA 2R46A 3FKEA 1GL6A 3LVVA 4X66M 5FTNA 2R4JA 4A3VB 5EP2A 1IN8A 1CXWA 1WGLA 2LVOC 2JE5A 1OGGA 2X49A 2EUCA 3C58A 4OX9M 5IT9S 4GHLA 4HL4A 4NXMM 2Z7JA 2KEBA 2JA2A 3FYDA 3SARA 1YE9A 4ZPXA 1LTMA 1ZAEA 2MH8A 1P3QQ 5DYIA 2DAGA 1IY2A 4I81A 3ZC7B 3KS8A 5KO3A 3GLHA 3TPZA 2CFOA 3LQQA 3M6AA 3T6PA 4FCWA 2DAIA 1H0GA 1UR8A 3U60B 3GPYA 3GPUA 3KSXA 1HNXM 3AOEC 2EJSA 4IBDA 2BG1A 4PT5A 4HMCA 1QUSA 2DHRA 1ZQ9A 3GPPA 1K3XA 1GO5A 1JR3A 4LZJA 1G4AE 3HGIA 4JI3M 3U5ZB 1TH3A 4LF4M 1YUEA 1NO1A 4AQYM 5FLXS 2VQFM 3B74A 2Z8YM 3VDUA 4OUIA 3Q8XA 4MB4A 1CK7A 2Y2JA 3U6MA 1UR9A 2DWMA 1VEKA 4IBEA 7CATA 3UK6A 3CGWA 1XMOM 2CUZA 1TH2A 4B7GA 2VIIA 3EIHA 3PNYA 2CE7A 1TDZA 1KSFX 2QHOB 4DV2M 1GVNA 4OJOA 1HR0M 4Z2JA 2Y21A 3J81S 3ILKA 2CRUA 1E9RA 3KOZE 4KT0F 4S12A 2E5LM 3L28A 3WD1A 3NBXX 2R65A 3W67A 2C98A 3GLGA 2K9DA 3SYLA 1AIPC 4D82A 4FVMA 1QAMA 3AFHA 5ITRA 4W5WA 1L1TA 2O01F 1OIZA 5ITTA 3HHZA 2XH9A 4B7HA 3FUUA 4LF5M 4NZ3A 3LCUA 1W5SA 2FH0A 2Y0TA 2MROB 1G41A 3D8BA 4L6V6 4ANRA 3LMMA 1W1PA 4B08A 1DGBA 2ZTDA 5BPVA 4REZA 4L78A 1N78A 4B3SM 2DZNB 1OIPA 2QQ8A 4WP2A 4LFCM 1OGBA 2C96A 4RNAA 1OQYA 1QANA 3KOYE 1WXQA 1T6OA 3SFZA 1IXSA 3AOEA 4NXNM 4MGKE 4MM3B 4QNRA 2OOBA 1L2DA 1NVMA 4B3TM 3M7PA 1ZV1A 3GRVA 4Z2KA 1G3IA 3UZUA 4IBIA 1ORYB 1D0LA 2I7PA 2XEPA 4X65M 2JXNA 1W1YA 2CV2A 3DZDA 2Y2MA 1NNUC 4NZ1A 3HZJA 5EJCA 3RGPA 3ZQJA 2AHMA 1EFUB 1XXHB 4LRTA 5KQDA 2DWNA 3GRUA 1N32M 1YU0A 4CJ6A 2XD1A 3WD4A 1GLNA 3CF0A 4F1IA 2DNAA 2R45A 3QYBA 1J7KA 4Z2IA 1K82A 4GEWA 1NNJA 2OQ4A 2JUJA 4HLQA 1VEJA 2GQFA 3H4JA 2KXEA 1J7MA 3I04M 3U6CA 1IN6A 3MJ5A 2J7OA 3E46A 2UUBM 3U6EA 1TH4A 3ZCBB 4M0WA 5DNYA 1PJJA 4OVZB 4RF1A 4JI5M 4DV7M 3J27B 3U6SA 1SG9A 1Y8GA 2KRKA 2YQZA 2YNMD 2J7NA 2RGHA 2DKLA 3FRIA 3TWMA 2FFFB 2R6FA 5E6JA 3WD0A 4OJPA 1ED7A 3L2AA 4KLNA 4LJ9A 4R71A 1YU3A 4NSRA 4DR4M 4NOOB 3JR5A 4BLCA 3HHWA 1JR3D 2VF8A 5FTJA 3DFZA 2FS1A 2CEAA 1L1ZA 3HONA 1NJGA 3OTOM 1YU2A 4JXJA 4MB5A 4NRWA 1N36M 2DZLA 3B89A 3QYEA 2CV1A 3BXWA 1L6JA 1BVSA 2XD5A 4DV0M 3N3FA 1R7RA 4BBAA 3R8FA 1IN5A 4XBOA 2UXBM 2B3TA 2LH0A 1UFZA 3A98B 3GLIA 4UN2B 2XZUA 4MH0E 4PDGA 3FTEA 1NV8A 2DVWB 2UXCM 1EIJA 2UUAM 1JB0F 2Z3XA 3L29A 1HJPA 1DGHA 2Y2OA 3A45A 4LJ4A 3Q8GA 4LFAM 2LNHC 4BB9A 2KDLA 2ZANA 4PDIA 2XSZD 1EE8A 1TDHA 3KS4A 4JV5M 1NY6A 3WD3A 1QQWA 2LXEA 2QBYA 2C99A 1QVRA 4X64M 4G4OA 2HL7A 2RRUA 2W82A 4Y28F 2C5RA 3VKHA 4NZ4A 2L6OA 1NHWC 2G5GX 4LZZA 5LMUM 2Y20A 4PD2A 1XHBA 3K9OA 4GHAA 3GLFE 1NJFA 3B7NA 1Q39A 1D2NA 3MMPA 2JNHA 4DR7M 3UGJA 1R2ZA 4GKKM 3B7QA 4OJ5A 1SXJC 4DV6M 3DOAA 1YU1A 4MGYE 5EXPA 1XWIA 4LGYA 2KNVA 5FTMA 2DZOB 2XZFA 2Y2IA 4X62M 2HWJA 3RE8A 2EO2A 5ITXA 4GKJM 4M0DA 4R3DA 2DAEA 5FTKA 5ITYA 1X37A 2EA0A 3VK8A 4LF8M 1F4IA 4FD2A 4MGZE 1QDRA 4IBJA 1Z5CA 4G6ZA 2FNAA 3CF2A 2Y2LA 2JP7A 3FTDA 3JAMS 1QO6A 4I5SA 4EIWA 3GLHE 2L2DA 4D81A 2ERCA 3I4YA 4CGYB 1DV0A 3U61A 3HU3A 1WJ7A 1E6ZA 3E21A 1HT2E 4DR6M 2OO9A 3D8LA 3FUWA 4KHPM 1A5TA 5E26A 4LJ8A 3WHKA 2Q2EB 4JI2M 4MB7A 4MGIE 1JR3E 3GRRA 3KOWE 4FW9A 2V5OA 1O6IA 1T3TA 2L7IA 1I4WA 4WW0A 4HMDA 4QOZC 1IY0A 3B9PA 3HU2A 5F3WA 4Z2LA 4G4QA 8CATA 1TGUA 2XFTA 3KP0E 3TWLA 3HSHA 1IXZA 1OAIA 2YR0A 2VDBB 4I8OA 3GLFB 2F4VM 3HJ8A 1Z59A 3DA1A 1H0IA 1DGFA 2DI0A 1H8PA 3EIEA 4AKGA 3U6QA 1JQJC 3R9XB 4G3OA 5C1BA 3GRYA 2H5XA 4PCZA 3AV0A 2QZ4A 2F5NA 1GJTA 2BWBA 1IQPA 3JR4A 4JI7M 4IJFA 3SASA 2Z4SA 3HHYA 4NYUA 5EXXA 3GLGE 4QNLA 2D7GA 1V33A 1C1KA 1N34M 2UXDM 3NBIA 2C9CA 2OPFA 1HQYE 3TE6A 4G4RA 3T38A 5IWAM 1TR8A 3GLHB 3C3EA 1KFVA 4P16A 2KW0A 1SXJA 3SHFA 1J5EM 2DAMA 1QDTA 2I7NA 4FWDA 3AJIB 4L8RC 1TF0B 5H37D 5KPTA 4HEOA 3J7AS 1HNZM 2NQ8C 1IXRC 1PM5A 1OKSA 1Q02A 4QHSA 2F5SA 1QZMA 2DENA 3K9PA 4GC9A 2CP8A 1W1VA 5EP3A 4LCBA 1HQCA 1CUKA 3NWLA 3E4RA 2HHHM 4B3RM 2Y2HA 1IFYA 4JN6A 3PFIA 1YSYA 4ITQA 2APLA 2QSFX 2JY8A 4AG5A 2X8AA 1RU3A 3A42A 4GH9A 4II7A 1LV7A 4DBGB 3J2PB 3BBZA 4JI4M 3RGSA 4OJ6A 2WSCF 1R4GA 4GC5A 3KP1E 3FYCA 4FCTA 2K47A 2F5QA 2G3QA 2O25A 3F92A 3FRHA 4M9XA 4XGIA 3QWLA 1W5TA 2HKJA 5BR8M 5ITQA 1E6PA 2DWLA 3FTFA 1T43A 5IREB 3GLGB 3K8ZA 3U60A 1PJIA 1QAOA 4Q7JA 3SBJA 2HCBA 1ZMWA 3HWSA 2JZ1A 2LVQD 1G71A 2D49A 1PRBA 2R18A 1NSFA 5DFLA 2WZJA 4L16A 2LHGA 3C3DA 2M5ZA 2XGNA 2MGWA 4GRIA 3V76A 4TX8A 3U5ZA 3W0LB 1GJSA 4AKIA 2BJWA 1YU4A 3U6LA 3M7GA 4B7FA 3SYKA 2L09A 2FFJA 2KNZA 2LWXA 4IBBA 3TQSA 3WX7A 2LVPC 3SHGB 2BJVA 4LGMA 5DYGA 4JI1M 1XNRM 2L7HA 2ZM6M 3AL0C 3FE3A 2RTSA 3L25A 1IBKM 1N75A 1NHGC 4Z8XA 5GKNA 2FE8A 3I4VA 5EXTA 4OU7A 3SAUA 2F5OA 3CTWB 3GO8A 3QAUA 4GITA 4IBKA 1E94E 2ZAOA 1WIVA 3GQ4A 3HY5A 1YLAA 2JY5A 4QHTA 1C7YA 1Z5BA 1IXSB 3B7ZA 2DHYA 4XK8F 4GIPA 3MQLA 4AI6A 2MR9A 4MGHA 2HAKA 1W1TA 3J80S 4LFBM 1N77A 3FUTA 2KNAA 5LMNM 4NC6A 4RKUF 4AG6A 3W0FA 1OAOC 1G59A 2UU9M 1GXDA 4DV4M 1K3WA 2KRUA 3BOSA 4DV5M 2JY7A 2L4EA 1IBMM 1WHCA 3GLIE 2Y0QA 2MJ5B 1L2CA 1HNWM 3HJSA 4OJLA 4HMEA 1E9SA 1OFIA 4YY3M 3UJNA 3MHVC 2UUCM 3SATA 3GQ5A 2UWXA 2DAKA 3L27A 3J7BA 4M9SA 4DV3M 1VEGA 2V1CA 3U6PA 4JI8M 2D7HA 4Z2HA 2D7EA 2X4AA 2JZ0A 2L4FA 4FWHA 3L26A 2GNOA 3T1HM 3M0EA 2O5RA 1MX0A 4MB3A 1GABA 1DGGA 2J5YA 3T1YM 1E88A 4NSOB 4IIWA 3WHLA 3SMSA 1SXJD 3HHXA 4IBCA 3MK6A 3W68A
chains in the Genus database with same CATH topology
5JI2E 2KZUA 2ZAMA 1Q3BA 2G8LA 3I51A 1OFHA 4LJAA 5A2QS 2XLJA 3GP1A 5FSWA 3PNVA 1MU5A 1YUBA 1IBLM 4LF6M 5ITXE 4AZFA 1XXHA 4LG2A 2QP9X 5EP4A 1XMQM 2V1UA 4B3MM 2CHVA 1J09A 3K1JA 3CF6E 3SMPA 4LF9M 4FCVA 1VDDA 3FD9A 1KYIA 3GLIB 4CISA 4D80A 4NYYA 4LY6A 1UM8A 4NY2A 1DGHB 2Z4RA 1GKIA 2A5YB 4OVZA 2BNKA 5EQTA 3VDPA 3HKPA 1R2YA 4DV1M 4GMQA 3K2LA 4WURA 4L4UA 3VFDA 3VK7A 2XSZA 2FOIC 4YHHM 1I94M 1QYRA 2F5PA 2QBYB 4IBFA 1XNQM 3KOXE 3HJQA 4LJ7A 4DUZM 3SAVA 1L2BA 3AOGA 2P5TA 4RF0A 4G4NA 4CHTB 3H4MA 2CHGA 3U6OA 3HU1A 2IOUA 3KVWA 3PVSA 4AKHA 5ITUA 3ZH9B 4LF7M 1Z6TA 2Y2NA 1Z5AA 2VQEM 1FNNA 4LRSA 1R6BX 3UMMA 2CHQA 3RFWA 2Y2QA 1L8QA 3A46A 4R7GA 3PXGA 5JI3E 3KSJA 4DR3M 4QNMA 5KPZA 3THGA 3KDSE 3E9SA 1S3SA 1IN7A 5KQ8A 2XF3A 5KPRA 4JI0M 5EXSA 4LJ5A 3SC3A 1H6UA 3LQRA 3VLFB 4QOSA 1SXJE 3U61B 2KZSA 4I4LA 2M60A 4DR2M 4M9ZA 1IN4A 2R4EA 3FUXA 3U6DA 5EP1A 3FUVA 4JYAM 4TUWA 4FWGA 4IBGA 2KA6B 1IM2A 2Y2GA 3LVWA 1E32A 2R62A 3KFUG 3GPXA 2CV0A 2Y2KA 2XFSA 1HT1E 3SAWA 1OJLA 3IG8A 2RKOA 5C18A 4Z6YA 3TL4X 1G8PA 2QCUA 1GL7A 2QENA 2V6ZM 5FTLA 4NL4H 4DR5M 2QPAA 4NRVA 2RGOA 1QAQA 4OW0A 2DXIA 2H1RA 1NY5A 1XC8A 4K0KM 4DUYM 4IJEA 4KO8A 3VKGA 3K92A 4L15A 3KW6A 2JCHA 3AKZA 2YFQA 1FJGM 3KXEC 4AW4A 2DWZB 3T15A 3IG5A 4JI6M 1Q3CA 1SXJB 3GQ3A 4LJ6A 1IY1A 5IZ7D 1DO0A 1N33M 2ZBKB 4KODA 2Y2PA 4DR1M 1DO2A 3FTCA 3TWKA 4NZ5A 3GLFA 2C9OA 2R46A 3FKEA 1GL6A 3LVVA 4X66M 5FTNA 2R4JA 4A3VB 5EP2A 1IN8A 2JE5A 2X49A 2EUCA 3C58A 4OX9M 5IT9S 4GHLA 4HL4A 4NXMM 2Z7JA 2KEBA 2JA2A 3FYDA 3SARA 1YE9A 4ZPXA 1ZAEA 5DYIA 1IY2A 4I81A 3ZC7B 3KS8A 5KO3A 3GLHA 3TPZA 2CFOA 3LQQA 3M6AA 4FCWA 3U60B 3GPYA 3GPUA 3KSXA 1HNXM 3AOEC 2BG1A 4IBDA 4PT5A 2DHRA 1ZQ9A 3GPPA 1K3XA 1JR3A 4LZJA 1G4AE 3HGIA 4JI3M 3U5ZB 1TH3A 4LF4M 1YUEA 4AQYM 5FLXS 2VQFM 3VDUA 4OUIA 3Q8XA 2Y2JA 3U6MA 2DWMA 4IBEA 7CATA 3UK6A 1XMOM 2CUZA 1TH2A 4B7GA 2VIIA 3EIHA 3PNYA 2CE7A 1TDZA 1KSFX 4DV2M 1GVNA 4OJOA 1HR0M 2Y21A 3J81S 3ILKA 1E9RA 3KOZE 4S12A 2E5LM 3L28A 2R65A 2C98A 3GLGA 3SYLA 4D82A 4FVMA 1QAMA 3AFHA 5ITRA 4W5WA 1L1TA 5ITTA 3HHZA 2XH9A 4B7HA 3FUUA 4LF5M 4NZ3A 1W5SA 2Y0TA 1G41A 3D8BA 3LMMA 4B08A 1DGBA 5BPVA 4REZA 4L78A 1N78A 4B3SM 2DZNB 4LFCM 2C96A 4RNAA 1QANA 3KOYE 1WXQA 3SFZA 3AOEA 4NXNM 4MGKE 4MM3B 4QNRA 1L2DA 1NVMA 4B3TM 3GRVA 1G3IA 3UZUA 4IBIA 1ORYB 2I7PA 2XEPA 4X65M 2CV2A 3DZDA 2Y2MA 1NNUC 4NZ1A 5EJCA 3RGPA 2AHMA 1XXHB 4LRTA 5KQDA 2DWNA 1N32M 3GRUA 1YU0A 2XD1A 3CF0A 1GLNA 2R45A 1J7KA 1K82A 1NNJA 2OQ4A 4HLQA 2KXEA 3U6CA 1IN6A 3MJ5A 2J7OA 2UUBM 3U6EA 1TH4A 3ZCBB 4M0WA 5DNYA 1PJJA 4OVZB 4RF1A 4JI5M 4DV7M 3J27B 3U6SA 2KRKA 2YQZA 2YNMD 2J7NA 2RGHA 3TWMA 2FFFB 5E6JA 4OJPA 3L2AA 4KLNA 4LJ9A 1YU3A 4NSRA 4DR4M 4NOOB 3JR5A 4BLCA 3HHWA 1JR3D 5FTJA 3DFZA 2CEAA 1L1ZA 3HONA 1NJGA 3OTOM 1YU2A 4JXJA 4NRWA 1N36M 2CV1A 2XD5A 4DV0M 3N3FA 1R7RA 4BBAA 3R8FA 1IN5A 4XBOA 2UXBM 2LH0A 3A98B 3GLIA 2XZUA 4MH0E 4PDGA 3FTEA 2UXCM 2DVWB 2UUAM 2Z3XA 3L29A 1DGHA 2Y2OA 3A45A 4LJ4A 4LFAM 2LNHC 4BB9A 2ZANA 4PDIA 2XSZD 1EE8A 1TDHA 3KS4A 4JV5M 1NY6A 1QQWA 2LXEA 2QBYA 2C99A 1QVRA 4X64M 4G4OA 2HL7A 2C5RA 2W82A 3VKHA 4NZ4A 2L6OA 1NHWC 2G5GX 4LZZA 5LMUM 2Y20A 4PD2A 1XHBA 4GHAA 1NJFA 1Q39A 1D2NA 4DR7M 4GKKM 3UGJA 1R2ZA 4OJ5A 1SXJC 4DV6M 3DOAA 1YU1A 4MGYE 5EXPA 1XWIA 4LGYA 5FTMA 2DZOB 2XZFA 2Y2IA 4X62M 3RE8A 2EO2A 5ITXA 4GKJM 4M0DA 4R3DA 5ITYA 5FTKA 2EA0A 1X37A 3VK8A 4LF8M 4FD2A 4MGZE 4IBJA 1Z5CA 4G6ZA 2FNAA 3CF2A 2Y2LA 3FTDA 3JAMS 4I5SA 4EIWA 4D81A 2ERCA 3I4YA 4CGYB 3U61A 3HU3A 4DR6M 1HT2E 3D8LA 3FUWA 4KHPM 5E26A 4LJ8A 3WHKA 2Q2EB 4JI2M 4MB7A 4MGIE 3GRRA 3KOWE 4FW9A 1T3TA 2L7IA 1I4WA 4WW0A 4QOZC 1IY0A 3B9PA 3HU2A 5F3WA 4G4QA 8CATA 1TGUA 2XFTA 3KP0E 3TWLA 3HSHA 1IXZA 2YR0A 4I8OA 3GLFB 2F4VM 3HJ8A 1Z59A 3DA1A 1DGFA 3EIEA 4AKGA 3U6QA 1JQJC 3R9XB 5C1BA 3GRYA 2F5NA 4PCZA 3AV0A 2QZ4A 4JI7M 3JR4A 1IQPA 4IJFA 3SASA 2Z4SA 3HHYA 4NYUA 5EXXA 4QNLA 2D7GA 1C1KA 1N34M 2UXDM 3NBIA 2C9CA 2OPFA 1HQYE 3TE6A 4G4RA 3T38A 5IWAM 3GLHB 1KFVA 4P16A 2KW0A 1SXJA 3SHFA 1J5EM 4FWDA 2I7NA 3AJIB 4L8RC 5H37D 5KPTA 3J7AS 1HNZM 2NQ8C 1IXRC 1PM5A 4QHSA 2F5SA 1QZMA 4GC9A 5EP3A 4LCBA 1HQCA 3NWLA 2HHHM 3E4RA 4B3RM 2Y2HA 4JN6A 3PFIA 1YSYA 4ITQA 4AG5A 2X8AA 4GH9A 3A42A 4II7A 1LV7A 3J2PB 4JI4M 3RGSA 4OJ6A 4GC5A 3KP1E 3FYCA 4FCTA 2K47A 2F5QA 4M9XA 4XGIA 3QWLA 1W5TA 2HKJA 5BR8M 5ITQA 2DWLA 3FTFA 5IREB 3GLGB 3K8ZA 3U60A 1PJIA 1QAOA 3SBJA 2HCBA 3HWSA 2R18A 1NSFA 4L16A 2M5ZA 2XGNA 4GRIA 3U5ZA 3W0LB 4AKIA 1YU4A 2BJWA 3U6LA 3M7GA 4B7FA 3SYKA 2L09A 2FFJA 4IBBA 2LWXA 3TQSA 3WX7A 3SHGB 4JI1M 2BJVA 4LGMA 5DYGA 3AL0C 1XNRM 2L7HA 2ZM6M 3L25A 1IBKM 1N75A 1NHGC 4Z8XA 5GKNA 2FE8A 3I4VA 5EXTA 4OU7A 3SAUA 2F5OA 3CTWB 3GO8A 3QAUA 4GITA 4IBKA 1E94E 2ZAOA 3GQ4A 4QHTA 1Z5BA 1IXSB 4GIPA 4AI6A 4MGHA 3J80S 4LFBM 1N77A 3FUTA 5LMNM 2UU9M 4AG6A 1G59A 3W0FA 4DV4M 1K3WA 2KRUA 3BOSA 4DV5M 1IBMM 2Y0QA 1L2CA 1HNWM 3HJSA 4OJLA 1E9SA 1OFIA 4YY3M 3UJNA 3MHVC 2UUCM 3SATA 3GQ5A 2UWXA 3L27A 3J7BA 4M9SA 4DV3M 2V1CA 3U6PA 4JI8M 2D7HA 2D7EA 2X4AA 4FWHA 3L26A 3T1HM 3M0EA 2O5RA 1MX0A 1DGGA 3T1YM 4NSOB 4IIWA 3WHLA 3SMSA 1SXJD 3HHXA 4IBCA 3MK6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IJF A;  4GH9 A;  3L28 A;  4IBD A;  4GHA A;  4IBB A;  4IBF A;  3FKE A;  3L25 A;  4LG2 A;  3L29 A;  3L27 A;  4IBK A;  4IBI A;  4IJE A;  3L26 A;  3L2A A;  4IBE A;  4GHL A;  3KS4 A;  4IBJ A;  4IBG A;  5BPV A;  3KS8 A;  4IBC A; 
#chains in the Genus database with same CATH topology
 5JI2 E;  2KZU A;  2ZAM A;  1D0K A;  2EKK A;  2R44 A;  1Q3B A;  2G8L A;  2LTU A;  1OFH A;  3I51 A;  4LJA A;  5A2Q S;  2XLJ A;  1VG5 A;  3GP1 A;  1WR1 B;  5FSW A;  3PNV A;  1MU5 A;  1YUB A;  2FN2 A;  1XB2 B;  1IBL M;  4LF6 M;  5ITX E;  4AZF A;  2BWE A;  2KHH A;  1XXH A;  4LG2 A;  2QP9 X;  5EP4 A;  1XMQ M;  2V1U A;  4B3M M;  2LHC A;  1PJS A;  2CHV A;  2JWS A;  1J09 A;  3K1J A;  3CF6 E;  3SMP A;  4LF9 M;  4FCV A;  1VDD A;  3FD9 A;  1KYI A;  3GLI B;  4CIS A;  4D80 A;  4NYY A;  3IHP A;  4LY6 A;  1UM8 A;  4NY2 A;  1DGH B;  2Z4R A;  1GKI A;  2A5Y B;  3LCV B;  4F2L A;  1GPF A;  4OVZ A;  2BNK A;  1ZMV A;  5EQT A;  3HKP A;  3VDP A;  4DV1 M;  4GMQ A;  1R2Y A;  3K2L A;  4WUR A;  1VDL A;  4L4U A;  3VFD A;  3VK7 A;  2XSZ A;  2FOI C;  4YHH M;  1I94 M;  1QYR A;  2F5P A;  2QBY B;  4IBF A;  1XNQ M;  1XXH E;  1AIW A;  3KOX E;  1E6N A;  3HJQ A;  4LJ7 A;  4DUZ M;  3SAV A;  1L2B A;  1D0M A;  3AOG A;  1R5L A;  2P5T A;  2R0I A;  4RF0 A;  2ZTC A;  4G4N A;  4CHT B;  3H4M A;  2CHG A;  3U6O A;  3HU1 A;  2IOU A;  3KVW A;  3PVS A;  2EKF A;  5ITU A;  3ZH9 B;  4AKH A;  4LF7 M;  1Z6T A;  2Y2N A;  1AUA A;  1Z5A A;  2VQE M;  2N35 A;  1FNN A;  4LRS A;  1R6B X;  5L8R F;  3UMM A;  1QUT A;  2CHQ A;  3RFW A;  2Y2Q A;  1L8Q A;  3A46 A;  4R7G A;  3PXG A;  5JI3 E;  1VQ1 A;  2VF7 A;  2CWB A;  3KSJ A;  1EAK A;  2WSE F;  4DR3 M;  4QNM A;  1E8B A;  5KPZ A;  1GOI A;  3THG A;  1PDC A;  3KDS E;  3E9S A;  1S3S A;  1IN7 A;  5KQ8 A;  2XF3 A;  3HX3 A;  5KPR A;  4JI0 M;  5EXS A;  2LBC A;  4LJ5 A;  3SC3 A;  1H6U A;  3LQR A;  3VLF B;  4QOS A;  1SXJ E;  2K0B X;  3U61 B;  2KZS A;  1KS0 A;  4I4L A;  2M60 A;  4DR2 M;  3I01 M;  4M9Z A;  1IN4 A;  2R4E A;  3FUX A;  3U6D A;  1QZE A;  3LW5 F;  5EP1 A;  3WD2 A;  2K6B A;  3FUV A;  4JYA M;  2LVN C;  4TUW A;  4FWG A;  4IBG A;  2KA6 B;  1IM2 A;  2Y2G A;  3LVW A;  1E15 A;  1E32 A;  2R62 A;  2JY6 B;  3GPX A;  3KFU G;  2LVA A;  2CV0 A;  1PJT A;  2Y2K A;  2XFS A;  1HT1 E;  3SAW A;  1OJL A;  3IG8 A;  1V34 A;  2RKO A;  4Z6Y A;  3TL4 X;  5C18 A;  1G8P A;  3C9P A;  2QCU A;  1GL7 A;  2QEN A;  2V6Z M;  5FTL A;  4NL4 H;  4DR5 M;  2QPA A;  4NRV A;  1MN3 A;  1V92 A;  1QAQ A;  2RGO A;  3IEC A;  1E6R A;  4OW0 A;  2DXI A;  2H1R A;  1NV9 A;  1NY5 A;  1XC8 A;  4K0K M;  4DUY M;  4IJE A;  4KO8 A;  4P17 A;  3VKG A;  3K92 A;  4L15 A;  3KW6 A;  2JCH A;  3AKZ A;  2YFQ A;  4Z2G A;  2QNJ A;  1FJG M;  1PJQ A;  3KXE C;  4AW4 A;  2DWZ B;  3T15 A;  1ZMU A;  3IG5 A;  4JI6 M;  1Q3C A;  1SXJ B;  1PGY A;  2WSF F;  3GQ3 A;  1MJG M;  1TTE A;  4LJ6 A;  1IY1 A;  5IZ7 D;  1WGN A;  1DO0 A;  4CIZ A;  1N33 M;  2ZBK B;  4KOD A;  2Y2P A;  4DR1 M;  1DO2 A;  2OOA A;  3FTC A;  3TWK A;  4NZ5 A;  1OTR A;  3GLF A;  2C9O A;  2R46 A;  3FKE A;  1GL6 A;  3LVV A;  4X66 M;  5FTN A;  2R4J A;  4A3V B;  5EP2 A;  1IN8 A;  1CXW A;  1WGL A;  2LVO C;  2JE5 A;  1OGG A;  2X49 A;  2EUC A;  3C58 A;  4OX9 M;  5IT9 S;  4GHL A;  4HL4 A;  4NXM M;  2Z7J A;  2KEB A;  2JA2 A;  3FYD A;  3SAR A;  1YE9 A;  4ZPX A;  1LTM A;  1ZAE A;  2MH8 A;  1P3Q Q;  5DYI A;  2DAG A;  1IY2 A;  4I81 A;  3ZC7 B;  3KS8 A;  5KO3 A;  3GLH A;  3TPZ A;  2CFO A;  3LQQ A;  3M6A A;  3T6P A;  4FCW A;  2DAI A;  1H0G A;  1UR8 A;  3U60 B;  3GPY A;  3GPU A;  3KSX A;  1HNX M;  3AOE C;  2EJS A;  4IBD A;  2BG1 A;  4PT5 A;  4HMC A;  1QUS A;  2DHR A;  1ZQ9 A;  3GPP A;  1K3X A;  1GO5 A;  1JR3 A;  4LZJ A;  1G4A E;  3HGI A;  4JI3 M;  3U5Z B;  1TH3 A;  4LF4 M;  1YUE A;  1NO1 A;  4AQY M;  5FLX S;  2VQF M;  3B74 A;  2Z8Y M;  3VDU A;  4OUI A;  3Q8X A;  4MB4 A;  1CK7 A;  2Y2J A;  3U6M A;  1UR9 A;  2DWM A;  1VEK A;  4IBE A;  7CAT A;  3UK6 A;  3CGW A;  1XMO M;  2CUZ A;  1TH2 A;  4B7G A;  2VII A;  3EIH A;  3PNY A;  2CE7 A;  1TDZ A;  1KSF X;  2QHO B;  4DV2 M;  1GVN A;  4OJO A;  1HR0 M;  4Z2J A;  2Y21 A;  3J81 S;  3ILK A;  2CRU A;  1E9R A;  3KOZ E;  4KT0 F;  4S12 A;  2E5L M;  3L28 A;  3WD1 A;  3NBX X;  2R65 A;  3W67 A;  2C98 A;  3GLG A;  2K9D A;  3SYL A;  1AIP C;  4D82 A;  4FVM A;  1QAM A;  3AFH A;  5ITR A;  4W5W A;  1L1T A;  2O01 F;  1OIZ A;  5ITT A;  3HHZ A;  2XH9 A;  4B7H A;  3FUU A;  4LF5 M;  4NZ3 A;  3LCU A;  1W5S A;  2FH0 A;  2Y0T A;  2MRO B;  1G41 A;  3D8B A;  4L6V 6;  4ANR A;  3LMM A;  1W1P A;  4B08 A;  1DGB A;  2ZTD A;  5BPV A;  4REZ A;  4L78 A;  1N78 A;  4B3S M;  2DZN B;  1OIP A;  2QQ8 A;  4WP2 A;  4LFC M;  1OGB A;  2C96 A;  4RNA A;  1OQY A;  1QAN A;  3KOY E;  1WXQ A;  1T6O A;  3SFZ A;  1IXS A;  3AOE A;  4NXN M;  4MGK E;  4MM3 B;  4QNR A;  2OOB A;  1L2D A;  1NVM A;  4B3T M;  3M7P A;  1ZV1 A;  3GRV A;  4Z2K A;  1G3I A;  3UZU A;  4IBI A;  1ORY B;  1D0L A;  2I7P A;  2XEP A;  4X65 M;  2JXN A;  1W1Y A;  2CV2 A;  3DZD A;  2Y2M A;  1NNU C;  4NZ1 A;  3HZJ A;  5EJC A;  3RGP A;  3ZQJ A;  2AHM A;  1EFU B;  1XXH B;  4LRT A;  5KQD A;  2DWN A;  3GRU A;  1N32 M;  1YU0 A;  4CJ6 A;  2XD1 A;  3WD4 A;  1GLN A;  3CF0 A;  4F1I A;  2DNA A;  2R45 A;  3QYB A;  1J7K A;  4Z2I A;  1K82 A;  4GEW A;  1NNJ A;  2OQ4 A;  2JUJ A;  4HLQ A;  1VEJ A;  2GQF A;  3H4J A;  2KXE A;  1J7M A;  3I04 M;  3U6C A;  1IN6 A;  3MJ5 A;  2J7O A;  3E46 A;  2UUB M;  3U6E A;  1TH4 A;  3ZCB B;  4M0W A;  5DNY A;  1PJJ A;  4OVZ B;  4RF1 A;  4JI5 M;  4DV7 M;  3J27 B;  3U6S A;  1SG9 A;  1Y8G A;  2KRK A;  2YQZ A;  2YNM D;  2J7N A;  2RGH A;  2DKL A;  3FRI A;  3TWM A;  2FFF B;  2R6F A;  5E6J A;  3WD0 A;  4OJP A;  1ED7 A;  3L2A A;  4KLN A;  4LJ9 A;  4R71 A;  1YU3 A;  4NSR A;  4DR4 M;  4NOO B;  3JR5 A;  4BLC A;  3HHW A;  1JR3 D;  2VF8 A;  5FTJ A;  3DFZ A;  2FS1 A;  2CEA A;  1L1Z A;  3HON A;  1NJG A;  3OTO M;  1YU2 A;  4JXJ A;  4MB5 A;  4NRW A;  1N36 M;  2DZL A;  3B89 A;  3QYE A;  2CV1 A;  3BXW A;  1L6J A;  1BVS A;  2XD5 A;  4DV0 M;  3N3F A;  1R7R A;  4BBA A;  3R8F A;  1IN5 A;  4XBO A;  2UXB M;  2B3T A;  2LH0 A;  1UFZ A;  3A98 B;  3GLI A;  4UN2 B;  2XZU A;  4MH0 E;  4PDG A;  3FTE A;  1NV8 A;  2DVW B;  2UXC M;  1EIJ A;  2UUA M;  1JB0 F;  2Z3X A;  3L29 A;  1HJP A;  1DGH A;  2Y2O A;  3A45 A;  4LJ4 A;  3Q8G A;  4LFA M;  2LNH C;  4BB9 A;  2KDL A;  2ZAN A;  4PDI A;  2XSZ D;  1EE8 A;  1TDH A;  3KS4 A;  4JV5 M;  1NY6 A;  3WD3 A;  1QQW A;  2LXE A;  2QBY A;  2C99 A;  1QVR A;  4X64 M;  4G4O A;  2HL7 A;  2RRU A;  2W82 A;  4Y28 F;  2C5R A;  3VKH A;  4NZ4 A;  2L6O A;  1NHW C;  2G5G X;  4LZZ A;  5LMU M;  2Y20 A;  4PD2 A;  1XHB A;  3K9O A;  4GHA A;  3GLF E;  1NJF A;  3B7N A;  1Q39 A;  1D2N A;  3MMP A;  2JNH A;  4DR7 M;  3UGJ A;  1R2Z A;  4GKK M;  3B7Q A;  4OJ5 A;  1SXJ C;  4DV6 M;  3DOA A;  1YU1 A;  4MGY E;  5EXP A;  1XWI A;  4LGY A;  2KNV A;  5FTM A;  2DZO B;  2XZF A;  2Y2I A;  4X62 M;  2HWJ A;  3RE8 A;  2EO2 A;  5ITX A;  4GKJ M;  4M0D A;  4R3D A;  2DAE A;  5FTK A;  5ITY A;  1X37 A;  2EA0 A;  3VK8 A;  4LF8 M;  1F4I A;  4FD2 A;  4MGZ E;  1QDR A;  4IBJ A;  1Z5C A;  4G6Z A;  2FNA A;  3CF2 A;  2Y2L A;  2JP7 A;  3FTD A;  3JAM S;  1QO6 A;  4I5S A;  4EIW A;  3GLH E;  2L2D A;  4D81 A;  2ERC A;  3I4Y A;  4CGY B;  1DV0 A;  3U61 A;  3HU3 A;  1WJ7 A;  1E6Z A;  3E21 A;  1HT2 E;  4DR6 M;  2OO9 A;  3D8L A;  3FUW A;  4KHP M;  1A5T A;  5E26 A;  4LJ8 A;  3WHK A;  2Q2E B;  4JI2 M;  4MB7 A;  4MGI E;  1JR3 E;  3GRR A;  3KOW E;  4FW9 A;  2V5O A;  1O6I A;  1T3T A;  2L7I A;  1I4W A;  4WW0 A;  4HMD A;  4QOZ C;  1IY0 A;  3B9P A;  3HU2 A;  5F3W A;  4Z2L A;  4G4Q A;  8CAT A;  1TGU A;  2XFT A;  3KP0 E;  3TWL A;  3HSH A;  1IXZ A;  1OAI A;  2YR0 A;  2VDB B;  4I8O A;  3GLF B;  2F4V M;  3HJ8 A;  1Z59 A;  3DA1 A;  1H0I A;  1DGF A;  2DI0 A;  1H8P A;  3EIE A;  4AKG A;  3U6Q A;  1JQJ C;  3R9X B;  4G3O A;  5C1B A;  3GRY A;  2H5X A;  4PCZ A;  3AV0 A;  2QZ4 A;  2F5N A;  1GJT A;  2BWB A;  1IQP A;  3JR4 A;  4JI7 M;  4IJF A;  3SAS A;  2Z4S A;  3HHY A;  4NYU A;  5EXX A;  3GLG E;  4QNL A;  2D7G A;  1V33 A;  1C1K A;  1N34 M;  2UXD M;  3NBI A;  2C9C A;  2OPF A;  1HQY E;  3TE6 A;  4G4R A;  3T38 A;  5IWA M;  1TR8 A;  3GLH B;  3C3E A;  1KFV A;  4P16 A;  2KW0 A;  1SXJ A;  3SHF A;  1J5E M;  2DAM A;  1QDT A;  2I7N A;  4FWD A;  3AJI B;  4L8R C;  1TF0 B;  5H37 D;  5KPT A;  4HEO A;  3J7A S;  1HNZ M;  2NQ8 C;  1IXR C;  1PM5 A;  1OKS A;  1Q02 A;  4QHS A;  2F5S A;  1QZM A;  2DEN A;  3K9P A;  4GC9 A;  2CP8 A;  1W1V A;  5EP3 A;  4LCB A;  1HQC A;  1CUK A;  3NWL A;  3E4R A;  2HHH M;  4B3R M;  2Y2H A;  1IFY A;  4JN6 A;  3PFI A;  1YSY A;  4ITQ A;  2APL A;  2QSF X;  2JY8 A;  4AG5 A;  2X8A A;  1RU3 A;  3A42 A;  4GH9 A;  4II7 A;  1LV7 A;  4DBG B;  3J2P B;  3BBZ A;  4JI4 M;  3RGS A;  4OJ6 A;  2WSC F;  1R4G A;  4GC5 A;  3KP1 E;  3FYC A;  4FCT A;  2K47 A;  2F5Q A;  2G3Q A;  2O25 A;  3F92 A;  3FRH A;  4M9X A;  4XGI A;  3QWL A;  1W5T A;  2HKJ A;  5BR8 M;  5ITQ A;  1E6P A;  2DWL A;  3FTF A;  1T43 A;  5IRE B;  3GLG B;  3K8Z A;  3U60 A;  1PJI A;  1QAO A;  4Q7J A;  3SBJ A;  2HCB A;  1ZMW A;  3HWS A;  2JZ1 A;  2LVQ D;  1G71 A;  2D49 A;  1PRB A;  2R18 A;  1NSF A;  5DFL A;  2WZJ A;  4L16 A;  2LHG A;  3C3D A;  2M5Z A;  2XGN A;  2MGW A;  4GRI A;  3V76 A;  4TX8 A;  3U5Z A;  3W0L B;  1GJS A;  4AKI A;  2BJW A;  1YU4 A;  3U6L A;  3M7G A;  4B7F A;  3SYK A;  2L09 A;  2FFJ A;  2KNZ A;  2LWX A;  4IBB A;  3TQS A;  3WX7 A;  2LVP C;  3SHG B;  2BJV A;  4LGM A;  5DYG A;  4JI1 M;  1XNR M;  2L7H A;  2ZM6 M;  3AL0 C;  3FE3 A;  2RTS A;  3L25 A;  1IBK M;  1N75 A;  1NHG C;  4Z8X A;  5GKN A;  2FE8 A;  3I4V A;  5EXT A;  4OU7 A;  3SAU A;  2F5O A;  3CTW B;  3GO8 A;  3QAU A;  4GIT A;  4IBK A;  1E94 E;  2ZAO A;  1WIV A;  3GQ4 A;  3HY5 A;  1YLA A;  2JY5 A;  4QHT A;  1C7Y A;  1Z5B A;  1IXS B;  3B7Z A;  2DHY A;  4XK8 F;  4GIP A;  3MQL A;  4AI6 A;  2MR9 A;  4MGH A;  2HAK A;  1W1T A;  3J80 S;  4LFB M;  1N77 A;  3FUT A;  2KNA A;  5LMN M;  4NC6 A;  4RKU F;  4AG6 A;  3W0F A;  1OAO C;  1G59 A;  2UU9 M;  1GXD A;  4DV4 M;  1K3W A;  2KRU A;  3BOS A;  4DV5 M;  2JY7 A;  2L4E A;  1IBM M;  1WHC A;  3GLI E;  2Y0Q A;  2MJ5 B;  1L2C A;  1HNW M;  3HJS A;  4OJL A;  4HME A;  1E9S A;  1OFI A;  4YY3 M;  3UJN A;  3MHV C;  2UUC M;  3SAT A;  3GQ5 A;  2UWX A;  2DAK A;  3L27 A;  3J7B A;  4M9S A;  4DV3 M;  1VEG A;  2V1C A;  3U6P A;  4JI8 M;  2D7H A;  4Z2H A;  2D7E A;  2X4A A;  2JZ0 A;  2L4F A;  4FWH A;  3L26 A;  2GNO A;  3T1H M;  3M0E A;  2O5R A;  1MX0 A;  4MB3 A;  1GAB A;  1DGG A;  2J5Y A;  3T1Y M;  1E88 A;  4NSO B;  4IIW A;  3WHL A;  3SMS A;  1SXJ D;  3HHX A;  4IBC A;  3MK6 A;  3W68 A; 
#chains in the Genus database with same CATH homology
 5JI2 E;  2KZU A;  2ZAM A;  1Q3B A;  2G8L A;  3I51 A;  1OFH A;  4LJA A;  5A2Q S;  2XLJ A;  3GP1 A;  5FSW A;  3PNV A;  1MU5 A;  1YUB A;  1IBL M;  4LF6 M;  5ITX E;  4AZF A;  1XXH A;  4LG2 A;  2QP9 X;  5EP4 A;  1XMQ M;  2V1U A;  4B3M M;  2CHV A;  1J09 A;  3K1J A;  3CF6 E;  3SMP A;  4LF9 M;  4FCV A;  1VDD A;  3FD9 A;  1KYI A;  3GLI B;  4CIS A;  4D80 A;  4NYY A;  4LY6 A;  1UM8 A;  4NY2 A;  1DGH B;  2Z4R A;  1GKI A;  2A5Y B;  4OVZ A;  2BNK A;  5EQT A;  3VDP A;  3HKP A;  1R2Y A;  4DV1 M;  4GMQ A;  3K2L A;  4WUR A;  4L4U A;  3VFD A;  3VK7 A;  2XSZ A;  2FOI C;  4YHH M;  1I94 M;  1QYR A;  2F5P A;  2QBY B;  4IBF A;  1XNQ M;  3KOX E;  3HJQ A;  4LJ7 A;  4DUZ M;  3SAV A;  1L2B A;  3AOG A;  2P5T A;  4RF0 A;  4G4N A;  4CHT B;  3H4M A;  2CHG A;  3U6O A;  3HU1 A;  2IOU A;  3KVW A;  3PVS A;  4AKH A;  5ITU A;  3ZH9 B;  4LF7 M;  1Z6T A;  2Y2N A;  1Z5A A;  2VQE M;  1FNN A;  4LRS A;  1R6B X;  3UMM A;  2CHQ A;  3RFW A;  2Y2Q A;  1L8Q A;  3A46 A;  4R7G A;  3PXG A;  5JI3 E;  3KSJ A;  4DR3 M;  4QNM A;  5KPZ A;  3THG A;  3KDS E;  3E9S A;  1S3S A;  1IN7 A;  5KQ8 A;  2XF3 A;  5KPR A;  4JI0 M;  5EXS A;  4LJ5 A;  3SC3 A;  1H6U A;  3LQR A;  3VLF B;  4QOS A;  1SXJ E;  3U61 B;  2KZS A;  4I4L A;  2M60 A;  4DR2 M;  4M9Z A;  1IN4 A;  2R4E A;  3FUX A;  3U6D A;  5EP1 A;  3FUV A;  4JYA M;  4TUW A;  4FWG A;  4IBG A;  2KA6 B;  1IM2 A;  2Y2G A;  3LVW A;  1E32 A;  2R62 A;  3KFU G;  3GPX A;  2CV0 A;  2Y2K A;  2XFS A;  1HT1 E;  3SAW A;  1OJL A;  3IG8 A;  2RKO A;  5C18 A;  4Z6Y A;  3TL4 X;  1G8P A;  2QCU A;  1GL7 A;  2QEN A;  2V6Z M;  5FTL A;  4NL4 H;  4DR5 M;  2QPA A;  4NRV A;  2RGO A;  1QAQ A;  4OW0 A;  2DXI A;  2H1R A;  1NY5 A;  1XC8 A;  4K0K M;  4DUY M;  4IJE A;  4KO8 A;  3VKG A;  3K92 A;  4L15 A;  3KW6 A;  2JCH A;  3AKZ A;  2YFQ A;  1FJG M;  3KXE C;  4AW4 A;  2DWZ B;  3T15 A;  3IG5 A;  4JI6 M;  1Q3C A;  1SXJ B;  3GQ3 A;  4LJ6 A;  1IY1 A;  5IZ7 D;  1DO0 A;  1N33 M;  2ZBK B;  4KOD A;  2Y2P A;  4DR1 M;  1DO2 A;  3FTC A;  3TWK A;  4NZ5 A;  3GLF A;  2C9O A;  2R46 A;  3FKE A;  1GL6 A;  3LVV A;  4X66 M;  5FTN A;  2R4J A;  4A3V B;  5EP2 A;  1IN8 A;  2JE5 A;  2X49 A;  2EUC A;  3C58 A;  4OX9 M;  5IT9 S;  4GHL A;  4HL4 A;  4NXM M;  2Z7J A;  2KEB A;  2JA2 A;  3FYD A;  3SAR A;  1YE9 A;  4ZPX A;  1ZAE A;  5DYI A;  1IY2 A;  4I81 A;  3ZC7 B;  3KS8 A;  5KO3 A;  3GLH A;  3TPZ A;  2CFO A;  3LQQ A;  3M6A A;  4FCW A;  3U60 B;  3GPY A;  3GPU A;  3KSX A;  1HNX M;  3AOE C;  2BG1 A;  4IBD A;  4PT5 A;  2DHR A;  1ZQ9 A;  3GPP A;  1K3X A;  1JR3 A;  4LZJ A;  1G4A E;  3HGI A;  4JI3 M;  3U5Z B;  1TH3 A;  4LF4 M;  1YUE A;  4AQY M;  5FLX S;  2VQF M;  3VDU A;  4OUI A;  3Q8X A;  2Y2J A;  3U6M A;  2DWM A;  4IBE A;  7CAT A;  3UK6 A;  1XMO M;  2CUZ A;  1TH2 A;  4B7G A;  2VII A;  3EIH A;  3PNY A;  2CE7 A;  1TDZ A;  1KSF X;  4DV2 M;  1GVN A;  4OJO A;  1HR0 M;  2Y21 A;  3J81 S;  3ILK A;  1E9R A;  3KOZ E;  4S12 A;  2E5L M;  3L28 A;  2R65 A;  2C98 A;  3GLG A;  3SYL A;  4D82 A;  4FVM A;  1QAM A;  3AFH A;  5ITR A;  4W5W A;  1L1T A;  5ITT A;  3HHZ A;  2XH9 A;  4B7H A;  3FUU A;  4LF5 M;  4NZ3 A;  1W5S A;  2Y0T A;  1G41 A;  3D8B A;  3LMM A;  4B08 A;  1DGB A;  5BPV A;  4REZ A;  4L78 A;  1N78 A;  4B3S M;  2DZN B;  4LFC M;  2C96 A;  4RNA A;  1QAN A;  3KOY E;  1WXQ A;  3SFZ A;  3AOE A;  4NXN M;  4MGK E;  4MM3 B;  4QNR A;  1L2D A;  1NVM A;  4B3T M;  3GRV A;  1G3I A;  3UZU A;  4IBI A;  1ORY B;  2I7P A;  2XEP A;  4X65 M;  2CV2 A;  3DZD A;  2Y2M A;  1NNU C;  4NZ1 A;  5EJC A;  3RGP A;  2AHM A;  1XXH B;  4LRT A;  5KQD A;  2DWN A;  1N32 M;  3GRU A;  1YU0 A;  2XD1 A;  3CF0 A;  1GLN A;  2R45 A;  1J7K A;  1K82 A;  1NNJ A;  2OQ4 A;  4HLQ A;  2KXE A;  3U6C A;  1IN6 A;  3MJ5 A;  2J7O A;  2UUB M;  3U6E A;  1TH4 A;  3ZCB B;  4M0W A;  5DNY A;  1PJJ A;  4OVZ B;  4RF1 A;  4JI5 M;  4DV7 M;  3J27 B;  3U6S A;  2KRK A;  2YQZ A;  2YNM D;  2J7N A;  2RGH A;  3TWM A;  2FFF B;  5E6J A;  4OJP A;  3L2A A;  4KLN A;  4LJ9 A;  1YU3 A;  4NSR A;  4DR4 M;  4NOO B;  3JR5 A;  4BLC A;  3HHW A;  1JR3 D;  5FTJ A;  3DFZ A;  2CEA A;  1L1Z A;  3HON A;  1NJG A;  3OTO M;  1YU2 A;  4JXJ A;  4NRW A;  1N36 M;  2CV1 A;  2XD5 A;  4DV0 M;  3N3F A;  1R7R A;  4BBA A;  3R8F A;  1IN5 A;  4XBO A;  2UXB M;  2LH0 A;  3A98 B;  3GLI A;  2XZU A;  4MH0 E;  4PDG A;  3FTE A;  2UXC M;  2DVW B;  2UUA M;  2Z3X A;  3L29 A;  1DGH A;  2Y2O A;  3A45 A;  4LJ4 A;  4LFA M;  2LNH C;  4BB9 A;  2ZAN A;  4PDI A;  2XSZ D;  1EE8 A;  1TDH A;  3KS4 A;  4JV5 M;  1NY6 A;  1QQW A;  2LXE A;  2QBY A;  2C99 A;  1QVR A;  4X64 M;  4G4O A;  2HL7 A;  2C5R A;  2W82 A;  3VKH A;  4NZ4 A;  2L6O A;  1NHW C;  2G5G X;  4LZZ A;  5LMU M;  2Y20 A;  4PD2 A;  1XHB A;  4GHA A;  1NJF A;  1Q39 A;  1D2N A;  4DR7 M;  4GKK M;  3UGJ A;  1R2Z A;  4OJ5 A;  1SXJ C;  4DV6 M;  3DOA A;  1YU1 A;  4MGY E;  5EXP A;  1XWI A;  4LGY A;  5FTM A;  2DZO B;  2XZF A;  2Y2I A;  4X62 M;  3RE8 A;  2EO2 A;  5ITX A;  4GKJ M;  4M0D A;  4R3D A;  5ITY A;  5FTK A;  2EA0 A;  1X37 A;  3VK8 A;  4LF8 M;  4FD2 A;  4MGZ E;  4IBJ A;  1Z5C A;  4G6Z A;  2FNA A;  3CF2 A;  2Y2L A;  3FTD A;  3JAM S;  4I5S A;  4EIW A;  4D81 A;  2ERC A;  3I4Y A;  4CGY B;  3U61 A;  3HU3 A;  4DR6 M;  1HT2 E;  3D8L A;  3FUW A;  4KHP M;  5E26 A;  4LJ8 A;  3WHK A;  2Q2E B;  4JI2 M;  4MB7 A;  4MGI E;  3GRR A;  3KOW E;  4FW9 A;  1T3T A;  2L7I A;  1I4W A;  4WW0 A;  4QOZ C;  1IY0 A;  3B9P A;  3HU2 A;  5F3W A;  4G4Q A;  8CAT A;  1TGU A;  2XFT A;  3KP0 E;  3TWL A;  3HSH A;  1IXZ A;  2YR0 A;  4I8O A;  3GLF B;  2F4V M;  3HJ8 A;  1Z59 A;  3DA1 A;  1DGF A;  3EIE A;  4AKG A;  3U6Q A;  1JQJ C;  3R9X B;  5C1B A;  3GRY A;  2F5N A;  4PCZ A;  3AV0 A;  2QZ4 A;  4JI7 M;  3JR4 A;  1IQP A;  4IJF A;  3SAS A;  2Z4S A;  3HHY A;  4NYU A;  5EXX A;  4QNL A;  2D7G A;  1C1K A;  1N34 M;  2UXD M;  3NBI A;  2C9C A;  2OPF A;  1HQY E;  3TE6 A;  4G4R A;  3T38 A;  5IWA M;  3GLH B;  1KFV A;  4P16 A;  2KW0 A;  1SXJ A;  3SHF A;  1J5E M;  4FWD A;  2I7N A;  3AJI B;  4L8R C;  5H37 D;  5KPT A;  3J7A S;  1HNZ M;  2NQ8 C;  1IXR C;  1PM5 A;  4QHS A;  2F5S A;  1QZM A;  4GC9 A;  5EP3 A;  4LCB A;  1HQC A;  3NWL A;  2HHH M;  3E4R A;  4B3R M;  2Y2H A;  4JN6 A;  3PFI A;  1YSY A;  4ITQ A;  4AG5 A;  2X8A A;  4GH9 A;  3A42 A;  4II7 A;  1LV7 A;  3J2P B;  4JI4 M;  3RGS A;  4OJ6 A;  4GC5 A;  3KP1 E;  3FYC A;  4FCT A;  2K47 A;  2F5Q A;  4M9X A;  4XGI A;  3QWL A;  1W5T A;  2HKJ A;  5BR8 M;  5ITQ A;  2DWL A;  3FTF A;  5IRE B;  3GLG B;  3K8Z A;  3U60 A;  1PJI A;  1QAO A;  3SBJ A;  2HCB A;  3HWS A;  2R18 A;  1NSF A;  4L16 A;  2M5Z A;  2XGN A;  4GRI A;  3U5Z A;  3W0L B;  4AKI A;  1YU4 A;  2BJW A;  3U6L A;  3M7G A;  4B7F A;  3SYK A;  2L09 A;  2FFJ A;  4IBB A;  2LWX A;  3TQS A;  3WX7 A;  3SHG B;  4JI1 M;  2BJV A;  4LGM A;  5DYG A;  3AL0 C;  1XNR M;  2L7H A;  2ZM6 M;  3L25 A;  1IBK M;  1N75 A;  1NHG C;  4Z8X A;  5GKN A;  2FE8 A;  3I4V A;  5EXT A;  4OU7 A;  3SAU A;  2F5O A;  3CTW B;  3GO8 A;  3QAU A;  4GIT A;  4IBK A;  1E94 E;  2ZAO A;  3GQ4 A;  4QHT A;  1Z5B A;  1IXS B;  4GIP A;  4AI6 A;  4MGH A;  3J80 S;  4LFB M;  1N77 A;  3FUT A;  5LMN M;  2UU9 M;  4AG6 A;  1G59 A;  3W0F A;  4DV4 M;  1K3W A;  2KRU A;  3BOS A;  4DV5 M;  1IBM M;  2Y0Q A;  1L2C A;  1HNW M;  3HJS A;  4OJL A;  1E9S A;  1OFI A;  4YY3 M;  3UJN A;  3MHV C;  2UUC M;  3SAT A;  3GQ5 A;  2UWX A;  3L27 A;  3J7B A;  4M9S A;  4DV3 M;  2V1C A;  3U6P A;  4JI8 M;  2D7H A;  2D7E A;  2X4A A;  4FWH A;  3L26 A;  3T1H M;  3M0E A;  2O5R A;  1MX0 A;  1DGG A;  3T1Y M;  4NSO B;  4IIW A;  3WHL A;  3SMS A;  1SXJ D;  3HHX A;  4IBC A;  3MK6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...