4IBBA

Ebola virus vp35 bound to small molecule
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
123
structure length
123
Chain Sequence
DISAKDLRNIMYDHLPGFGTAFHQLVQVICKLGKDSNSLDIIHAEFQASLAEGDSPQCALIQITKRVPIFQDAAPPVIHIRSRGDIPRACQKSLRPVPPSPKIDRGWVCVFQLQDGKTLGLKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Polymerase cofactor VP35
publication title In Silico Derived Small Molecules Bind the Filovirus VP35 Protein and Inhibit Its Polymerase Cofactor Activity.
pubmed doi rcsb
source organism Ebola virus
molecule tags Transcription/transcription inhibitor
total genus 42
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-12-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.950 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4ibbA01
2.10.10.70 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 4ibbA02
5BPVA 4IJFA 4GH9A 3L29A 3KS4A 4IBKA 3KS8A 4GHAA 3L25A 4IBBA 3L26A 3FKEA 4LG2A 4IBGA 4GHLA 3L2AA 4IBEA 3L28A 4IBFA 4IBCA 3L27A 4IBIA 4IBJA 4IBDA 4IJEA
chains in the Genus database with same CATH superfamily
2HL7A 2X49A 2ZBKB 1N36M 1K3WA 2HCBA 1N75A 3LVWA 3U6PA 4OJ6A 3HX3A 1DGHB 1HT2E 4HEOA 2LWXA 1R2ZA 1GXDA 2Y2KA 3KS4A 1EIJA 1YUBA 5GKNA 1IN5A 2IOUA 1YE9A 1KYIA 4GEWA 3SFZA 3C3DA 1YLAA 2DI0A 3C3EA 3GRRA 4MGKE 1N32M 2UXCM 2LH0A 2YNMD 3GO8A 3VDPA 1QYRA 2OOAA 3J27B 1GJSA 1W5TA 2BWBA 1IN4A 3GQ5A 4NL4H 1XB2B 5EJCA 2ZM6M 1L8QA 4WURA 1VEGA 1HNWM 1G8PA 2UXDM 2F5PA 1Z5AA 1WIVA 2Y2MA 2JWSA 5LMNM 3SBJA 4Z2LA 5DNYA 1OIPA 4Z2KA 5IREB 3LW5F 2O25A 5JI3E 4ITQA 1C1KA 1E32A 4DR1M 2G3QA 4AKGA 4MGZE 4Z8XA 1G41A 4NOOB 5C18A 5FSWA 4TUWA 1WGNA 3IECA 1N33M 4LFAM 2KA6B 2RGOA 5IWAM 3NWLA 2DZOB 1XXHA 2J7NA 3HU1A 5IT9S 4QNMA 1OKSA 1EE8A 2APLA 4MB5A 4LG2A 1W1YA 2R44A 4X64M 3THGA 2R46A 1DGGA 4RNAA 1W5SA 1KS0A 3AJIB 2KRKA 4LRSA 2DHYA 2R45A 4MGIE 1ZAEA 1YU4A 2Y2LA 2XH9A 3HJSA 1NJGA 1QDTA 2C96A 4KT0F 5KQDA 3TQSA 2L2DA 3HHYA 1NY6A 2AHMA 3L27A 3WD1A 2MROB 3PXGA 3IG5A 1GLNA 4P17A 3SYKA 1NNJA 1E6RA 1TH2A 2V6ZM 1YSYA 2XEPA 4R3DA 5IZ7D 4LJAA 2BJVA 4NYYA 4QHTA 1XNRM 5F3WA 1GVNA 3JAMS 4QNLA 4IBKA 1WXQA 1C7YA 2BNKA 3AOGA 1Z59A 2MGWA 1YU2A 1W1PA 5C1BA 3L25A 1DGBA 5EXPA 1W1VA 2KXEA 2QHOB 2RRUA 1VDLA 3FRIA 4G4QA 1CUKA 3SARA 1SG9A 1S3SA 4DV5M 7CATA 4HLQA 2MJ5B 2H5XA 4JI0M 4JI3M 3GLFA 2Y2NA 3KFUG 3DZDA 3JR5A 2Y2OA 4B08A 4IBCA 1IBLM 1VQ1A 4IBJA 2HWJA 1E6NA 4GC9A 5L8RF 2CHGA 3Q8GA 3QWLA 4GC5A 4II7A 3CF6E 2UXBM 4CIZA 4I4LA 3WD2A 2M60A 1IFYA 1IN7A 1AIPC 1D2NA 3I51A 3GLFE 2Y20A 3J81S 3B89A 4GHAA 4AZFA 1XXHB 4GKJM 2LVOC 3LQRA 1OJLA 3PVSA 5E26A 4LF9M 3GRYA 1XC8A 1NV8A 1TH4A 2R0IA 4L16A 4DR7M 2Y2PA 5EXTA 4HMDA 2DAGA 4NY2A 4ZPXA 4OJLA 3AKZA 4IJEA 2JUJA 4X65M 2KEBA 4FCWA 1J09A 1OIZA 3W68A 4ANRA 1YUEA 4LJ8A 1Z5BA 2VDBB 3TWMA 3GRVA 3CF0A 4LZJA 3FTFA 1XWIA 1H0GA 1GO5A 1Y8GA 1F4IA 2DAIA 4BLCA 4AKIA 3SAVA 3PFIA 4JI4M 2Y2HA 1G59A 1Q02A 2ZAMA 2QQ8A 2FE8A 3SATA 1MN3A 1QVRA 2JE5A 1N77A 4MB4A 2DZLA 3A98B 3F92A 2RTSA 5EQTA 1E6PA 1Z5CA 2R18A 4R71A 3T15A 2JY8A 2G5GX 3A45A 3B7ZA 3WHKA 1QUTA 2QNJA 1KSFX 4X66M 5KPTA 2KNZA 1TF0B 3U5ZB 4L6V6 1K82A 1E8BA 1L6JA 4OJOA 1IN8A 2FFFB 3I4YA 1ZQ9A 2CE7A 3FTCA 5ITQA 1NVMA 2C9OA 3SC3A 3VLFB 2JXNA 3HU2A 3VKHA 4B7GA 4PDGA 5KQ8A 2FOIC 3KOZE 4QHSA 3J80S 3W0LB 3FYDA 3SAUA 1HQCA 4HMEA 4HL4A 3TWLA 1DGFA 3KOWE 3ZCBB 2L7IA 3GLHB 3GPPA 1I94M 4Y28F 1Q39A 1HT1E 1E15A 3TL4X 2EUCA 2EKKA 2UWXA 1SXJA 4JYAM 2D7GA 5FTNA 4YY3M 2ZTDA 2CV2A 2YQZA 2FFJA 3HONA 4D82A 4NSOB 1OQYA 3FKEA 3UGJA 4PDIA 3KW6A 1Z6TA 3LCUA 4NC6A 2WSFF 3MQLA 2K9DA 4FWDA 1PGYA 3EIHA 1NY5A 3FUVA 1QANA 4B3SM 4LJ4A 2Z3XA 4LF7M 4LJ7A 4DR4M 1SXJE 1QAOA 3TPZA 4B7FA 3WD0A 3KSJA 5EP4A 5EP3A 2W82A 4IBBA 4L4UA 4DV0M 2C9CA 2R4JA 2DZNB 4G4NA 2P5TA 4IBGA 2QPAA 2DKLA 2WZJA 1HR0M 5ITTA 2KDLA 3FTEA 1TDHA 4LFBM 3FUTA 4OUIA 4LF8M 1ZMVA 1JB0F 2H1RA 4LJ5A 3SAWA 3D8BA 2LVPC 4GIPA 5DFLA 1IXSB 4Z2GA 1WHCA 4OX9M 3OTOM 1NHGC 3LMMA 3TWKA 1OGBA 4DV3M 4DUYM 2DHRA 1HQYE 1XXHE 4RF1A 3KP0E 2R4EA 3JR4A 2CUZA 4UN2B 5FTKA 2UUAM 4AI6A 4HMCA 2JNHA 1PJSA 1QAMA 5BPVA 2CV0A 4NZ5A 5EXSA 2DAKA 2LVQD 4MB7A 1XMOM 2XFTA 4AQYM 3K9PA 2NQ8C 4L15A 3J7BA 1NNUC 4MH0E 4RKUF 4G4RA 2WSCF 4JI1M 4LFCM 1CK7A 1PJJA 2VF8A 1D0LA 3T38A 2DWMA 4CJ6A 1E6ZA 2XSZA 3K92A 4LY6A 4RF0A 3GRUA 2L4EA 3AL0C 4NZ4A 1Q3CA 3GQ4A 2R65A 2ZTCA 2YFQA 5DYIA 3B7QA 4DV2M 3NBIA 4OU7A 3VK7A 2XD1A 2Y2GA 1SXJB 3T1YM 3RFWA 3FTDA 2OOBA 3MHVC 4TX8A 3WHLA 3Q8XA 2Y21A 4IBIA 2RKOA 3QAUA 3SMPA 3U5ZA 4AKHA 1WR1B 2FS1A 3WD4A 1NHWC 2LBCA 3I4VA 2J5YA 4GKKM 4NYUA 1ED7A 1YU3A 2WSEF 3CTWB 1IBMM 2K0BX 3HWSA 2KZUA 3B7NA 1RU3A 2ZAOA 4IJFA 3FUWA 4NXNM 3SYLA 2CV1A 2JY7A 2I7PA 3B74A 4PT5A 3IHPA 4WP2A 2XFSA 1N78A 2HKJA 3MJ5A 4DR2M 1GL7A 3CGWA 2QCUA 3ZC7B 1QZMA 2XF3A 1NO1A 1NJFA 2DWLA 4OJPA 1D0MA 1VEJA 3GLHA 3KXEC 1UM8A 4DR6M 2B3TA 2DWZB 5ITXA 1IXZA 4QOSA 4IBFA 1R2YA 4P16A 4QNRA 3T6PA 1WGLA 3D8LA 3GLGA 2QP9X 1SXJC 4D80A 2KNAA 4MGHA 1V92A 4IBDA 2OO9A 1Q3BA 4LJ6A 3AFHA 4OW0A 3GLHE 2CHQA 1E94E 4FVMA 3LQQA 2HHHM 2FH0A 5ITXE 4REZA 3AOEA 4GH9A 3L29A 2Q2EB 2N35A 2ZANA 3RGSA 2OQ4A 3GLGE 2R6FA 3KS8A 2JZ1A 2G8LA 1IQPA 3RE8A 1YU1A 1T3TA 2D7EA 3L26A 1QQWA 4Z2JA 2XGNA 3E46A 3VFDA 3PNYA 1JR3A 3HKPA 2Z8YM 3M7GA 3U60A 5DYGA 4XK8F 5ITUA 4DBGB 1T43A 3H4MA 1GOIA 2C5RA 2CFOA 1PJTA 1D0KA 4YHHM 3MK6A 1IXSA 2QSFX 4A3VB 1EAKA 3K1JA 4M9SA 2BG1A 1IY0A 4G4OA 2OPFA 4L8RC 2EO2A 4L78A 1IY2A 1R4GA 2XZUA 1JR3E 2O5RA 3DFZA 5EP1A 3RGPA 3U6OA 4FWGA 1MX0A 3M6AA 5ITRA 3FUXA 1R7RA 3HHZA 2XLJA 3U6MA 3HJ8A 2J7OA 3E9SA 3HU3A 2BJWA 3UMMA 5H37D 2L7HA 4JV5M 1IN6A 2JCHA 3PNVA 4NSRA 3UZUA 4I8OA 3FRHA 2Z7JA 4PD2A 2EKFA 4LRTA 2QBYA 2VIIA 4GHLA 3WD3A 1PDCA 3J7AS 2JY6B 1OAIA 1P3QQ 4JI8M 3L28A 3J2PB 1VG5A 2CRUA 1ZV1A 1H8PA 3SHFA 2JY5A 3BOSA 4LJ9A 3U61B 1L1ZA 4Z2HA 4LCBA 5KPZA 2YR0A 1XHBA 3CF2A 4DV6M 2JZ0A 3UK6A 3GLGB 1GPFA 2UUBM 1GL6A 4LF4M 1J7KA 2L09A 3HHXA 2F5OA 2DENA 4S12A 1DO2A 5LMUM 1J5EM 4CISA 4MGYE 2BWEA 3GP1A 3ZQJA 1GKIA 4JXJA 2XSZD 1XMQM 1A5TA 2F5NA 1VEKA 2VQFM 3M0EA 1N34M 2HAKA 1HJPA 5A2QS 1GJTA 3VDUA 1QAQA 3QYEA 8CATA 3I01M 2Y0TA 1TH3A 3DOAA 4GRIA 4IIWA 4DR5M 1OFHA 3VK8A 4B3RM 2CEAA 4FD2A 3U60B 2UUCM 4DR3M 1W1TA 3HGIA 2E5LM 3U6DA 4DV4M 3GPYA 1ORYB 3N3FA 3FE3A 2QZ4A 3KP1E 1WJ7A 5EP2A 1MU5A 2GNOA 2FNAA 3ILKA 1IBKM 4PCZA 2L4FA 4NRVA 1NV9A 4FCTA 2LNHC 3SHGB 3KOYE 2KZSA 1QDRA 4OJ5A 3U6LA 1O6IA 3U6QA 3TE6A 3SMSA 4XGIA 2V1UA 4EIWA 2D7HA 2KHHA 4X62M 1OGGA 4FW9A 3AOEC 3GLIB 3ZH9B 4WW0A 2C98A 5FTMA 1AUAA 1PRBA 4B3TM 3HZJA 1L2CA 3K2LA 2XD5A 4D81A 2QBYB 3AV0A 2F5QA 1ZMUA 3L2AA 3C58A 3W67A 4BBAA 4K0KM 3DA1A 2A5YB 3UJNA 3KVWA 4JN6A 2R62A 5BR8M 3R8FA 2VQEM 4LF5M 1FJGM 4DUZM 1AIWA 2LTUA 3I04M 3T1HM 2K6BA 3K9OA 2M5ZA 1OAOC 4G6ZA 4BB9A 3A42A 4DV7M 4XBOA 5JI2E 2V1CA 2JA2A 4LZZA 1L2DA 1E9SA 2MR9A 2K47A 3GPXA 2XZFA 3M7PA 2I7NA 1TGUA 1TDZA 2LVAA 3LVVA 3VKGA 1T6OA 5KPRA 1QUSA 4NXMM 4OVZA 4CGYB 5E6JA 3KDSE 2JP7A 1JR3D 4NZ1A 4MB3A 1JQJC 1V33A 1ZMWA 3W0FA 3IG8A 3EIEA 1K3XA 1DO0A 4B3MM 1R6BX 1EFUB 1LV7A 1IM2A 4AG5A 1HNZM 2Z4SA 2Z4RA 4FWHA 4LF6M 2FN2A 4F2LA 5FTJA 1PJIA 2KRUA 2DAMA 4B7HA 2GQFA 1DV0A 1L1TA 4GITA 1BVSA 3U6EA 2CWBA 3E21A 3U61A 4W5WA 3K8ZA 4M0DA 3U6CA 4M0WA 4G3OA 3GQ3A 3E4RA 4I5SA 2KW0A 4KODA 1TR8A 4M9XA 1PJQA 4NRWA 4NZ3A 1FNNA 3MMPA 4FCVA 4GMQA 2C99A 1NSFA 1VDDA 4I81A 3R9XB 1G71A 1DGHA 1X37A 2MH8A 4DV1M 2Y2IA 1PM5A 4Z2IA 1H0IA 2Y2QA 2Y0QA 2LHGA 4LGMA 1MJGM 4JI6M 1UR8A 1E88A 1QO6A 3U6SA 3WX7A 1G4AE 3BXWA 5ITYA 3C9PA 1SXJD 4LGYA 3FUUA 1IY1A 2VF7A 2EA0A 2DNAA 2UU9M 2V5OA 2D49A 4F1IA 1YU0A 1G3IA 4M9ZA 2X4AA 1CXWA 2KNVA 2F5SA 1IXRC 2O01F 2QENA 3QYBA 1H6UA 4Z6YA 1KFVA 4JI7M 3A46A 5KO3A 1L2BA 2DXIA 1OTRA 1GABA 3FD9A 5FLXS 1OFIA 3HSHA 2CP8A 1HNXM 4JI2M 1QZEA 1I4WA 4CHTB 2DWNA 2CHVA 4OVZB 4AW4A 3KOXE 3BBZA 2LHCA 1LTMA 2LXEA 5EXXA 4AG6A 3GLIA 2Y2JA 2L6OA 4KLNA 1J7MA 1XNQM 1TTEA 2DAEA 3FYCA 2ERCA 2X8AA 3HJQA 3HY5A 2LVNC 3KSXA 3LCVB 1R5LA 4IBEA 4Q7JA 1V34A 3NBXX 5FTLA 3GLFB 3H4JA 3SASA 4MM3B 3B9PA 1E9RA 3GPUA 4JI5M 3GLIE 2RGHA 3V76A 4R7GA 2F4VM 4KHPM 2EJSA 4KO8A 2DVWB 4QOZC 3HHWA 1UR9A 1UFZA
chains in the Genus database with same CATH topology
2HL7A 2X49A 2ZBKB 1N36M 1K3WA 2HCBA 1N75A 3LVWA 3U6PA 4OJ6A 1DGHB 1HT2E 1R2ZA 2LWXA 2Y2KA 3KS4A 1YUBA 5GKNA 1IN5A 2IOUA 1YE9A 1KYIA 3SFZA 1N32M 2UXCM 3GRRA 4MGKE 2LH0A 2YNMD 3GO8A 3VDPA 1QYRA 3J27B 1W5TA 1IN4A 3GQ5A 4NL4H 2ZM6M 5EJCA 1L8QA 4WURA 1HNWM 1G8PA 2UXDM 2F5PA 1Z5AA 2Y2MA 5LMNM 3SBJA 5DNYA 5IREB 5JI3E 4ITQA 1C1KA 1E32A 4DR1M 4AKGA 4MGZE 4Z8XA 1G41A 4NOOB 5C18A 5FSWA 4TUWA 1N33M 4LFAM 2KA6B 2RGOA 5IWAM 3NWLA 2DZOB 1XXHA 2J7NA 3HU1A 5IT9S 4QNMA 1EE8A 4LG2A 4X64M 3THGA 2R46A 1DGGA 4RNAA 1W5SA 3AJIB 2KRKA 4LRSA 2R45A 4MGIE 1YU4A 1ZAEA 2Y2LA 2XH9A 3HJSA 1NJGA 2C96A 5KQDA 3TQSA 3HHYA 1NY6A 2AHMA 3L27A 3PXGA 3IG5A 1GLNA 3SYKA 1NNJA 1TH2A 2V6ZM 1YSYA 2XEPA 4R3DA 5IZ7D 4LJAA 2BJVA 4NYYA 4QHTA 1XNRM 5F3WA 1GVNA 3JAMS 4QNLA 4IBKA 1WXQA 2BNKA 3AOGA 1Z59A 1YU2A 5C1BA 3L25A 1DGBA 5EXPA 2KXEA 4G4QA 3SARA 1S3SA 4DV5M 7CATA 4HLQA 4JI0M 4JI3M 2Y2NA 3GLFA 3KFUG 3DZDA 3JR5A 2Y2OA 4B08A 4IBCA 1IBLM 4IBJA 4GC9A 2UXBM 2CHGA 3QWLA 4GC5A 4II7A 3CF6E 4I4LA 2M60A 1D2NA 1IN7A 3I51A 2Y20A 3J81S 4GHAA 4AZFA 1XXHB 4GKJM 3LQRA 1OJLA 3PVSA 5E26A 4LF9M 3GRYA 1XC8A 1TH4A 4L16A 4DR7M 2Y2PA 5EXTA 4NY2A 4ZPXA 4OJLA 3AKZA 4IJEA 4X65M 2KEBA 4FCWA 1J09A 1YUEA 4LJ8A 1Z5BA 3TWMA 3GRVA 3CF0A 4LZJA 3FTFA 1XWIA 4BLCA 4AKIA 3SAVA 3PFIA 4JI4M 2Y2HA 1G59A 2ZAMA 3SATA 2FE8A 1QVRA 2JE5A 1N77A 3A98B 5EQTA 1Z5CA 2R18A 3T15A 1L2CA 2G5GX 3A45A 3WHKA 4X66M 5KPTA 1K82A 1KSFX 3U5ZB 4OJOA 1IN8A 2FFFB 3I4YA 1ZQ9A 2CE7A 3FTCA 5ITQA 1NVMA 2C9OA 3SC3A 3VLFB 3HU2A 3VKHA 4B7GA 4PDGA 5KQ8A 2FOIC 3KOZE 4QHSA 3J80S 3W0LB 3FYDA 3SAUA 1HQCA 4HL4A 3TWLA 1DGFA 3KOWE 3ZCBB 2L7IA 3GLHB 3GPPA 1I94M 1Q39A 1HT1E 3TL4X 2EUCA 2UWXA 1SXJA 4JYAM 2D7GA 5FTNA 4YY3M 2CV2A 2YQZA 2FFJA 3HONA 4D82A 4NSOB 3FKEA 3UGJA 4PDIA 3KW6A 1Z6TA 4FWDA 3FUVA 3EIHA 1NY5A 4B3SM 1QANA 4LJ4A 2Z3XA 4LF7M 4LJ7A 4DR4M 1SXJE 1QAOA 3TPZA 4B7FA 3KSJA 5EP4A 5EP3A 2W82A 4IBBA 4L4UA 4DV0M 2C9CA 2R4JA 2DZNB 4G4NA 2P5TA 4IBGA 2QPAA 1HR0M 5ITTA 3FTEA 1TDHA 4LFBM 3FUTA 4LF8M 3SAWA 4LJ5A 2H1RA 3D8BA 4GIPA 1IXSB 4OX9M 3OTOM 1NHGC 3LMMA 3TWKA 4DV3M 4DUYM 2DHRA 1HQYE 4RF1A 3JR4A 3KP0E 2R4EA 2CUZA 5FTKA 2UUAM 4AI6A 5BPVA 1QAMA 2CV0A 4NZ5A 5EXSA 4MB7A 1XMOM 2XFTA 4AQYM 2NQ8C 4L15A 3J7BA 1NNUC 4MH0E 4G4RA 4JI1M 4LFCM 1PJJA 3T38A 2DWMA 2XSZA 3K92A 4LY6A 4RF0A 3GRUA 3AL0C 4NZ4A 1Q3CA 3GQ4A 2R65A 2YFQA 5DYIA 4DV2M 3NBIA 4OU7A 3VK7A 2XD1A 2Y2GA 1SXJB 3T1YM 3RFWA 3FTDA 3MHVC 3WHLA 3Q8XA 2Y21A 4IBIA 2RKOA 3QAUA 3SMPA 3U5ZA 4AKHA 1NHWC 3I4VA 4GKKM 4NYUA 1YU3A 3CTWB 1IBMM 3HWSA 2KZUA 2ZAOA 4IJFA 3FUWA 4NXNM 3SYLA 2CV1A 2I7PA 4PT5A 2XFSA 1N78A 2HKJA 3MJ5A 4DR2M 1GL7A 2QCUA 3ZC7B 1QZMA 2XF3A 4OJPA 1NJFA 2DWLA 3GLHA 3KXEC 1UM8A 4DR6M 2DWZB 5ITXA 1IXZA 4QOSA 4IBFA 1R2YA 4P16A 4QNRA 3D8LA 3GLGA 2QP9X 1SXJC 4D80A 4MGHA 4IBDA 1Q3BA 4LJ6A 3AFHA 4OW0A 2CHQA 1E94E 4FVMA 3LQQA 2HHHM 5ITXE 4REZA 3AOEA 4GH9A 3L29A 2Q2EB 2ZANA 3RGSA 2OQ4A 3KS8A 1YU1A 2G8LA 1IQPA 3RE8A 1T3TA 2D7EA 3L26A 1QQWA 2XGNA 3VFDA 3PNYA 1JR3A 3HKPA 3M7GA 3U60A 4OUIA 5DYGA 5ITUA 3H4MA 2C5RA 2CFOA 4YHHM 3MK6A 4A3VB 3K1JA 4M9SA 2BG1A 1IY0A 4G4OA 2OPFA 4L8RC 2EO2A 4L78A 1IY2A 2XZUA 2O5RA 3DFZA 5EP1A 3RGPA 3U6OA 4FWGA 1MX0A 3M6AA 5ITRA 3FUXA 1R7RA 3HHZA 2XLJA 3U6MA 3HJ8A 2J7OA 3E9SA 3HU3A 2BJWA 3UMMA 5H37D 2L7HA 4JV5M 1IN6A 2JCHA 3PNVA 4NSRA 3UZUA 4I8OA 2Z7JA 4PD2A 4LRTA 2QBYA 2VIIA 4GHLA 3J7AS 4JI8M 3L28A 3J2PB 3SHFA 3BOSA 4LJ9A 3U61B 1L1ZA 4LCBA 5KPZA 2YR0A 1XHBA 3CF2A 4DV6M 3GLGB 3UK6A 2UUBM 1GL6A 4LF4M 1J7KA 2L09A 3HHXA 2F5OA 4S12A 1DO2A 5LMUM 1J5EM 4CISA 4MGYE 3GP1A 1GKIA 4JXJA 2XSZD 1XMQM 2F5NA 1N34M 2VQFM 3M0EA 5A2QS 3VDUA 1QAQA 8CATA 2Y0TA 1TH3A 3DOAA 4GRIA 4IIWA 4DR5M 1OFHA 3VK8A 4B3RM 2CEAA 4FD2A 3U60B 2UUCM 4DR3M 3HGIA 2E5LM 3U6DA 4DV4M 3GPYA 1ORYB 3N3FA 2QZ4A 3KP1E 5EP2A 1MU5A 3ILKA 2FNAA 1IBKM 4PCZA 4NRVA 4FCTA 2LNHC 3SHGB 3KOYE 2KZSA 4OJ5A 3U6LA 3U6QA 3TE6A 3SMSA 4XGIA 2V1UA 4EIWA 2D7HA 4X62M 4FW9A 3AOEC 3GLIB 3ZH9B 4WW0A 2C98A 5FTMA 4B3TM 3K2LA 2XD5A 4D81A 2QBYB 3AV0A 2F5QA 3L2AA 3C58A 4BBAA 4K0KM 3DA1A 2A5YB 3UJNA 3KVWA 4JN6A 2R62A 5BR8M 3R8FA 2VQEM 4LF5M 1FJGM 4DUZM 3T1HM 2M5ZA 4G6ZA 4BB9A 3A42A 4DV7M 4XBOA 5JI2E 2V1CA 2JA2A 4LZZA 1L2DA 1E9SA 3GPXA 2K47A 2XZFA 2I7NA 1TGUA 1TDZA 3LVVA 3VKGA 5KPRA 4NXMM 4OVZA 4CGYB 5E6JA 3KDSE 1JR3D 4NZ1A 1JQJC 3W0FA 3IG8A 3EIEA 1K3XA 1DO0A 4B3MM 1R6BX 1LV7A 1IM2A 4AG5A 1HNZM 2Z4SA 2Z4RA 4FWHA 4LF6M 5FTJA 1PJIA 2KRUA 4B7HA 1L1TA 4GITA 3U6EA 3U61A 4W5WA 3K8ZA 4M0DA 3U6CA 4M0WA 3GQ3A 3E4RA 4I5SA 2KW0A 4KODA 4M9XA 4NRWA 4NZ3A 1FNNA 4GMQA 4FCVA 2C99A 1NSFA 1VDDA 4I81A 3R9XB 2Y2IA 1DGHA 1X37A 4DV1M 1PM5A 2Y2QA 2Y0QA 4LGMA 4JI6M 3U6SA 3WX7A 1G4AE 5ITYA 1SXJD 4LGYA 3FUUA 1IY1A 2EA0A 2UU9M 1YU0A 1G3IA 4M9ZA 2X4AA 2F5SA 1IXRC 2QENA 1KFVA 1H6UA 4Z6YA 4JI7M 3A46A 5KO3A 1L2BA 2DXIA 3FD9A 5FLXS 1OFIA 3HSHA 1HNXM 4JI2M 1I4WA 4CHTB 2DWNA 2CHVA 4OVZB 4AW4A 3KOXE 4AG6A 2LXEA 5EXXA 3GLIA 2Y2JA 2L6OA 4KLNA 1XNQM 3FYCA 2ERCA 2X8AA 3HJQA 3KSXA 4IBEA 5FTLA 3SASA 3GLFB 4MM3B 3B9PA 1E9RA 3GPUA 4JI5M 2F4VM 2RGHA 4KHPM 4R7GA 4KO8A 2DVWB 4QOZC 3HHWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BPV A;  4IJF A;  4GH9 A;  3L29 A;  3KS4 A;  4IBK A;  3KS8 A;  4GHA A;  3L25 A;  4IBB A;  3L26 A;  3FKE A;  4LG2 A;  4IBG A;  4GHL A;  3L2A A;  4IBE A;  3L28 A;  4IBF A;  4IBC A;  3L27 A;  4IBI A;  4IBJ A;  4IBD A;  4IJE A; 
#chains in the Genus database with same CATH topology
 2HL7 A;  2X49 A;  2ZBK B;  1N36 M;  1K3W A;  2HCB A;  1N75 A;  3LVW A;  3U6P A;  4OJ6 A;  3HX3 A;  1DGH B;  1HT2 E;  4HEO A;  2LWX A;  1R2Z A;  1GXD A;  2Y2K A;  3KS4 A;  1EIJ A;  1YUB A;  5GKN A;  1IN5 A;  2IOU A;  1YE9 A;  1KYI A;  4GEW A;  3SFZ A;  3C3D A;  1YLA A;  2DI0 A;  3C3E A;  3GRR A;  4MGK E;  1N32 M;  2UXC M;  2LH0 A;  2YNM D;  3GO8 A;  3VDP A;  1QYR A;  2OOA A;  3J27 B;  1GJS A;  1W5T A;  2BWB A;  1IN4 A;  3GQ5 A;  4NL4 H;  1XB2 B;  5EJC A;  2ZM6 M;  1L8Q A;  4WUR A;  1VEG A;  1HNW M;  1G8P A;  2UXD M;  2F5P A;  1Z5A A;  1WIV A;  2Y2M A;  2JWS A;  5LMN M;  3SBJ A;  4Z2L A;  5DNY A;  1OIP A;  4Z2K A;  5IRE B;  3LW5 F;  2O25 A;  5JI3 E;  4ITQ A;  1C1K A;  1E32 A;  4DR1 M;  2G3Q A;  4AKG A;  4MGZ E;  4Z8X A;  1G41 A;  4NOO B;  5C18 A;  5FSW A;  4TUW A;  1WGN A;  3IEC A;  1N33 M;  4LFA M;  2KA6 B;  2RGO A;  5IWA M;  3NWL A;  2DZO B;  1XXH A;  2J7N A;  3HU1 A;  5IT9 S;  4QNM A;  1OKS A;  1EE8 A;  2APL A;  4MB5 A;  4LG2 A;  1W1Y A;  2R44 A;  4X64 M;  3THG A;  2R46 A;  1DGG A;  4RNA A;  1W5S A;  1KS0 A;  3AJI B;  2KRK A;  4LRS A;  2DHY A;  2R45 A;  4MGI E;  1ZAE A;  1YU4 A;  2Y2L A;  2XH9 A;  3HJS A;  1NJG A;  1QDT A;  2C96 A;  4KT0 F;  5KQD A;  3TQS A;  2L2D A;  3HHY A;  1NY6 A;  2AHM A;  3L27 A;  3WD1 A;  2MRO B;  3PXG A;  3IG5 A;  1GLN A;  4P17 A;  3SYK A;  1NNJ A;  1E6R A;  1TH2 A;  2V6Z M;  1YSY A;  2XEP A;  4R3D A;  5IZ7 D;  4LJA A;  2BJV A;  4NYY A;  4QHT A;  1XNR M;  5F3W A;  1GVN A;  3JAM S;  4QNL A;  4IBK A;  1WXQ A;  1C7Y A;  2BNK A;  3AOG A;  1Z59 A;  2MGW A;  1YU2 A;  1W1P A;  5C1B A;  3L25 A;  1DGB A;  5EXP A;  1W1V A;  2KXE A;  2QHO B;  2RRU A;  1VDL A;  3FRI A;  4G4Q A;  1CUK A;  3SAR A;  1SG9 A;  1S3S A;  4DV5 M;  7CAT A;  4HLQ A;  2MJ5 B;  2H5X A;  4JI0 M;  4JI3 M;  3GLF A;  2Y2N A;  3KFU G;  3DZD A;  3JR5 A;  2Y2O A;  4B08 A;  4IBC A;  1IBL M;  1VQ1 A;  4IBJ A;  2HWJ A;  1E6N A;  4GC9 A;  5L8R F;  2CHG A;  3Q8G A;  3QWL A;  4GC5 A;  4II7 A;  3CF6 E;  2UXB M;  4CIZ A;  4I4L A;  3WD2 A;  2M60 A;  1IFY A;  1IN7 A;  1AIP C;  1D2N A;  3I51 A;  3GLF E;  2Y20 A;  3J81 S;  3B89 A;  4GHA A;  4AZF A;  1XXH B;  4GKJ M;  2LVO C;  3LQR A;  1OJL A;  3PVS A;  5E26 A;  4LF9 M;  3GRY A;  1XC8 A;  1NV8 A;  1TH4 A;  2R0I A;  4L16 A;  4DR7 M;  2Y2P A;  5EXT A;  4HMD A;  2DAG A;  4NY2 A;  4ZPX A;  4OJL A;  3AKZ A;  4IJE A;  2JUJ A;  4X65 M;  2KEB A;  4FCW A;  1J09 A;  1OIZ A;  3W68 A;  4ANR A;  1YUE A;  4LJ8 A;  1Z5B A;  2VDB B;  3TWM A;  3GRV A;  3CF0 A;  4LZJ A;  3FTF A;  1XWI A;  1H0G A;  1GO5 A;  1Y8G A;  1F4I A;  2DAI A;  4BLC A;  4AKI A;  3SAV A;  3PFI A;  4JI4 M;  2Y2H A;  1G59 A;  1Q02 A;  2ZAM A;  2QQ8 A;  2FE8 A;  3SAT A;  1MN3 A;  1QVR A;  2JE5 A;  1N77 A;  4MB4 A;  2DZL A;  3A98 B;  3F92 A;  2RTS A;  5EQT A;  1E6P A;  1Z5C A;  2R18 A;  4R71 A;  3T15 A;  2JY8 A;  2G5G X;  3A45 A;  3B7Z A;  3WHK A;  1QUT A;  2QNJ A;  1KSF X;  4X66 M;  5KPT A;  2KNZ A;  1TF0 B;  3U5Z B;  4L6V 6;  1K82 A;  1E8B A;  1L6J A;  4OJO A;  1IN8 A;  2FFF B;  3I4Y A;  1ZQ9 A;  2CE7 A;  3FTC A;  5ITQ A;  1NVM A;  2C9O A;  3SC3 A;  3VLF B;  2JXN A;  3HU2 A;  3VKH A;  4B7G A;  4PDG A;  5KQ8 A;  2FOI C;  3KOZ E;  4QHS A;  3J80 S;  3W0L B;  3FYD A;  3SAU A;  1HQC A;  4HME A;  4HL4 A;  3TWL A;  1DGF A;  3KOW E;  3ZCB B;  2L7I A;  3GLH B;  3GPP A;  1I94 M;  4Y28 F;  1Q39 A;  1HT1 E;  1E15 A;  3TL4 X;  2EUC A;  2EKK A;  2UWX A;  1SXJ A;  4JYA M;  2D7G A;  5FTN A;  4YY3 M;  2ZTD A;  2CV2 A;  2YQZ A;  2FFJ A;  3HON A;  4D82 A;  4NSO B;  1OQY A;  3FKE A;  3UGJ A;  4PDI A;  3KW6 A;  1Z6T A;  3LCU A;  4NC6 A;  2WSF F;  3MQL A;  2K9D A;  4FWD A;  1PGY A;  3EIH A;  1NY5 A;  3FUV A;  1QAN A;  4B3S M;  4LJ4 A;  2Z3X A;  4LF7 M;  4LJ7 A;  4DR4 M;  1SXJ E;  1QAO A;  3TPZ A;  4B7F A;  3WD0 A;  3KSJ A;  5EP4 A;  5EP3 A;  2W82 A;  4IBB A;  4L4U A;  4DV0 M;  2C9C A;  2R4J A;  2DZN B;  4G4N A;  2P5T A;  4IBG A;  2QPA A;  2DKL A;  2WZJ A;  1HR0 M;  5ITT A;  2KDL A;  3FTE A;  1TDH A;  4LFB M;  3FUT A;  4OUI A;  4LF8 M;  1ZMV A;  1JB0 F;  2H1R A;  4LJ5 A;  3SAW A;  3D8B A;  2LVP C;  4GIP A;  5DFL A;  1IXS B;  4Z2G A;  1WHC A;  4OX9 M;  3OTO M;  1NHG C;  3LMM A;  3TWK A;  1OGB A;  4DV3 M;  4DUY M;  2DHR A;  1HQY E;  1XXH E;  4RF1 A;  3KP0 E;  2R4E A;  3JR4 A;  2CUZ A;  4UN2 B;  5FTK A;  2UUA M;  4AI6 A;  4HMC A;  2JNH A;  1PJS A;  1QAM A;  5BPV A;  2CV0 A;  4NZ5 A;  5EXS A;  2DAK A;  2LVQ D;  4MB7 A;  1XMO M;  2XFT A;  4AQY M;  3K9P A;  2NQ8 C;  4L15 A;  3J7B A;  1NNU C;  4MH0 E;  4RKU F;  4G4R A;  2WSC F;  4JI1 M;  4LFC M;  1CK7 A;  1PJJ A;  2VF8 A;  1D0L A;  3T38 A;  2DWM A;  4CJ6 A;  1E6Z A;  2XSZ A;  3K92 A;  4LY6 A;  4RF0 A;  3GRU A;  2L4E A;  3AL0 C;  4NZ4 A;  1Q3C A;  3GQ4 A;  2R65 A;  2ZTC A;  2YFQ A;  5DYI A;  3B7Q A;  4DV2 M;  3NBI A;  4OU7 A;  3VK7 A;  2XD1 A;  2Y2G A;  1SXJ B;  3T1Y M;  3RFW A;  3FTD A;  2OOB A;  3MHV C;  4TX8 A;  3WHL A;  3Q8X A;  2Y21 A;  4IBI A;  2RKO A;  3QAU A;  3SMP A;  3U5Z A;  4AKH A;  1WR1 B;  2FS1 A;  3WD4 A;  1NHW C;  2LBC A;  3I4V A;  2J5Y A;  4GKK M;  4NYU A;  1ED7 A;  1YU3 A;  2WSE F;  3CTW B;  1IBM M;  2K0B X;  3HWS A;  2KZU A;  3B7N A;  1RU3 A;  2ZAO A;  4IJF A;  3FUW A;  4NXN M;  3SYL A;  2CV1 A;  2JY7 A;  2I7P A;  3B74 A;  4PT5 A;  3IHP A;  4WP2 A;  2XFS A;  1N78 A;  2HKJ A;  3MJ5 A;  4DR2 M;  1GL7 A;  3CGW A;  2QCU A;  3ZC7 B;  1QZM A;  2XF3 A;  1NO1 A;  1NJF A;  2DWL A;  4OJP A;  1D0M A;  1VEJ A;  3GLH A;  3KXE C;  1UM8 A;  4DR6 M;  2B3T A;  2DWZ B;  5ITX A;  1IXZ A;  4QOS A;  4IBF A;  1R2Y A;  4P16 A;  4QNR A;  3T6P A;  1WGL A;  3D8L A;  3GLG A;  2QP9 X;  1SXJ C;  4D80 A;  2KNA A;  4MGH A;  1V92 A;  4IBD A;  2OO9 A;  1Q3B A;  4LJ6 A;  3AFH A;  4OW0 A;  3GLH E;  2CHQ A;  1E94 E;  4FVM A;  3LQQ A;  2HHH M;  2FH0 A;  5ITX E;  4REZ A;  3AOE A;  4GH9 A;  3L29 A;  2Q2E B;  2N35 A;  2ZAN A;  3RGS A;  2OQ4 A;  3GLG E;  2R6F A;  3KS8 A;  2JZ1 A;  2G8L A;  1IQP A;  3RE8 A;  1YU1 A;  1T3T A;  2D7E A;  3L26 A;  1QQW A;  4Z2J A;  2XGN A;  3E46 A;  3VFD A;  3PNY A;  1JR3 A;  3HKP A;  2Z8Y M;  3M7G A;  3U60 A;  5DYG A;  4XK8 F;  5ITU A;  4DBG B;  1T43 A;  3H4M A;  1GOI A;  2C5R A;  2CFO A;  1PJT A;  1D0K A;  4YHH M;  3MK6 A;  1IXS A;  2QSF X;  4A3V B;  1EAK A;  3K1J A;  4M9S A;  2BG1 A;  1IY0 A;  4G4O A;  2OPF A;  4L8R C;  2EO2 A;  4L78 A;  1IY2 A;  1R4G A;  2XZU A;  1JR3 E;  2O5R A;  3DFZ A;  5EP1 A;  3RGP A;  3U6O A;  4FWG A;  1MX0 A;  3M6A A;  5ITR A;  3FUX A;  1R7R A;  3HHZ A;  2XLJ A;  3U6M A;  3HJ8 A;  2J7O A;  3E9S A;  3HU3 A;  2BJW A;  3UMM A;  5H37 D;  2L7H A;  4JV5 M;  1IN6 A;  2JCH A;  3PNV A;  4NSR A;  3UZU A;  4I8O A;  3FRH A;  2Z7J A;  4PD2 A;  2EKF A;  4LRT A;  2QBY A;  2VII A;  4GHL A;  3WD3 A;  1PDC A;  3J7A S;  2JY6 B;  1OAI A;  1P3Q Q;  4JI8 M;  3L28 A;  3J2P B;  1VG5 A;  2CRU A;  1ZV1 A;  1H8P A;  3SHF A;  2JY5 A;  3BOS A;  4LJ9 A;  3U61 B;  1L1Z A;  4Z2H A;  4LCB A;  5KPZ A;  2YR0 A;  1XHB A;  3CF2 A;  4DV6 M;  2JZ0 A;  3UK6 A;  3GLG B;  1GPF A;  2UUB M;  1GL6 A;  4LF4 M;  1J7K A;  2L09 A;  3HHX A;  2F5O A;  2DEN A;  4S12 A;  1DO2 A;  5LMU M;  1J5E M;  4CIS A;  4MGY E;  2BWE A;  3GP1 A;  3ZQJ A;  1GKI A;  4JXJ A;  2XSZ D;  1XMQ M;  1A5T A;  2F5N A;  1VEK A;  2VQF M;  3M0E A;  1N34 M;  2HAK A;  1HJP A;  5A2Q S;  1GJT A;  3VDU A;  1QAQ A;  3QYE A;  8CAT A;  3I01 M;  2Y0T A;  1TH3 A;  3DOA A;  4GRI A;  4IIW A;  4DR5 M;  1OFH A;  3VK8 A;  4B3R M;  2CEA A;  4FD2 A;  3U60 B;  2UUC M;  4DR3 M;  1W1T A;  3HGI A;  2E5L M;  3U6D A;  4DV4 M;  3GPY A;  1ORY B;  3N3F A;  3FE3 A;  2QZ4 A;  3KP1 E;  1WJ7 A;  5EP2 A;  1MU5 A;  2GNO A;  2FNA A;  3ILK A;  1IBK M;  4PCZ A;  2L4F A;  4NRV A;  1NV9 A;  4FCT A;  2LNH C;  3SHG B;  3KOY E;  2KZS A;  1QDR A;  4OJ5 A;  3U6L A;  1O6I A;  3U6Q A;  3TE6 A;  3SMS A;  4XGI A;  2V1U A;  4EIW A;  2D7H A;  2KHH A;  4X62 M;  1OGG A;  4FW9 A;  3AOE C;  3GLI B;  3ZH9 B;  4WW0 A;  2C98 A;  5FTM A;  1AUA A;  1PRB A;  4B3T M;  3HZJ A;  1L2C A;  3K2L A;  2XD5 A;  4D81 A;  2QBY B;  3AV0 A;  2F5Q A;  1ZMU A;  3L2A A;  3C58 A;  3W67 A;  4BBA A;  4K0K M;  3DA1 A;  2A5Y B;  3UJN A;  3KVW A;  4JN6 A;  2R62 A;  5BR8 M;  3R8F A;  2VQE M;  4LF5 M;  1FJG M;  4DUZ M;  1AIW A;  2LTU A;  3I04 M;  3T1H M;  2K6B A;  3K9O A;  2M5Z A;  1OAO C;  4G6Z A;  4BB9 A;  3A42 A;  4DV7 M;  4XBO A;  5JI2 E;  2V1C A;  2JA2 A;  4LZZ A;  1L2D A;  1E9S A;  2MR9 A;  2K47 A;  3GPX A;  2XZF A;  3M7P A;  2I7N A;  1TGU A;  1TDZ A;  2LVA A;  3LVV A;  3VKG A;  1T6O A;  5KPR A;  1QUS A;  4NXM M;  4OVZ A;  4CGY B;  5E6J A;  3KDS E;  2JP7 A;  1JR3 D;  4NZ1 A;  4MB3 A;  1JQJ C;  1V33 A;  1ZMW A;  3W0F A;  3IG8 A;  3EIE A;  1K3X A;  1DO0 A;  4B3M M;  1R6B X;  1EFU B;  1LV7 A;  1IM2 A;  4AG5 A;  1HNZ M;  2Z4S A;  2Z4R A;  4FWH A;  4LF6 M;  2FN2 A;  4F2L A;  5FTJ A;  1PJI A;  2KRU A;  2DAM A;  4B7H A;  2GQF A;  1DV0 A;  1L1T A;  4GIT A;  1BVS A;  3U6E A;  2CWB A;  3E21 A;  3U61 A;  4W5W A;  3K8Z A;  4M0D A;  3U6C A;  4M0W A;  4G3O A;  3GQ3 A;  3E4R A;  4I5S A;  2KW0 A;  4KOD A;  1TR8 A;  4M9X A;  1PJQ A;  4NRW A;  4NZ3 A;  1FNN A;  3MMP A;  4FCV A;  4GMQ A;  2C99 A;  1NSF A;  1VDD A;  4I81 A;  3R9X B;  1G71 A;  1DGH A;  1X37 A;  2MH8 A;  4DV1 M;  2Y2I A;  1PM5 A;  4Z2I A;  1H0I A;  2Y2Q A;  2Y0Q A;  2LHG A;  4LGM A;  1MJG M;  4JI6 M;  1UR8 A;  1E88 A;  1QO6 A;  3U6S A;  3WX7 A;  1G4A E;  3BXW A;  5ITY A;  3C9P A;  1SXJ D;  4LGY A;  3FUU A;  1IY1 A;  2VF7 A;  2EA0 A;  2DNA A;  2UU9 M;  2V5O A;  2D49 A;  4F1I A;  1YU0 A;  1G3I A;  4M9Z A;  2X4A A;  1CXW A;  2KNV A;  2F5S A;  1IXR C;  2O01 F;  2QEN A;  3QYB A;  1H6U A;  4Z6Y A;  1KFV A;  4JI7 M;  3A46 A;  5KO3 A;  1L2B A;  2DXI A;  1OTR A;  1GAB A;  3FD9 A;  5FLX S;  1OFI A;  3HSH A;  2CP8 A;  1HNX M;  4JI2 M;  1QZE A;  1I4W A;  4CHT B;  2DWN A;  2CHV A;  4OVZ B;  4AW4 A;  3KOX E;  3BBZ A;  2LHC A;  1LTM A;  2LXE A;  5EXX A;  4AG6 A;  3GLI A;  2Y2J A;  2L6O A;  4KLN A;  1J7M A;  1XNQ M;  1TTE A;  2DAE A;  3FYC A;  2ERC A;  2X8A A;  3HJQ A;  3HY5 A;  2LVN C;  3KSX A;  3LCV B;  1R5L A;  4IBE A;  4Q7J A;  1V34 A;  3NBX X;  5FTL A;  3GLF B;  3H4J A;  3SAS A;  4MM3 B;  3B9P A;  1E9R A;  3GPU A;  4JI5 M;  3GLI E;  2RGH A;  3V76 A;  4R7G A;  2F4V M;  4KHP M;  2EJS A;  4KO8 A;  2DVW B;  4QOZ C;  3HHW A;  1UR9 A;  1UFZ A; 
#chains in the Genus database with same CATH homology
 2HL7 A;  2X49 A;  2ZBK B;  1N36 M;  1K3W A;  2HCB A;  1N75 A;  3LVW A;  3U6P A;  4OJ6 A;  1DGH B;  1HT2 E;  1R2Z A;  2LWX A;  2Y2K A;  3KS4 A;  1YUB A;  5GKN A;  1IN5 A;  2IOU A;  1YE9 A;  1KYI A;  3SFZ A;  1N32 M;  2UXC M;  3GRR A;  4MGK E;  2LH0 A;  2YNM D;  3GO8 A;  3VDP A;  1QYR A;  3J27 B;  1W5T A;  1IN4 A;  3GQ5 A;  4NL4 H;  2ZM6 M;  5EJC A;  1L8Q A;  4WUR A;  1HNW M;  1G8P A;  2UXD M;  2F5P A;  1Z5A A;  2Y2M A;  5LMN M;  3SBJ A;  5DNY A;  5IRE B;  5JI3 E;  4ITQ A;  1C1K A;  1E32 A;  4DR1 M;  4AKG A;  4MGZ E;  4Z8X A;  1G41 A;  4NOO B;  5C18 A;  5FSW A;  4TUW A;  1N33 M;  4LFA M;  2KA6 B;  2RGO A;  5IWA M;  3NWL A;  2DZO B;  1XXH A;  2J7N A;  3HU1 A;  5IT9 S;  4QNM A;  1EE8 A;  4LG2 A;  4X64 M;  3THG A;  2R46 A;  1DGG A;  4RNA A;  1W5S A;  3AJI B;  2KRK A;  4LRS A;  2R45 A;  4MGI E;  1YU4 A;  1ZAE A;  2Y2L A;  2XH9 A;  3HJS A;  1NJG A;  2C96 A;  5KQD A;  3TQS A;  3HHY A;  1NY6 A;  2AHM A;  3L27 A;  3PXG A;  3IG5 A;  1GLN A;  3SYK A;  1NNJ A;  1TH2 A;  2V6Z M;  1YSY A;  2XEP A;  4R3D A;  5IZ7 D;  4LJA A;  2BJV A;  4NYY A;  4QHT A;  1XNR M;  5F3W A;  1GVN A;  3JAM S;  4QNL A;  4IBK A;  1WXQ A;  2BNK A;  3AOG A;  1Z59 A;  1YU2 A;  5C1B A;  3L25 A;  1DGB A;  5EXP A;  2KXE A;  4G4Q A;  3SAR A;  1S3S A;  4DV5 M;  7CAT A;  4HLQ A;  4JI0 M;  4JI3 M;  2Y2N A;  3GLF A;  3KFU G;  3DZD A;  3JR5 A;  2Y2O A;  4B08 A;  4IBC A;  1IBL M;  4IBJ A;  4GC9 A;  2UXB M;  2CHG A;  3QWL A;  4GC5 A;  4II7 A;  3CF6 E;  4I4L A;  2M60 A;  1D2N A;  1IN7 A;  3I51 A;  2Y20 A;  3J81 S;  4GHA A;  4AZF A;  1XXH B;  4GKJ M;  3LQR A;  1OJL A;  3PVS A;  5E26 A;  4LF9 M;  3GRY A;  1XC8 A;  1TH4 A;  4L16 A;  4DR7 M;  2Y2P A;  5EXT A;  4NY2 A;  4ZPX A;  4OJL A;  3AKZ A;  4IJE A;  4X65 M;  2KEB A;  4FCW A;  1J09 A;  1YUE A;  4LJ8 A;  1Z5B A;  3TWM A;  3GRV A;  3CF0 A;  4LZJ A;  3FTF A;  1XWI A;  4BLC A;  4AKI A;  3SAV A;  3PFI A;  4JI4 M;  2Y2H A;  1G59 A;  2ZAM A;  3SAT A;  2FE8 A;  1QVR A;  2JE5 A;  1N77 A;  3A98 B;  5EQT A;  1Z5C A;  2R18 A;  3T15 A;  1L2C A;  2G5G X;  3A45 A;  3WHK A;  4X66 M;  5KPT A;  1K82 A;  1KSF X;  3U5Z B;  4OJO A;  1IN8 A;  2FFF B;  3I4Y A;  1ZQ9 A;  2CE7 A;  3FTC A;  5ITQ A;  1NVM A;  2C9O A;  3SC3 A;  3VLF B;  3HU2 A;  3VKH A;  4B7G A;  4PDG A;  5KQ8 A;  2FOI C;  3KOZ E;  4QHS A;  3J80 S;  3W0L B;  3FYD A;  3SAU A;  1HQC A;  4HL4 A;  3TWL A;  1DGF A;  3KOW E;  3ZCB B;  2L7I A;  3GLH B;  3GPP A;  1I94 M;  1Q39 A;  1HT1 E;  3TL4 X;  2EUC A;  2UWX A;  1SXJ A;  4JYA M;  2D7G A;  5FTN A;  4YY3 M;  2CV2 A;  2YQZ A;  2FFJ A;  3HON A;  4D82 A;  4NSO B;  3FKE A;  3UGJ A;  4PDI A;  3KW6 A;  1Z6T A;  4FWD A;  3FUV A;  3EIH A;  1NY5 A;  4B3S M;  1QAN A;  4LJ4 A;  2Z3X A;  4LF7 M;  4LJ7 A;  4DR4 M;  1SXJ E;  1QAO A;  3TPZ A;  4B7F A;  3KSJ A;  5EP4 A;  5EP3 A;  2W82 A;  4IBB A;  4L4U A;  4DV0 M;  2C9C A;  2R4J A;  2DZN B;  4G4N A;  2P5T A;  4IBG A;  2QPA A;  1HR0 M;  5ITT A;  3FTE A;  1TDH A;  4LFB M;  3FUT A;  4LF8 M;  3SAW A;  4LJ5 A;  2H1R A;  3D8B A;  4GIP A;  1IXS B;  4OX9 M;  3OTO M;  1NHG C;  3LMM A;  3TWK A;  4DV3 M;  4DUY M;  2DHR A;  1HQY E;  4RF1 A;  3JR4 A;  3KP0 E;  2R4E A;  2CUZ A;  5FTK A;  2UUA M;  4AI6 A;  5BPV A;  1QAM A;  2CV0 A;  4NZ5 A;  5EXS A;  4MB7 A;  1XMO M;  2XFT A;  4AQY M;  2NQ8 C;  4L15 A;  3J7B A;  1NNU C;  4MH0 E;  4G4R A;  4JI1 M;  4LFC M;  1PJJ A;  3T38 A;  2DWM A;  2XSZ A;  3K92 A;  4LY6 A;  4RF0 A;  3GRU A;  3AL0 C;  4NZ4 A;  1Q3C A;  3GQ4 A;  2R65 A;  2YFQ A;  5DYI A;  4DV2 M;  3NBI A;  4OU7 A;  3VK7 A;  2XD1 A;  2Y2G A;  1SXJ B;  3T1Y M;  3RFW A;  3FTD A;  3MHV C;  3WHL A;  3Q8X A;  2Y21 A;  4IBI A;  2RKO A;  3QAU A;  3SMP A;  3U5Z A;  4AKH A;  1NHW C;  3I4V A;  4GKK M;  4NYU A;  1YU3 A;  3CTW B;  1IBM M;  3HWS A;  2KZU A;  2ZAO A;  4IJF A;  3FUW A;  4NXN M;  3SYL A;  2CV1 A;  2I7P A;  4PT5 A;  2XFS A;  1N78 A;  2HKJ A;  3MJ5 A;  4DR2 M;  1GL7 A;  2QCU A;  3ZC7 B;  1QZM A;  2XF3 A;  4OJP A;  1NJF A;  2DWL A;  3GLH A;  3KXE C;  1UM8 A;  4DR6 M;  2DWZ B;  5ITX A;  1IXZ A;  4QOS A;  4IBF A;  1R2Y A;  4P16 A;  4QNR A;  3D8L A;  3GLG A;  2QP9 X;  1SXJ C;  4D80 A;  4MGH A;  4IBD A;  1Q3B A;  4LJ6 A;  3AFH A;  4OW0 A;  2CHQ A;  1E94 E;  4FVM A;  3LQQ A;  2HHH M;  5ITX E;  4REZ A;  3AOE A;  4GH9 A;  3L29 A;  2Q2E B;  2ZAN A;  3RGS A;  2OQ4 A;  3KS8 A;  1YU1 A;  2G8L A;  1IQP A;  3RE8 A;  1T3T A;  2D7E A;  3L26 A;  1QQW A;  2XGN A;  3VFD A;  3PNY A;  1JR3 A;  3HKP A;  3M7G A;  3U60 A;  4OUI A;  5DYG A;  5ITU A;  3H4M A;  2C5R A;  2CFO A;  4YHH M;  3MK6 A;  4A3V B;  3K1J A;  4M9S A;  2BG1 A;  1IY0 A;  4G4O A;  2OPF A;  4L8R C;  2EO2 A;  4L78 A;  1IY2 A;  2XZU A;  2O5R A;  3DFZ A;  5EP1 A;  3RGP A;  3U6O A;  4FWG A;  1MX0 A;  3M6A A;  5ITR A;  3FUX A;  1R7R A;  3HHZ A;  2XLJ A;  3U6M A;  3HJ8 A;  2J7O A;  3E9S A;  3HU3 A;  2BJW A;  3UMM A;  5H37 D;  2L7H A;  4JV5 M;  1IN6 A;  2JCH A;  3PNV A;  4NSR A;  3UZU A;  4I8O A;  2Z7J A;  4PD2 A;  4LRT A;  2QBY A;  2VII A;  4GHL A;  3J7A S;  4JI8 M;  3L28 A;  3J2P B;  3SHF A;  3BOS A;  4LJ9 A;  3U61 B;  1L1Z A;  4LCB A;  5KPZ A;  2YR0 A;  1XHB A;  3CF2 A;  4DV6 M;  3GLG B;  3UK6 A;  2UUB M;  1GL6 A;  4LF4 M;  1J7K A;  2L09 A;  3HHX A;  2F5O A;  4S12 A;  1DO2 A;  5LMU M;  1J5E M;  4CIS A;  4MGY E;  3GP1 A;  1GKI A;  4JXJ A;  2XSZ D;  1XMQ M;  2F5N A;  1N34 M;  2VQF M;  3M0E A;  5A2Q S;  3VDU A;  1QAQ A;  8CAT A;  2Y0T A;  1TH3 A;  3DOA A;  4GRI A;  4IIW A;  4DR5 M;  1OFH A;  3VK8 A;  4B3R M;  2CEA A;  4FD2 A;  3U60 B;  2UUC M;  4DR3 M;  3HGI A;  2E5L M;  3U6D A;  4DV4 M;  3GPY A;  1ORY B;  3N3F A;  2QZ4 A;  3KP1 E;  5EP2 A;  1MU5 A;  3ILK A;  2FNA A;  1IBK M;  4PCZ A;  4NRV A;  4FCT A;  2LNH C;  3SHG B;  3KOY E;  2KZS A;  4OJ5 A;  3U6L A;  3U6Q A;  3TE6 A;  3SMS A;  4XGI A;  2V1U A;  4EIW A;  2D7H A;  4X62 M;  4FW9 A;  3AOE C;  3GLI B;  3ZH9 B;  4WW0 A;  2C98 A;  5FTM A;  4B3T M;  3K2L A;  2XD5 A;  4D81 A;  2QBY B;  3AV0 A;  2F5Q A;  3L2A A;  3C58 A;  4BBA A;  4K0K M;  3DA1 A;  2A5Y B;  3UJN A;  3KVW A;  4JN6 A;  2R62 A;  5BR8 M;  3R8F A;  2VQE M;  4LF5 M;  1FJG M;  4DUZ M;  3T1H M;  2M5Z A;  4G6Z A;  4BB9 A;  3A42 A;  4DV7 M;  4XBO A;  5JI2 E;  2V1C A;  2JA2 A;  4LZZ A;  1L2D A;  1E9S A;  3GPX A;  2K47 A;  2XZF A;  2I7N A;  1TGU A;  1TDZ A;  3LVV A;  3VKG A;  5KPR A;  4NXM M;  4OVZ A;  4CGY B;  5E6J A;  3KDS E;  1JR3 D;  4NZ1 A;  1JQJ C;  3W0F A;  3IG8 A;  3EIE A;  1K3X A;  1DO0 A;  4B3M M;  1R6B X;  1LV7 A;  1IM2 A;  4AG5 A;  1HNZ M;  2Z4S A;  2Z4R A;  4FWH A;  4LF6 M;  5FTJ A;  1PJI A;  2KRU A;  4B7H A;  1L1T A;  4GIT A;  3U6E A;  3U61 A;  4W5W A;  3K8Z A;  4M0D A;  3U6C A;  4M0W A;  3GQ3 A;  3E4R A;  4I5S A;  2KW0 A;  4KOD A;  4M9X A;  4NRW A;  4NZ3 A;  1FNN A;  4GMQ A;  4FCV A;  2C99 A;  1NSF A;  1VDD A;  4I81 A;  3R9X B;  2Y2I A;  1DGH A;  1X37 A;  4DV1 M;  1PM5 A;  2Y2Q A;  2Y0Q A;  4LGM A;  4JI6 M;  3U6S A;  3WX7 A;  1G4A E;  5ITY A;  1SXJ D;  4LGY A;  3FUU A;  1IY1 A;  2EA0 A;  2UU9 M;  1YU0 A;  1G3I A;  4M9Z A;  2X4A A;  2F5S A;  1IXR C;  2QEN A;  1KFV A;  1H6U A;  4Z6Y A;  4JI7 M;  3A46 A;  5KO3 A;  1L2B A;  2DXI A;  3FD9 A;  5FLX S;  1OFI A;  3HSH A;  1HNX M;  4JI2 M;  1I4W A;  4CHT B;  2DWN A;  2CHV A;  4OVZ B;  4AW4 A;  3KOX E;  4AG6 A;  2LXE A;  5EXX A;  3GLI A;  2Y2J A;  2L6O A;  4KLN A;  1XNQ M;  3FYC A;  2ERC A;  2X8A A;  3HJQ A;  3KSX A;  4IBE A;  5FTL A;  3SAS A;  3GLF B;  4MM3 B;  3B9P A;  1E9R A;  3GPU A;  4JI5 M;  2F4V M;  2RGH A;  4KHP M;  4R7G A;  4KO8 A;  2DVW B;  4QOZ C;  3HHW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...