4IBFA

Ebola virus vp35 bound to small molecule
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
123
structure length
123
Chain Sequence
DISAKDLRNIMYDHLPGFGTAFHQLVQVICKLGKDSNSLDIIHAEFQASLAEGDSPQCALIQITKRVPIFQDAAPPVIHIRSRGDIPRACQKSLRPVPPSPKIDRGWVCVFQLQDGKTLGLKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Polymerase cofactor VP35
publication title In Silico Derived Small Molecules Bind the Filovirus VP35 Protein and Inhibit Its Polymerase Cofactor Activity.
pubmed doi rcsb
source organism Ebola virus
molecule tags Transcription/transcription inhibitor
total genus 42
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-12-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.950 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4ibfA01
2.10.10.70 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 4ibfA02
3L29A 4LG2A 4IBEA 4IBIA 3L2AA 4GHLA 5BPVA 4IBKA 4IJEA 4GH9A 3FKEA 4IBDA 3KS8A 4GHAA 3L25A 4IBFA 3L26A 3KS4A 4IBJA 4IBCA 3L28A 4IBGA 3L27A 4IJFA 4IBBA
chains in the Genus database with same CATH superfamily
2KW0A 1GXDA 2CUZA 3AOEA 4NRWA 1Z5AA 3TE6A 5DFLA 1OAOC 3MQLA 3LVWA 5FTLA 1IBLM 2QP9X 1QAOA 1GL6A 3FE3A 5KO3A 3M0EA 4IBKA 4AG6A 3T15A 4NL4H 5ITQA 1VEGA 3CTWB 5EP4A 1L2CA 2UUBM 2BWBA 2I7NA 4OVZA 3U6SA 2RGHA 2FFFB 2QENA 1E6RA 1K3XA 3FKEA 1IN6A 2CHVA 3F92A 3RE8A 2WSFF 4OW0A 1E6ZA 2RRUA 4DV0M 3FRIA 3KVWA 2DZOB 3LMMA 1HJPA 4GKJM 1NY6A 4M0DA 1G41A 4QNLA 5H37D 5EXTA 3SYKA 1TR8A 3HJQA 2Z7JA 4GMQA 5FTMA 1EAKA 2Y2JA 3M7PA 3M7GA 4IBBA 1JB0F 4LFAM 2M5ZA 3KOZE 4GIPA 1V33A 1DO0A 4QNMA 3W68A 2Y2LA 4UN2B 2LVAA 2MR9A 3HHZA 3BBZA 2QSFX 3FUVA 2CV1A 2LBCA 1G59A 5KPRA 1IXRC 1G71A 4JI5M 2APLA 2KA6B 2OO9A 4LF9M 4AG5A 2Y0QA 5EXXA 3GLHA 4HMDA 3GLIE 4TX8A 3E9SA 3B9PA 3LCVB 1T43A 1OKSA 3T1HM 4AKGA 3SFZA 1GL7A 3J2PB 5JI2E 3ZC7B 7CATA 3BXWA 3THGA 4Z6YA 2Y2IA 1ZMWA 1ZAEA 1JQJC 2K9DA 1O6IA 4FVMA 3B74A 1J7MA 1DGHA 2J7OA 1L1TA 4OJ5A 3CGWA 4NZ5A 4AKHA 2I7PA 3DA1A 3GP1A 2CP8A 2H1RA 3R9XB 1IY2A 1P3QQ 1OIZA 2C98A 1Z5BA 4Z2JA 1OTRA 1SXJA 3T6PA 5KPZA 4MB3A 4F2LA 4MGYE 4FW9A 4G4QA 5FTJA 3SHGB 3CF0A 4W5WA 4K0KM 3DOAA 2Y2OA 1YE9A 3WHLA 4FCWA 4DR3M 4LF5M 1SXJD 3FYCA 2RTSA 4M9XA 1QAMA 2FH0A 4MB5A 5IT9S 5LMNM 1OAIA 1QZEA 2DAGA 2MJ5B 4KO8A 4NRVA 2BWEA 4OVZB 3JAMS 4P16A 1IBKM 1W1TA 1PJIA 4LJ5A 4LJ4A 3KP0E 4GHLA 3N3FA 4LCBA 1D0LA 2L09A 2UWXA 2XFSA 4QNRA 3SAVA 1PGYA 4B3SM 1TDZA 3I51A 2B3TA 2L7IA 3SHFA 3VKHA 2JWSA 2QNJA 1PDCA 3FUXA 2Y0TA 2ZAMA 1D0KA 1WGLA 5ITUA 1E94E 1KS0A 2CV2A 2KXEA 4MGZE 3DFZA 1N77A 4S12A 3T38A 4LFBM 1R7RA 3TWKA 2DWLA 1GOIA 1NJGA 1GLNA 1NV8A 5DYGA 1MX0A 3E21A 4GC9A 4CIZA 3NBIA 3GLHB 2XZUA 1NHWC 1QDTA 3MK6A 3PNVA 1S3SA 2QQ8A 4XBOA 5EP3A 1DO2A 4B7HA 1XMQM 3QWLA 4OU7A 1PJJA 2JNHA 2JY5A 4HEOA 1NNJA 2XH9A 4JI0M 4IBIA 2F5QA 3JR5A 1T3TA 1HNXM 2F5PA 4JYAM 5E26A 2LNHC 3J7BA 3ILKA 4R3DA 1XWIA 2CHQA 1N34M 3HJ8A 4IJEA 4JI7M 2DWNA 3IECA 1X37A 3C3DA 4LGYA 4I81A 1IY0A 1QZMA 2W82A 3VDUA 2JY8A 1BVSA 3QYBA 4QOSA 1V34A 4IBDA 4PDIA 4OJPA 1AIWA 2GNOA 4Z2IA 1OGBA 4MH0E 4NYYA 3KSJA 5JI3E 3KOWE 4X66M 3SASA 4B7GA 2X49A 1VQ1A 2HAKA 5FLXS 3HGIA 3L28A 3WX7A 3IG8A 1KSFX 2L4EA 1SXJB 1YUEA 4QHSA 3I01M 1YU4A 4MB4A 4DR1M 1IQPA 2F4VM 2X4AA 3HU3A 4GRIA 2KHHA 3U61B 2KDLA 2LH0A 3K1JA 4LY6A 3VLFB 3HWSA 1H8PA 1QDRA 2VF8A 5BR8M 4BB9A 1RU3A 1WIVA 4G4RA 3GO8A 3GLGB 3GRUA 2RKOA 4KT0F 1N78A 3KSXA 1YU0A 1TDHA 2LWXA 3U6CA 2DZNB 2CE7A 3VKGA 3VK7A 2R44A 2R46A 2VDBB 3GLHE 3KS8A 3GLFB 3V76A 3M6AA 2EJSA 4X65M 1A5TA 4LRSA 1GO5A 1WXQA 2QBYB 1HT2E 2CWBA 4WURA 1HR0M 4WP2A 4LF4M 1H0IA 1IFYA 1D0MA 2DHYA 5C1BA 1YU1A 1MN3A 1XB2B 2R6FA 5KQDA 3GQ4A 2R4JA 3WD0A 2HCBA 3KOXE 1N36M 4CISA 2DKLA 4DV1M 1R2ZA 4LZJA 3ZH9B 5FTNA 4ITQA 4PCZA 2ZANA 2KRKA 3IG5A 3SMSA 1DGBA 4PD2A 2UUAM 1WJ7A 4LJ6A 1R5LA 2NQ8C 4KLNA 4CJ6A 2RGOA 3J80S 4FD2A 1JR3A 4D81A 4L16A 3U6EA 4L78A 3W67A 1I94M 1DGFA 4JI4M 4Z2LA 1SXJE 1UR9A 3UZUA 4B3MM 1GJTA 2XFTA 4PT5A 5ITYA 1LTMA 3GPUA 2Y2KA 3LW5F 1NHGC 4M9ZA 3D8BA 1C7YA 3HZJA 2CHGA 1F4IA 2DAIA 1JR3D 1TH4A 1HQCA 3I4VA 4BBAA 3J27B 4GKKM 4B3RM 5EP2A 1XHBA 2XD1A 3HKPA 1CK7A 4AQYM 3AJIB 3PVSA 4GITA 3AKZA 4G4OA 2D49A 3GQ5A 2YQZA 2WSCF 5FSWA 2MGWA 1GVNA 1Z6TA 2CFOA 1GKIA 5GKNA 3ZCBB 1PJSA 1J09A 2UU9M 4LRTA 4JI2M 2DI0A 2DENA 2L7HA 3WD3A 3AV0A 3HSHA 4G3OA 2ZTCA 2O01F 3FUWA 4XK8F 4MGKE 2UXBM 2J5YA 1NV9A 4PDGA 3UMMA 1NO1A 1J7KA 2DAMA 4HL4A 3U61A 2KNVA 2XZFA 3SMPA 2XF3A 4LJ9A 3U6LA 3U60B 4X62M 3UJNA 1YU3A 4FWDA 3GLGA 1OFHA 2V1UA 1N32M 2G8LA 1IXZA 3ZQJA 2Y2GA 1EFUB 3U6OA 2OOAA 2JY7A 3D8LA 3U6MA 4IBEA 1SG9A 2ZBKB 5ITTA 2Y20A 4Y28F 3GLFA 5FTKA 2JXNA 2YNMD 1Q3CA 2JCHA 3RGSA 4YHHM 2QBYA 1NSFA 1ZV1A 2HHHM 1HNZM 4L15A 1MU5A 4HLQA 2MROB 4KODA 1XC8A 4DV4M 4LF7M 4TUWA 2DWZB 3B7ZA 2Y2QA 1HT1E 1R6BX 1TTEA 4DR5M 4IBFA 1K3WA 1QANA 2V6ZM 2L2DA 3TQSA 5C18A 2OOBA 3L27A 4F1IA 2M60A 3I04M 2UXCM 1IN4A 2LVNC 2YFQA 4B08A 1ZMUA 3EIHA 4HMCA 1Y8GA 2ZM6M 4B7FA 1L2BA 2EKKA 4FWHA 3U5ZB 3WD1A 3QAUA 4FCVA 2BG1A 1Q39A 2A5YB 4BLCA 4DR7M 2JP7A 1W1VA 4GC5A 1XXHB 2JZ1A 1TH3A 4LJAA 5DYIA 2L6OA 1NVMA 3AOEC 1L1ZA 1V92A 3FD9A 3WHKA 3IHPA 2XSZD 1L6JA 1L2DA 1QAQA 2QZ4A 3K9OA 4GH9A 3RFWA 3UGJA 3L25A 3MMPA 1E9RA 3FUUA 3KOYE 2Q2EB 2O25A 2XLJA 3LVVA 4IBJA 1AIPC 1GJSA 4I5SA 1GPFA 2JE5A 4MB7A 2DAEA 2C9OA 4Z2KA 2EO2A 4REZA 4DV5M 4OJ6A 4LFCM 2ZAOA 3LCUA 4JXJA 3L2AA 3GRVA 4ZPXA 4KHPM 2G5GX 1VEKA 3EIEA 3R8FA 1IY1A 1CUKA 1NNUC 2FFJA 2FOIC 4Z8XA 2D7HA 2K47A 3C3EA 3PFIA 5EJCA 3U60A 4JI6M 4NXMM 1AUAA 4NSOB 4Z2HA 3HONA 2D7GA 3TWLA 4LJ7A 2JY6B 3BOSA 1XNRM 4FCTA 2KZUA 2VF7A 4NOOB 1N33M 1PJQA 2DHRA 1JR3E 2K0BX 2KNAA 4D82A 3K2LA 2DZLA 2Z4RA 2R45A 1YUBA 5EQTA 1PM5A 1UFZA 1IBMM 3GLIB 3RGPA 3TPZA 4DV2M 4RNAA 1Z5CA 2DXIA 2LVPC 4M9SA 3AOGA 4NSRA 5IWAM 4DR6M 1W1YA 4R7GA 3KXEC 1E6PA 2H5XA 4M0WA 2DWMA 2Z3XA 2QCUA 2KEBA 4DUYM 1XMOM 2EKFA 2DAKA 5E6JA 1G8PA 2FE8A 2F5NA 3H4JA 3K92A 2C9CA 1EE8A 1EIJA 2QPAA 3KW6A 4DR4M 4AKIA 3W0LB 3TL4X 5L8RF 4JI3M 3MJ5A 1QUTA 5DNYA 3HHYA 3U6PA 4NY2A 3FTFA 1E6NA 1C1KA 2KRUA 4AZFA 3SATA 4WW0A 4GHAA 1Q02A 4LZZA 2HWJA 1YLAA 3A45A 3GRRA 1SXJC 2LVOC 2WZJA 4RKUF 2CV0A 3U5ZA 3HU2A 3NBXX 1W5TA 1QVRA 2R62A 3GRYA 4RF0A 2OQ4A 4G6ZA 2F5OA 1GABA 4AW4A 1XXHA 4A3VB 3J7AS 2D7EA 2DVWB 3W0FA 2UXDM 4DV3M 2KZSA 3HU1A 4YY3M 4RF1A 4NZ3A 1OQYA 1WHCA 3GLGE 5F3WA 3L29A 4NC6A 3LQQA 4LG2A 3B7NA 3HHXA 1PRBA 1E15A 3JR4A 2VQEM 3KP1E 4OUIA 8CATA 1UM8A 5BPVA 3E4RA 4L6V6 3GLFE 3U6QA 4JI1M 1VDLA 2P5TA 3SC3A 4G4NA 1IM2A 2R0IA 1H0GA 1R4GA 3DZDA 3PNYA 1HNWM 1QO6A 4R71A 1J5EM 2CEAA 1XNQM 4X64M 4Z2GA 2LHCA 2UUCM 1LV7A 3L26A 2JA2A 4QHTA 3FTEA 1ZQ9A 1TH2A 3FUTA 4GEWA 4ANRA 4XGIA 2LHGA 3HY5A 4JN6A 3WD2A 4DV7M 4D80A 5KQ8A 3FYDA 4OX9M 3B89A 1Z59A 2FNAA 3SAUA 1WGNA 3A42A 1G4AE 2LTUA 3Q8XA 2EA0A 3GLIA 3E46A 2FN2A 1TF0B 3GPXA 1IN7A 1I4WA 2BJWA 2LXEA 4MM3B 3UK6A 3J81S 2CRUA 1E8BA 2OPFA 2ERCA 3SARA 1IXSB 3FRHA 1MJGM 1CXWA 2AHMA 2MH8A 3VFDA 3A46A 3KDSE 3SYLA 1FNNA 1VDDA 4L4UA 2X8AA 3VK8A 4CGYB 3QYEA 2E5LM 3C58A 1FJGM 3FTDA 2Z4SA 4MGIE 2O5RA 4Q7JA 2C99A 2VIIA 1VG5A 3KS4A 4OJOA 2Y2HA 3CF2A 1QYRA 5ITRA 3I4YA 4IBGA 2J7NA 1T6OA 4NXNM 4P17A 4HMEA 4NZ1A 1VEJA 3T1YM 2Z8YM 4AI6A 2FS1A 1OJLA 2V1CA 2XSZA 4I8OA 4NZ4A 2C96A 3AFHA 3LQRA 3AL0C 2HL7A 2K6BA 2WSEF 2BNKA 5IZ7D 3U6DA 3PXGA 2JUJA 4II7A 1NY5A 4L8RC 2F5SA 2R4EA 4IIWA 4NYUA 1KFVA 3OTOM 1NJFA 3VDPA 2C5RA 1R2YA 3KFUG 3HJSA 2Y2PA 3C9PA 2VQFM 4LF6M 2XEPA 5LMUM 5EXPA 2EUCA 2JZ0A 1TGUA 3B7QA 1QQWA 1HQYE 1ZMVA 2QHOB 1E88A 1G3IA 3H4MA 4B3TM 3HHWA 1IN5A 3K9PA 4IBCA 5EP1A 4DV6M 2DNAA 1H6UA 1WR1B 1Q3BA 4I4LA 2IOUA 2V5OA 3K8ZA 2Y2MA 4IJFA 2BJVA 1OFIA 5EXSA 4JI8M 3A98B 4MGHA 2XD5A 1L8QA 1E32A 4LF8M 3Q8GA 3MHVC 4QOZC 3HX3A 1YU2A 5ITXE 4OJLA 1PJTA 1N75A 3NWLA 1E9SA 1W5SA 1KYIA 1D2NA 4LGMA 1ORYB 4JV5M 1DGHB 2Y2NA 1OIPA 2R65A 4DUZM 2R18A 2ZTDA 3CF6E 1DGGA 2L4FA 4LJ8A 1OGGA 1ED7A 3GQ3A 3GPYA 5A2QS 1IN8A 2YR0A 3GPPA 3TWMA 1DV0A 3WD4A 4DBGB 1K82A 2HKJA 3SAWA 2N35A 2G3QA 1W1PA 2Y21A 2LVQD 1QUSA 1YSYA 2KNZA 2XGNA 4FWGA 5IREB 1IXSA 2GQFA 5ITXA 5KPTA 4CHTB 4DR2M 3SBJA 3FTCA 4EIWA 1UR8A 1XXHE
chains in the Genus database with same CATH topology
2KW0A 2CUZA 3AOEA 4NRWA 1Z5AA 3TE6A 3LVWA 5FTLA 1IBLM 2QP9X 1QAOA 1GL6A 5KO3A 3M0EA 4IBKA 4AG6A 3T15A 4NL4H 5ITQA 3CTWB 5EP4A 2UUBM 1L2CA 2I7NA 4OVZA 3U6SA 2RGHA 2FFFB 2QENA 1K3XA 3FKEA 1IN6A 2CHVA 3RE8A 4OW0A 4DV0M 3KVWA 2DZOB 3LMMA 4GKJM 1NY6A 4M0DA 1G41A 4QNLA 5H37D 5EXTA 3SYKA 3HJQA 2Z7JA 4GMQA 5FTMA 2Y2JA 3M7GA 4IBBA 4LFAM 2Y2LA 2M5ZA 3KOZE 4GIPA 4QNMA 1DO0A 3HHZA 2CV1A 3FUVA 1G59A 5KPRA 1IXRC 4JI5M 2KA6B 4LF9M 4AG5A 2Y0QA 5EXXA 3GLHA 3E9SA 3B9PA 3T1HM 4AKGA 3SFZA 1GL7A 3J2PB 5JI2E 3ZC7B 7CATA 3THGA 4Z6YA 2Y2IA 4NZ5A 1ZAEA 1JQJC 4FVMA 1DGHA 2J7OA 1L1TA 4OJ5A 4AKHA 2I7PA 3DA1A 3GP1A 2H1RA 3R9XB 1IY2A 2C98A 1Z5BA 1SXJA 5KPZA 4MGYE 4FW9A 4G4QA 5FTJA 3SHGB 3CF0A 4W5WA 4K0KM 3DOAA 2Y2OA 1YE9A 3WHLA 4FCWA 4DR3M 4LF5M 1SXJD 3FYCA 4M9XA 1QAMA 5IT9S 5LMNM 4OVZB 4KO8A 4NRVA 1IBKM 3JAMS 4P16A 1PJIA 4LJ5A 4LJ4A 3KP0E 4GHLA 3N3FA 4LCBA 2L09A 2UWXA 2XFSA 4QNRA 3SAVA 4B3SM 1TDZA 3I51A 3VKHA 2L7IA 3SHFA 3FUXA 2Y0TA 2ZAMA 5ITUA 1E94E 2CV2A 2KXEA 4MGZE 3DFZA 1N77A 4S12A 3T38A 4LFBM 1R7RA 3TWKA 2DWLA 1NJGA 1GLNA 5DYGA 1MX0A 4GC9A 3NBIA 3GLHB 2XZUA 1NHWC 3MK6A 5EP3A 3PNVA 1S3SA 4XBOA 4B7HA 1XMQM 1DO2A 3QWLA 4OU7A 1PJJA 1NNJA 2XH9A 4JI0M 4IBIA 2F5QA 3JR5A 1T3TA 1HNXM 2F5PA 4JYAM 5E26A 2LNHC 3J7BA 3ILKA 4R3DA 1XWIA 2CHQA 1N34M 3HJ8A 4IJEA 4JI7M 2DWNA 1X37A 3VDUA 4LGYA 4I81A 1IY0A 1QZMA 2W82A 4QOSA 4OJPA 4IBDA 4PDIA 4MH0E 4NYYA 3KSJA 5JI3E 3KOWE 4X66M 3SASA 4B7GA 2X49A 3WX7A 5FLXS 3HGIA 3L28A 3IG8A 1KSFX 1SXJB 1YUEA 4QHSA 1YU4A 4DR1M 1IQPA 2F4VM 2X4AA 3HU3A 4GRIA 3U61B 2LH0A 3K1JA 4LY6A 3VLFB 3HWSA 5BR8M 4BB9A 4G4RA 3GO8A 3GLGB 3GRUA 2RKOA 1N78A 3KSXA 1YU0A 1TDHA 2LWXA 3U6CA 2DZNB 2CE7A 3VKGA 3VK7A 2R46A 3KS8A 3GLFB 3M6AA 4X65M 4LRSA 1WXQA 2QBYB 1HT2E 4WURA 1HR0M 4LF4M 5C1BA 1YU1A 3GQ4A 5KQDA 2R4JA 2HCBA 3KOXE 1N36M 4CISA 4DV1M 1R2ZA 4LZJA 3ZH9B 5FTNA 4ITQA 4PCZA 2ZANA 3IG5A 2KRKA 3SMSA 1DGBA 4PD2A 2UUAM 4LJ6A 2NQ8C 4KLNA 2RGOA 3J80S 4FD2A 1JR3A 4D81A 4L16A 3U6EA 4L78A 1I94M 1DGFA 4JI4M 1SXJE 3UZUA 4B3MM 2XFTA 4PT5A 5ITYA 3GPUA 2Y2KA 1NHGC 4M9ZA 3D8BA 2CHGA 1JR3D 1TH4A 1HQCA 3I4VA 4BBAA 3J27B 4GKKM 4B3RM 5EP2A 1XHBA 2XD1A 3HKPA 4AQYM 3AJIB 3PVSA 4GITA 3AKZA 4G4OA 3GQ5A 2YQZA 5FSWA 1GVNA 1Z6TA 2CFOA 1GKIA 5GKNA 3ZCBB 2UU9M 1J09A 4JI2M 4LRTA 2L7HA 3AV0A 3HSHA 3FUWA 4MGKE 2UXBM 4PDGA 3UMMA 1J7KA 4HL4A 3U61A 2XZFA 3SMPA 2XF3A 4LJ9A 3U6LA 3U60B 4X62M 3UJNA 1YU3A 4FWDA 3GLGA 1OFHA 2V1UA 1N32M 2G8LA 1IXZA 2Y2GA 3U6OA 3D8LA 3U6MA 4IBEA 5ITTA 2ZBKB 2Y20A 3GLFA 5FTKA 2YNMD 1Q3CA 2JCHA 3RGSA 4YHHM 2QBYA 1NSFA 2HHHM 1HNZM 4L15A 1MU5A 4HLQA 4KODA 1XC8A 4DV4M 4LF7M 4TUWA 2DWZB 2Y2QA 1HT1E 1R6BX 4DR5M 4IBFA 1K3WA 1QANA 2V6ZM 3TQSA 5C18A 3L27A 2UXCM 2M60A 1IN4A 2YFQA 4B08A 3EIHA 2ZM6M 4B7FA 1L2BA 4FWHA 3U5ZB 3QAUA 4FCVA 2BG1A 1Q39A 2A5YB 4BLCA 4DR7M 4GC5A 1XXHB 1TH3A 4LJAA 5DYIA 2L6OA 1NVMA 3AOEC 1L1ZA 3FD9A 3WHKA 2XSZD 1L2DA 1QAQA 2QZ4A 4GH9A 3UGJA 3RFWA 3L25A 1E9RA 3FUUA 3KOYE 2Q2EB 2XLJA 3LVVA 4IBJA 4I5SA 2JE5A 4MB7A 2C9OA 2EO2A 4REZA 4DV5M 4OJ6A 4LFCM 2ZAOA 4JXJA 3L2AA 3GRVA 4ZPXA 4KHPM 2G5GX 3EIEA 3R8FA 1IY1A 1NNUC 2FFJA 2FOIC 4Z8XA 2D7HA 2K47A 3PFIA 5EJCA 3U60A 4JI6M 4NXMM 4NSOB 3HONA 2D7GA 3TWLA 4LJ7A 1XNRM 3BOSA 2KZUA 4NOOB 1N33M 2DHRA 4D82A 1PM5A 3K2LA 2Z4RA 2R45A 1YUBA 5EQTA 1IBMM 3GLIB 3RGPA 3TPZA 4DV2M 4RNAA 1Z5CA 2DXIA 4M9SA 3AOGA 4NSRA 5IWAM 4DR6M 4R7GA 3KXEC 4M0WA 2DWMA 2Z3XA 2QCUA 2KEBA 4DUYM 1XMOM 5E6JA 2F5NA 1G8PA 2FE8A 3K92A 2C9CA 1EE8A 2QPAA 3KW6A 4DR4M 4AKIA 3W0LB 3TL4X 4JI3M 3MJ5A 5DNYA 3HHYA 3U6PA 4NY2A 3FTFA 1C1KA 2KRUA 4AZFA 3SATA 4WW0A 4GHAA 4LZZA 3A45A 3GRRA 1SXJC 2CV0A 3U5ZA 3HU2A 4RF0A 1W5TA 1QVRA 2R62A 3GRYA 2OQ4A 2F5OA 4G6ZA 4AW4A 1XXHA 4A3VB 3J7AS 2D7EA 2DVWB 3W0FA 2UXDM 4DV3M 2KZSA 3HU1A 4YY3M 4RF1A 4NZ3A 5F3WA 3L29A 3LQQA 4LG2A 3HHXA 3JR4A 2VQEM 3KP1E 4OUIA 8CATA 1UM8A 5BPVA 3E4RA 3U6QA 4JI1M 2P5TA 3SC3A 4G4NA 1IM2A 3DZDA 3PNYA 1HNWM 1J5EM 2CEAA 1XNQM 4X64M 2UUCM 1LV7A 3L26A 2JA2A 4QHTA 3FTEA 1ZQ9A 1TH2A 3FUTA 4XGIA 4JN6A 4DV7M 4D80A 5KQ8A 3FYDA 4OX9M 1Z59A 2FNAA 3SAUA 3A42A 1G4AE 3Q8XA 2EA0A 3GLIA 3GPXA 1IN7A 1I4WA 2BJWA 2LXEA 4MM3B 3UK6A 3J81S 2OPFA 2ERCA 3SARA 1IXSB 2AHMA 3VFDA 3A46A 3KDSE 3SYLA 1FNNA 1VDDA 4L4UA 2X8AA 3VK8A 4CGYB 2E5LM 3C58A 1FJGM 3FTDA 2Z4SA 4MGIE 2O5RA 2C99A 2VIIA 4OJOA 3KS4A 2Y2HA 3CF2A 1QYRA 5ITRA 3I4YA 4IBGA 2J7NA 4NZ1A 4NXNM 3T1YM 4AI6A 1OJLA 2V1CA 2XSZA 4I8OA 4NZ4A 2C96A 3AFHA 3LQRA 3AL0C 2HL7A 5IZ7D 2BNKA 3U6DA 3PXGA 4II7A 1NY5A 4L8RC 2F5SA 2R4EA 4IIWA 4NYUA 1KFVA 3OTOM 1NJFA 3VDPA 2C5RA 1R2YA 3KFUG 3HJSA 2Y2PA 2VQFM 4LF6M 2XEPA 5LMUM 5EXPA 2EUCA 1TGUA 1QQWA 1HQYE 1G3IA 3H4MA 4B3TM 3HHWA 1IN5A 4IBCA 4DV6M 5EP1A 1H6UA 4I4LA 1Q3BA 2IOUA 3K8ZA 2Y2MA 4IJFA 2BJVA 1OFIA 5EXSA 4JI8M 3A98B 4MGHA 2XD5A 1L8QA 1E32A 4LF8M 3MHVC 4QOZC 1YU2A 5ITXE 4OJLA 1N75A 3NWLA 1E9SA 1W5SA 1KYIA 1D2NA 4LGMA 1ORYB 4JV5M 1DGHB 2Y2NA 2R65A 4DUZM 2R18A 3CF6E 1DGGA 4LJ8A 3GQ3A 3GPYA 5A2QS 1IN8A 2YR0A 3GPPA 3TWMA 1K82A 2HKJA 3SAWA 2Y21A 4FWGA 1YSYA 2XGNA 5IREB 3SBJA 5ITXA 5KPTA 4CHTB 4DR2M 3FTCA 4EIWA 4FCTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L29 A;  4LG2 A;  4IBE A;  4IBI A;  3L2A A;  4GHL A;  5BPV A;  4IBK A;  4IJE A;  4GH9 A;  3FKE A;  4IBD A;  3KS8 A;  4GHA A;  3L25 A;  4IBF A;  3L26 A;  3KS4 A;  4IBJ A;  4IBC A;  3L28 A;  4IBG A;  3L27 A;  4IJF A;  4IBB A; 
#chains in the Genus database with same CATH topology
 2KW0 A;  1GXD A;  2CUZ A;  3AOE A;  4NRW A;  1Z5A A;  3TE6 A;  5DFL A;  1OAO C;  3MQL A;  3LVW A;  5FTL A;  1IBL M;  2QP9 X;  1QAO A;  1GL6 A;  3FE3 A;  5KO3 A;  3M0E A;  4IBK A;  4AG6 A;  3T15 A;  4NL4 H;  5ITQ A;  1VEG A;  3CTW B;  5EP4 A;  1L2C A;  2UUB M;  2BWB A;  2I7N A;  4OVZ A;  3U6S A;  2RGH A;  2FFF B;  2QEN A;  1E6R A;  1K3X A;  3FKE A;  1IN6 A;  2CHV A;  3F92 A;  3RE8 A;  2WSF F;  4OW0 A;  1E6Z A;  2RRU A;  4DV0 M;  3FRI A;  3KVW A;  2DZO B;  3LMM A;  1HJP A;  4GKJ M;  1NY6 A;  4M0D A;  1G41 A;  4QNL A;  5H37 D;  5EXT A;  3SYK A;  1TR8 A;  3HJQ A;  2Z7J A;  4GMQ A;  5FTM A;  1EAK A;  2Y2J A;  3M7P A;  3M7G A;  4IBB A;  1JB0 F;  4LFA M;  2M5Z A;  3KOZ E;  4GIP A;  1V33 A;  1DO0 A;  4QNM A;  3W68 A;  2Y2L A;  4UN2 B;  2LVA A;  2MR9 A;  3HHZ A;  3BBZ A;  2QSF X;  3FUV A;  2CV1 A;  2LBC A;  1G59 A;  5KPR A;  1IXR C;  1G71 A;  4JI5 M;  2APL A;  2KA6 B;  2OO9 A;  4LF9 M;  4AG5 A;  2Y0Q A;  5EXX A;  3GLH A;  4HMD A;  3GLI E;  4TX8 A;  3E9S A;  3B9P A;  3LCV B;  1T43 A;  1OKS A;  3T1H M;  4AKG A;  3SFZ A;  1GL7 A;  3J2P B;  5JI2 E;  3ZC7 B;  7CAT A;  3BXW A;  3THG A;  4Z6Y A;  2Y2I A;  1ZMW A;  1ZAE A;  1JQJ C;  2K9D A;  1O6I A;  4FVM A;  3B74 A;  1J7M A;  1DGH A;  2J7O A;  1L1T A;  4OJ5 A;  3CGW A;  4NZ5 A;  4AKH A;  2I7P A;  3DA1 A;  3GP1 A;  2CP8 A;  2H1R A;  3R9X B;  1IY2 A;  1P3Q Q;  1OIZ A;  2C98 A;  1Z5B A;  4Z2J A;  1OTR A;  1SXJ A;  3T6P A;  5KPZ A;  4MB3 A;  4F2L A;  4MGY E;  4FW9 A;  4G4Q A;  5FTJ A;  3SHG B;  3CF0 A;  4W5W A;  4K0K M;  3DOA A;  2Y2O A;  1YE9 A;  3WHL A;  4FCW A;  4DR3 M;  4LF5 M;  1SXJ D;  3FYC A;  2RTS A;  4M9X A;  1QAM A;  2FH0 A;  4MB5 A;  5IT9 S;  5LMN M;  1OAI A;  1QZE A;  2DAG A;  2MJ5 B;  4KO8 A;  4NRV A;  2BWE A;  4OVZ B;  3JAM S;  4P16 A;  1IBK M;  1W1T A;  1PJI A;  4LJ5 A;  4LJ4 A;  3KP0 E;  4GHL A;  3N3F A;  4LCB A;  1D0L A;  2L09 A;  2UWX A;  2XFS A;  4QNR A;  3SAV A;  1PGY A;  4B3S M;  1TDZ A;  3I51 A;  2B3T A;  2L7I A;  3SHF A;  3VKH A;  2JWS A;  2QNJ A;  1PDC A;  3FUX A;  2Y0T A;  2ZAM A;  1D0K A;  1WGL A;  5ITU A;  1E94 E;  1KS0 A;  2CV2 A;  2KXE A;  4MGZ E;  3DFZ A;  1N77 A;  4S12 A;  3T38 A;  4LFB M;  1R7R A;  3TWK A;  2DWL A;  1GOI A;  1NJG A;  1GLN A;  1NV8 A;  5DYG A;  1MX0 A;  3E21 A;  4GC9 A;  4CIZ A;  3NBI A;  3GLH B;  2XZU A;  1NHW C;  1QDT A;  3MK6 A;  3PNV A;  1S3S A;  2QQ8 A;  4XBO A;  5EP3 A;  1DO2 A;  4B7H A;  1XMQ M;  3QWL A;  4OU7 A;  1PJJ A;  2JNH A;  2JY5 A;  4HEO A;  1NNJ A;  2XH9 A;  4JI0 M;  4IBI A;  2F5Q A;  3JR5 A;  1T3T A;  1HNX M;  2F5P A;  4JYA M;  5E26 A;  2LNH C;  3J7B A;  3ILK A;  4R3D A;  1XWI A;  2CHQ A;  1N34 M;  3HJ8 A;  4IJE A;  4JI7 M;  2DWN A;  3IEC A;  1X37 A;  3C3D A;  4LGY A;  4I81 A;  1IY0 A;  1QZM A;  2W82 A;  3VDU A;  2JY8 A;  1BVS A;  3QYB A;  4QOS A;  1V34 A;  4IBD A;  4PDI A;  4OJP A;  1AIW A;  2GNO A;  4Z2I A;  1OGB A;  4MH0 E;  4NYY A;  3KSJ A;  5JI3 E;  3KOW E;  4X66 M;  3SAS A;  4B7G A;  2X49 A;  1VQ1 A;  2HAK A;  5FLX S;  3HGI A;  3L28 A;  3WX7 A;  3IG8 A;  1KSF X;  2L4E A;  1SXJ B;  1YUE A;  4QHS A;  3I01 M;  1YU4 A;  4MB4 A;  4DR1 M;  1IQP A;  2F4V M;  2X4A A;  3HU3 A;  4GRI A;  2KHH A;  3U61 B;  2KDL A;  2LH0 A;  3K1J A;  4LY6 A;  3VLF B;  3HWS A;  1H8P A;  1QDR A;  2VF8 A;  5BR8 M;  4BB9 A;  1RU3 A;  1WIV A;  4G4R A;  3GO8 A;  3GLG B;  3GRU A;  2RKO A;  4KT0 F;  1N78 A;  3KSX A;  1YU0 A;  1TDH A;  2LWX A;  3U6C A;  2DZN B;  2CE7 A;  3VKG A;  3VK7 A;  2R44 A;  2R46 A;  2VDB B;  3GLH E;  3KS8 A;  3GLF B;  3V76 A;  3M6A A;  2EJS A;  4X65 M;  1A5T A;  4LRS A;  1GO5 A;  1WXQ A;  2QBY B;  1HT2 E;  2CWB A;  4WUR A;  1HR0 M;  4WP2 A;  4LF4 M;  1H0I A;  1IFY A;  1D0M A;  2DHY A;  5C1B A;  1YU1 A;  1MN3 A;  1XB2 B;  2R6F A;  5KQD A;  3GQ4 A;  2R4J A;  3WD0 A;  2HCB A;  3KOX E;  1N36 M;  4CIS A;  2DKL A;  4DV1 M;  1R2Z A;  4LZJ A;  3ZH9 B;  5FTN A;  4ITQ A;  4PCZ A;  2ZAN A;  2KRK A;  3IG5 A;  3SMS A;  1DGB A;  4PD2 A;  2UUA M;  1WJ7 A;  4LJ6 A;  1R5L A;  2NQ8 C;  4KLN A;  4CJ6 A;  2RGO A;  3J80 S;  4FD2 A;  1JR3 A;  4D81 A;  4L16 A;  3U6E A;  4L78 A;  3W67 A;  1I94 M;  1DGF A;  4JI4 M;  4Z2L A;  1SXJ E;  1UR9 A;  3UZU A;  4B3M M;  1GJT A;  2XFT A;  4PT5 A;  5ITY A;  1LTM A;  3GPU A;  2Y2K A;  3LW5 F;  1NHG C;  4M9Z A;  3D8B A;  1C7Y A;  3HZJ A;  2CHG A;  1F4I A;  2DAI A;  1JR3 D;  1TH4 A;  1HQC A;  3I4V A;  4BBA A;  3J27 B;  4GKK M;  4B3R M;  5EP2 A;  1XHB A;  2XD1 A;  3HKP A;  1CK7 A;  4AQY M;  3AJI B;  3PVS A;  4GIT A;  3AKZ A;  4G4O A;  2D49 A;  3GQ5 A;  2YQZ A;  2WSC F;  5FSW A;  2MGW A;  1GVN A;  1Z6T A;  2CFO A;  1GKI A;  5GKN A;  3ZCB B;  1PJS A;  1J09 A;  2UU9 M;  4LRT A;  4JI2 M;  2DI0 A;  2DEN A;  2L7H A;  3WD3 A;  3AV0 A;  3HSH A;  4G3O A;  2ZTC A;  2O01 F;  3FUW A;  4XK8 F;  4MGK E;  2UXB M;  2J5Y A;  1NV9 A;  4PDG A;  3UMM A;  1NO1 A;  1J7K A;  2DAM A;  4HL4 A;  3U61 A;  2KNV A;  2XZF A;  3SMP A;  2XF3 A;  4LJ9 A;  3U6L A;  3U60 B;  4X62 M;  3UJN A;  1YU3 A;  4FWD A;  3GLG A;  1OFH A;  2V1U A;  1N32 M;  2G8L A;  1IXZ A;  3ZQJ A;  2Y2G A;  1EFU B;  3U6O A;  2OOA A;  2JY7 A;  3D8L A;  3U6M A;  4IBE A;  1SG9 A;  2ZBK B;  5ITT A;  2Y20 A;  4Y28 F;  3GLF A;  5FTK A;  2JXN A;  2YNM D;  1Q3C A;  2JCH A;  3RGS A;  4YHH M;  2QBY A;  1NSF A;  1ZV1 A;  2HHH M;  1HNZ M;  4L15 A;  1MU5 A;  4HLQ A;  2MRO B;  4KOD A;  1XC8 A;  4DV4 M;  4LF7 M;  4TUW A;  2DWZ B;  3B7Z A;  2Y2Q A;  1HT1 E;  1R6B X;  1TTE A;  4DR5 M;  4IBF A;  1K3W A;  1QAN A;  2V6Z M;  2L2D A;  3TQS A;  5C18 A;  2OOB A;  3L27 A;  4F1I A;  2M60 A;  3I04 M;  2UXC M;  1IN4 A;  2LVN C;  2YFQ A;  4B08 A;  1ZMU A;  3EIH A;  4HMC A;  1Y8G A;  2ZM6 M;  4B7F A;  1L2B A;  2EKK A;  4FWH A;  3U5Z B;  3WD1 A;  3QAU A;  4FCV A;  2BG1 A;  1Q39 A;  2A5Y B;  4BLC A;  4DR7 M;  2JP7 A;  1W1V A;  4GC5 A;  1XXH B;  2JZ1 A;  1TH3 A;  4LJA A;  5DYI A;  2L6O A;  1NVM A;  3AOE C;  1L1Z A;  1V92 A;  3FD9 A;  3WHK A;  3IHP A;  2XSZ D;  1L6J A;  1L2D A;  1QAQ A;  2QZ4 A;  3K9O A;  4GH9 A;  3RFW A;  3UGJ A;  3L25 A;  3MMP A;  1E9R A;  3FUU A;  3KOY E;  2Q2E B;  2O25 A;  2XLJ A;  3LVV A;  4IBJ A;  1AIP C;  1GJS A;  4I5S A;  1GPF A;  2JE5 A;  4MB7 A;  2DAE A;  2C9O A;  4Z2K A;  2EO2 A;  4REZ A;  4DV5 M;  4OJ6 A;  4LFC M;  2ZAO A;  3LCU A;  4JXJ A;  3L2A A;  3GRV A;  4ZPX A;  4KHP M;  2G5G X;  1VEK A;  3EIE A;  3R8F A;  1IY1 A;  1CUK A;  1NNU C;  2FFJ A;  2FOI C;  4Z8X A;  2D7H A;  2K47 A;  3C3E A;  3PFI A;  5EJC A;  3U60 A;  4JI6 M;  4NXM M;  1AUA A;  4NSO B;  4Z2H A;  3HON A;  2D7G A;  3TWL A;  4LJ7 A;  2JY6 B;  3BOS A;  1XNR M;  4FCT A;  2KZU A;  2VF7 A;  4NOO B;  1N33 M;  1PJQ A;  2DHR A;  1JR3 E;  2K0B X;  2KNA A;  4D82 A;  3K2L A;  2DZL A;  2Z4R A;  2R45 A;  1YUB A;  5EQT A;  1PM5 A;  1UFZ A;  1IBM M;  3GLI B;  3RGP A;  3TPZ A;  4DV2 M;  4RNA A;  1Z5C A;  2DXI A;  2LVP C;  4M9S A;  3AOG A;  4NSR A;  5IWA M;  4DR6 M;  1W1Y A;  4R7G A;  3KXE C;  1E6P A;  2H5X A;  4M0W A;  2DWM A;  2Z3X A;  2QCU A;  2KEB A;  4DUY M;  1XMO M;  2EKF A;  2DAK A;  5E6J A;  1G8P A;  2FE8 A;  2F5N A;  3H4J A;  3K92 A;  2C9C A;  1EE8 A;  1EIJ A;  2QPA A;  3KW6 A;  4DR4 M;  4AKI A;  3W0L B;  3TL4 X;  5L8R F;  4JI3 M;  3MJ5 A;  1QUT A;  5DNY A;  3HHY A;  3U6P A;  4NY2 A;  3FTF A;  1E6N A;  1C1K A;  2KRU A;  4AZF A;  3SAT A;  4WW0 A;  4GHA A;  1Q02 A;  4LZZ A;  2HWJ A;  1YLA A;  3A45 A;  3GRR A;  1SXJ C;  2LVO C;  2WZJ A;  4RKU F;  2CV0 A;  3U5Z A;  3HU2 A;  3NBX X;  1W5T A;  1QVR A;  2R62 A;  3GRY A;  4RF0 A;  2OQ4 A;  4G6Z A;  2F5O A;  1GAB A;  4AW4 A;  1XXH A;  4A3V B;  3J7A S;  2D7E A;  2DVW B;  3W0F A;  2UXD M;  4DV3 M;  2KZS A;  3HU1 A;  4YY3 M;  4RF1 A;  4NZ3 A;  1OQY A;  1WHC A;  3GLG E;  5F3W A;  3L29 A;  4NC6 A;  3LQQ A;  4LG2 A;  3B7N A;  3HHX A;  1PRB A;  1E15 A;  3JR4 A;  2VQE M;  3KP1 E;  4OUI A;  8CAT A;  1UM8 A;  5BPV A;  3E4R A;  4L6V 6;  3GLF E;  3U6Q A;  4JI1 M;  1VDL A;  2P5T A;  3SC3 A;  4G4N A;  1IM2 A;  2R0I A;  1H0G A;  1R4G A;  3DZD A;  3PNY A;  1HNW M;  1QO6 A;  4R71 A;  1J5E M;  2CEA A;  1XNQ M;  4X64 M;  4Z2G A;  2LHC A;  2UUC M;  1LV7 A;  3L26 A;  2JA2 A;  4QHT A;  3FTE A;  1ZQ9 A;  1TH2 A;  3FUT A;  4GEW A;  4ANR A;  4XGI A;  2LHG A;  3HY5 A;  4JN6 A;  3WD2 A;  4DV7 M;  4D80 A;  5KQ8 A;  3FYD A;  4OX9 M;  3B89 A;  1Z59 A;  2FNA A;  3SAU A;  1WGN A;  3A42 A;  1G4A E;  2LTU A;  3Q8X A;  2EA0 A;  3GLI A;  3E46 A;  2FN2 A;  1TF0 B;  3GPX A;  1IN7 A;  1I4W A;  2BJW A;  2LXE A;  4MM3 B;  3UK6 A;  3J81 S;  2CRU A;  1E8B A;  2OPF A;  2ERC A;  3SAR A;  1IXS B;  3FRH A;  1MJG M;  1CXW A;  2AHM A;  2MH8 A;  3VFD A;  3A46 A;  3KDS E;  3SYL A;  1FNN A;  1VDD A;  4L4U A;  2X8A A;  3VK8 A;  4CGY B;  3QYE A;  2E5L M;  3C58 A;  1FJG M;  3FTD A;  2Z4S A;  4MGI E;  2O5R A;  4Q7J A;  2C99 A;  2VII A;  1VG5 A;  3KS4 A;  4OJO A;  2Y2H A;  3CF2 A;  1QYR A;  5ITR A;  3I4Y A;  4IBG A;  2J7N A;  1T6O A;  4NXN M;  4P17 A;  4HME A;  4NZ1 A;  1VEJ A;  3T1Y M;  2Z8Y M;  4AI6 A;  2FS1 A;  1OJL A;  2V1C A;  2XSZ A;  4I8O A;  4NZ4 A;  2C96 A;  3AFH A;  3LQR A;  3AL0 C;  2HL7 A;  2K6B A;  2WSE F;  2BNK A;  5IZ7 D;  3U6D A;  3PXG A;  2JUJ A;  4II7 A;  1NY5 A;  4L8R C;  2F5S A;  2R4E A;  4IIW A;  4NYU A;  1KFV A;  3OTO M;  1NJF A;  3VDP A;  2C5R A;  1R2Y A;  3KFU G;  3HJS A;  2Y2P A;  3C9P A;  2VQF M;  4LF6 M;  2XEP A;  5LMU M;  5EXP A;  2EUC A;  2JZ0 A;  1TGU A;  3B7Q A;  1QQW A;  1HQY E;  1ZMV A;  2QHO B;  1E88 A;  1G3I A;  3H4M A;  4B3T M;  3HHW A;  1IN5 A;  3K9P A;  4IBC A;  5EP1 A;  4DV6 M;  2DNA A;  1H6U A;  1WR1 B;  1Q3B A;  4I4L A;  2IOU A;  2V5O A;  3K8Z A;  2Y2M A;  4IJF A;  2BJV A;  1OFI A;  5EXS A;  4JI8 M;  3A98 B;  4MGH A;  2XD5 A;  1L8Q A;  1E32 A;  4LF8 M;  3Q8G A;  3MHV C;  4QOZ C;  3HX3 A;  1YU2 A;  5ITX E;  4OJL A;  1PJT A;  1N75 A;  3NWL A;  1E9S A;  1W5S A;  1KYI A;  1D2N A;  4LGM A;  1ORY B;  4JV5 M;  1DGH B;  2Y2N A;  1OIP A;  2R65 A;  4DUZ M;  2R18 A;  2ZTD A;  3CF6 E;  1DGG A;  2L4F A;  4LJ8 A;  1OGG A;  1ED7 A;  3GQ3 A;  3GPY A;  5A2Q S;  1IN8 A;  2YR0 A;  3GPP A;  3TWM A;  1DV0 A;  3WD4 A;  4DBG B;  1K82 A;  2HKJ A;  3SAW A;  2N35 A;  2G3Q A;  1W1P A;  2Y21 A;  2LVQ D;  1QUS A;  1YSY A;  2KNZ A;  2XGN A;  4FWG A;  5IRE B;  1IXS A;  2GQF A;  5ITX A;  5KPT A;  4CHT B;  4DR2 M;  3SBJ A;  3FTC A;  4EIW A;  1UR8 A;  1XXH E; 
#chains in the Genus database with same CATH homology
 2KW0 A;  2CUZ A;  3AOE A;  4NRW A;  1Z5A A;  3TE6 A;  3LVW A;  5FTL A;  1IBL M;  2QP9 X;  1QAO A;  1GL6 A;  5KO3 A;  3M0E A;  4IBK A;  4AG6 A;  3T15 A;  4NL4 H;  5ITQ A;  3CTW B;  5EP4 A;  2UUB M;  1L2C A;  2I7N A;  4OVZ A;  3U6S A;  2RGH A;  2FFF B;  2QEN A;  1K3X A;  3FKE A;  1IN6 A;  2CHV A;  3RE8 A;  4OW0 A;  4DV0 M;  3KVW A;  2DZO B;  3LMM A;  4GKJ M;  1NY6 A;  4M0D A;  1G41 A;  4QNL A;  5H37 D;  5EXT A;  3SYK A;  3HJQ A;  2Z7J A;  4GMQ A;  5FTM A;  2Y2J A;  3M7G A;  4IBB A;  4LFA M;  2Y2L A;  2M5Z A;  3KOZ E;  4GIP A;  4QNM A;  1DO0 A;  3HHZ A;  2CV1 A;  3FUV A;  1G59 A;  5KPR A;  1IXR C;  4JI5 M;  2KA6 B;  4LF9 M;  4AG5 A;  2Y0Q A;  5EXX A;  3GLH A;  3E9S A;  3B9P A;  3T1H M;  4AKG A;  3SFZ A;  1GL7 A;  3J2P B;  5JI2 E;  3ZC7 B;  7CAT A;  3THG A;  4Z6Y A;  2Y2I A;  4NZ5 A;  1ZAE A;  1JQJ C;  4FVM A;  1DGH A;  2J7O A;  1L1T A;  4OJ5 A;  4AKH A;  2I7P A;  3DA1 A;  3GP1 A;  2H1R A;  3R9X B;  1IY2 A;  2C98 A;  1Z5B A;  1SXJ A;  5KPZ A;  4MGY E;  4FW9 A;  4G4Q A;  5FTJ A;  3SHG B;  3CF0 A;  4W5W A;  4K0K M;  3DOA A;  2Y2O A;  1YE9 A;  3WHL A;  4FCW A;  4DR3 M;  4LF5 M;  1SXJ D;  3FYC A;  4M9X A;  1QAM A;  5IT9 S;  5LMN M;  4OVZ B;  4KO8 A;  4NRV A;  1IBK M;  3JAM S;  4P16 A;  1PJI A;  4LJ5 A;  4LJ4 A;  3KP0 E;  4GHL A;  3N3F A;  4LCB A;  2L09 A;  2UWX A;  2XFS A;  4QNR A;  3SAV A;  4B3S M;  1TDZ A;  3I51 A;  3VKH A;  2L7I A;  3SHF A;  3FUX A;  2Y0T A;  2ZAM A;  5ITU A;  1E94 E;  2CV2 A;  2KXE A;  4MGZ E;  3DFZ A;  1N77 A;  4S12 A;  3T38 A;  4LFB M;  1R7R A;  3TWK A;  2DWL A;  1NJG A;  1GLN A;  5DYG A;  1MX0 A;  4GC9 A;  3NBI A;  3GLH B;  2XZU A;  1NHW C;  3MK6 A;  5EP3 A;  3PNV A;  1S3S A;  4XBO A;  4B7H A;  1XMQ M;  1DO2 A;  3QWL A;  4OU7 A;  1PJJ A;  1NNJ A;  2XH9 A;  4JI0 M;  4IBI A;  2F5Q A;  3JR5 A;  1T3T A;  1HNX M;  2F5P A;  4JYA M;  5E26 A;  2LNH C;  3J7B A;  3ILK A;  4R3D A;  1XWI A;  2CHQ A;  1N34 M;  3HJ8 A;  4IJE A;  4JI7 M;  2DWN A;  1X37 A;  3VDU A;  4LGY A;  4I81 A;  1IY0 A;  1QZM A;  2W82 A;  4QOS A;  4OJP A;  4IBD A;  4PDI A;  4MH0 E;  4NYY A;  3KSJ A;  5JI3 E;  3KOW E;  4X66 M;  3SAS A;  4B7G A;  2X49 A;  3WX7 A;  5FLX S;  3HGI A;  3L28 A;  3IG8 A;  1KSF X;  1SXJ B;  1YUE A;  4QHS A;  1YU4 A;  4DR1 M;  1IQP A;  2F4V M;  2X4A A;  3HU3 A;  4GRI A;  3U61 B;  2LH0 A;  3K1J A;  4LY6 A;  3VLF B;  3HWS A;  5BR8 M;  4BB9 A;  4G4R A;  3GO8 A;  3GLG B;  3GRU A;  2RKO A;  1N78 A;  3KSX A;  1YU0 A;  1TDH A;  2LWX A;  3U6C A;  2DZN B;  2CE7 A;  3VKG A;  3VK7 A;  2R46 A;  3KS8 A;  3GLF B;  3M6A A;  4X65 M;  4LRS A;  1WXQ A;  2QBY B;  1HT2 E;  4WUR A;  1HR0 M;  4LF4 M;  5C1B A;  1YU1 A;  3GQ4 A;  5KQD A;  2R4J A;  2HCB A;  3KOX E;  1N36 M;  4CIS A;  4DV1 M;  1R2Z A;  4LZJ A;  3ZH9 B;  5FTN A;  4ITQ A;  4PCZ A;  2ZAN A;  3IG5 A;  2KRK A;  3SMS A;  1DGB A;  4PD2 A;  2UUA M;  4LJ6 A;  2NQ8 C;  4KLN A;  2RGO A;  3J80 S;  4FD2 A;  1JR3 A;  4D81 A;  4L16 A;  3U6E A;  4L78 A;  1I94 M;  1DGF A;  4JI4 M;  1SXJ E;  3UZU A;  4B3M M;  2XFT A;  4PT5 A;  5ITY A;  3GPU A;  2Y2K A;  1NHG C;  4M9Z A;  3D8B A;  2CHG A;  1JR3 D;  1TH4 A;  1HQC A;  3I4V A;  4BBA A;  3J27 B;  4GKK M;  4B3R M;  5EP2 A;  1XHB A;  2XD1 A;  3HKP A;  4AQY M;  3AJI B;  3PVS A;  4GIT A;  3AKZ A;  4G4O A;  3GQ5 A;  2YQZ A;  5FSW A;  1GVN A;  1Z6T A;  2CFO A;  1GKI A;  5GKN A;  3ZCB B;  2UU9 M;  1J09 A;  4JI2 M;  4LRT A;  2L7H A;  3AV0 A;  3HSH A;  3FUW A;  4MGK E;  2UXB M;  4PDG A;  3UMM A;  1J7K A;  4HL4 A;  3U61 A;  2XZF A;  3SMP A;  2XF3 A;  4LJ9 A;  3U6L A;  3U60 B;  4X62 M;  3UJN A;  1YU3 A;  4FWD A;  3GLG A;  1OFH A;  2V1U A;  1N32 M;  2G8L A;  1IXZ A;  2Y2G A;  3U6O A;  3D8L A;  3U6M A;  4IBE A;  5ITT A;  2ZBK B;  2Y20 A;  3GLF A;  5FTK A;  2YNM D;  1Q3C A;  2JCH A;  3RGS A;  4YHH M;  2QBY A;  1NSF A;  2HHH M;  1HNZ M;  4L15 A;  1MU5 A;  4HLQ A;  4KOD A;  1XC8 A;  4DV4 M;  4LF7 M;  4TUW A;  2DWZ B;  2Y2Q A;  1HT1 E;  1R6B X;  4DR5 M;  4IBF A;  1K3W A;  1QAN A;  2V6Z M;  3TQS A;  5C18 A;  3L27 A;  2UXC M;  2M60 A;  1IN4 A;  2YFQ A;  4B08 A;  3EIH A;  2ZM6 M;  4B7F A;  1L2B A;  4FWH A;  3U5Z B;  3QAU A;  4FCV A;  2BG1 A;  1Q39 A;  2A5Y B;  4BLC A;  4DR7 M;  4GC5 A;  1XXH B;  1TH3 A;  4LJA A;  5DYI A;  2L6O A;  1NVM A;  3AOE C;  1L1Z A;  3FD9 A;  3WHK A;  2XSZ D;  1L2D A;  1QAQ A;  2QZ4 A;  4GH9 A;  3UGJ A;  3RFW A;  3L25 A;  1E9R A;  3FUU A;  3KOY E;  2Q2E B;  2XLJ A;  3LVV A;  4IBJ A;  4I5S A;  2JE5 A;  4MB7 A;  2C9O A;  2EO2 A;  4REZ A;  4DV5 M;  4OJ6 A;  4LFC M;  2ZAO A;  4JXJ A;  3L2A A;  3GRV A;  4ZPX A;  4KHP M;  2G5G X;  3EIE A;  3R8F A;  1IY1 A;  1NNU C;  2FFJ A;  2FOI C;  4Z8X A;  2D7H A;  2K47 A;  3PFI A;  5EJC A;  3U60 A;  4JI6 M;  4NXM M;  4NSO B;  3HON A;  2D7G A;  3TWL A;  4LJ7 A;  1XNR M;  3BOS A;  2KZU A;  4NOO B;  1N33 M;  2DHR A;  4D82 A;  1PM5 A;  3K2L A;  2Z4R A;  2R45 A;  1YUB A;  5EQT A;  1IBM M;  3GLI B;  3RGP A;  3TPZ A;  4DV2 M;  4RNA A;  1Z5C A;  2DXI A;  4M9S A;  3AOG A;  4NSR A;  5IWA M;  4DR6 M;  4R7G A;  3KXE C;  4M0W A;  2DWM A;  2Z3X A;  2QCU A;  2KEB A;  4DUY M;  1XMO M;  5E6J A;  2F5N A;  1G8P A;  2FE8 A;  3K92 A;  2C9C A;  1EE8 A;  2QPA A;  3KW6 A;  4DR4 M;  4AKI A;  3W0L B;  3TL4 X;  4JI3 M;  3MJ5 A;  5DNY A;  3HHY A;  3U6P A;  4NY2 A;  3FTF A;  1C1K A;  2KRU A;  4AZF A;  3SAT A;  4WW0 A;  4GHA A;  4LZZ A;  3A45 A;  3GRR A;  1SXJ C;  2CV0 A;  3U5Z A;  3HU2 A;  4RF0 A;  1W5T A;  1QVR A;  2R62 A;  3GRY A;  2OQ4 A;  2F5O A;  4G6Z A;  4AW4 A;  1XXH A;  4A3V B;  3J7A S;  2D7E A;  2DVW B;  3W0F A;  2UXD M;  4DV3 M;  2KZS A;  3HU1 A;  4YY3 M;  4RF1 A;  4NZ3 A;  5F3W A;  3L29 A;  3LQQ A;  4LG2 A;  3HHX A;  3JR4 A;  2VQE M;  3KP1 E;  4OUI A;  8CAT A;  1UM8 A;  5BPV A;  3E4R A;  3U6Q A;  4JI1 M;  2P5T A;  3SC3 A;  4G4N A;  1IM2 A;  3DZD A;  3PNY A;  1HNW M;  1J5E M;  2CEA A;  1XNQ M;  4X64 M;  2UUC M;  1LV7 A;  3L26 A;  2JA2 A;  4QHT A;  3FTE A;  1ZQ9 A;  1TH2 A;  3FUT A;  4XGI A;  4JN6 A;  4DV7 M;  4D80 A;  5KQ8 A;  3FYD A;  4OX9 M;  1Z59 A;  2FNA A;  3SAU A;  3A42 A;  1G4A E;  3Q8X A;  2EA0 A;  3GLI A;  3GPX A;  1IN7 A;  1I4W A;  2BJW A;  2LXE A;  4MM3 B;  3UK6 A;  3J81 S;  2OPF A;  2ERC A;  3SAR A;  1IXS B;  2AHM A;  3VFD A;  3A46 A;  3KDS E;  3SYL A;  1FNN A;  1VDD A;  4L4U A;  2X8A A;  3VK8 A;  4CGY B;  2E5L M;  3C58 A;  1FJG M;  3FTD A;  2Z4S A;  4MGI E;  2O5R A;  2C99 A;  2VII A;  4OJO A;  3KS4 A;  2Y2H A;  3CF2 A;  1QYR A;  5ITR A;  3I4Y A;  4IBG A;  2J7N A;  4NZ1 A;  4NXN M;  3T1Y M;  4AI6 A;  1OJL A;  2V1C A;  2XSZ A;  4I8O A;  4NZ4 A;  2C96 A;  3AFH A;  3LQR A;  3AL0 C;  2HL7 A;  5IZ7 D;  2BNK A;  3U6D A;  3PXG A;  4II7 A;  1NY5 A;  4L8R C;  2F5S A;  2R4E A;  4IIW A;  4NYU A;  1KFV A;  3OTO M;  1NJF A;  3VDP A;  2C5R A;  1R2Y A;  3KFU G;  3HJS A;  2Y2P A;  2VQF M;  4LF6 M;  2XEP A;  5LMU M;  5EXP A;  2EUC A;  1TGU A;  1QQW A;  1HQY E;  1G3I A;  3H4M A;  4B3T M;  3HHW A;  1IN5 A;  4IBC A;  4DV6 M;  5EP1 A;  1H6U A;  4I4L A;  1Q3B A;  2IOU A;  3K8Z A;  2Y2M A;  4IJF A;  2BJV A;  1OFI A;  5EXS A;  4JI8 M;  3A98 B;  4MGH A;  2XD5 A;  1L8Q A;  1E32 A;  4LF8 M;  3MHV C;  4QOZ C;  1YU2 A;  5ITX E;  4OJL A;  1N75 A;  3NWL A;  1E9S A;  1W5S A;  1KYI A;  1D2N A;  4LGM A;  1ORY B;  4JV5 M;  1DGH B;  2Y2N A;  2R65 A;  4DUZ M;  2R18 A;  3CF6 E;  1DGG A;  4LJ8 A;  3GQ3 A;  3GPY A;  5A2Q S;  1IN8 A;  2YR0 A;  3GPP A;  3TWM A;  1K82 A;  2HKJ A;  3SAW A;  2Y21 A;  4FWG A;  1YSY A;  2XGN A;  5IRE B;  3SBJ A;  5ITX A;  5KPT A;  4CHT B;  4DR2 M;  3FTC A;  4EIW A;  4FCT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...