4IBFA

Ebola virus vp35 bound to small molecule
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
123
structure length
123
Chain Sequence
b'DISAKDLRNIMYDHLPGFGTAFHQLVQVICKLGKDSNSLDIIHAEFQASLAEGDSPQCALIQITKRVPIFQDAAPPVIHIRSRGDIPRACQKSLRPVPPSPKIDRGWVCVFQLQDGKTLGLKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Polymerase cofactor VP35
molecule tags Transcription/transcription inhibitor
source organism Ebola virus
publication title In Silico Derived Small Molecules Bind the Filovirus VP35 Protein and Inhibit Its Polymerase Cofactor Activity.
pubmed doi rcsb
total genus 42
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-12-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.950 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4ibfA01
2.10.10.70 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 4ibfA02
4IJFA 4IBKA 3L26A 3L2AA 4GHLA 4IBJA 3L27A 4IBBA 3KS4A 3FKEA 4IBFA 4IBDA 4IJEA 4LG2A 4GHAA 3L28A 4IBEA 5BPVA 3L25A 4IBGA 4GH9A 4IBIA 4IBCA 3L29A 3KS8A
chains in the Genus database with same CATH superfamily
3TQSA 4NYYA 4NYUA 3AV0A 3DZDA 4LJ9A 4NC6A 5KQDA 1TR8A 1WR1B 3A42A 2DNAA 4MGZE 2VQFM 1Z59A 1KFVA 4KHPM 2JY6B 3I04M 4JI4M 1E6RA 1O6IA 1NNJA 2LVQD 5EQTA 1PRBA 1NV8A 3CF0A 2EA0A 3KVWA 2LBCA 3CF6E 2FOIC 3TE6A 4DUZM 2CRUA 2QPAA 3U6MA 3AOGA 2CHQA 2DAGA 2I7PA 4LF6M 2UUAM 3FUXA 3TL4X 4JYAM 2V5OA 3MQLA 1EE8A 4LJ7A 3HHXA 2Z3XA 3SYKA 3LCVB 4ANRA 4FCWA 2L6OA 4LGMA 5IT9S 3D8LA 3HJSA 3FE3A 1P3QQ 4DV0M 3QWLA 1K3WA 2L4FA 3QYBA 1IXZA 2M5ZA 4HL4A 4G6ZA 7CATA 3GQ3A 1N77A 1ZMWA 3L27A 4G4OA 1R6BX 1G71A 2YNMD 1OKSA 4AKHA 1AIPC 4HMEA 3SAVA 4R3DA 2BG1A 1GLNA 4LJAA 4JI5M 4MGIE 4AW4A 4JI2M 2FH0A 1TTEA 5A2QS 2F5PA 1DGGA 1OJLA 3B9PA 1ZMVA 4DBGB 4BBAA 2Q2EB 2ZAMA 2FFJA 2DWLA 2QHOB 3KOXE 1VDLA 2O5RA 2V1CA 4FWGA 4MM3B 4FCVA 5IWAM 2XEPA 1XNRM 3L25A 1NO1A 1Z5BA 1HQCA 2R18A 1FJGM 2EUCA 3PVSA 2X4AA 2DHRA 2WZJA 4LY6A 1W1YA 5EXXA 3L26A 1ZMUA 1JR3A 1TGUA 5FTLA 3HHZA 1XWIA 4I4LA 1G59A 2XGNA 3SMSA 3C58A 2K9DA 4NZ1A 4M0WA 2UXDM 4GRIA 3GLIA 2F5SA 1QDRA 4Z2LA 4TX8A 3LCUA 2MROB 2Y2MA 2J7OA 1Z6TA 4KT0F 1ZQ9A 3C3EA 2LVNC 3TWLA 4B7HA 5BR8M 2XF3A 4G4RA 4AI6A 3GLIB 3KFUG 2YQZA 3SAUA 1L1TA 4L16A 3KSJA 3RFWA 2JUJA 2R4EA 5FTJA 4AKGA 3PNYA 3HWSA 3T15A 3GP1A 2Y20A 3EIHA 2QBYB 3K8ZA 1X37A 4XK8F 3KW6A 1KYIA 2LVAA 5JI3E 4D82A 1V34A 3J7AS 2JZ1A 2Z4RA 1TDZA 1TH3A 3HJQA 3I4VA 4ITQA 2O01F 2Y0TA 2Y2OA 4L15A 1GKIA 1QYRA 2FNAA 2HWJA 2R6FA 1L2CA 2CV2A 3J80S 3W68A 2QSFX 2LWXA 5FTNA 4AZFA 4NRWA 3LQRA 3ZQJA 1E88A 2X49A 3E21A 3NBXX 1IBKM 2VF8A 1DO2A 2CEAA 4LZJA 4QNRA 4QHSA 3I4YA 1R4GA 1C7YA 1WIVA 3GPPA 3J27B 2A5YB 4QOZC 1D2NA 3Q8GA 4LRSA 2KNVA 4LJ8A 2EKFA 1QANA 4NOOB 4W5WA 4JV5M 2JZ0A 1IN5A 4IJFA 4DR7M 3WD3A 3K9PA 4MGKE 1VEJA 4Q7JA 3GRUA 2EJSA 4M9XA 2KRKA 4NZ4A 4OUIA 4Z2GA 2RGOA 2JWSA 3MJ5A 3T38A 3FKEA 4DR5M 1ZAEA 2QCUA 2C5RA 4AKIA 1L2BA 2J7NA 1IM2A 3KOZE 1Z5CA 1OIPA 4CGYB 1IQPA 4B7FA 2JY8A 1S3SA 4GHAA 1GABA 3DOAA 1N34M 3C9PA 3B7NA 4OU7A 1SXJD 3W67A 2FE8A 3I01M 4PT5A 5FSWA 1E9RA 5EXTA 3HZJA 4X62M 2L7HA 4D80A 1D0MA 5ITUA 2UUCM 2DAIA 2DAKA 2CV1A 3HU3A 4Z2KA 1GO5A 1NY6A 1MJGM 1OFHA 2DZNB 4FCTA 3UJNA 5E6JA 4II7A 1E15A 5L8RF 3L2AA 2WSEF 3DFZA 1IXRC 1PJIA 4IIWA 2UXCM 3HJ8A 2HAKA 3IECA 4QNLA 1EIJA 1E9SA 2DKLA 3GLHB 1XXHE 3GRYA 1E6PA 3FYCA 3B7QA 4WW0A 4X65M 4TUWA 3CF2A 3SHFA 2R46A 1NSFA 4QOSA 3E46A 3GLGE 3TWMA 3T1YM 2HHHM 4MGHA 3WX7A 4K0KM 1OAIA 4GC5A 1YU0A 1YUBA 3EIEA 4DR1M 3VK7A 3SMPA 2KW0A 3GRRA 4MH0E 2XFSA 5ITRA 4X66M 2APLA 4LF7M 3GLGB 4NXNM 3NBIA 2ZTCA 3HX3A 4B08A 2HCBA 4JI8M 4NY2A 2DAMA 1F4IA 1CK7A 4Z2HA 1GJSA 1XXHB 2JP7A 4IBKA 4KO8A 3JAMS 2KHHA 5EP3A 2AHMA 2R4JA 1VG5A 3PFIA 4JI6M 2RRUA 5ITYA 4CIZA 3HY5A 1IY2A 2QZ4A 1QAOA 2LH0A 1L8QA 4OJPA 2CWBA 2C9CA 4GEWA 4NSOB 3W0LB 2CHVA 2KDLA 1PJSA 1AUAA 2ZBKB 3QAUA 1OIZA 4MGYE 3V76A 3LVVA 4FW9A 3WHKA 1IN6A 2L7IA 4IJEA 1I94M 2UU9M 2R44A 3KP0E 3BBZA 3SYLA 4F1IA 3FRIA 2FS1A 1GL6A 2Y21A 3L28A 4GC9A 3GPXA 2MJ5B 4XGIA 3U6QA 3SAWA 1HR0M 1RU3A 1W1VA 4WP2A 2H1RA 2OO9A 1NJFA 5ITXE 4JXJA 5BPVA 2VQEM 1A5TA 3SBJA 2F5NA 2UWXA 1NNUC 4DV3M 1IXSA 1HNZM 1VQ1A 3KOYE 4BLCA 4M0DA 3GRVA 2UUBM 5FLXS 4GKKM 1YU4A 3TWKA 1LV7A 1T3TA 3U5ZA 1N75A 1IY0A 1SXJE 1PJTA 4P17A 1HNXM 4LF8M 4R71A 1PJJA 1E6NA 2JNHA 3E4RA 4JI3M 2QENA 1W5TA 3FYDA 4GHLA 3I51A 1YU3A 2Y2GA 3SARA 2KA6B 2KNAA 5IREB 2CP8A 3GLHE 1OFIA 4OVZB 1WGNA 1R2ZA 2D49A 1OTRA 3U6CA 1PDCA 2VIIA 2R62A 4GITA 1R2YA 3WD4A 2DVWB 1QAMA 2BJWA 4LCBA 1XC8A 2Y2QA 1H6UA 3SC3A 2ZM6M 5C1BA 3K2LA 2F5OA 1K82A 2XSZA 4L8RC 3FUUA 4HMCA 3FTEA 3M0EA 2DHYA 1QZEA 1DGHA 2KXEA 2DENA 3HU1A 5EP2A 4EIWA 1QO6A 2G3QA 1J7MA 1T6OA 3D8BA 2LHGA 1BVSA 5DNYA 3K92A 2BNKA 1ORYB 1OAOC 2Y0QA 2Z4SA 1PJQA 5H37D 2WSFF 1L2DA 3F92A 1DGHB 2CE7A 3PNVA 4OW0A 4RNAA 2Y2NA 2LHCA 4LJ6A 3J2PB 1EAKA 3NWLA 4NRVA 1V92A 3H4JA 2FN2A 4HLQA 4JI0M 3A98B 1E6ZA 2MGWA 4B3TM 4M9ZA 2F4VM 2Y2LA 2C9OA 2DAEA 4DR4M 1IN8A 2Z8YM 4AG6A 3A46A 5LMUM 1D0LA 1E32A 3K1JA 3VDPA 4S12A 4Z8XA 3U6DA 1KS0A 2Y2JA 2QBYA 3W0FA 3VLFB 2JXNA 3WD2A 5EP1A 3HKPA 2V1UA 1NHWC 3KDSE 4CHTB 2J5YA 2UXBM 3VDUA 3L29A 2IOUA 3SFZA 1N33M 2CV0A 1JB0F 4Z2JA 2XZFA 1J09A 3GQ4A 4G4NA 2C98A 1VDDA 4DV7M 3VKHA 2MH8A 1HT1E 2GNOA 2P5TA 4RF1A 4XBOA 1HJPA 2ZANA 4IBBA 2JE5A 4I81A 4A3VB 1GVNA 2NQ8C 5E26A 5KPZA 3BOSA 5LMNM 1CXWA 3J7BA 2HL7A 1FNNA 2BWBA 4JN6A 3WHLA 4LFAM 4F2LA 4DR6M 4MB3A 4PDIA 1ZV1A 4OVZA 1XXHA 3GLFB 3R8FA 1YU1A 2EKKA 2OOBA 1DGFA 1YSYA 3VKGA 2JY5A 4B3SM 3B74A 4P16A 4RF0A 3VK8A 3IG8A 2XD1A 4GIPA 2DI0A 3CGWA 1Q02A 4GH9A 1PGYA 2Y2KA 1R5LA 3LVWA 5C18A 3RGSA 4DV6M 3FTFA 2CUZA 1YLAA 3U61A 3R9XB 1W5SA 2RGHA 1IBMM 3KXEC 4OJ6A 1NJGA 1IXSB 3KS4A 4D81A 3JR4A 3E9SA 4HMDA 3WD1A 1QDTA 4IBFA 1IBLM 3U60A 2Y2HA 1L1ZA 1CUKA 3FTCA 1GXDA 2VF7A 1K3XA 4CISA 4BB9A 3GLHA 5EXSA 2B3TA 4LJ5A 2ERCA 1VEKA 4L6V6 1R7RA 4B3MM 4AQYM 2DZOB 1GJTA 4FWHA 3U6SA 1T43A 1SXJA 3UMMA 2LXEA 4LRTA 4FWDA 3UK6A 1Q39A 5ITQA 4RKUF 3SASA 2H5XA 1TH4A 3KSXA 2O25A 1E8BA 1HNWM 8CATA 4YHHM 5DYIA 4AG5A 3GO8A 4LFCM 2QP9X 1Q3BA 2LTUA 1D0KA 3GLFE 1IN4A 4Z6YA 1UR8A 3ILKA 1LTMA 2E5LM 2V6ZM 4NSRA 1DGBA 4LF5M 1XNQM 2KZUA 5DYGA 2FFFB 1H0GA 1YUEA 3U6LA 1OQYA 3DA1A 4QNMA 4KLNA 3N3FA 3LMMA 4LFBM 2CFOA 1C1KA 3C3DA 3CTWB 1Y8GA 2ZAOA 3UGJA 3J81S 2LNHC 3M7GA 3UZUA 2R45A 3GLFA 1H8PA 3KP1E 1N36M 2M60A 1QAQA 3LQQA 5DFLA 2RTSA 2OQ4A 3GPUA 3AL0C 4MB5A 4GMQA 4NXMM 1DO0A 4OX9M 3M6AA 2JA2A 2XD5A 1L6JA 4X64M 4UN2B 3GPYA 1WJ7A 1YE9A 3JR5A 2R65A 1J5EM 3HONA 3U6EA 1TF0B 5KPRA 3HU2A 3KS8A 2DWZB 1IN7A 1HT2E 4WURA 4FD2A 4JI7M 2JY7A 4CJ6A 1MN3A 1QUTA 2Z7JA 3T1HM 1IY1A 1GL7A 4OJOA 4MB7A 1UFZA 2JCHA 3FUVA 3ZCBB 4MB4A 2XFTA 3KOWE 2DWMA 3ZH9B 2Y2IA 3HHYA 3PXGA 1MX0A 3FUWA 5FTKA 2XSZD 3FD9A 1XB2B 2YR0A 4I5SA 1UR9A 4L4UA 5KO3A 2D7EA 3B89A 1JR3E 2F5QA 1NHGC 2MR9A 5KQ8A 3AKZA 2XZUA 4LF4M 2R0IA 1XMQM 4L78A 2G8LA 4PDGA 3K9OA 1PM5A 2Y2PA 2C96A 4ZPXA 3MMPA 3HGIA 4DV5M 5EXPA 2C99A 2VDBB 3WD0A 2L2DA 4M9SA 1W1PA 3GQ5A 2BJVA 2LVOC 3HSHA 4G4QA 1H0IA 5FTMA 5IZ7D 1NV9A 1EFUB 1MU5A 3RE8A 3RGPA 3VFDA 2KEBA 3ZC7B 1XMOM 4PD2A 1SXJB 3U61B 5ITTA 2L09A 4DR3M 1OGGA 4LJ4A 1WXQA 3IG5A 3SATA 1G8PA 3H4MA 4R7GA 2DWNA 3FTDA 2GQFA 2LVPC 4Y28F 1YU2A 4Z2IA 2W82A 1QUSA 2L4EA 2N35A 2XH9A 1TDHA 3MK6A 3Q8XA 4DR2M 4GKJM 3MHVC 4IBIA 3LW5F 4QHTA 5JI2E 1OGBA 4FVMA 4IBCA 2WSCF 1J7KA 3T6PA 1TH2A 2XLJA 4DV1M 1Q3CA 2DZLA 2HKJA 4REZA 1G41A 3AOEA 4G3OA 2YFQA 1G3IA 5EP4A 4NZ3A 1I4WA 3GLGA 1QQWA 1UM8A 4PCZA 1JR3D 3AOEC 3SHGB 4IBDA 2CHGA 2EO2A 2KZSA 1SXJC 4OJ5A 4DV2M 2D7GA 3U6OA 1W1TA 2DXIA 4OJLA 1SG9A 4NL4H 3AFHA 4LG2A 1WHCA 4LZZA 3B7ZA 4IBEA 4HEOA 4LGYA 1E94E 3U5ZB 3BXWA 1WGLA 3M7PA 4YY3M 2X8AA 4KODA 1NY5A 1V33A 5EJCA 4I8OA 1IFYA 3U60B 1DV0A 3U6PA 3IHPA 1Z5AA 3AJIB 1QVRA 3FUTA 4NZ5A 1GPFA 4DUYM 2K6BA 3QYEA 1QZMA 4IBJA 2RKOA 2KRUA 2BWEA 1XHBA 3FRHA 2ZTDA 4B7GA 1HQYE 1KSFX 4DV4M 3GLIE 2OOAA 4LF9M 2K47A 3TPZA 1AIWA 1NVMA 2D7HA 1N78A 4B3RM 1N32M 1ED7A 3THGA 2OPFA 5GKNA 1VEGA 2G5GX 2KNZA 2K0BX 1JQJC 2I7NA 5KPTA 3HHWA 4IBGA 3A45A 1GOIA 4JI1M 1G4AE 2QNJA 5ITXA 3OTOM 5F3WA 2QQ8A
chains in the Genus database with same CATH topology
3TQSA 4NYYA 4NYUA 3AV0A 3DZDA 4LJ9A 5KQDA 3A42A 4MGZE 2VQFM 4KHPM 1Z59A 1KFVA 4JI4M 1NNJA 5EQTA 3CF0A 2EA0A 3KVWA 3CF6E 3TE6A 2FOIC 4DUZM 3U6MA 2QPAA 3AOGA 2CHQA 2I7PA 4LF6M 2UUAM 3FUXA 3TL4X 4JYAM 1EE8A 4LJ7A 3HHXA 2Z3XA 3SYKA 4FCWA 2L6OA 4LGMA 5IT9S 3D8LA 3HJSA 4DV0M 1K3WA 3QWLA 1IXZA 2M5ZA 4HL4A 4G6ZA 7CATA 3GQ3A 1N77A 3L27A 4G4OA 1R6BX 2YNMD 4AKHA 3SAVA 4R3DA 2BG1A 1GLNA 4LJAA 4JI5M 4MGIE 4AW4A 4JI2M 5A2QS 2F5PA 1DGGA 1OJLA 3B9PA 4BBAA 2Q2EB 2ZAMA 2FFJA 2DWLA 3KOXE 3L25A 2O5RA 2V1CA 4FWGA 4MM3B 4FCVA 5IWAM 2XEPA 1XNRM 1Z5BA 1HQCA 2R18A 1FJGM 2EUCA 3PVSA 2X4AA 2DHRA 4LY6A 5EXXA 3L26A 1JR3A 1TGUA 5FTLA 3HHZA 1XWIA 4I4LA 1G59A 2XGNA 3SMSA 3C58A 4NZ1A 4M0WA 2UXDM 4GRIA 3GLIA 2F5SA 2Y2MA 2J7OA 1Z6TA 1ZQ9A 5BR8M 4B7HA 3TWLA 4G4RA 4AI6A 2XF3A 3GLIB 3KFUG 2YQZA 3SAUA 1L1TA 4L16A 3KSJA 3RFWA 4AKGA 2R4EA 5FTJA 3PNYA 3HWSA 3T15A 3GP1A 2Y20A 3EIHA 2QBYB 3K8ZA 1X37A 3KW6A 1KYIA 5JI3E 4D82A 3J7AS 1TDZA 2Z4RA 1TH3A 3HJQA 3I4VA 4ITQA 2Y0TA 2Y2OA 4L15A 1GKIA 1QYRA 2FNAA 1L2CA 2CV2A 3J80S 5FTNA 2LWXA 4AZFA 4NRWA 3LQRA 2X49A 1IBKM 1DO2A 2CEAA 4LZJA 4QNRA 4QHSA 3I4YA 3GPPA 3J27B 2A5YB 4QOZC 1D2NA 4LRSA 4NOOB 4LJ8A 1QANA 4W5WA 4JV5M 4IJFA 1IN5A 4DR7M 4MGKE 3GRUA 4M9XA 2KRKA 4NZ4A 4OUIA 2RGOA 3MJ5A 3T38A 3FKEA 4DR5M 1ZAEA 2QCUA 2C5RA 4AKIA 1L2BA 2J7NA 1IM2A 3KOZE 1Z5CA 4CGYB 1IQPA 4B7FA 1S3SA 4GHAA 3DOAA 1N34M 4OU7A 1SXJD 2FE8A 4PT5A 5FSWA 1E9RA 5EXTA 4X62M 2L7HA 4D80A 5ITUA 2UUCM 2CV1A 3HU3A 1NY6A 1OFHA 4FCTA 2DZNB 3UJNA 5E6JA 4II7A 3L2AA 2UXCM 3DFZA 1IXRC 1PJIA 4IIWA 3HJ8A 4QNLA 1E9SA 3GLHB 3GRYA 3FYCA 4X65M 4WW0A 4TUWA 3CF2A 3SHFA 2R46A 1NSFA 4QOSA 3TWMA 3T1YM 2HHHM 4MGHA 3WX7A 4K0KM 4GC5A 1YU0A 1YUBA 3EIEA 4DR1M 3VK7A 3SMPA 2KW0A 3GRRA 4MH0E 2XFSA 5ITRA 4X66M 4LF7M 3GLGB 4NXNM 3NBIA 2HCBA 4JI8M 4NY2A 1XXHB 4IBKA 4KO8A 3JAMS 5EP3A 2AHMA 2R4JA 3PFIA 4JI6M 5ITYA 4OJPA 1IY2A 2QZ4A 1QAOA 2LH0A 1L8QA 2C9CA 4NSOB 3W0LB 2CHVA 4MGYE 4B08A 4CHTB 2ZBKB 3QAUA 3WHKA 3LVVA 4FW9A 2UU9M 1IN6A 2L7IA 4IJEA 1I94M 3KP0E 3SYLA 1GL6A 2Y21A 3L28A 4GC9A 3GPXA 4XGIA 3U6QA 3SAWA 1HR0M 2H1RA 1NJFA 5ITXE 4JXJA 5BPVA 2VQEM 3SBJA 2F5NA 2UWXA 1NNUC 4DV3M 1HNZM 2UUBM 3KOYE 4BLCA 4GKKM 4M0DA 3GRVA 1YU4A 5FLXS 3TWKA 1LV7A 1T3TA 3U5ZA 1N75A 1IY0A 1SXJE 1HNXM 4LF8M 1PJJA 3E4RA 4JI3M 2QENA 1W5TA 3FYDA 4GHLA 3I51A 1YU3A 2Y2GA 3SARA 2KA6B 5IREB 1OFIA 4OVZB 1R2ZA 3U6CA 2VIIA 2R62A 4GITA 1R2YA 2DVWB 1QAMA 2BJWA 4LCBA 1XC8A 2Y2QA 1H6UA 3SC3A 2ZM6M 5C1BA 3K2LA 2F5OA 1K82A 2XSZA 4L8RC 3FUUA 3FTEA 3M0EA 3HU1A 4EIWA 1DGHA 2KXEA 5EP2A 3D8BA 5DNYA 3K92A 2BNKA 2Y0QA 1ORYB 2Z4SA 5H37D 1L2DA 3PNVA 1DGHB 2CE7A 4OW0A 4RNAA 2Y2NA 4LJ6A 3J2PB 3NWLA 4NRVA 4HLQA 4JI0M 3A98B 4B3TM 4M9ZA 2F4VM 2Y2LA 2C9OA 4DR4M 1IN8A 4AG6A 5LMUM 3A46A 1E32A 3K1JA 3VDPA 4S12A 4Z8XA 3U6DA 2Y2JA 2QBYA 3W0FA 3VLFB 5EP1A 3HKPA 2V1UA 1NHWC 3KDSE 2UXBM 3VDUA 3L29A 2IOUA 3SFZA 1N33M 2CV0A 2XZFA 1J09A 3GQ4A 4G4NA 2C98A 1VDDA 4DV7M 3VKHA 1HT1E 2JE5A 2P5TA 4RF1A 4XBOA 2ZANA 4IBBA 4I81A 4A3VB 1GVNA 2NQ8C 5E26A 5KPZA 3BOSA 5LMNM 3J7BA 2HL7A 1FNNA 4JN6A 4DR6M 3WHLA 4LFAM 4PDIA 4OVZA 3GLFB 1XXHA 3R8FA 1YU1A 1DGFA 1YSYA 3VKGA 4B3SM 3VK8A 4P16A 4RF0A 2XD1A 3IG8A 4GIPA 4GH9A 2Y2KA 3LVWA 5C18A 3RGSA 4DV6M 3FTFA 2CUZA 3U61A 3R9XB 1W5SA 2RGHA 1IBMM 3KXEC 4OJ6A 1NJGA 1IXSB 3KS4A 4D81A 3JR4A 3E9SA 4IBFA 1IBLM 3U60A 2Y2HA 1L1ZA 3FTCA 1K3XA 4CISA 4BB9A 3GLHA 5EXSA 4LJ5A 2ERCA 1R7RA 4B3MM 4AQYM 2DZOB 4FWHA 3U6SA 1SXJA 3UMMA 2LXEA 4LRTA 4FWDA 3UK6A 1Q39A 5ITQA 3SASA 1TH4A 3KSXA 1HNWM 8CATA 4YHHM 5DYIA 4AG5A 3GO8A 4LFCM 2QP9X 1Q3BA 1IN4A 4Z6YA 3ILKA 2E5LM 2V6ZM 4NSRA 1DGBA 4LF5M 1XNQM 2KZUA 5DYGA 2FFFB 1YUEA 3U6LA 3DA1A 4QNMA 3N3FA 4KLNA 3LMMA 4LFBM 2CFOA 1C1KA 3CTWB 2ZAOA 3UGJA 3J81S 2LNHC 3M7GA 3UZUA 2R45A 3GLFA 3KP1E 1N36M 2M60A 1QAQA 3LQQA 2OQ4A 3GPUA 3AL0C 4GMQA 4NXMM 1DO0A 4OX9M 3M6AA 2JA2A 2XD5A 4X64M 3GPYA 3JR5A 1YE9A 3HONA 2R65A 1J5EM 3U6EA 5KPRA 3HU2A 3KS8A 2DWZB 1IN7A 1HT2E 4WURA 4FD2A 4JI7M 3T1HM 2Z7JA 1IY1A 1GL7A 4OJOA 4MB7A 2JCHA 3FUVA 3ZCBB 2XFTA 3KOWE 2DWMA 3ZH9B 2Y2IA 3HHYA 3PXGA 1MX0A 3FUWA 5FTKA 2XSZD 3FD9A 2YR0A 4I5SA 4L4UA 5KO3A 2D7EA 2F5QA 1NHGC 5KQ8A 3AKZA 2XZUA 4LF4M 1XMQM 4L78A 2G8LA 4PDGA 1PM5A 2Y2PA 2C96A 4ZPXA 3HGIA 4DV5M 5EXPA 2C99A 4M9SA 3GQ5A 2BJVA 3HSHA 4G4QA 5FTMA 5IZ7D 1MU5A 3RE8A 3RGPA 3VFDA 2KEBA 3ZC7B 1XMOM 4PD2A 1SXJB 3U61B 5ITTA 2L09A 4DR3M 4LJ4A 1WXQA 3IG5A 3SATA 1G8PA 3H4MA 4R7GA 2DWNA 3FTDA 1YU2A 2W82A 2XH9A 1TDHA 3MK6A 3Q8XA 4DR2M 4GKJM 3MHVC 4IBIA 4QHTA 5JI2E 4FVMA 4IBCA 1J7KA 2XLJA 1TH2A 4DV1M 1Q3CA 2HKJA 4REZA 1G41A 3AOEA 2YFQA 1G3IA 5EP4A 4NZ3A 1I4WA 3GLGA 1QQWA 1UM8A 4PCZA 1JR3D 3AOEC 3SHGB 4IBDA 2CHGA 2EO2A 2KZSA 1SXJC 4OJ5A 4DV2M 2D7GA 3U6OA 2DXIA 4OJLA 4NL4H 3AFHA 4LG2A 4LZZA 4IBEA 4LGYA 3U5ZB 1E94E 4YY3M 2X8AA 4KODA 1NY5A 5EJCA 4I8OA 3U60B 3U6PA 1Z5AA 3AJIB 1QVRA 3FUTA 4NZ5A 4DUYM 4IBJA 2RKOA 2KRUA 1XHBA 4B7GA 1HQYE 1KSFX 4DV4M 4LF9M 2K47A 3TPZA 1NVMA 2D7HA 1N78A 4B3RM 1N32M 3THGA 2OPFA 5GKNA 2G5GX 1JQJC 2I7NA 5KPTA 3HHWA 4IBGA 3A45A 4JI1M 1G4AE 1QZMA 5ITXA 3OTOM 5F3WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IJF A;  4IBK A;  3L26 A;  3L2A A;  4GHL A;  4IBJ A;  3L27 A;  4IBB A;  3KS4 A;  3FKE A;  4IBF A;  4IBD A;  4IJE A;  4LG2 A;  4GHA A;  3L28 A;  4IBE A;  5BPV A;  3L25 A;  4IBG A;  4GH9 A;  4IBI A;  4IBC A;  3L29 A;  3KS8 A; 
#chains in the Genus database with same CATH topology
 3TQS A;  4NYY A;  4NYU A;  3AV0 A;  3DZD A;  4LJ9 A;  4NC6 A;  5KQD A;  1TR8 A;  1WR1 B;  3A42 A;  2DNA A;  4MGZ E;  2VQF M;  1Z59 A;  1KFV A;  4KHP M;  2JY6 B;  3I04 M;  4JI4 M;  1E6R A;  1O6I A;  1NNJ A;  2LVQ D;  5EQT A;  1PRB A;  1NV8 A;  3CF0 A;  2EA0 A;  3KVW A;  2LBC A;  3CF6 E;  2FOI C;  3TE6 A;  4DUZ M;  2CRU A;  2QPA A;  3U6M A;  3AOG A;  2CHQ A;  2DAG A;  2I7P A;  4LF6 M;  2UUA M;  3FUX A;  3TL4 X;  4JYA M;  2V5O A;  3MQL A;  1EE8 A;  4LJ7 A;  3HHX A;  2Z3X A;  3SYK A;  3LCV B;  4ANR A;  4FCW A;  2L6O A;  4LGM A;  5IT9 S;  3D8L A;  3HJS A;  3FE3 A;  1P3Q Q;  4DV0 M;  3QWL A;  1K3W A;  2L4F A;  3QYB A;  1IXZ A;  2M5Z A;  4HL4 A;  4G6Z A;  7CAT A;  3GQ3 A;  1N77 A;  1ZMW A;  3L27 A;  4G4O A;  1R6B X;  1G71 A;  2YNM D;  1OKS A;  4AKH A;  1AIP C;  4HME A;  3SAV A;  4R3D A;  2BG1 A;  1GLN A;  4LJA A;  4JI5 M;  4MGI E;  4AW4 A;  4JI2 M;  2FH0 A;  1TTE A;  5A2Q S;  2F5P A;  1DGG A;  1OJL A;  3B9P A;  1ZMV A;  4DBG B;  4BBA A;  2Q2E B;  2ZAM A;  2FFJ A;  2DWL A;  2QHO B;  3KOX E;  1VDL A;  2O5R A;  2V1C A;  4FWG A;  4MM3 B;  4FCV A;  5IWA M;  2XEP A;  1XNR M;  3L25 A;  1NO1 A;  1Z5B A;  1HQC A;  2R18 A;  1FJG M;  2EUC A;  3PVS A;  2X4A A;  2DHR A;  2WZJ A;  4LY6 A;  1W1Y A;  5EXX A;  3L26 A;  1ZMU A;  1JR3 A;  1TGU A;  5FTL A;  3HHZ A;  1XWI A;  4I4L A;  1G59 A;  2XGN A;  3SMS A;  3C58 A;  2K9D A;  4NZ1 A;  4M0W A;  2UXD M;  4GRI A;  3GLI A;  2F5S A;  1QDR A;  4Z2L A;  4TX8 A;  3LCU A;  2MRO B;  2Y2M A;  2J7O A;  1Z6T A;  4KT0 F;  1ZQ9 A;  3C3E A;  2LVN C;  3TWL A;  4B7H A;  5BR8 M;  2XF3 A;  4G4R A;  4AI6 A;  3GLI B;  3KFU G;  2YQZ A;  3SAU A;  1L1T A;  4L16 A;  3KSJ A;  3RFW A;  2JUJ A;  2R4E A;  5FTJ A;  4AKG A;  3PNY A;  3HWS A;  3T15 A;  3GP1 A;  2Y20 A;  3EIH A;  2QBY B;  3K8Z A;  1X37 A;  4XK8 F;  3KW6 A;  1KYI A;  2LVA A;  5JI3 E;  4D82 A;  1V34 A;  3J7A S;  2JZ1 A;  2Z4R A;  1TDZ A;  1TH3 A;  3HJQ A;  3I4V A;  4ITQ A;  2O01 F;  2Y0T A;  2Y2O A;  4L15 A;  1GKI A;  1QYR A;  2FNA A;  2HWJ A;  2R6F A;  1L2C A;  2CV2 A;  3J80 S;  3W68 A;  2QSF X;  2LWX A;  5FTN A;  4AZF A;  4NRW A;  3LQR A;  3ZQJ A;  1E88 A;  2X49 A;  3E21 A;  3NBX X;  1IBK M;  2VF8 A;  1DO2 A;  2CEA A;  4LZJ A;  4QNR A;  4QHS A;  3I4Y A;  1R4G A;  1C7Y A;  1WIV A;  3GPP A;  3J27 B;  2A5Y B;  4QOZ C;  1D2N A;  3Q8G A;  4LRS A;  2KNV A;  4LJ8 A;  2EKF A;  1QAN A;  4NOO B;  4W5W A;  4JV5 M;  2JZ0 A;  1IN5 A;  4IJF A;  4DR7 M;  3WD3 A;  3K9P A;  4MGK E;  1VEJ A;  4Q7J A;  3GRU A;  2EJS A;  4M9X A;  2KRK A;  4NZ4 A;  4OUI A;  4Z2G A;  2RGO A;  2JWS A;  3MJ5 A;  3T38 A;  3FKE A;  4DR5 M;  1ZAE A;  2QCU A;  2C5R A;  4AKI A;  1L2B A;  2J7N A;  1IM2 A;  3KOZ E;  1Z5C A;  1OIP A;  4CGY B;  1IQP A;  4B7F A;  2JY8 A;  1S3S A;  4GHA A;  1GAB A;  3DOA A;  1N34 M;  3C9P A;  3B7N A;  4OU7 A;  1SXJ D;  3W67 A;  2FE8 A;  3I01 M;  4PT5 A;  5FSW A;  1E9R A;  5EXT A;  3HZJ A;  4X62 M;  2L7H A;  4D80 A;  1D0M A;  5ITU A;  2UUC M;  2DAI A;  2DAK A;  2CV1 A;  3HU3 A;  4Z2K A;  1GO5 A;  1NY6 A;  1MJG M;  1OFH A;  2DZN B;  4FCT A;  3UJN A;  5E6J A;  4II7 A;  1E15 A;  5L8R F;  3L2A A;  2WSE F;  3DFZ A;  1IXR C;  1PJI A;  4IIW A;  2UXC M;  3HJ8 A;  2HAK A;  3IEC A;  4QNL A;  1EIJ A;  1E9S A;  2DKL A;  3GLH B;  1XXH E;  3GRY A;  1E6P A;  3FYC A;  3B7Q A;  4WW0 A;  4X65 M;  4TUW A;  3CF2 A;  3SHF A;  2R46 A;  1NSF A;  4QOS A;  3E46 A;  3GLG E;  3TWM A;  3T1Y M;  2HHH M;  4MGH A;  3WX7 A;  4K0K M;  1OAI A;  4GC5 A;  1YU0 A;  1YUB A;  3EIE A;  4DR1 M;  3VK7 A;  3SMP A;  2KW0 A;  3GRR A;  4MH0 E;  2XFS A;  5ITR A;  4X66 M;  2APL A;  4LF7 M;  3GLG B;  4NXN M;  3NBI A;  2ZTC A;  3HX3 A;  4B08 A;  2HCB A;  4JI8 M;  4NY2 A;  2DAM A;  1F4I A;  1CK7 A;  4Z2H A;  1GJS A;  1XXH B;  2JP7 A;  4IBK A;  4KO8 A;  3JAM S;  2KHH A;  5EP3 A;  2AHM A;  2R4J A;  1VG5 A;  3PFI A;  4JI6 M;  2RRU A;  5ITY A;  4CIZ A;  3HY5 A;  1IY2 A;  2QZ4 A;  1QAO A;  2LH0 A;  1L8Q A;  4OJP A;  2CWB A;  2C9C A;  4GEW A;  4NSO B;  3W0L B;  2CHV A;  2KDL A;  1PJS A;  1AUA A;  2ZBK B;  3QAU A;  1OIZ A;  4MGY E;  3V76 A;  3LVV A;  4FW9 A;  3WHK A;  1IN6 A;  2L7I A;  4IJE A;  1I94 M;  2UU9 M;  2R44 A;  3KP0 E;  3BBZ A;  3SYL A;  4F1I A;  3FRI A;  2FS1 A;  1GL6 A;  2Y21 A;  3L28 A;  4GC9 A;  3GPX A;  2MJ5 B;  4XGI A;  3U6Q A;  3SAW A;  1HR0 M;  1RU3 A;  1W1V A;  4WP2 A;  2H1R A;  2OO9 A;  1NJF A;  5ITX E;  4JXJ A;  5BPV A;  2VQE M;  1A5T A;  3SBJ A;  2F5N A;  2UWX A;  1NNU C;  4DV3 M;  1IXS A;  1HNZ M;  1VQ1 A;  3KOY E;  4BLC A;  4M0D A;  3GRV A;  2UUB M;  5FLX S;  4GKK M;  1YU4 A;  3TWK A;  1LV7 A;  1T3T A;  3U5Z A;  1N75 A;  1IY0 A;  1SXJ E;  1PJT A;  4P17 A;  1HNX M;  4LF8 M;  4R71 A;  1PJJ A;  1E6N A;  2JNH A;  3E4R A;  4JI3 M;  2QEN A;  1W5T A;  3FYD A;  4GHL A;  3I51 A;  1YU3 A;  2Y2G A;  3SAR A;  2KA6 B;  2KNA A;  5IRE B;  2CP8 A;  3GLH E;  1OFI A;  4OVZ B;  1WGN A;  1R2Z A;  2D49 A;  1OTR A;  3U6C A;  1PDC A;  2VII A;  2R62 A;  4GIT A;  1R2Y A;  3WD4 A;  2DVW B;  1QAM A;  2BJW A;  4LCB A;  1XC8 A;  2Y2Q A;  1H6U A;  3SC3 A;  2ZM6 M;  5C1B A;  3K2L A;  2F5O A;  1K82 A;  2XSZ A;  4L8R C;  3FUU A;  4HMC A;  3FTE A;  3M0E A;  2DHY A;  1QZE A;  1DGH A;  2KXE A;  2DEN A;  3HU1 A;  5EP2 A;  4EIW A;  1QO6 A;  2G3Q A;  1J7M A;  1T6O A;  3D8B A;  2LHG A;  1BVS A;  5DNY A;  3K92 A;  2BNK A;  1ORY B;  1OAO C;  2Y0Q A;  2Z4S A;  1PJQ A;  5H37 D;  2WSF F;  1L2D A;  3F92 A;  1DGH B;  2CE7 A;  3PNV A;  4OW0 A;  4RNA A;  2Y2N A;  2LHC A;  4LJ6 A;  3J2P B;  1EAK A;  3NWL A;  4NRV A;  1V92 A;  3H4J A;  2FN2 A;  4HLQ A;  4JI0 M;  3A98 B;  1E6Z A;  2MGW A;  4B3T M;  4M9Z A;  2F4V M;  2Y2L A;  2C9O A;  2DAE A;  4DR4 M;  1IN8 A;  2Z8Y M;  4AG6 A;  3A46 A;  5LMU M;  1D0L A;  1E32 A;  3K1J A;  3VDP A;  4S12 A;  4Z8X A;  3U6D A;  1KS0 A;  2Y2J A;  2QBY A;  3W0F A;  3VLF B;  2JXN A;  3WD2 A;  5EP1 A;  3HKP A;  2V1U A;  1NHW C;  3KDS E;  4CHT B;  2J5Y A;  2UXB M;  3VDU A;  3L29 A;  2IOU A;  3SFZ A;  1N33 M;  2CV0 A;  1JB0 F;  4Z2J A;  2XZF A;  1J09 A;  3GQ4 A;  4G4N A;  2C98 A;  1VDD A;  4DV7 M;  3VKH A;  2MH8 A;  1HT1 E;  2GNO A;  2P5T A;  4RF1 A;  4XBO A;  1HJP A;  2ZAN A;  4IBB A;  2JE5 A;  4I81 A;  4A3V B;  1GVN A;  2NQ8 C;  5E26 A;  5KPZ A;  3BOS A;  5LMN M;  1CXW A;  3J7B A;  2HL7 A;  1FNN A;  2BWB A;  4JN6 A;  3WHL A;  4LFA M;  4F2L A;  4DR6 M;  4MB3 A;  4PDI A;  1ZV1 A;  4OVZ A;  1XXH A;  3GLF B;  3R8F A;  1YU1 A;  2EKK A;  2OOB A;  1DGF A;  1YSY A;  3VKG A;  2JY5 A;  4B3S M;  3B74 A;  4P16 A;  4RF0 A;  3VK8 A;  3IG8 A;  2XD1 A;  4GIP A;  2DI0 A;  3CGW A;  1Q02 A;  4GH9 A;  1PGY A;  2Y2K A;  1R5L A;  3LVW A;  5C18 A;  3RGS A;  4DV6 M;  3FTF A;  2CUZ A;  1YLA A;  3U61 A;  3R9X B;  1W5S A;  2RGH A;  1IBM M;  3KXE C;  4OJ6 A;  1NJG A;  1IXS B;  3KS4 A;  4D81 A;  3JR4 A;  3E9S A;  4HMD A;  3WD1 A;  1QDT A;  4IBF A;  1IBL M;  3U60 A;  2Y2H A;  1L1Z A;  1CUK A;  3FTC A;  1GXD A;  2VF7 A;  1K3X A;  4CIS A;  4BB9 A;  3GLH A;  5EXS A;  2B3T A;  4LJ5 A;  2ERC A;  1VEK A;  4L6V 6;  1R7R A;  4B3M M;  4AQY M;  2DZO B;  1GJT A;  4FWH A;  3U6S A;  1T43 A;  1SXJ A;  3UMM A;  2LXE A;  4LRT A;  4FWD A;  3UK6 A;  1Q39 A;  5ITQ A;  4RKU F;  3SAS A;  2H5X A;  1TH4 A;  3KSX A;  2O25 A;  1E8B A;  1HNW M;  8CAT A;  4YHH M;  5DYI A;  4AG5 A;  3GO8 A;  4LFC M;  2QP9 X;  1Q3B A;  2LTU A;  1D0K A;  3GLF E;  1IN4 A;  4Z6Y A;  1UR8 A;  3ILK A;  1LTM A;  2E5L M;  2V6Z M;  4NSR A;  1DGB A;  4LF5 M;  1XNQ M;  2KZU A;  5DYG A;  2FFF B;  1H0G A;  1YUE A;  3U6L A;  1OQY A;  3DA1 A;  4QNM A;  4KLN A;  3N3F A;  3LMM A;  4LFB M;  2CFO A;  1C1K A;  3C3D A;  3CTW B;  1Y8G A;  2ZAO A;  3UGJ A;  3J81 S;  2LNH C;  3M7G A;  3UZU A;  2R45 A;  3GLF A;  1H8P A;  3KP1 E;  1N36 M;  2M60 A;  1QAQ A;  3LQQ A;  5DFL A;  2RTS A;  2OQ4 A;  3GPU A;  3AL0 C;  4MB5 A;  4GMQ A;  4NXM M;  1DO0 A;  4OX9 M;  3M6A A;  2JA2 A;  2XD5 A;  1L6J A;  4X64 M;  4UN2 B;  3GPY A;  1WJ7 A;  1YE9 A;  3JR5 A;  2R65 A;  1J5E M;  3HON A;  3U6E A;  1TF0 B;  5KPR A;  3HU2 A;  3KS8 A;  2DWZ B;  1IN7 A;  1HT2 E;  4WUR A;  4FD2 A;  4JI7 M;  2JY7 A;  4CJ6 A;  1MN3 A;  1QUT A;  2Z7J A;  3T1H M;  1IY1 A;  1GL7 A;  4OJO A;  4MB7 A;  1UFZ A;  2JCH A;  3FUV A;  3ZCB B;  4MB4 A;  2XFT A;  3KOW E;  2DWM A;  3ZH9 B;  2Y2I A;  3HHY A;  3PXG A;  1MX0 A;  3FUW A;  5FTK A;  2XSZ D;  3FD9 A;  1XB2 B;  2YR0 A;  4I5S A;  1UR9 A;  4L4U A;  5KO3 A;  2D7E A;  3B89 A;  1JR3 E;  2F5Q A;  1NHG C;  2MR9 A;  5KQ8 A;  3AKZ A;  2XZU A;  4LF4 M;  2R0I A;  1XMQ M;  4L78 A;  2G8L A;  4PDG A;  3K9O A;  1PM5 A;  2Y2P A;  2C96 A;  4ZPX A;  3MMP A;  3HGI A;  4DV5 M;  5EXP A;  2C99 A;  2VDB B;  3WD0 A;  2L2D A;  4M9S A;  1W1P A;  3GQ5 A;  2BJV A;  2LVO C;  3HSH A;  4G4Q A;  1H0I A;  5FTM A;  5IZ7 D;  1NV9 A;  1EFU B;  1MU5 A;  3RE8 A;  3RGP A;  3VFD A;  2KEB A;  3ZC7 B;  1XMO M;  4PD2 A;  1SXJ B;  3U61 B;  5ITT A;  2L09 A;  4DR3 M;  1OGG A;  4LJ4 A;  1WXQ A;  3IG5 A;  3SAT A;  1G8P A;  3H4M A;  4R7G A;  2DWN A;  3FTD A;  2GQF A;  2LVP C;  4Y28 F;  1YU2 A;  4Z2I A;  2W82 A;  1QUS A;  2L4E A;  2N35 A;  2XH9 A;  1TDH A;  3MK6 A;  3Q8X A;  4DR2 M;  4GKJ M;  3MHV C;  4IBI A;  3LW5 F;  4QHT A;  5JI2 E;  1OGB A;  4FVM A;  4IBC A;  2WSC F;  1J7K A;  3T6P A;  1TH2 A;  2XLJ A;  4DV1 M;  1Q3C A;  2DZL A;  2HKJ A;  4REZ A;  1G41 A;  3AOE A;  4G3O A;  2YFQ A;  1G3I A;  5EP4 A;  4NZ3 A;  1I4W A;  3GLG A;  1QQW A;  1UM8 A;  4PCZ A;  1JR3 D;  3AOE C;  3SHG B;  4IBD A;  2CHG A;  2EO2 A;  2KZS A;  1SXJ C;  4OJ5 A;  4DV2 M;  2D7G A;  3U6O A;  1W1T A;  2DXI A;  4OJL A;  1SG9 A;  4NL4 H;  3AFH A;  4LG2 A;  1WHC A;  4LZZ A;  3B7Z A;  4IBE A;  4HEO A;  4LGY A;  1E94 E;  3U5Z B;  3BXW A;  1WGL A;  3M7P A;  4YY3 M;  2X8A A;  4KOD A;  1NY5 A;  1V33 A;  5EJC A;  4I8O A;  1IFY A;  3U60 B;  1DV0 A;  3U6P A;  3IHP A;  1Z5A A;  3AJI B;  1QVR A;  3FUT A;  4NZ5 A;  1GPF A;  4DUY M;  2K6B A;  3QYE A;  1QZM A;  4IBJ A;  2RKO A;  2KRU A;  2BWE A;  1XHB A;  3FRH A;  2ZTD A;  4B7G A;  1HQY E;  1KSF X;  4DV4 M;  3GLI E;  2OOA A;  4LF9 M;  2K47 A;  3TPZ A;  1AIW A;  1NVM A;  2D7H A;  1N78 A;  4B3R M;  1N32 M;  1ED7 A;  3THG A;  2OPF A;  5GKN A;  1VEG A;  2G5G X;  2KNZ A;  2K0B X;  1JQJ C;  2I7N A;  5KPT A;  3HHW A;  4IBG A;  3A45 A;  1GOI A;  4JI1 M;  1G4A E;  2QNJ A;  5ITX A;  3OTO M;  5F3W A;  2QQ8 A; 
#chains in the Genus database with same CATH homology
 3TQS A;  4NYY A;  4NYU A;  3AV0 A;  3DZD A;  4LJ9 A;  5KQD A;  3A42 A;  4MGZ E;  2VQF M;  4KHP M;  1Z59 A;  1KFV A;  4JI4 M;  1NNJ A;  5EQT A;  3CF0 A;  2EA0 A;  3KVW A;  3CF6 E;  3TE6 A;  2FOI C;  4DUZ M;  3U6M A;  2QPA A;  3AOG A;  2CHQ A;  2I7P A;  4LF6 M;  2UUA M;  3FUX A;  3TL4 X;  4JYA M;  1EE8 A;  4LJ7 A;  3HHX A;  2Z3X A;  3SYK A;  4FCW A;  2L6O A;  4LGM A;  5IT9 S;  3D8L A;  3HJS A;  4DV0 M;  1K3W A;  3QWL A;  1IXZ A;  2M5Z A;  4HL4 A;  4G6Z A;  7CAT A;  3GQ3 A;  1N77 A;  3L27 A;  4G4O A;  1R6B X;  2YNM D;  4AKH A;  3SAV A;  4R3D A;  2BG1 A;  1GLN A;  4LJA A;  4JI5 M;  4MGI E;  4AW4 A;  4JI2 M;  5A2Q S;  2F5P A;  1DGG A;  1OJL A;  3B9P A;  4BBA A;  2Q2E B;  2ZAM A;  2FFJ A;  2DWL A;  3KOX E;  3L25 A;  2O5R A;  2V1C A;  4FWG A;  4MM3 B;  4FCV A;  5IWA M;  2XEP A;  1XNR M;  1Z5B A;  1HQC A;  2R18 A;  1FJG M;  2EUC A;  3PVS A;  2X4A A;  2DHR A;  4LY6 A;  5EXX A;  3L26 A;  1JR3 A;  1TGU A;  5FTL A;  3HHZ A;  1XWI A;  4I4L A;  1G59 A;  2XGN A;  3SMS A;  3C58 A;  4NZ1 A;  4M0W A;  2UXD M;  4GRI A;  3GLI A;  2F5S A;  2Y2M A;  2J7O A;  1Z6T A;  1ZQ9 A;  5BR8 M;  4B7H A;  3TWL A;  4G4R A;  4AI6 A;  2XF3 A;  3GLI B;  3KFU G;  2YQZ A;  3SAU A;  1L1T A;  4L16 A;  3KSJ A;  3RFW A;  4AKG A;  2R4E A;  5FTJ A;  3PNY A;  3HWS A;  3T15 A;  3GP1 A;  2Y20 A;  3EIH A;  2QBY B;  3K8Z A;  1X37 A;  3KW6 A;  1KYI A;  5JI3 E;  4D82 A;  3J7A S;  1TDZ A;  2Z4R A;  1TH3 A;  3HJQ A;  3I4V A;  4ITQ A;  2Y0T A;  2Y2O A;  4L15 A;  1GKI A;  1QYR A;  2FNA A;  1L2C A;  2CV2 A;  3J80 S;  5FTN A;  2LWX A;  4AZF A;  4NRW A;  3LQR A;  2X49 A;  1IBK M;  1DO2 A;  2CEA A;  4LZJ A;  4QNR A;  4QHS A;  3I4Y A;  3GPP A;  3J27 B;  2A5Y B;  4QOZ C;  1D2N A;  4LRS A;  4NOO B;  4LJ8 A;  1QAN A;  4W5W A;  4JV5 M;  4IJF A;  1IN5 A;  4DR7 M;  4MGK E;  3GRU A;  4M9X A;  2KRK A;  4NZ4 A;  4OUI A;  2RGO A;  3MJ5 A;  3T38 A;  3FKE A;  4DR5 M;  1ZAE A;  2QCU A;  2C5R A;  4AKI A;  1L2B A;  2J7N A;  1IM2 A;  3KOZ E;  1Z5C A;  4CGY B;  1IQP A;  4B7F A;  1S3S A;  4GHA A;  3DOA A;  1N34 M;  4OU7 A;  1SXJ D;  2FE8 A;  4PT5 A;  5FSW A;  1E9R A;  5EXT A;  4X62 M;  2L7H A;  4D80 A;  5ITU A;  2UUC M;  2CV1 A;  3HU3 A;  1NY6 A;  1OFH A;  4FCT A;  2DZN B;  3UJN A;  5E6J A;  4II7 A;  3L2A A;  2UXC M;  3DFZ A;  1IXR C;  1PJI A;  4IIW A;  3HJ8 A;  4QNL A;  1E9S A;  3GLH B;  3GRY A;  3FYC A;  4X65 M;  4WW0 A;  4TUW A;  3CF2 A;  3SHF A;  2R46 A;  1NSF A;  4QOS A;  3TWM A;  3T1Y M;  2HHH M;  4MGH A;  3WX7 A;  4K0K M;  4GC5 A;  1YU0 A;  1YUB A;  3EIE A;  4DR1 M;  3VK7 A;  3SMP A;  2KW0 A;  3GRR A;  4MH0 E;  2XFS A;  5ITR A;  4X66 M;  4LF7 M;  3GLG B;  4NXN M;  3NBI A;  2HCB A;  4JI8 M;  4NY2 A;  1XXH B;  4IBK A;  4KO8 A;  3JAM S;  5EP3 A;  2AHM A;  2R4J A;  3PFI A;  4JI6 M;  5ITY A;  4OJP A;  1IY2 A;  2QZ4 A;  1QAO A;  2LH0 A;  1L8Q A;  2C9C A;  4NSO B;  3W0L B;  2CHV A;  4MGY E;  4B08 A;  4CHT B;  2ZBK B;  3QAU A;  3WHK A;  3LVV A;  4FW9 A;  2UU9 M;  1IN6 A;  2L7I A;  4IJE A;  1I94 M;  3KP0 E;  3SYL A;  1GL6 A;  2Y21 A;  3L28 A;  4GC9 A;  3GPX A;  4XGI A;  3U6Q A;  3SAW A;  1HR0 M;  2H1R A;  1NJF A;  5ITX E;  4JXJ A;  5BPV A;  2VQE M;  3SBJ A;  2F5N A;  2UWX A;  1NNU C;  4DV3 M;  1HNZ M;  2UUB M;  3KOY E;  4BLC A;  4GKK M;  4M0D A;  3GRV A;  1YU4 A;  5FLX S;  3TWK A;  1LV7 A;  1T3T A;  3U5Z A;  1N75 A;  1IY0 A;  1SXJ E;  1HNX M;  4LF8 M;  1PJJ A;  3E4R A;  4JI3 M;  2QEN A;  1W5T A;  3FYD A;  4GHL A;  3I51 A;  1YU3 A;  2Y2G A;  3SAR A;  2KA6 B;  5IRE B;  1OFI A;  4OVZ B;  1R2Z A;  3U6C A;  2VII A;  2R62 A;  4GIT A;  1R2Y A;  2DVW B;  1QAM A;  2BJW A;  4LCB A;  1XC8 A;  2Y2Q A;  1H6U A;  3SC3 A;  2ZM6 M;  5C1B A;  3K2L A;  2F5O A;  1K82 A;  2XSZ A;  4L8R C;  3FUU A;  3FTE A;  3M0E A;  3HU1 A;  4EIW A;  1DGH A;  2KXE A;  5EP2 A;  3D8B A;  5DNY A;  3K92 A;  2BNK A;  2Y0Q A;  1ORY B;  2Z4S A;  5H37 D;  1L2D A;  3PNV A;  1DGH B;  2CE7 A;  4OW0 A;  4RNA A;  2Y2N A;  4LJ6 A;  3J2P B;  3NWL A;  4NRV A;  4HLQ A;  4JI0 M;  3A98 B;  4B3T M;  4M9Z A;  2F4V M;  2Y2L A;  2C9O A;  4DR4 M;  1IN8 A;  4AG6 A;  5LMU M;  3A46 A;  1E32 A;  3K1J A;  3VDP A;  4S12 A;  4Z8X A;  3U6D A;  2Y2J A;  2QBY A;  3W0F A;  3VLF B;  5EP1 A;  3HKP A;  2V1U A;  1NHW C;  3KDS E;  2UXB M;  3VDU A;  3L29 A;  2IOU A;  3SFZ A;  1N33 M;  2CV0 A;  2XZF A;  1J09 A;  3GQ4 A;  4G4N A;  2C98 A;  1VDD A;  4DV7 M;  3VKH A;  1HT1 E;  2JE5 A;  2P5T A;  4RF1 A;  4XBO A;  2ZAN A;  4IBB A;  4I81 A;  4A3V B;  1GVN A;  2NQ8 C;  5E26 A;  5KPZ A;  3BOS A;  5LMN M;  3J7B A;  2HL7 A;  1FNN A;  4JN6 A;  4DR6 M;  3WHL A;  4LFA M;  4PDI A;  4OVZ A;  3GLF B;  1XXH A;  3R8F A;  1YU1 A;  1DGF A;  1YSY A;  3VKG A;  4B3S M;  3VK8 A;  4P16 A;  4RF0 A;  2XD1 A;  3IG8 A;  4GIP A;  4GH9 A;  2Y2K A;  3LVW A;  5C18 A;  3RGS A;  4DV6 M;  3FTF A;  2CUZ A;  3U61 A;  3R9X B;  1W5S A;  2RGH A;  1IBM M;  3KXE C;  4OJ6 A;  1NJG A;  1IXS B;  3KS4 A;  4D81 A;  3JR4 A;  3E9S A;  4IBF A;  1IBL M;  3U60 A;  2Y2H A;  1L1Z A;  3FTC A;  1K3X A;  4CIS A;  4BB9 A;  3GLH A;  5EXS A;  4LJ5 A;  2ERC A;  1R7R A;  4B3M M;  4AQY M;  2DZO B;  4FWH A;  3U6S A;  1SXJ A;  3UMM A;  2LXE A;  4LRT A;  4FWD A;  3UK6 A;  1Q39 A;  5ITQ A;  3SAS A;  1TH4 A;  3KSX A;  1HNW M;  8CAT A;  4YHH M;  5DYI A;  4AG5 A;  3GO8 A;  4LFC M;  2QP9 X;  1Q3B A;  1IN4 A;  4Z6Y A;  3ILK A;  2E5L M;  2V6Z M;  4NSR A;  1DGB A;  4LF5 M;  1XNQ M;  2KZU A;  5DYG A;  2FFF B;  1YUE A;  3U6L A;  3DA1 A;  4QNM A;  3N3F A;  4KLN A;  3LMM A;  4LFB M;  2CFO A;  1C1K A;  3CTW B;  2ZAO A;  3UGJ A;  3J81 S;  2LNH C;  3M7G A;  3UZU A;  2R45 A;  3GLF A;  3KP1 E;  1N36 M;  2M60 A;  1QAQ A;  3LQQ A;  2OQ4 A;  3GPU A;  3AL0 C;  4GMQ A;  4NXM M;  1DO0 A;  4OX9 M;  3M6A A;  2JA2 A;  2XD5 A;  4X64 M;  3GPY A;  3JR5 A;  1YE9 A;  3HON A;  2R65 A;  1J5E M;  3U6E A;  5KPR A;  3HU2 A;  3KS8 A;  2DWZ B;  1IN7 A;  1HT2 E;  4WUR A;  4FD2 A;  4JI7 M;  3T1H M;  2Z7J A;  1IY1 A;  1GL7 A;  4OJO A;  4MB7 A;  2JCH A;  3FUV A;  3ZCB B;  2XFT A;  3KOW E;  2DWM A;  3ZH9 B;  2Y2I A;  3HHY A;  3PXG A;  1MX0 A;  3FUW A;  5FTK A;  2XSZ D;  3FD9 A;  2YR0 A;  4I5S A;  4L4U A;  5KO3 A;  2D7E A;  2F5Q A;  1NHG C;  5KQ8 A;  3AKZ A;  2XZU A;  4LF4 M;  1XMQ M;  4L78 A;  2G8L A;  4PDG A;  1PM5 A;  2Y2P A;  2C96 A;  4ZPX A;  3HGI A;  4DV5 M;  5EXP A;  2C99 A;  4M9S A;  3GQ5 A;  2BJV A;  3HSH A;  4G4Q A;  5FTM A;  5IZ7 D;  1MU5 A;  3RE8 A;  3RGP A;  3VFD A;  2KEB A;  3ZC7 B;  1XMO M;  4PD2 A;  1SXJ B;  3U61 B;  5ITT A;  2L09 A;  4DR3 M;  4LJ4 A;  1WXQ A;  3IG5 A;  3SAT A;  1G8P A;  3H4M A;  4R7G A;  2DWN A;  3FTD A;  1YU2 A;  2W82 A;  2XH9 A;  1TDH A;  3MK6 A;  3Q8X A;  4DR2 M;  4GKJ M;  3MHV C;  4IBI A;  4QHT A;  5JI2 E;  4FVM A;  4IBC A;  1J7K A;  2XLJ A;  1TH2 A;  4DV1 M;  1Q3C A;  2HKJ A;  4REZ A;  1G41 A;  3AOE A;  2YFQ A;  1G3I A;  5EP4 A;  4NZ3 A;  1I4W A;  3GLG A;  1QQW A;  1UM8 A;  4PCZ A;  1JR3 D;  3AOE C;  3SHG B;  4IBD A;  2CHG A;  2EO2 A;  2KZS A;  1SXJ C;  4OJ5 A;  4DV2 M;  2D7G A;  3U6O A;  2DXI A;  4OJL A;  4NL4 H;  3AFH A;  4LG2 A;  4LZZ A;  4IBE A;  4LGY A;  3U5Z B;  1E94 E;  4YY3 M;  2X8A A;  4KOD A;  1NY5 A;  5EJC A;  4I8O A;  3U60 B;  3U6P A;  1Z5A A;  3AJI B;  1QVR A;  3FUT A;  4NZ5 A;  4DUY M;  4IBJ A;  2RKO A;  2KRU A;  1XHB A;  4B7G A;  1HQY E;  1KSF X;  4DV4 M;  4LF9 M;  2K47 A;  3TPZ A;  1NVM A;  2D7H A;  1N78 A;  4B3R M;  1N32 M;  3THG A;  2OPF A;  5GKN A;  2G5G X;  1JQJ C;  2I7N A;  5KPT A;  3HHW A;  4IBG A;  3A45 A;  4JI1 M;  1G4A E;  1QZM A;  5ITX A;  3OTO M;  5F3W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...