4IBJA

Ebola virus vp35 bound to small molecule
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
124
structure length
124
Chain Sequence
PDISAKDLRNIMYDHLPGFGTAFHQLVQVICKLGKDSNSLDIIHAEFQASLAEGDSPQCALIQITKRVPIFQDAAPPVIHIRSRGDIPRACQKSLRPVPPSPKIDRGWVCVFQLQDGKTLGLKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Polymerase cofactor VP35
publication title In Silico Derived Small Molecules Bind the Filovirus VP35 Protein and Inhibit Its Polymerase Cofactor Activity.
pubmed doi rcsb
source organism Ebola virus
molecule tags Transcription/transcription inhibitor
total genus 40
structure length 124
sequence length 124
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-12-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.950 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4ibjA01
2.10.10.70 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 4ibjA02
4IBCA 4IBJA 3KS8A 3KS4A 4IBGA 5BPVA 4IBFA 4GHLA 3L2AA 4IJFA 3FKEA 3L28A 4IJEA 4IBBA 4GHAA 4GH9A 3L25A 3L29A 4IBDA 4IBKA 4IBIA 3L27A 4LG2A 4IBEA 3L26A
chains in the Genus database with same CATH superfamily
1IY0A 2KW0A 2E5LM 1E94E 1XXHE 4S12A 4L78A 1YU4A 1G41A 2EO2A 3I4YA 4M9ZA 2XZFA 2HL7A 4KO8A 3VKHA 1UR9A 3GPYA 2C99A 3L28A 3VK8A 1EE8A 3U60A 4LJ6A 2L4EA 1KYIA 3RFWA 4DV5M 4LGMA 4OVZA 1GO5A 1D0KA 2F5OA 2JNHA 3W67A 1E88A 2R0IA 4QNMA 4LF9M 3FTFA 1R2YA 2Y2PA 4NL4H 1ED7A 4DV1M 2JXNA 2V1CA 3E4RA 4GEWA 4WP2A 3U6EA 4LJAA 2KNVA 4M9XA 4AI6A 1QO6A 1QAOA 1AIWA 1GVNA 1C1KA 1QAMA 4OVZB 2Z4RA 2Y2OA 4LJ5A 1XWIA 1A5TA 4IBFA 2KNAA 5F3WA 3KSXA 1E15A 1IN4A 4LFBM 4AZFA 4MGYE 2QPAA 3LVVA 3FUWA 1XHBA 2W82A 2LWXA 3LQQA 4ANRA 2EA0A 4JYAM 2LVAA 2DWZB 1FJGM 1QDTA 4AG6A 4P16A 2Y2NA 2CV2A 3U6OA 4LF6M 1BVSA 4Z2JA 3W0LB 1R4GA 2VIIA 5L8RF 2KRKA 1T6OA 3HJ8A 2ERCA 2Y0TA 4IBKA 4L15A 4NSOB 5FTJA 1V33A 3L27A 1PRBA 4LJ9A 3SFZA 4OUIA 1DGFA 1IY1A 2G5GX 2K47A 1QANA 4IBEA 1FNNA 4NSRA 2R6FA 3TE6A 1N77A 3WHLA 1UFZA 4M0WA 3F92A 1L2BA 1IN7A 2L7IA 2R62A 3DOAA 2IOUA 3SMPA 3HJSA 2WZJA 3V76A 1RU3A 4CGYB 3GLHB 3SHFA 3VDPA 1DGBA 3FUTA 2KZUA 1WXQA 1NV8A 5EXPA 3U61A 3K2LA 3RGPA 1DGGA 4B3TM 1W1YA 2XSZD 5KQDA 3HY5A 2QCUA 4JI8M 5KPRA 4YHHM 4R71A 4FWGA 4M9SA 4LF8M 4JI6M 2MROB 1EFUB 2CWBA 1OQYA 3U61B 4IBCA 1HT2E 2K9DA 2DZNB 4MM3B 4OX9M 3BOSA 1OGBA 1IXRC 5KQ8A 4OU7A 1GJTA 4AKHA 2YFQA 3GP1A 2JCHA 3AFHA 3J2PB 3Q8XA 4WW0A 1H8PA 3HSHA 2R45A 4LFCM 3HGIA 2JY5A 3H4JA 2N35A 2DAEA 2MGWA 2G8LA 3E46A 3LQRA 1NO1A 2FFJA 4MGKE 2Y2KA 2CV1A 1JB0F 1Z5AA 1IXZA 1JQJC 4D80A 1PGYA 2LVOC 4LJ8A 3J27B 5DYIA 3OTOM 4HLQA 2JUJA 5ITQA 3GLGA 1VG5A 4IBBA 4WURA 2ZM6M 4DR1M 4DR3M 1K82A 4GH9A 1R6BX 3L25A 5IT9S 2CE7A 3KOWE 4GC9A 2YR0A 3K8ZA 2LHGA 4QHTA 3B9PA 3CF6E 1Z59A 1ORYB 2LTUA 3HWSA 3QYEA 4HMEA 1QDRA 4Z2IA 2QBYB 2I7NA 1NV9A 2KRUA 4YY3M 4LG2A 2JA2A 2FS1A 1VEJA 3DZDA 3IECA 1NNJA 1DO2A 2EJSA 2DI0A 2MH8A 2Y0QA 1GJSA 3GLGB 3U5ZA 4P17A 2F5SA 1L1TA 1WGNA 1JR3E 4LFAM 3WD1A 2QHOB 3W0FA 4OJ5A 4LF7M 4LF5M 4IJFA 4OJOA 2LVPC 5FTLA 4D81A 3TPZA 3IHPA 2UUAM 3HHZA 3VLFB 2XZUA 1ZV1A 4X66M 3I51A 1N36M 3U6DA 1N75A 1C7YA 2DZOB 3ZCBB 3H4MA 4FCTA 3VK7A 5LMUM 3SASA 2CV0A 3PNYA 3HZJA 2XSZA 3HKPA 4XK8F 4D82A 3D8LA 1GABA 4LCBA 4Z2KA 5EP3A 5LMNM 4I8OA 1IN5A 2BJWA 5ITXE 1IQPA 3CF0A 2BNKA 2EKKA 3HU1A 3K92A 3NBIA 2KHHA 4FCWA 4LRSA 1TH3A 1TDHA 2RGOA 3M7GA 2OO9A 3T15A 3L26A 4L8RC 1V34A 4JI0M 1YUEA 1KSFX 3PFIA 2KDLA 4DV6M 1OIPA 5E6JA 4NZ3A 1IN8A 2QNJA 4NRWA 1W1PA 1IBKM 1WJ7A 2I7PA 2O5RA 4R3DA 3UGJA 4Z2HA 3MHVC 4QOZC 1H0IA 4TX8A 4JI2M 3FE3A 3T38A 4TUWA 1NJFA 1MN3A 1WHCA 2C9OA 2FOIC 2KZSA 4MGHA 3T6PA 3C58A 2D7GA 4G4RA 2C5RA 2LVQD 1D0MA 1VDLA 2LH0A 4NC6A 2LNHC 1VEGA 2DHRA 2P5TA 2WSCF 4NYYA 4Z8XA 1D2NA 1N32M 2K6BA 4OJ6A 2R4JA 2HKJA 2BWBA 1HQYE 3U6SA 3U60B 3MJ5A 2D7HA 4CHTB 2DAGA 3SHGB 3KS4A 3KW6A 4L4UA 1SXJA 3L2AA 4X62M 4NXNM 1IM2A 1LTMA 3GQ5A 2JZ1A 2D49A 4QNRA 1Q3BA 3KVWA 3A98B 1GOIA 1G59A 4DUYM 1ZMUA 4G4OA 2DXIA 3BBZA 2QP9X 3RGSA 2MJ5B 3SAUA 3FRIA 3B89A 2JY7A 1IBMM 1QUTA 3MQLA 2UWXA 2XF3A 2LHCA 2KEBA 2DWNA 4Y28F 3ZC7B 1L6JA 2Y2MA 4QNLA 1Q02A 3M0EA 1QQWA 2OPFA 4JV5M 4FVMA 4PT5A 5DFLA 4GC5A 1OKSA 4KT0F 4JI5M 1XNRM 3GLFA 1Z5BA 1K3XA 2F5PA 3PVSA 4PDGA 2RTSA 2XFTA 1QVRA 1GKIA 2QENA 3I04M 1P3QQ 3AJIB 4FWDA 1HJPA 4NZ1A 1R7RA 1AUAA 3C3DA 4DR7M 2X49A 4MGZE 4XGIA 2R46A 3GRRA 3U6QA 4JN6A 1E6RA 1XC8A 2DWLA 1IXSA 2X8AA 1UM8A 4B3SM 3TL4X 3HU2A 1TF0B 2LXEA 3D8BA 2LBCA 3KP1E 4MB3A 1QZEA 2GQFA 2XH9A 1MU5A 2L6OA 1D0LA 4DUZM 1TGUA 4Q7JA 4DBGB 4XBOA 2YNMD 4LZZA 1VDDA 2ZAMA 2FE8A 3K9PA 4JI4M 1H0GA 4RF0A 1OAOC 1TR8A 2CP8A 4LF4M 1PJTA 4GRIA 3SYLA 4X65M 2R18A 1O6IA 1J7MA 3MK6A 2JY6B 1ZQ9A 2JZ0A 2CHQA 2RRUA 3JR4A 3E9SA 3JR5A 4NZ4A 5E26A 3GLIA 3FYDA 3AV0A 1XMOM 2DAMA 4W5WA 1YE9A 1VEKA 2Y2LA 2L09A 1J7KA 5FTNA 5KPZA 4MB7A 4JI7M 3FD9A 4GHAA 3J7AS 3W68A 4EIWA 1SXJC 3NBXX 1X37A 2L2DA 5EP1A 7CATA 3GO8A 3U6PA 2O01F 1XXHA 2DNAA 2ZBKB 1VQ1A 5EJCA 2F5NA 1NJGA 4KHPM 4LJ7A 2CFOA 2EUCA 4QOSA 3C9PA 3T1HM 3SATA 1ZMVA 3A46A 2FFFB 2DHYA 2Y20A 3GRVA 4BB9A 4DV7M 4GMQA 3KXEC 2CEAA 5KO3A 3ILKA 3UJNA 5ITUA 2VQFM 1KS0A 5EXXA 1SXJD 2Z7JA 3EIHA 1HQCA 3ZH9B 3TWMA 1GLNA 4AQYM 1E6ZA 2KA6B 2L4FA 2XEPA 3GLHE 5FTMA 4DR4M 3N3FA 3FYCA 8CATA 1W5TA 3A45A 1DO0A 3QAUA 2WSEF 1CK7A 2Y2IA 1YU2A 3U5ZB 2V5OA 3R8FA 1OFHA 3SAVA 5GKNA 2VF8A 1NY6A 1OFIA 3J81S 3CGWA 3WD4A 4I81A 4ITQA 3TQSA 4B7FA 3FTCA 4IBIA 1TTEA 2JY8A 4R7GA 2LVNC 5H37D 1J09A 3AOGA 4RNAA 4MB5A 4MGIE 4F2LA 1ZAEA 1W1VA 4A3VB 1EIJA 4DR2M 4HEOA 2QSFX 2UXCM 4B7HA 2H1RA 3CTWB 2HCBA 2VDBB 2C96A 3AOEA 5BPVA 3EIEA 1L2DA 4NXMM 4G6ZA 4GHLA 2J7OA 4FCVA 4KODA 2HWJA 1T43A 4LRTA 4OJPA 5C1BA 1N34M 4OW0A 1K3WA 3KFUG 1DGHA 1SG9A 1NY5A 3HX3A 1IN6A 2L7HA 4NOOB 2ZAOA 3PNVA 4GKJM 4GIPA 1HT1E 3A42A 4KLNA 3Q8GA 1QUSA 4B3MM 3L29A 2NQ8C 2EKFA 2VF7A 2XFSA 4IBDA 1R5LA 3LCVB 4G4NA 1L1ZA 1DGHB 4DV0M 1GPFA 3GLGE 2H5XA 2RGHA 1W5SA 4G4QA 1YLAA 1L2CA 5ITTA 2DWMA 2C9CA 4JXJA 4B7GA 5ITYA 1PJQA 4GITA 1MX0A 3BXWA 3FUXA 1G3IA 3B74A 1PJJA 3FKEA 4M0DA 4MH0E 1WR1B 3WD3A 3WD0A 3HONA 1F4IA 3WX7A 3FUVA 3FTEA 4JI3M 1H6UA 3QWLA 4FD2A 2J5YA 1LV7A 1EAKA 4AKGA 3U6LA 1YSYA 2V6ZM 4IJEA 5EXTA 4LJ4A 4CISA 2DAIA 1TH2A 1SXJB 2Q2EB 4HL4A 1E6PA 1HR0M 4CJ6A 2Z3XA 2DENA 2B3TA 3UK6A 3R9XB 5JI2E 3QYBA 2O25A 3SC3A 1IFYA 2JWSA 2UUBM 4NY2A 1OTRA 1IY2A 2G3QA 3RE8A 3FTDA 4FWHA 1YU0A 3I4VA 1UR8A 2R65A 1T3TA 4QHSA 3PXGA 1S3SA 2R4EA 3VKGA 2APLA 4B08A 1PJIA 1OGGA 4IIWA 5EQTA 4PCZA 3SMSA 3HJQA 4PDIA 3U6MA 1Z6TA 2XD5A 1G4AE 3K1JA 4OJLA 2D7EA 4MB4A 3GPXA 4DV2M 3VDUA 3WHKA 5DNYA 2CHVA 5IREB 3LCUA 2KXEA 5FSWA 5IWAM 5FLXS 4F1IA 3AOEC 3LW5F 1ZMWA 1AIPC 5KPTA 2KNZA 3GQ4A 3GLFB 3I01M 3IG5A 3T1YM 2Y2JA 1GL6A 2M60A 1JR3A 3IG8A 2Y2QA 1GL7A 3HHXA 3GLHA 2V1UA 4CIZA 2GNOA 1PM5A 1YU3A 2CRUA 1NHGC 1R2ZA 1XNQM 2HHHM 3GQ3A 3SAWA 3KS8A 4IBGA 1IXSB 1PDCA 1W1TA 1HNWM 3KP0E 2CHGA 2BWEA 1OAIA 3HU3A 3J80S 3HHWA 4DR6M 1YU1A 1TH4A 1Q39A 4DV4M 4DR5M 3KOZE 1NVMA 2ZTDA 3FRHA 3GPPA 1CXWA 2FH0A 2K0BX 1NHWC 2OOBA 2RKOA 1MJGM 3B7NA 3KSJA 3NWLA 3SYKA 1NNUC 4BLCA 3SBJA 4NRVA 3CF2A 3AL0C 1N33M 5FTKA 1SXJE 5IZ7D 2UUCM 5EXSA 2C98A 3HHYA 4Z6YA 5ITXA 1HNZM 2UXDM 2FNAA 1E9RA 1KFVA 1PJSA 4B3RM 2DAKA 4K0KM 2WSFF 2HAKA 2Z8YM 3MMPA 3GLIB 2BG1A 3KDSE 3C3EA 4I4LA 4HMDA 1DV0A 4I5SA 1QZMA 1L8QA 3THGA 4X64M 3M7PA 4IBJA 4GKKM 2JE5A 1G71A 2A5YB 3DA1A 3SARA 2F4VM 4DV3M 5C18A 3LMMA 1GXDA 1I94M 4L16A 2DVWB 2R44A 5JI3E 2MR9A 1XXHB 2QQ8A 2Y21A 3VFDA 4UN2B 1NSFA 4BBAA 4JI1M 3FUUA 4Z2LA 1E9SA 2QBYA 4G3OA 1TDZA 1OIZA 2M5ZA 3GLFE 5EP4A 1CUKA 5BR8M 5EP2A 4HMCA 1OJLA 3WD2A 2AHMA 2VQEM 1XMQM 2OOAA 3AKZA 1HNXM 2Z4SA 4LY6A 1E32A 3E21A 3GRYA 2ZANA 4REZA 4AG5A 2Y2HA 3KOXE 3J7BA 3GPUA 5ITRA 4LGYA 1Z5CA 4FW9A 3K9OA 1Q3CA 2F5QA 2Y2GA 4RF1A 2ZTCA 1J5EM 3KOYE 2DKLA 1YUBA 3LVWA 2XLJA 2XD1A 4NZ5A 3JAMS 4AKIA 3TWKA 3B7ZA 1QYRA 2X4AA 3B7QA 5A2QS 3M6AA 4LZJA 1QAQA 1N78A 1Y8GA 2YQZA 2FN2A 2BJVA 2DZLA 2J7NA 2XGNA 4ZPXA 5DYGA 4PD2A 4II7A 1E8BA 3TWLA 3GLIE 3U6CA 1XB2B 2OQ4A 4NYUA 3UMMA 1I4WA 4RKUF 2UXBM 1E6NA 4Z2GA 1V92A 1JR3D 3GRUA 1G8PA 2JP7A 3UZUA 2QZ4A 1WIVA 4L6V6 4AW4A 1IBLM 2CUZA 3ZQJA 2UU9M 3DFZA 1WGLA
chains in the Genus database with same CATH topology
1IY0A 2KW0A 2E5LM 1E94E 4S12A 4L78A 1YU4A 1G41A 2EO2A 3I4YA 4M9ZA 2XZFA 2HL7A 4KO8A 3VKHA 3GPYA 2C99A 3L28A 3VK8A 1EE8A 3U60A 4LJ6A 3RFWA 1KYIA 4DV5M 4LGMA 4OVZA 2F5OA 4QNMA 4LF9M 3FTFA 1R2YA 2Y2PA 4NL4H 4DV1M 2V1CA 3E4RA 3U6EA 4LJAA 4M9XA 4AI6A 1QAOA 1GVNA 1C1KA 1QAMA 4OVZB 2Z4RA 2Y2OA 4LJ5A 1XWIA 4IBFA 5F3WA 3KSXA 1IN4A 4LFBM 4AZFA 4MGYE 2QPAA 3LVVA 3FUWA 1XHBA 2W82A 2LWXA 3LQQA 2EA0A 4JYAM 2DWZB 1FJGM 4AG6A 4P16A 2Y2NA 2CV2A 3U6OA 4LF6M 3W0LB 2VIIA 2KRKA 3HJ8A 2ERCA 2Y0TA 4IBKA 4L15A 4NSOB 5FTJA 3L27A 4LJ9A 3SFZA 4OUIA 1DGFA 1IY1A 2G5GX 2K47A 1QANA 4IBEA 1FNNA 4NSRA 3TE6A 1N77A 3WHLA 4M0WA 1L2BA 1IN7A 2L7IA 2R62A 3DOAA 2IOUA 3SMPA 3HJSA 4CGYB 3GLHB 3SHFA 3VDPA 1DGBA 3FUTA 2KZUA 1WXQA 5EXPA 3U61A 3K2LA 3RGPA 1DGGA 4B3TM 2XSZD 5KQDA 2QCUA 4JI8M 5KPRA 4YHHM 4FWGA 4M9SA 4LF8M 4JI6M 3U61B 4IBCA 1HT2E 2DZNB 4MM3B 4OX9M 3BOSA 1IXRC 5KQ8A 4OU7A 4AKHA 2YFQA 3GP1A 2JCHA 3AFHA 3J2PB 3Q8XA 4WW0A 3HSHA 2R45A 4LFCM 3HGIA 4RF1A 3LQRA 2G8LA 2FFJA 4MGKE 2Y2KA 2CV1A 1Z5AA 1IXZA 1JQJC 4D80A 5DYIA 4LJ8A 3J27B 3OTOM 4HLQA 5ITQA 3GLGA 4DR1M 4DR3M 4IBBA 4WURA 2ZM6M 1K82A 5IT9S 4GH9A 1R6BX 3L25A 2CE7A 3KOWE 4GC9A 2YR0A 3K8ZA 4QHTA 3B9PA 3CF6E 1Z59A 1ORYB 3HWSA 2QBYB 2I7NA 2KRUA 4YY3M 4LG2A 2JA2A 3DZDA 1NNJA 1DO2A 2Y0QA 3GLGB 3U5ZA 2F5SA 1L1TA 4LFAM 3W0FA 4OJ5A 4LF7M 4LF5M 4IJFA 4OJOA 5FTLA 4D81A 3TPZA 2UUAM 3HHZA 3VLFB 4X66M 3I51A 1N36M 3U6DA 1N75A 2DZOB 3ZCBB 3H4MA 4FCTA 3VK7A 5LMUM 3SASA 2CV0A 3PNYA 2XSZA 3HKPA 4D82A 3D8LA 4LCBA 5EP3A 5LMNM 4I8OA 1IN5A 2BJWA 5ITXE 1IQPA 3CF0A 2BNKA 3HU1A 3NBIA 3K92A 4FCWA 4NRVA 3L26A 4LRSA 1TH3A 1TDHA 2RGOA 3M7GA 3T15A 4L8RC 4JI0M 1YUEA 1KSFX 3PFIA 4DV6M 5E6JA 4NZ3A 1IN8A 4NRWA 1IBKM 2I7PA 2O5RA 3UGJA 4R3DA 3MHVC 4QOZC 4JI2M 3T38A 4TUWA 1NJFA 2FOIC 2KZSA 2C9OA 4MGHA 3C58A 4DR6M 4G4RA 2D7GA 2C5RA 2LH0A 2LNHC 2P5TA 2DHRA 4NYYA 4Z8XA 1D2NA 1N32M 4OJ6A 2R4JA 2HKJA 1HQYE 3U6SA 3U60B 3MJ5A 2D7HA 4CHTB 3SHGB 3KS4A 3KW6A 4L4UA 1SXJA 3L2AA 4X62M 4NXNM 1IM2A 3GQ5A 4QNRA 1Q3BA 3KVWA 3A98B 1G59A 4DUYM 4G4OA 2DXIA 2QP9X 3RGSA 3SAUA 1IBMM 2UWXA 2XF3A 2KEBA 2DWNA 2Y2MA 3ZC7B 4QNLA 3M0EA 1QQWA 2OPFA 4JV5M 4FVMA 4PT5A 4GC5A 4JI5M 1XNRM 3GLFA 1Z5BA 1K3XA 2F5PA 3PVSA 4PDGA 2XFTA 1QVRA 1GKIA 2QENA 3AJIB 4FWDA 4NZ1A 1R7RA 4DR7M 2X49A 4MGZE 4XGIA 2R46A 3GRRA 3U6QA 4JN6A 1XC8A 2DWLA 2X8AA 1UM8A 4B3SM 3TL4X 3HU2A 2LXEA 3D8BA 3KP1E 2XH9A 1MU5A 2L6OA 4DUZM 1TGUA 4XBOA 2YNMD 4LZZA 1VDDA 2ZAMA 2FE8A 4JI4M 4RF0A 4LF4M 4GRIA 3SYLA 4X65M 2R18A 3MK6A 1ZQ9A 2CHQA 3JR4A 3E9SA 3JR5A 4NZ4A 5E26A 3GLIA 3FYDA 3AV0A 1XMOM 4W5WA 1YE9A 2Y2LA 2L09A 1J7KA 5FTNA 5KPZA 4MB7A 4JI7M 3FD9A 4GHAA 3J7AS 4EIWA 1SXJC 7CATA 1X37A 5EP1A 3GO8A 3U6PA 2F5NA 1XXHA 2ZBKB 5EJCA 4KHPM 1NJGA 4LJ7A 2CFOA 2EUCA 4QOSA 3SATA 3T1HM 2FFFB 3A46A 2Y20A 3GRVA 4BB9A 4DV7M 4GMQA 3KXEC 2CEAA 5KO3A 3ILKA 3UJNA 5ITUA 2VQFM 5EXXA 1SXJD 2Z7JA 3EIHA 1HQCA 3ZH9B 3TWMA 1GLNA 4AQYM 2KA6B 5FTMA 2XEPA 4DR4M 3N3FA 3FYCA 8CATA 1W5TA 3A45A 1DO0A 3QAUA 2Y2IA 1YU2A 3U5ZB 3R8FA 1OFHA 3SAVA 5GKNA 1NY6A 1OFIA 3J81S 4I81A 4ITQA 3TQSA 4B7FA 3FTCA 4IBIA 4R7GA 5H37D 1J09A 3AOGA 4RNAA 4MGIE 1ZAEA 4A3VB 4DR2M 2UXCM 4B7HA 2H1RA 3CTWB 2HCBA 3AOEA 2C96A 5BPVA 1L2DA 3EIEA 4NXMM 4GHLA 4G6ZA 2J7OA 4FCVA 4KODA 4LRTA 4OJPA 5C1BA 1N34M 4OW0A 1K3WA 3KFUG 1DGHA 1NY5A 1IN6A 2L7HA 4NOOB 2ZAOA 3PNVA 4GKJM 4GIPA 1HT1E 3A42A 4KLNA 4B3MM 3L29A 2NQ8C 4IBDA 4G4NA 2XFSA 1L1ZA 1DGHB 4DV0M 4G4QA 2RGHA 1W5SA 1L2CA 5ITTA 2DWMA 2C9CA 4JXJA 4B7GA 5ITYA 4GITA 1MX0A 3FUXA 1G3IA 1PJJA 3FKEA 4M0DA 4MH0E 3HONA 3WX7A 3FUVA 3FTEA 4JI3M 1H6UA 3QWLA 4FD2A 1LV7A 4AKGA 3U6LA 1YSYA 2V6ZM 4IJEA 5EXTA 4LJ4A 4CISA 1TH2A 1SXJB 2Q2EB 4HL4A 1HR0M 2Z3XA 3UK6A 3R9XB 5JI2E 3SC3A 2UUBM 4NY2A 1IY2A 3RE8A 3FTDA 4FWHA 1YU0A 3I4VA 2R65A 1T3TA 4QHSA 3PXGA 1S3SA 2R4EA 3VKGA 4B08A 1PJIA 4IIWA 5EQTA 4PCZA 3SMSA 3HJQA 4PDIA 3U6MA 1Z6TA 2XD5A 1G4AE 3K1JA 4OJLA 2D7EA 3GPXA 4DV2M 3VDUA 3WHKA 5DNYA 2CHVA 5IREB 2KXEA 5FSWA 5IWAM 5FLXS 3AOEC 3GQ4A 3GLFB 5KPTA 3IG5A 3T1YM 2Y2JA 1GL6A 2M60A 1JR3A 3IG8A 2Y2QA 1GL7A 3HHXA 3GLHA 2V1UA 1PM5A 1YU3A 1NHGC 1R2ZA 1XNQM 2HHHM 3GQ3A 3SAWA 3KS8A 4IBGA 1IXSB 1HNWM 3KP0E 2CHGA 1YU1A 3J80S 3HU3A 3HHWA 1TH4A 1Q39A 4DV4M 4DR5M 3KOZE 1NVMA 3GPPA 2RKOA 3KSJA 1NHWC 3NWLA 4BLCA 2XZUA 3SYKA 1NNUC 3SBJA 3AL0C 1N33M 3CF2A 5FTKA 1SXJE 5IZ7D 2UUCM 5EXSA 2C98A 3HHYA 4Z6YA 5ITXA 1HNZM 2UXDM 2FNAA 1E9RA 1KFVA 4B3RM 4K0KM 2BG1A 3GLIB 3KDSE 4I4LA 4I5SA 1QZMA 1L8QA 3THGA 4X64M 4IBJA 4GKKM 2JE5A 2A5YB 3DA1A 3SARA 2F4VM 4DV3M 5C18A 3LMMA 1I94M 4L16A 2DVWB 5JI3E 1XXHB 2Y21A 3VFDA 1NSFA 4BBAA 4JI1M 3FUUA 1E9SA 2QBYA 1TDZA 2M5ZA 5EP4A 5BR8M 5EP2A 1OJLA 2AHMA 2VQEM 1XMQM 3AKZA 1HNXM 2Z4SA 4LY6A 1E32A 3GRYA 2ZANA 4REZA 4AG5A 2Y2HA 3KOXE 3J7BA 3GPUA 5ITRA 4LGYA 1Z5CA 4FW9A 1Q3CA 2Y2GA 1J5EM 3KOYE 2XD1A 1YUBA 3LVWA 2XLJA 4NZ5A 3JAMS 4AKIA 3TWKA 1QYRA 2X4AA 5A2QS 3M6AA 4LZJA 1QAQA 1N78A 2YQZA 2BJVA 2J7NA 2XGNA 4ZPXA 5DYGA 4PD2A 4II7A 3TWLA 3U6CA 2OQ4A 4NYUA 3UMMA 1I4WA 2UXBM 1JR3D 3GRUA 1G8PA 3UZUA 2QZ4A 4AW4A 1IBLM 2UU9M 2CUZA 3DFZA 2F5QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IBC A;  4IBJ A;  3KS8 A;  3KS4 A;  4IBG A;  5BPV A;  4IBF A;  4GHL A;  3L2A A;  4IJF A;  3FKE A;  3L28 A;  4IJE A;  4IBB A;  4GHA A;  4GH9 A;  3L25 A;  3L29 A;  4IBD A;  4IBK A;  4IBI A;  3L27 A;  4LG2 A;  4IBE A;  3L26 A; 
#chains in the Genus database with same CATH topology
 1IY0 A;  2KW0 A;  2E5L M;  1E94 E;  1XXH E;  4S12 A;  4L78 A;  1YU4 A;  1G41 A;  2EO2 A;  3I4Y A;  4M9Z A;  2XZF A;  2HL7 A;  4KO8 A;  3VKH A;  1UR9 A;  3GPY A;  2C99 A;  3L28 A;  3VK8 A;  1EE8 A;  3U60 A;  4LJ6 A;  2L4E A;  1KYI A;  3RFW A;  4DV5 M;  4LGM A;  4OVZ A;  1GO5 A;  1D0K A;  2F5O A;  2JNH A;  3W67 A;  1E88 A;  2R0I A;  4QNM A;  4LF9 M;  3FTF A;  1R2Y A;  2Y2P A;  4NL4 H;  1ED7 A;  4DV1 M;  2JXN A;  2V1C A;  3E4R A;  4GEW A;  4WP2 A;  3U6E A;  4LJA A;  2KNV A;  4M9X A;  4AI6 A;  1QO6 A;  1QAO A;  1AIW A;  1GVN A;  1C1K A;  1QAM A;  4OVZ B;  2Z4R A;  2Y2O A;  4LJ5 A;  1XWI A;  1A5T A;  4IBF A;  2KNA A;  5F3W A;  3KSX A;  1E15 A;  1IN4 A;  4LFB M;  4AZF A;  4MGY E;  2QPA A;  3LVV A;  3FUW A;  1XHB A;  2W82 A;  2LWX A;  3LQQ A;  4ANR A;  2EA0 A;  4JYA M;  2LVA A;  2DWZ B;  1FJG M;  1QDT A;  4AG6 A;  4P16 A;  2Y2N A;  2CV2 A;  3U6O A;  4LF6 M;  1BVS A;  4Z2J A;  3W0L B;  1R4G A;  2VII A;  5L8R F;  2KRK A;  1T6O A;  3HJ8 A;  2ERC A;  2Y0T A;  4IBK A;  4L15 A;  4NSO B;  5FTJ A;  1V33 A;  3L27 A;  1PRB A;  4LJ9 A;  3SFZ A;  4OUI A;  1DGF A;  1IY1 A;  2G5G X;  2K47 A;  1QAN A;  4IBE A;  1FNN A;  4NSR A;  2R6F A;  3TE6 A;  1N77 A;  3WHL A;  1UFZ A;  4M0W A;  3F92 A;  1L2B A;  1IN7 A;  2L7I A;  2R62 A;  3DOA A;  2IOU A;  3SMP A;  3HJS A;  2WZJ A;  3V76 A;  1RU3 A;  4CGY B;  3GLH B;  3SHF A;  3VDP A;  1DGB A;  3FUT A;  2KZU A;  1WXQ A;  1NV8 A;  5EXP A;  3U61 A;  3K2L A;  3RGP A;  1DGG A;  4B3T M;  1W1Y A;  2XSZ D;  5KQD A;  3HY5 A;  2QCU A;  4JI8 M;  5KPR A;  4YHH M;  4R71 A;  4FWG A;  4M9S A;  4LF8 M;  4JI6 M;  2MRO B;  1EFU B;  2CWB A;  1OQY A;  3U61 B;  4IBC A;  1HT2 E;  2K9D A;  2DZN B;  4MM3 B;  4OX9 M;  3BOS A;  1OGB A;  1IXR C;  5KQ8 A;  4OU7 A;  1GJT A;  4AKH A;  2YFQ A;  3GP1 A;  2JCH A;  3AFH A;  3J2P B;  3Q8X A;  4WW0 A;  1H8P A;  3HSH A;  2R45 A;  4LFC M;  3HGI A;  2JY5 A;  3H4J A;  2N35 A;  2DAE A;  2MGW A;  2G8L A;  3E46 A;  3LQR A;  1NO1 A;  2FFJ A;  4MGK E;  2Y2K A;  2CV1 A;  1JB0 F;  1Z5A A;  1IXZ A;  1JQJ C;  4D80 A;  1PGY A;  2LVO C;  4LJ8 A;  3J27 B;  5DYI A;  3OTO M;  4HLQ A;  2JUJ A;  5ITQ A;  3GLG A;  1VG5 A;  4IBB A;  4WUR A;  2ZM6 M;  4DR1 M;  4DR3 M;  1K82 A;  4GH9 A;  1R6B X;  3L25 A;  5IT9 S;  2CE7 A;  3KOW E;  4GC9 A;  2YR0 A;  3K8Z A;  2LHG A;  4QHT A;  3B9P A;  3CF6 E;  1Z59 A;  1ORY B;  2LTU A;  3HWS A;  3QYE A;  4HME A;  1QDR A;  4Z2I A;  2QBY B;  2I7N A;  1NV9 A;  2KRU A;  4YY3 M;  4LG2 A;  2JA2 A;  2FS1 A;  1VEJ A;  3DZD A;  3IEC A;  1NNJ A;  1DO2 A;  2EJS A;  2DI0 A;  2MH8 A;  2Y0Q A;  1GJS A;  3GLG B;  3U5Z A;  4P17 A;  2F5S A;  1L1T A;  1WGN A;  1JR3 E;  4LFA M;  3WD1 A;  2QHO B;  3W0F A;  4OJ5 A;  4LF7 M;  4LF5 M;  4IJF A;  4OJO A;  2LVP C;  5FTL A;  4D81 A;  3TPZ A;  3IHP A;  2UUA M;  3HHZ A;  3VLF B;  2XZU A;  1ZV1 A;  4X66 M;  3I51 A;  1N36 M;  3U6D A;  1N75 A;  1C7Y A;  2DZO B;  3ZCB B;  3H4M A;  4FCT A;  3VK7 A;  5LMU M;  3SAS A;  2CV0 A;  3PNY A;  3HZJ A;  2XSZ A;  3HKP A;  4XK8 F;  4D82 A;  3D8L A;  1GAB A;  4LCB A;  4Z2K A;  5EP3 A;  5LMN M;  4I8O A;  1IN5 A;  2BJW A;  5ITX E;  1IQP A;  3CF0 A;  2BNK A;  2EKK A;  3HU1 A;  3K92 A;  3NBI A;  2KHH A;  4FCW A;  4LRS A;  1TH3 A;  1TDH A;  2RGO A;  3M7G A;  2OO9 A;  3T15 A;  3L26 A;  4L8R C;  1V34 A;  4JI0 M;  1YUE A;  1KSF X;  3PFI A;  2KDL A;  4DV6 M;  1OIP A;  5E6J A;  4NZ3 A;  1IN8 A;  2QNJ A;  4NRW A;  1W1P A;  1IBK M;  1WJ7 A;  2I7P A;  2O5R A;  4R3D A;  3UGJ A;  4Z2H A;  3MHV C;  4QOZ C;  1H0I A;  4TX8 A;  4JI2 M;  3FE3 A;  3T38 A;  4TUW A;  1NJF A;  1MN3 A;  1WHC A;  2C9O A;  2FOI C;  2KZS A;  4MGH A;  3T6P A;  3C58 A;  2D7G A;  4G4R A;  2C5R A;  2LVQ D;  1D0M A;  1VDL A;  2LH0 A;  4NC6 A;  2LNH C;  1VEG A;  2DHR A;  2P5T A;  2WSC F;  4NYY A;  4Z8X A;  1D2N A;  1N32 M;  2K6B A;  4OJ6 A;  2R4J A;  2HKJ A;  2BWB A;  1HQY E;  3U6S A;  3U60 B;  3MJ5 A;  2D7H A;  4CHT B;  2DAG A;  3SHG B;  3KS4 A;  3KW6 A;  4L4U A;  1SXJ A;  3L2A A;  4X62 M;  4NXN M;  1IM2 A;  1LTM A;  3GQ5 A;  2JZ1 A;  2D49 A;  4QNR A;  1Q3B A;  3KVW A;  3A98 B;  1GOI A;  1G59 A;  4DUY M;  1ZMU A;  4G4O A;  2DXI A;  3BBZ A;  2QP9 X;  3RGS A;  2MJ5 B;  3SAU A;  3FRI A;  3B89 A;  2JY7 A;  1IBM M;  1QUT A;  3MQL A;  2UWX A;  2XF3 A;  2LHC A;  2KEB A;  2DWN A;  4Y28 F;  3ZC7 B;  1L6J A;  2Y2M A;  4QNL A;  1Q02 A;  3M0E A;  1QQW A;  2OPF A;  4JV5 M;  4FVM A;  4PT5 A;  5DFL A;  4GC5 A;  1OKS A;  4KT0 F;  4JI5 M;  1XNR M;  3GLF A;  1Z5B A;  1K3X A;  2F5P A;  3PVS A;  4PDG A;  2RTS A;  2XFT A;  1QVR A;  1GKI A;  2QEN A;  3I04 M;  1P3Q Q;  3AJI B;  4FWD A;  1HJP A;  4NZ1 A;  1R7R A;  1AUA A;  3C3D A;  4DR7 M;  2X49 A;  4MGZ E;  4XGI A;  2R46 A;  3GRR A;  3U6Q A;  4JN6 A;  1E6R A;  1XC8 A;  2DWL A;  1IXS A;  2X8A A;  1UM8 A;  4B3S M;  3TL4 X;  3HU2 A;  1TF0 B;  2LXE A;  3D8B A;  2LBC A;  3KP1 E;  4MB3 A;  1QZE A;  2GQF A;  2XH9 A;  1MU5 A;  2L6O A;  1D0L A;  4DUZ M;  1TGU A;  4Q7J A;  4DBG B;  4XBO A;  2YNM D;  4LZZ A;  1VDD A;  2ZAM A;  2FE8 A;  3K9P A;  4JI4 M;  1H0G A;  4RF0 A;  1OAO C;  1TR8 A;  2CP8 A;  4LF4 M;  1PJT A;  4GRI A;  3SYL A;  4X65 M;  2R18 A;  1O6I A;  1J7M A;  3MK6 A;  2JY6 B;  1ZQ9 A;  2JZ0 A;  2CHQ A;  2RRU A;  3JR4 A;  3E9S A;  3JR5 A;  4NZ4 A;  5E26 A;  3GLI A;  3FYD A;  3AV0 A;  1XMO M;  2DAM A;  4W5W A;  1YE9 A;  1VEK A;  2Y2L A;  2L09 A;  1J7K A;  5FTN A;  5KPZ A;  4MB7 A;  4JI7 M;  3FD9 A;  4GHA A;  3J7A S;  3W68 A;  4EIW A;  1SXJ C;  3NBX X;  1X37 A;  2L2D A;  5EP1 A;  7CAT A;  3GO8 A;  3U6P A;  2O01 F;  1XXH A;  2DNA A;  2ZBK B;  1VQ1 A;  5EJC A;  2F5N A;  1NJG A;  4KHP M;  4LJ7 A;  2CFO A;  2EUC A;  4QOS A;  3C9P A;  3T1H M;  3SAT A;  1ZMV A;  3A46 A;  2FFF B;  2DHY A;  2Y20 A;  3GRV A;  4BB9 A;  4DV7 M;  4GMQ A;  3KXE C;  2CEA A;  5KO3 A;  3ILK A;  3UJN A;  5ITU A;  2VQF M;  1KS0 A;  5EXX A;  1SXJ D;  2Z7J A;  3EIH A;  1HQC A;  3ZH9 B;  3TWM A;  1GLN A;  4AQY M;  1E6Z A;  2KA6 B;  2L4F A;  2XEP A;  3GLH E;  5FTM A;  4DR4 M;  3N3F A;  3FYC A;  8CAT A;  1W5T A;  3A45 A;  1DO0 A;  3QAU A;  2WSE F;  1CK7 A;  2Y2I A;  1YU2 A;  3U5Z B;  2V5O A;  3R8F A;  1OFH A;  3SAV A;  5GKN A;  2VF8 A;  1NY6 A;  1OFI A;  3J81 S;  3CGW A;  3WD4 A;  4I81 A;  4ITQ A;  3TQS A;  4B7F A;  3FTC A;  4IBI A;  1TTE A;  2JY8 A;  4R7G A;  2LVN C;  5H37 D;  1J09 A;  3AOG A;  4RNA A;  4MB5 A;  4MGI E;  4F2L A;  1ZAE A;  1W1V A;  4A3V B;  1EIJ A;  4DR2 M;  4HEO A;  2QSF X;  2UXC M;  4B7H A;  2H1R A;  3CTW B;  2HCB A;  2VDB B;  2C96 A;  3AOE A;  5BPV A;  3EIE A;  1L2D A;  4NXM M;  4G6Z A;  4GHL A;  2J7O A;  4FCV A;  4KOD A;  2HWJ A;  1T43 A;  4LRT A;  4OJP A;  5C1B A;  1N34 M;  4OW0 A;  1K3W A;  3KFU G;  1DGH A;  1SG9 A;  1NY5 A;  3HX3 A;  1IN6 A;  2L7H A;  4NOO B;  2ZAO A;  3PNV A;  4GKJ M;  4GIP A;  1HT1 E;  3A42 A;  4KLN A;  3Q8G A;  1QUS A;  4B3M M;  3L29 A;  2NQ8 C;  2EKF A;  2VF7 A;  2XFS A;  4IBD A;  1R5L A;  3LCV B;  4G4N A;  1L1Z A;  1DGH B;  4DV0 M;  1GPF A;  3GLG E;  2H5X A;  2RGH A;  1W5S A;  4G4Q A;  1YLA A;  1L2C A;  5ITT A;  2DWM A;  2C9C A;  4JXJ A;  4B7G A;  5ITY A;  1PJQ A;  4GIT A;  1MX0 A;  3BXW A;  3FUX A;  1G3I A;  3B74 A;  1PJJ A;  3FKE A;  4M0D A;  4MH0 E;  1WR1 B;  3WD3 A;  3WD0 A;  3HON A;  1F4I A;  3WX7 A;  3FUV A;  3FTE A;  4JI3 M;  1H6U A;  3QWL A;  4FD2 A;  2J5Y A;  1LV7 A;  1EAK A;  4AKG A;  3U6L A;  1YSY A;  2V6Z M;  4IJE A;  5EXT A;  4LJ4 A;  4CIS A;  2DAI A;  1TH2 A;  1SXJ B;  2Q2E B;  4HL4 A;  1E6P A;  1HR0 M;  4CJ6 A;  2Z3X A;  2DEN A;  2B3T A;  3UK6 A;  3R9X B;  5JI2 E;  3QYB A;  2O25 A;  3SC3 A;  1IFY A;  2JWS A;  2UUB M;  4NY2 A;  1OTR A;  1IY2 A;  2G3Q A;  3RE8 A;  3FTD A;  4FWH A;  1YU0 A;  3I4V A;  1UR8 A;  2R65 A;  1T3T A;  4QHS A;  3PXG A;  1S3S A;  2R4E A;  3VKG A;  2APL A;  4B08 A;  1PJI A;  1OGG A;  4IIW A;  5EQT A;  4PCZ A;  3SMS A;  3HJQ A;  4PDI A;  3U6M A;  1Z6T A;  2XD5 A;  1G4A E;  3K1J A;  4OJL A;  2D7E A;  4MB4 A;  3GPX A;  4DV2 M;  3VDU A;  3WHK A;  5DNY A;  2CHV A;  5IRE B;  3LCU A;  2KXE A;  5FSW A;  5IWA M;  5FLX S;  4F1I A;  3AOE C;  3LW5 F;  1ZMW A;  1AIP C;  5KPT A;  2KNZ A;  3GQ4 A;  3GLF B;  3I01 M;  3IG5 A;  3T1Y M;  2Y2J A;  1GL6 A;  2M60 A;  1JR3 A;  3IG8 A;  2Y2Q A;  1GL7 A;  3HHX A;  3GLH A;  2V1U A;  4CIZ A;  2GNO A;  1PM5 A;  1YU3 A;  2CRU A;  1NHG C;  1R2Z A;  1XNQ M;  2HHH M;  3GQ3 A;  3SAW A;  3KS8 A;  4IBG A;  1IXS B;  1PDC A;  1W1T A;  1HNW M;  3KP0 E;  2CHG A;  2BWE A;  1OAI A;  3HU3 A;  3J80 S;  3HHW A;  4DR6 M;  1YU1 A;  1TH4 A;  1Q39 A;  4DV4 M;  4DR5 M;  3KOZ E;  1NVM A;  2ZTD A;  3FRH A;  3GPP A;  1CXW A;  2FH0 A;  2K0B X;  1NHW C;  2OOB A;  2RKO A;  1MJG M;  3B7N A;  3KSJ A;  3NWL A;  3SYK A;  1NNU C;  4BLC A;  3SBJ A;  4NRV A;  3CF2 A;  3AL0 C;  1N33 M;  5FTK A;  1SXJ E;  5IZ7 D;  2UUC M;  5EXS A;  2C98 A;  3HHY A;  4Z6Y A;  5ITX A;  1HNZ M;  2UXD M;  2FNA A;  1E9R A;  1KFV A;  1PJS A;  4B3R M;  2DAK A;  4K0K M;  2WSF F;  2HAK A;  2Z8Y M;  3MMP A;  3GLI B;  2BG1 A;  3KDS E;  3C3E A;  4I4L A;  4HMD A;  1DV0 A;  4I5S A;  1QZM A;  1L8Q A;  3THG A;  4X64 M;  3M7P A;  4IBJ A;  4GKK M;  2JE5 A;  1G71 A;  2A5Y B;  3DA1 A;  3SAR A;  2F4V M;  4DV3 M;  5C18 A;  3LMM A;  1GXD A;  1I94 M;  4L16 A;  2DVW B;  2R44 A;  5JI3 E;  2MR9 A;  1XXH B;  2QQ8 A;  2Y21 A;  3VFD A;  4UN2 B;  1NSF A;  4BBA A;  4JI1 M;  3FUU A;  4Z2L A;  1E9S A;  2QBY A;  4G3O A;  1TDZ A;  1OIZ A;  2M5Z A;  3GLF E;  5EP4 A;  1CUK A;  5BR8 M;  5EP2 A;  4HMC A;  1OJL A;  3WD2 A;  2AHM A;  2VQE M;  1XMQ M;  2OOA A;  3AKZ A;  1HNX M;  2Z4S A;  4LY6 A;  1E32 A;  3E21 A;  3GRY A;  2ZAN A;  4REZ A;  4AG5 A;  2Y2H A;  3KOX E;  3J7B A;  3GPU A;  5ITR A;  4LGY A;  1Z5C A;  4FW9 A;  3K9O A;  1Q3C A;  2F5Q A;  2Y2G A;  4RF1 A;  2ZTC A;  1J5E M;  3KOY E;  2DKL A;  1YUB A;  3LVW A;  2XLJ A;  2XD1 A;  4NZ5 A;  3JAM S;  4AKI A;  3TWK A;  3B7Z A;  1QYR A;  2X4A A;  3B7Q A;  5A2Q S;  3M6A A;  4LZJ A;  1QAQ A;  1N78 A;  1Y8G A;  2YQZ A;  2FN2 A;  2BJV A;  2DZL A;  2J7N A;  2XGN A;  4ZPX A;  5DYG A;  4PD2 A;  4II7 A;  1E8B A;  3TWL A;  3GLI E;  3U6C A;  1XB2 B;  2OQ4 A;  4NYU A;  3UMM A;  1I4W A;  4RKU F;  2UXB M;  1E6N A;  4Z2G A;  1V92 A;  1JR3 D;  3GRU A;  1G8P A;  2JP7 A;  3UZU A;  2QZ4 A;  1WIV A;  4L6V 6;  4AW4 A;  1IBL M;  2CUZ A;  3ZQJ A;  2UU9 M;  3DFZ A;  1WGL A; 
#chains in the Genus database with same CATH homology
 1IY0 A;  2KW0 A;  2E5L M;  1E94 E;  4S12 A;  4L78 A;  1YU4 A;  1G41 A;  2EO2 A;  3I4Y A;  4M9Z A;  2XZF A;  2HL7 A;  4KO8 A;  3VKH A;  3GPY A;  2C99 A;  3L28 A;  3VK8 A;  1EE8 A;  3U60 A;  4LJ6 A;  3RFW A;  1KYI A;  4DV5 M;  4LGM A;  4OVZ A;  2F5O A;  4QNM A;  4LF9 M;  3FTF A;  1R2Y A;  2Y2P A;  4NL4 H;  4DV1 M;  2V1C A;  3E4R A;  3U6E A;  4LJA A;  4M9X A;  4AI6 A;  1QAO A;  1GVN A;  1C1K A;  1QAM A;  4OVZ B;  2Z4R A;  2Y2O A;  4LJ5 A;  1XWI A;  4IBF A;  5F3W A;  3KSX A;  1IN4 A;  4LFB M;  4AZF A;  4MGY E;  2QPA A;  3LVV A;  3FUW A;  1XHB A;  2W82 A;  2LWX A;  3LQQ A;  2EA0 A;  4JYA M;  2DWZ B;  1FJG M;  4AG6 A;  4P16 A;  2Y2N A;  2CV2 A;  3U6O A;  4LF6 M;  3W0L B;  2VII A;  2KRK A;  3HJ8 A;  2ERC A;  2Y0T A;  4IBK A;  4L15 A;  4NSO B;  5FTJ A;  3L27 A;  4LJ9 A;  3SFZ A;  4OUI A;  1DGF A;  1IY1 A;  2G5G X;  2K47 A;  1QAN A;  4IBE A;  1FNN A;  4NSR A;  3TE6 A;  1N77 A;  3WHL A;  4M0W A;  1L2B A;  1IN7 A;  2L7I A;  2R62 A;  3DOA A;  2IOU A;  3SMP A;  3HJS A;  4CGY B;  3GLH B;  3SHF A;  3VDP A;  1DGB A;  3FUT A;  2KZU A;  1WXQ A;  5EXP A;  3U61 A;  3K2L A;  3RGP A;  1DGG A;  4B3T M;  2XSZ D;  5KQD A;  2QCU A;  4JI8 M;  5KPR A;  4YHH M;  4FWG A;  4M9S A;  4LF8 M;  4JI6 M;  3U61 B;  4IBC A;  1HT2 E;  2DZN B;  4MM3 B;  4OX9 M;  3BOS A;  1IXR C;  5KQ8 A;  4OU7 A;  4AKH A;  2YFQ A;  3GP1 A;  2JCH A;  3AFH A;  3J2P B;  3Q8X A;  4WW0 A;  3HSH A;  2R45 A;  4LFC M;  3HGI A;  4RF1 A;  3LQR A;  2G8L A;  2FFJ A;  4MGK E;  2Y2K A;  2CV1 A;  1Z5A A;  1IXZ A;  1JQJ C;  4D80 A;  5DYI A;  4LJ8 A;  3J27 B;  3OTO M;  4HLQ A;  5ITQ A;  3GLG A;  4DR1 M;  4DR3 M;  4IBB A;  4WUR A;  2ZM6 M;  1K82 A;  5IT9 S;  4GH9 A;  1R6B X;  3L25 A;  2CE7 A;  3KOW E;  4GC9 A;  2YR0 A;  3K8Z A;  4QHT A;  3B9P A;  3CF6 E;  1Z59 A;  1ORY B;  3HWS A;  2QBY B;  2I7N A;  2KRU A;  4YY3 M;  4LG2 A;  2JA2 A;  3DZD A;  1NNJ A;  1DO2 A;  2Y0Q A;  3GLG B;  3U5Z A;  2F5S A;  1L1T A;  4LFA M;  3W0F A;  4OJ5 A;  4LF7 M;  4LF5 M;  4IJF A;  4OJO A;  5FTL A;  4D81 A;  3TPZ A;  2UUA M;  3HHZ A;  3VLF B;  4X66 M;  3I51 A;  1N36 M;  3U6D A;  1N75 A;  2DZO B;  3ZCB B;  3H4M A;  4FCT A;  3VK7 A;  5LMU M;  3SAS A;  2CV0 A;  3PNY A;  2XSZ A;  3HKP A;  4D82 A;  3D8L A;  4LCB A;  5EP3 A;  5LMN M;  4I8O A;  1IN5 A;  2BJW A;  5ITX E;  1IQP A;  3CF0 A;  2BNK A;  3HU1 A;  3NBI A;  3K92 A;  4FCW A;  4NRV A;  3L26 A;  4LRS A;  1TH3 A;  1TDH A;  2RGO A;  3M7G A;  3T15 A;  4L8R C;  4JI0 M;  1YUE A;  1KSF X;  3PFI A;  4DV6 M;  5E6J A;  4NZ3 A;  1IN8 A;  4NRW A;  1IBK M;  2I7P A;  2O5R A;  3UGJ A;  4R3D A;  3MHV C;  4QOZ C;  4JI2 M;  3T38 A;  4TUW A;  1NJF A;  2FOI C;  2KZS A;  2C9O A;  4MGH A;  3C58 A;  4DR6 M;  4G4R A;  2D7G A;  2C5R A;  2LH0 A;  2LNH C;  2P5T A;  2DHR A;  4NYY A;  4Z8X A;  1D2N A;  1N32 M;  4OJ6 A;  2R4J A;  2HKJ A;  1HQY E;  3U6S A;  3U60 B;  3MJ5 A;  2D7H A;  4CHT B;  3SHG B;  3KS4 A;  3KW6 A;  4L4U A;  1SXJ A;  3L2A A;  4X62 M;  4NXN M;  1IM2 A;  3GQ5 A;  4QNR A;  1Q3B A;  3KVW A;  3A98 B;  1G59 A;  4DUY M;  4G4O A;  2DXI A;  2QP9 X;  3RGS A;  3SAU A;  1IBM M;  2UWX A;  2XF3 A;  2KEB A;  2DWN A;  2Y2M A;  3ZC7 B;  4QNL A;  3M0E A;  1QQW A;  2OPF A;  4JV5 M;  4FVM A;  4PT5 A;  4GC5 A;  4JI5 M;  1XNR M;  3GLF A;  1Z5B A;  1K3X A;  2F5P A;  3PVS A;  4PDG A;  2XFT A;  1QVR A;  1GKI A;  2QEN A;  3AJI B;  4FWD A;  4NZ1 A;  1R7R A;  4DR7 M;  2X49 A;  4MGZ E;  4XGI A;  2R46 A;  3GRR A;  3U6Q A;  4JN6 A;  1XC8 A;  2DWL A;  2X8A A;  1UM8 A;  4B3S M;  3TL4 X;  3HU2 A;  2LXE A;  3D8B A;  3KP1 E;  2XH9 A;  1MU5 A;  2L6O A;  4DUZ M;  1TGU A;  4XBO A;  2YNM D;  4LZZ A;  1VDD A;  2ZAM A;  2FE8 A;  4JI4 M;  4RF0 A;  4LF4 M;  4GRI A;  3SYL A;  4X65 M;  2R18 A;  3MK6 A;  1ZQ9 A;  2CHQ A;  3JR4 A;  3E9S A;  3JR5 A;  4NZ4 A;  5E26 A;  3GLI A;  3FYD A;  3AV0 A;  1XMO M;  4W5W A;  1YE9 A;  2Y2L A;  2L09 A;  1J7K A;  5FTN A;  5KPZ A;  4MB7 A;  4JI7 M;  3FD9 A;  4GHA A;  3J7A S;  4EIW A;  1SXJ C;  7CAT A;  1X37 A;  5EP1 A;  3GO8 A;  3U6P A;  2F5N A;  1XXH A;  2ZBK B;  5EJC A;  4KHP M;  1NJG A;  4LJ7 A;  2CFO A;  2EUC A;  4QOS A;  3SAT A;  3T1H M;  2FFF B;  3A46 A;  2Y20 A;  3GRV A;  4BB9 A;  4DV7 M;  4GMQ A;  3KXE C;  2CEA A;  5KO3 A;  3ILK A;  3UJN A;  5ITU A;  2VQF M;  5EXX A;  1SXJ D;  2Z7J A;  3EIH A;  1HQC A;  3ZH9 B;  3TWM A;  1GLN A;  4AQY M;  2KA6 B;  5FTM A;  2XEP A;  4DR4 M;  3N3F A;  3FYC A;  8CAT A;  1W5T A;  3A45 A;  1DO0 A;  3QAU A;  2Y2I A;  1YU2 A;  3U5Z B;  3R8F A;  1OFH A;  3SAV A;  5GKN A;  1NY6 A;  1OFI A;  3J81 S;  4I81 A;  4ITQ A;  3TQS A;  4B7F A;  3FTC A;  4IBI A;  4R7G A;  5H37 D;  1J09 A;  3AOG A;  4RNA A;  4MGI E;  1ZAE A;  4A3V B;  4DR2 M;  2UXC M;  4B7H A;  2H1R A;  3CTW B;  2HCB A;  3AOE A;  2C96 A;  5BPV A;  1L2D A;  3EIE A;  4NXM M;  4GHL A;  4G6Z A;  2J7O A;  4FCV A;  4KOD A;  4LRT A;  4OJP A;  5C1B A;  1N34 M;  4OW0 A;  1K3W A;  3KFU G;  1DGH A;  1NY5 A;  1IN6 A;  2L7H A;  4NOO B;  2ZAO A;  3PNV A;  4GKJ M;  4GIP A;  1HT1 E;  3A42 A;  4KLN A;  4B3M M;  3L29 A;  2NQ8 C;  4IBD A;  4G4N A;  2XFS A;  1L1Z A;  1DGH B;  4DV0 M;  4G4Q A;  2RGH A;  1W5S A;  1L2C A;  5ITT A;  2DWM A;  2C9C A;  4JXJ A;  4B7G A;  5ITY A;  4GIT A;  1MX0 A;  3FUX A;  1G3I A;  1PJJ A;  3FKE A;  4M0D A;  4MH0 E;  3HON A;  3WX7 A;  3FUV A;  3FTE A;  4JI3 M;  1H6U A;  3QWL A;  4FD2 A;  1LV7 A;  4AKG A;  3U6L A;  1YSY A;  2V6Z M;  4IJE A;  5EXT A;  4LJ4 A;  4CIS A;  1TH2 A;  1SXJ B;  2Q2E B;  4HL4 A;  1HR0 M;  2Z3X A;  3UK6 A;  3R9X B;  5JI2 E;  3SC3 A;  2UUB M;  4NY2 A;  1IY2 A;  3RE8 A;  3FTD A;  4FWH A;  1YU0 A;  3I4V A;  2R65 A;  1T3T A;  4QHS A;  3PXG A;  1S3S A;  2R4E A;  3VKG A;  4B08 A;  1PJI A;  4IIW A;  5EQT A;  4PCZ A;  3SMS A;  3HJQ A;  4PDI A;  3U6M A;  1Z6T A;  2XD5 A;  1G4A E;  3K1J A;  4OJL A;  2D7E A;  3GPX A;  4DV2 M;  3VDU A;  3WHK A;  5DNY A;  2CHV A;  5IRE B;  2KXE A;  5FSW A;  5IWA M;  5FLX S;  3AOE C;  3GQ4 A;  3GLF B;  5KPT A;  3IG5 A;  3T1Y M;  2Y2J A;  1GL6 A;  2M60 A;  1JR3 A;  3IG8 A;  2Y2Q A;  1GL7 A;  3HHX A;  3GLH A;  2V1U A;  1PM5 A;  1YU3 A;  1NHG C;  1R2Z A;  1XNQ M;  2HHH M;  3GQ3 A;  3SAW A;  3KS8 A;  4IBG A;  1IXS B;  1HNW M;  3KP0 E;  2CHG A;  1YU1 A;  3J80 S;  3HU3 A;  3HHW A;  1TH4 A;  1Q39 A;  4DV4 M;  4DR5 M;  3KOZ E;  1NVM A;  3GPP A;  2RKO A;  3KSJ A;  1NHW C;  3NWL A;  4BLC A;  2XZU A;  3SYK A;  1NNU C;  3SBJ A;  3AL0 C;  1N33 M;  3CF2 A;  5FTK A;  1SXJ E;  5IZ7 D;  2UUC M;  5EXS A;  2C98 A;  3HHY A;  4Z6Y A;  5ITX A;  1HNZ M;  2UXD M;  2FNA A;  1E9R A;  1KFV A;  4B3R M;  4K0K M;  2BG1 A;  3GLI B;  3KDS E;  4I4L A;  4I5S A;  1QZM A;  1L8Q A;  3THG A;  4X64 M;  4IBJ A;  4GKK M;  2JE5 A;  2A5Y B;  3DA1 A;  3SAR A;  2F4V M;  4DV3 M;  5C18 A;  3LMM A;  1I94 M;  4L16 A;  2DVW B;  5JI3 E;  1XXH B;  2Y21 A;  3VFD A;  1NSF A;  4BBA A;  4JI1 M;  3FUU A;  1E9S A;  2QBY A;  1TDZ A;  2M5Z A;  5EP4 A;  5BR8 M;  5EP2 A;  1OJL A;  2AHM A;  2VQE M;  1XMQ M;  3AKZ A;  1HNX M;  2Z4S A;  4LY6 A;  1E32 A;  3GRY A;  2ZAN A;  4REZ A;  4AG5 A;  2Y2H A;  3KOX E;  3J7B A;  3GPU A;  5ITR A;  4LGY A;  1Z5C A;  4FW9 A;  1Q3C A;  2Y2G A;  1J5E M;  3KOY E;  2XD1 A;  1YUB A;  3LVW A;  2XLJ A;  4NZ5 A;  3JAM S;  4AKI A;  3TWK A;  1QYR A;  2X4A A;  5A2Q S;  3M6A A;  4LZJ A;  1QAQ A;  1N78 A;  2YQZ A;  2BJV A;  2J7N A;  2XGN A;  4ZPX A;  5DYG A;  4PD2 A;  4II7 A;  3TWL A;  3U6C A;  2OQ4 A;  4NYU A;  3UMM A;  1I4W A;  2UXB M;  1JR3 D;  3GRU A;  1G8P A;  3UZU A;  2QZ4 A;  4AW4 A;  1IBL M;  2UU9 M;  2CUZ A;  3DFZ A;  2F5Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...