4IBKA

Ebola virus vp35 bound to small molecule
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
123
structure length
123
Chain Sequence
b'DISAKDLRNIMYDHLPGFGTAFHQLVQVICKLGKDSNSLDIIHAEFQASLAEGDSPQCALIQITKRVPIFQDAAPPVIHIRSRGDIPRACQKSLRPVPPSPKIDRGWVCVFQLQDGKTLGLKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Polymerase cofactor VP35
publication title In Silico Derived Small Molecules Bind the Filovirus VP35 Protein and Inhibit Its Polymerase Cofactor Activity.
pubmed doi rcsb
source organism Ebola virus
molecule tags Transcription/transcription inhibitor
total genus 43
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-12-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.950 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4ibkA01
2.10.10.70 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 4ibkA02
3L25A 4GHAA 4IBDA 4IBKA 5BPVA 3L29A 4GHLA 4IJEA 3KS8A 3L26A 4IBEA 4GH9A 4IBBA 4IBIA 4IBJA 4IJFA 4LG2A 3L27A 4IBCA 3L2AA 4IBGA 4IBFA 3FKEA 3KS4A 3L28A
chains in the Genus database with same CATH superfamily
4JN6A 4S12A 5ITXA 3GPPA 1Q02A 3JAMS 4NC6A 4DR5M 2Y20A 3SHGB 4B7GA 3TWMA 4DR7M 2Y2KA 2DZOB 4B7HA 5C18A 1HT1E 1N36M 3B9PA 3GPXA 4GIPA 3AOEC 2A5YB 3JR5A 1N75A 3SAWA 2XFTA 3HJSA 1H6UA 1JR3D 3KVWA 2X4AA 4B3MM 3FUUA 2UUAM 1GXDA 2H1RA 3GP1A 1Z6TA 3HHWA 1LTMA 3KXEC 3A46A 4OJ6A 4GITA 3E46A 4NXMM 1EIJA 4R3DA 2Y2JA 3U60A 2DI0A 3HWSA 2G5GX 2E5LM 2UWXA 1Z5AA 4CHTB 3C9PA 4X65M 4Q7JA 4D82A 2EKFA 1J7MA 4LJ6A 1QAOA 4M9SA 3FRHA 5EP3A 4JYAM 2D7EA 4OU7A 1YU1A 3GO8A 2EA0A 2Z4SA 1HT2E 4ANRA 4X62M 4FCTA 2CEAA 1E9SA 3HHYA 3U6CA 4LF7M 3AFHA 3EIHA 3KP1E 3FTDA 1TH4A 4XBOA 2F5NA 1VG5A 1WIVA 2LHCA 4FWDA 2UUBM 3HU3A 4NYYA 5EXXA 1NV8A 2GQFA 5EQTA 3HY5A 1DO0A 2R0IA 3KFUG 3SMSA 2L7IA 2MH8A 3FD9A 2Z3XA 1NNJA 2DWMA 2R62A 4AKIA 1S3SA 5FSWA 1ZQ9A 2C5RA 3J7AS 2EUCA 5ITYA 2LXEA 2C9CA 5EXPA 4IBIA 2QZ4A 5FTJA 2MR9A 2W82A 3BOSA 2L7HA 3GLHE 1E6PA 4DR2M 2RTSA 5FTLA 2HHHM 2NQ8C 2WSEF 2JY6B 5IWAM 2DZNB 2UU9M 4MH0E 2Y2NA 4JI7M 1QUTA 4GKKM 3NBXX 4RF1A 2XZFA 2R45A 4CISA 4PT5A 1XXHB 2FOIC 5E26A 1NY6A 1TDZA 1D0KA 4D81A 1GL6A 3GLHA 2FNAA 4ITQA 4LF9M 2LVPC 2L4FA 3TWLA 1OGGA 1NY5A 4HMCA 2UUCM 3SARA 3HHXA 4TUWA 2JUJA 3K9PA 3LVVA 2R18A 3CGWA 1NV9A 4BB9A 2UXCM 4NRWA 2L09A 4AI6A 1QZMA 2EO2A 3ZCBB 2LVQD 1OTRA 1N78A 2JA2A 3SAUA 2LBCA 3GLIB 4JI4M 5IZ7D 2ZAOA 4AG6A 4Z2KA 1W5TA 1W5SA 8CATA 2FE8A 3VK7A 4DV6M 3H4MA 1G8PA 4LJ9A 4CGYB 1QZEA 2DAMA 3U61B 3BXWA 4LF6M 1PGYA 4OX9M 3VKHA 3FUVA 1HJPA 2CHGA 4XK8F 3UGJA 1SXJB 2XSZA 4B3SM 3KOWE 2Y0TA 2QP9X 4K0KM 1UM8A 1XNQM 2K9DA 2Z4RA 2ZANA 4AKGA 1Z5CA 4II7A 4MB7A 5JI3E 3GRVA 3I4YA 2F5OA 3QAUA 1OQYA 4G6ZA 1QDTA 5EJCA 3PVSA 3RFWA 1K3WA 4Z2JA 1TDHA 1YSYA 2V5OA 4DR1M 1MN3A 2ZM6M 3W0LB 4X64M 2XFSA 4PD2A 2XZUA 1JQJC 2HWJA 1G4AE 2MGWA 4REZA 2YR0A 2XF3A 4G4NA 3WD1A 4IBCA 2J7OA 3U6DA 3U60B 3SAVA 3NWLA 3MQLA 4QOSA 3UK6A 5KPTA 3V76A 2Y2QA 4Z2GA 2F5SA 4LCBA 1G41A 1IY0A 4Z2HA 4JI5M 2AHMA 4OVZA 2R6FA 1JR3E 2MJ5B 1VQ1A 3L29A 3WD2A 1PJJA 1GKIA 4AQYM 2LHGA 1IY1A 5FTKA 1Q3BA 2BNKA 1L2CA 3FTEA 1ORYB 3L26A 1E15A 5ITQA 4DV1M 3HONA 2BWBA 1IY2A 1ZMWA 3SHFA 2DAIA 1JB0F 4FW9A 4NOOB 2BJVA 1JR3A 4MGYE 3U6SA 1GABA 1QYRA 1RU3A 1K82A 2FFFB 4YY3M 2R46A 4LJ8A 4ZPXA 2C98A 3PFIA 4OJPA 2XH9A 3M0EA 4LZJA 3U6LA 4Y28F 2ERCA 3FKEA 2JY7A 3KP0E 1W1YA 1XNRM 5LMNM 4KODA 2C96A 2LWXA 1R2YA 4LGYA 3QYEA 4HEOA 3WHLA 5LMUM 4MB5A 3AJIB 1ZMVA 3B74A 3C58A 1HR0M 2JCHA 4JI6M 3QYBA 4JXJA 1IN5A 1X37A 3FE3A 3VK8A 1J5EM 4AG5A 4LFBM 3WD0A 2KW0A 4KHPM 3GLHB 2KZSA 1HNWM 3U6QA 4LRTA 1HNXM 3HU1A 1J09A 1DGHA 1SG9A 1WGLA 2Q2EB 2WZJA 1V92A 4IBBA 1L6JA 2XD1A 3TWKA 4L4UA 4WP2A 2M60A 1IN7A 1YUEA 1R6BX 4QNRA 3SASA 1HNZM 1Q3CA 5A2QS 2EJSA 3HZJA 4NSOB 3T38A 4P17A 3W67A 2FN2A 3E4RA 1L1ZA 3FUXA 2KNZA 2L6OA 3I01M 3MHVC 4KO8A 4G4QA 1KFVA 1ED7A 5FTMA 3GRYA 2LVOC 3UZUA 3M7PA 4B3TM 1MJGM 2MROB 1IBKM 5KQ8A 4FWGA 4M9XA 4JI2M 1XB2B 1W1TA 1OIPA 1OFIA 4MGHA 1N33M 4NZ1A 3SATA 1E32A 1QO6A 4CJ6A 3D8LA 2DAGA 1QAQA 1D0LA 1NHWC 3IECA 3TQSA 1I94M 1TH3A 1T43A 3VDUA 1EE8A 3QWLA 3KOZE 1L2DA 1E88A 4G4OA 3I04M 2DVWB 3FRIA 3W0FA 1E6NA 1T6OA 2JE5A 3L25A 3GRUA 1OFHA 5IREB 1QVRA 3RE8A 3RGSA 1IBLM 1C7YA 4JI1M 4GC5A 3GPYA 1KS0A 4Z2IA 1WR1B 2DKLA 3HX3A 3OTOM 4JI8M 1QDRA 3DOAA 3FUWA 3T15A 4NZ5A 1C1KA 1QQWA 2FH0A 4OVZB 2KEBA 2VQFM 1T3TA 1E9RA 5EP4A 2Y2MA 5KQDA 3RGPA 1ZAEA 1PJIA 1YU4A 2K0BX 3MJ5A 4X66M 1EAKA 3J81S 3HKPA 3GPUA 4NL4H 2Y2LA 1L8QA 5KPRA 2HL7A 4RF0A 5IT9S 2XD5A 1LV7A 2L2DA 1CXWA 1WXQA 2JP7A 3GLGE 2CE7A 2GNOA 3C3DA 1F4IA 2RGOA 1IXSA 5ITTA 4LJ5A 3KOXE 4L8RC 1V34A 2D49A 3DFZA 2HKJA 4GMQA 1R5LA 3SMPA 2LH0A 2LVNC 3H4JA 3JR4A 4G4RA 1AUAA 1YU0A 2QBYA 2G3QA 4GRIA 1XMQM 2LTUA 4LF8M 2KHHA 3LVWA 4PCZA 2YFQA 1AIPC 5H37D 2YQZA 3GLGA 3ZQJA 3IG5A 2KNVA 2CP8A 1FJGM 1P3QQ 3AL0C 4OW0A 1UR8A 2Y21A 2DWZB 4L6V6 1IN8A 1H0IA 3GQ5A 1H0GA 5DNYA 1DGHB 4JI0M 2OOAA 4HMDA 3E9SA 2DHRA 5DFLA 2JWSA 3HHZA 1N32M 2DHYA 2V6ZM 3I4VA 2EKKA 3N3FA 4B7FA 1N34M 3J27B 4P16A 3VLFB 3SBJA 2CWBA 2DXIA 1TTEA 1OGBA 1GJTA 1R2ZA 1QUSA 2ZAMA 2DWLA 2F5QA 4DV4M 2KA6B 1Z5BA 2CUZA 1E94E 3CF0A 1ZV1A 1R4GA 2VIIA 3IG8A 3T1YM 1XHBA 3WHKA 1EFUB 4AKHA 4WURA 4NYUA 4NXNM 2QHOB 3K92A 4NZ4A 2K47A 4DV2M 1PJTA 5GKNA 4I8OA 2I7PA 2JY8A 1VEGA 4L16A 5EXSA 3KDSE 3M7GA 3SC3A 4LG2A 4FVMA 1OAIA 3UMMA 1OKSA 4KT0F 4LGMA 2I7NA 3FYDA 4LF5M 1GPFA 1CK7A 1VEJA 2KNAA 3CTWB 1YUBA 2ZTDA 2H5XA 3AOEA 2D7HA 3U6OA 4I81A 3WX7A 2C99A 1O6IA 4MM3B 1QAMA 2KDLA 4Z8XA 4Z2LA 3PXGA 4DUZM 1E6RA 4PDGA 1YLAA 2J5YA 2RRUA 4IBDA 3GQ3A 2OQ4A 3C3EA 2K6BA 5KPZA 2V1UA 2DENA 5BPVA 2QCUA 1NVMA 2JNHA 3K8ZA 4IIWA 4UN2B 4LRSA 4MB3A 3GLFE 2Z8YM 1G3IA 5L8RF 4QNLA 5DYIA 4LJ4A 1NJFA 2Y2HA 3AV0A 3UJNA 1IN4A 2Y2OA 2B3TA 1OJLA 2DNAA 5EP2A 3J80S 1E6ZA 2BWEA 4IBJA 3FTCA 2JXNA 4G3OA 1NHGC 3GLFA 4I4LA 2JY5A 2DAKA 2JZ1A 3CF6E 4F2LA 2RGHA 2C9OA 2CV0A 4IBFA 3U5ZA 4DR3M 4DR4M 2BJWA 2ZBKB 1N77A 3J7BA 3U6EA 2Z7JA 3HJQA 2O25A 4DBGB 4F1IA 1PM5A 2QNJA 1K3XA 3I51A 4D80A 3GQ4A 4LFCM 1VEKA 4IJEA 1IXSB 3SYKA 1WGNA 3MMPA 1NSFA 1SXJC 3KS8A 4XGIA 5FTNA 2RKOA 2CV1A 2XEPA 4RNAA 1IBMM 4Z6YA 3LQRA 4R7GA 4PDIA 1UFZA 2QBYB 2FFJA 1KYIA 3K1JA 2KRUA 2O01F 3L27A 4IJFA 1SXJD 3SFZA 4CIZA 5FLXS 4QHTA 3GLGB 4FD2A 4I5SA 3FTFA 3TE6A 4M9ZA 3L2AA 3AKZA 3TPZA 1YE9A 3KOYE 2KRKA 1DGGA 5DYGA 3B7QA 1IN6A 3KW6A 3TL4X 5ITRA 2OO9A 3LCUA 1BVSA 1PJQA 2R4EA 1DGBA 4IBKA 4OJOA 2XLJA 4DUYM 3Q8XA 3SYLA 1IXRC 4GHLA 3BBZA 4NZ3A 2OOBA 2Y0QA 3M6AA 1HQYE 3MK6A 2P5TA 3AOGA 3IHPA 4YHHM 3VDPA 3HJ8A 4MGKE 3PNYA 2CHVA 4MB4A 3T1HM 4B08A 2X49A 3LMMA 3VFDA 1VDDA 1GOIA 4LFAM 4GKJM 1L2BA 1A5TA 2CFOA 3Q8GA 3K9OA 2APLA 2UXBM 3GRRA 4MGZE 3B89A 2VF7A 3ZH9B 2BG1A 2DZLA 1J7KA 1R7RA 1V33A 5EXTA 2Y2PA 4LJAA 4FCVA 5BR8M 3U6PA 1GL7A 2WSFF 3A42A 4FCWA 4DV3M 4L78A 4HL4A 4BBAA 3LQQA 4FWHA 2JZ0A 2KZUA 3F92A 2R44A 2N35A 1OAOC 1IM2A 1WJ7A 3WD3A 2VDBB 1W1VA 1NJGA 1ZMUA 1E8BA 1YU3A 4AZFA 2D7GA 1I4WA 1TH2A 3DA1A 4RKUF 4MGIE 4GH9A 2Y2GA 3J2PB 4QHSA 3A45A 2CV2A 1G59A 1GLNA 4QNMA 2CRUA 1TR8A 2R4JA 3KSXA 1PJSA 4GEWA 4JI3M 5KO3A 4DV7M 3ZC7B 5EP1A 4LF4M 2UXDM 1IFYA 4HLQA 2IOUA 4DV5M 4KLNA 3VKGA 4TX8A 1XMOM 1PDCA 4LY6A 1CUKA 4NY2A 3KS4A 1PRBA 2LNHC 3GLFB 4AW4A 2L4EA 4BLCA 2KXEA 3T6PA 4JV5M 2Y2IA 1MX0A 2VF8A 3R8FA 4GHAA 3U5ZB 3HGIA 1WHCA 7CATA 5JI2E 3LCVB 3KSJA 3E21A 3FYCA 1NNUC 4WW0A 2F4VM 1AIWA 1IXZA 3WD4A 2HAKA 1D2NA 4LZZA 2CHQA 1XXHE 3ILKA 4QOZC 1VDLA 2F5PA 1UR9A 3HU2A 2HCBA 1TF0B 4M0DA 1W1PA 4HMEA 1XC8A 1OIZA 3D8BA 2WSCF 4NSRA 4B3RM 1DV0A 1GVNA 4OUIA 3K2LA 2QQ8A 2LVAA 2ZTCA 1XWIA 3A98B 1MU5A 1XXHA 3DZDA 3EIEA 4W5WA 1YU2A 1Y8GA 3LW5F 1KSFX 3U6MA 2XSZD 4NRVA 1Z59A 3L28A 3GLIE 1L1TA 1HQCA 3B7ZA 2R65A 4OJ5A 3HSHA 3W68A 2XGNA 1D0MA 1TGUA 3NBIA 5F3WA 1H8PA 2FS1A 1GO5A 4A3VB 2M5ZA 3CF2A 1FNNA 2G8LA 2YNMD 2DWNA 1IQPA 3B7NA 4LJ7A 1Q39A 2QSFX 2OPFA 3R9XB 1SXJE 2QPAA 1G71A 3GLIA 1DO2A 4IBEA 3PNVA 4M0WA 5C1BA 5ITXE 2VQEM 4DV0M 4OJLA 2V1CA 5ITUA 3U61A 4DR6M 1DGFA 3FUTA 1QANA 4L15A 4GC9A 4IBGA 3THGA 1NO1A 1GJSA 1SXJA 5E6JA 4R71A 2DAEA 2QENA 2O5RA 4EIWA 2J7NA 2X8AA
chains in the Genus database with same CATH topology
4JN6A 4S12A 5ITXA 3GPPA 3JAMS 4DR5M 2Y20A 3SHGB 4B7GA 3TWMA 4DR7M 2Y2KA 2DZOB 4B7HA 5C18A 1HT1E 1N36M 3B9PA 3GPXA 4GIPA 3AOEC 2A5YB 3JR5A 1N75A 3SAWA 2XFTA 3HJSA 1H6UA 1JR3D 3KVWA 2X4AA 4B3MM 3FUUA 2UUAM 2H1RA 3GP1A 1Z6TA 3HHWA 3A46A 3KXEC 4OJ6A 4GITA 4NXMM 4R3DA 2Y2JA 3U60A 3HWSA 2G5GX 2E5LM 1Z5AA 4CHTB 4X65M 4D82A 4LJ6A 1QAOA 4M9SA 5EP3A 4JYAM 1YU1A 2D7EA 4OU7A 2UWXA 3GO8A 2EA0A 2Z4SA 1HT2E 4K0KM 4X62M 4FCTA 2CEAA 1E9SA 3HHYA 3U6CA 4LF7M 3AFHA 3EIHA 3KP1E 3FTDA 1TH4A 4XBOA 2F5NA 4FWDA 2UUBM 3HU3A 4NYYA 5EXXA 5EQTA 1DO0A 3KFUG 2Y2LA 3SMSA 2L7IA 3FD9A 2Z3XA 1NNJA 2DWMA 4AKIA 2R62A 1S3SA 5FSWA 1ZQ9A 2C5RA 3J7AS 2EUCA 5ITYA 2LXEA 2C9CA 5EXPA 4IBIA 2QZ4A 5FTJA 2W82A 3BOSA 2L7HA 4DR2M 5FTLA 2HHHM 2NQ8C 5IWAM 2DZNB 2UU9M 4MH0E 2Y2NA 4JI7M 4GKKM 4RF1A 2XZFA 2R45A 4CISA 4PT5A 1XXHB 2FOIC 5E26A 1NY6A 1TDZA 4D81A 1GL6A 3GLHA 2FNAA 4ITQA 4LF9M 3TWLA 1NY5A 2UUCM 3SARA 3HHXA 4TUWA 3LVVA 2R18A 4BB9A 2UXCM 4NRWA 2L09A 4AI6A 1QZMA 2EO2A 3ZCBB 1N78A 2JA2A 3SAUA 3GLIB 4JI4M 5IZ7D 2ZAOA 4AG6A 1W5TA 1W5SA 8CATA 2FE8A 3VK7A 4DV6M 3H4MA 1G8PA 4LJ9A 4CGYB 3U61B 4LF6M 4OX9M 3VKHA 3FUVA 2CHGA 3UGJA 1SXJB 2XSZA 4B3SM 3KOWE 2Y0TA 2QP9X 1UM8A 1XNQM 2Z4RA 2ZANA 4AKGA 1Z5CA 4II7A 4MB7A 5JI3E 3GRVA 3I4YA 2F5OA 3QAUA 4G6ZA 5EJCA 3RFWA 3PVSA 1K3WA 1TDHA 1YSYA 4DR1M 2ZM6M 3W0LB 4X64M 2XFSA 4PD2A 2XZUA 1JQJC 1G4AE 4REZA 2YR0A 2XF3A 4G4NA 4IBCA 2J7OA 3U6DA 3U60B 3SAVA 3NWLA 4QOSA 3UK6A 5KPTA 2Y2QA 2F5SA 4LCBA 1G41A 1IY0A 4JI5M 2AHMA 4OVZA 3L29A 1PJJA 1GKIA 4AQYM 1IY1A 5FTKA 1Q3BA 2BNKA 1L2CA 3FTEA 1ORYB 3L26A 5ITQA 4DV1M 3HONA 1IY2A 3SHFA 4FW9A 4NOOB 2BJVA 1JR3A 4MGYE 3U6SA 1QYRA 1K82A 2FFFB 4YY3M 2R46A 4LJ8A 4ZPXA 2C98A 3PFIA 4OJPA 2XH9A 3M0EA 4LZJA 3U6LA 2ERCA 3FKEA 3KP0E 1XNRM 5LMNM 4KODA 2C96A 2LWXA 1R2YA 4LGYA 3WHLA 5LMUM 3AJIB 1HR0M 3C58A 2JCHA 4JI6M 1J5EM 4JXJA 1IN5A 1X37A 3VK8A 4AG5A 4LFBM 2KW0A 4KHPM 3GLHB 2KZSA 1HNWM 3U6QA 4LRTA 1HNXM 3HU1A 1J09A 1DGHA 2Q2EB 4IBBA 2XD1A 3TWKA 4L4UA 2M60A 1IN7A 1YUEA 1R6BX 4QNRA 3SASA 1HNZM 1Q3CA 5A2QS 4NSOB 3T38A 3E4RA 1L1ZA 3FUXA 2L6OA 3MHVC 4KO8A 4G4QA 1KFVA 5FTMA 3GRYA 3UZUA 4B3TM 1IBKM 5KQ8A 4FWGA 4M9XA 4JI2M 4MGHA 1OFIA 1N33M 4NZ1A 3SATA 1E32A 3D8LA 1QAQA 3TQSA 1NHWC 1I94M 1TH3A 3VDUA 1EE8A 3QWLA 3KOZE 1L2DA 4G4OA 2DVWB 3W0FA 2JE5A 3L25A 3GRUA 1OFHA 5IREB 1QVRA 3RE8A 3RGSA 1IBLM 4JI1M 4GC5A 3GPYA 3OTOM 4JI8M 3FUWA 3DOAA 3T15A 4NZ5A 1C1KA 1QQWA 4OVZB 2KEBA 2VQFM 1T3TA 1E9RA 5EP4A 2Y2MA 5KQDA 3RGPA 1ZAEA 1PJIA 1YU4A 3MJ5A 4X66M 3J81S 3HKPA 3GPUA 4NL4H 1L8QA 5KPRA 2HL7A 4RF0A 5IT9S 2XD5A 1LV7A 1WXQA 2CE7A 2RGOA 5ITTA 4LJ5A 3KOXE 4L8RC 3DFZA 2HKJA 4GMQA 3SMPA 2LH0A 3JR4A 4G4RA 1YU0A 2QBYA 4GRIA 1XMQM 4LF8M 3LVWA 4PCZA 5H37D 2YFQA 3GLGA 2YQZA 3IG5A 1FJGM 3AL0C 4OW0A 2Y21A 2DWZB 1IN8A 3GQ5A 5DNYA 1DGHB 4JI0M 3E9SA 2DHRA 3HHZA 1N32M 2V6ZM 3I4VA 3N3FA 4B7FA 1N34M 3J27B 4P16A 3VLFB 3SBJA 2DXIA 1R2ZA 2ZAMA 2DWLA 2F5QA 4DV4M 2KA6B 1Z5BA 2CUZA 1E94E 3CF0A 2VIIA 3IG8A 3T1YM 1XHBA 3WHKA 4AKHA 4WURA 4NYUA 4NXNM 3K92A 4NZ4A 2K47A 4DV2M 5GKNA 4I8OA 2I7PA 4L16A 5EXSA 3KDSE 3M7GA 3SC3A 4LG2A 4FVMA 3UMMA 4LGMA 2I7NA 3FYDA 4LF5M 3CTWB 1YUBA 3AOEA 2D7HA 3U6OA 4I81A 3WX7A 2C99A 4MM3B 1QAMA 4Z8XA 3PXGA 4DUZM 4PDGA 2OQ4A 4IBDA 3GQ3A 5KPZA 2V1UA 5BPVA 2QCUA 1NVMA 4IIWA 3K8ZA 4LRSA 1G3IA 4QNLA 5DYIA 4LJ4A 1NJFA 2Y2HA 3AV0A 3UJNA 1IN4A 2Y2OA 1OJLA 5EP2A 3J80S 4IBJA 3FTCA 1NHGC 3GLFA 4I4LA 3CF6E 2RGHA 2C9OA 2CV0A 4IBFA 3U5ZA 4DR3M 4DR4M 2BJWA 2ZBKB 1N77A 3J7BA 3U6EA 2Z7JA 3HJQA 1PM5A 1K3XA 3I51A 4D80A 3GQ4A 4LFCM 4IJEA 1IXSB 3SYKA 1NSFA 1SXJC 3KS8A 4XGIA 5FTNA 2RKOA 2CV1A 2XEPA 4RNAA 1IBMM 4Z6YA 3LQRA 4R7GA 4PDIA 2QBYB 2FFJA 1KYIA 3K1JA 2KRUA 4IJFA 3L27A 3SFZA 1SXJD 5FLXS 3GLGB 4QHTA 4FD2A 4I5SA 3FTFA 3TE6A 4M9ZA 3L2AA 3AKZA 3TPZA 1YE9A 3KOYE 2KRKA 1DGGA 5DYGA 3KW6A 1IN6A 3TL4X 5ITRA 2R4EA 1DGBA 4IBKA 4OJOA 2XLJA 4DUYM 3Q8XA 3SYLA 1IXRC 4GHLA 4NZ3A 2Y0QA 3M6AA 1HQYE 3MK6A 2P5TA 3AOGA 4YHHM 3VDPA 3HJ8A 4MGKE 3PNYA 2CHVA 3T1HM 4B08A 2X49A 3LMMA 3VFDA 1VDDA 4LFAM 4GKJM 1L2BA 2CFOA 2UXBM 3GRRA 4MGZE 3ZH9B 2BG1A 1J7KA 1R7RA 5EXTA 2Y2PA 4LJAA 4FCVA 5BR8M 3U6PA 1GL7A 3A42A 4FCWA 4DV3M 4L78A 4HL4A 4BBAA 3LQQA 4FWHA 2KZUA 1IM2A 1NJGA 1YU3A 4AZFA 2D7GA 1I4WA 1TH2A 3DA1A 4MGIE 4GH9A 2Y2GA 3J2PB 4QHSA 3A45A 2CV2A 1G59A 1GLNA 4QNMA 5KO3A 2R4JA 3KSXA 4JI3M 2IOUA 4LF4M 4DV7M 3ZC7B 5EP1A 2UXDM 4HLQA 4DV5M 4KLNA 3VKGA 1XMOM 4LY6A 4NY2A 3KS4A 2LNHC 3GLFB 4AW4A 4BLCA 2KXEA 4JV5M 2Y2IA 1MX0A 3R8FA 4GHAA 3U5ZB 3HGIA 7CATA 5JI2E 3KSJA 2F4VM 3FYCA 1NNUC 4WW0A 1IXZA 1D2NA 4LZZA 2CHQA 3ILKA 4QOZC 2F5PA 3HU2A 2HCBA 4M0DA 1XC8A 3D8BA 4NSRA 4B3RM 1GVNA 4OUIA 3K2LA 1XWIA 3A98B 1MU5A 1XXHA 3DZDA 3EIEA 4W5WA 1YU2A 1KSFX 3U6MA 2XSZD 4NRVA 1Z59A 3L28A 1L1TA 1HQCA 2R65A 4OJ5A 3HSHA 2XGNA 1TGUA 3NBIA 5F3WA 4A3VB 2M5ZA 3CF2A 1FNNA 2G8LA 2YNMD 2DWNA 1IQPA 4LJ7A 1Q39A 2OPFA 3R9XB 1SXJE 2QPAA 3GLIA 1DO2A 4IBEA 3PNVA 4M0WA 5C1BA 5ITXE 2VQEM 4DV0M 4OJLA 2V1CA 5ITUA 3U61A 4DR6M 1DGFA 3FUTA 1QANA 4L15A 4GC9A 4IBGA 3THGA 1SXJA 5E6JA 2QENA 2O5RA 4EIWA 2J7NA 2X8AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L25 A;  4GHA A;  4IBD A;  4IBK A;  5BPV A;  3L29 A;  4GHL A;  4IJE A;  3KS8 A;  3L26 A;  4IBE A;  4GH9 A;  4IBB A;  4IBI A;  4IBJ A;  4IJF A;  4LG2 A;  3L27 A;  4IBC A;  3L2A A;  4IBG A;  4IBF A;  3FKE A;  3KS4 A;  3L28 A; 
#chains in the Genus database with same CATH topology
 4JN6 A;  4S12 A;  5ITX A;  3GPP A;  1Q02 A;  3JAM S;  4NC6 A;  4DR5 M;  2Y20 A;  3SHG B;  4B7G A;  3TWM A;  4DR7 M;  2Y2K A;  2DZO B;  4B7H A;  5C18 A;  1HT1 E;  1N36 M;  3B9P A;  3GPX A;  4GIP A;  3AOE C;  2A5Y B;  3JR5 A;  1N75 A;  3SAW A;  2XFT A;  3HJS A;  1H6U A;  1JR3 D;  3KVW A;  2X4A A;  4B3M M;  3FUU A;  2UUA M;  1GXD A;  2H1R A;  3GP1 A;  1Z6T A;  3HHW A;  1LTM A;  3KXE C;  3A46 A;  4OJ6 A;  4GIT A;  3E46 A;  4NXM M;  1EIJ A;  4R3D A;  2Y2J A;  3U60 A;  2DI0 A;  3HWS A;  2G5G X;  2E5L M;  2UWX A;  1Z5A A;  4CHT B;  3C9P A;  4X65 M;  4Q7J A;  4D82 A;  2EKF A;  1J7M A;  4LJ6 A;  1QAO A;  4M9S A;  3FRH A;  5EP3 A;  4JYA M;  2D7E A;  4OU7 A;  1YU1 A;  3GO8 A;  2EA0 A;  2Z4S A;  1HT2 E;  4ANR A;  4X62 M;  4FCT A;  2CEA A;  1E9S A;  3HHY A;  3U6C A;  4LF7 M;  3AFH A;  3EIH A;  3KP1 E;  3FTD A;  1TH4 A;  4XBO A;  2F5N A;  1VG5 A;  1WIV A;  2LHC A;  4FWD A;  2UUB M;  3HU3 A;  4NYY A;  5EXX A;  1NV8 A;  2GQF A;  5EQT A;  3HY5 A;  1DO0 A;  2R0I A;  3KFU G;  3SMS A;  2L7I A;  2MH8 A;  3FD9 A;  2Z3X A;  1NNJ A;  2DWM A;  2R62 A;  4AKI A;  1S3S A;  5FSW A;  1ZQ9 A;  2C5R A;  3J7A S;  2EUC A;  5ITY A;  2LXE A;  2C9C A;  5EXP A;  4IBI A;  2QZ4 A;  5FTJ A;  2MR9 A;  2W82 A;  3BOS A;  2L7H A;  3GLH E;  1E6P A;  4DR2 M;  2RTS A;  5FTL A;  2HHH M;  2NQ8 C;  2WSE F;  2JY6 B;  5IWA M;  2DZN B;  2UU9 M;  4MH0 E;  2Y2N A;  4JI7 M;  1QUT A;  4GKK M;  3NBX X;  4RF1 A;  2XZF A;  2R45 A;  4CIS A;  4PT5 A;  1XXH B;  2FOI C;  5E26 A;  1NY6 A;  1TDZ A;  1D0K A;  4D81 A;  1GL6 A;  3GLH A;  2FNA A;  4ITQ A;  4LF9 M;  2LVP C;  2L4F A;  3TWL A;  1OGG A;  1NY5 A;  4HMC A;  2UUC M;  3SAR A;  3HHX A;  4TUW A;  2JUJ A;  3K9P A;  3LVV A;  2R18 A;  3CGW A;  1NV9 A;  4BB9 A;  2UXC M;  4NRW A;  2L09 A;  4AI6 A;  1QZM A;  2EO2 A;  3ZCB B;  2LVQ D;  1OTR A;  1N78 A;  2JA2 A;  3SAU A;  2LBC A;  3GLI B;  4JI4 M;  5IZ7 D;  2ZAO A;  4AG6 A;  4Z2K A;  1W5T A;  1W5S A;  8CAT A;  2FE8 A;  3VK7 A;  4DV6 M;  3H4M A;  1G8P A;  4LJ9 A;  4CGY B;  1QZE A;  2DAM A;  3U61 B;  3BXW A;  4LF6 M;  1PGY A;  4OX9 M;  3VKH A;  3FUV A;  1HJP A;  2CHG A;  4XK8 F;  3UGJ A;  1SXJ B;  2XSZ A;  4B3S M;  3KOW E;  2Y0T A;  2QP9 X;  4K0K M;  1UM8 A;  1XNQ M;  2K9D A;  2Z4R A;  2ZAN A;  4AKG A;  1Z5C A;  4II7 A;  4MB7 A;  5JI3 E;  3GRV A;  3I4Y A;  2F5O A;  3QAU A;  1OQY A;  4G6Z A;  1QDT A;  5EJC A;  3PVS A;  3RFW A;  1K3W A;  4Z2J A;  1TDH A;  1YSY A;  2V5O A;  4DR1 M;  1MN3 A;  2ZM6 M;  3W0L B;  4X64 M;  2XFS A;  4PD2 A;  2XZU A;  1JQJ C;  2HWJ A;  1G4A E;  2MGW A;  4REZ A;  2YR0 A;  2XF3 A;  4G4N A;  3WD1 A;  4IBC A;  2J7O A;  3U6D A;  3U60 B;  3SAV A;  3NWL A;  3MQL A;  4QOS A;  3UK6 A;  5KPT A;  3V76 A;  2Y2Q A;  4Z2G A;  2F5S A;  4LCB A;  1G41 A;  1IY0 A;  4Z2H A;  4JI5 M;  2AHM A;  4OVZ A;  2R6F A;  1JR3 E;  2MJ5 B;  1VQ1 A;  3L29 A;  3WD2 A;  1PJJ A;  1GKI A;  4AQY M;  2LHG A;  1IY1 A;  5FTK A;  1Q3B A;  2BNK A;  1L2C A;  3FTE A;  1ORY B;  3L26 A;  1E15 A;  5ITQ A;  4DV1 M;  3HON A;  2BWB A;  1IY2 A;  1ZMW A;  3SHF A;  2DAI A;  1JB0 F;  4FW9 A;  4NOO B;  2BJV A;  1JR3 A;  4MGY E;  3U6S A;  1GAB A;  1QYR A;  1RU3 A;  1K82 A;  2FFF B;  4YY3 M;  2R46 A;  4LJ8 A;  4ZPX A;  2C98 A;  3PFI A;  4OJP A;  2XH9 A;  3M0E A;  4LZJ A;  3U6L A;  4Y28 F;  2ERC A;  3FKE A;  2JY7 A;  3KP0 E;  1W1Y A;  1XNR M;  5LMN M;  4KOD A;  2C96 A;  2LWX A;  1R2Y A;  4LGY A;  3QYE A;  4HEO A;  3WHL A;  5LMU M;  4MB5 A;  3AJI B;  1ZMV A;  3B74 A;  3C58 A;  1HR0 M;  2JCH A;  4JI6 M;  3QYB A;  4JXJ A;  1IN5 A;  1X37 A;  3FE3 A;  3VK8 A;  1J5E M;  4AG5 A;  4LFB M;  3WD0 A;  2KW0 A;  4KHP M;  3GLH B;  2KZS A;  1HNW M;  3U6Q A;  4LRT A;  1HNX M;  3HU1 A;  1J09 A;  1DGH A;  1SG9 A;  1WGL A;  2Q2E B;  2WZJ A;  1V92 A;  4IBB A;  1L6J A;  2XD1 A;  3TWK A;  4L4U A;  4WP2 A;  2M60 A;  1IN7 A;  1YUE A;  1R6B X;  4QNR A;  3SAS A;  1HNZ M;  1Q3C A;  5A2Q S;  2EJS A;  3HZJ A;  4NSO B;  3T38 A;  4P17 A;  3W67 A;  2FN2 A;  3E4R A;  1L1Z A;  3FUX A;  2KNZ A;  2L6O A;  3I01 M;  3MHV C;  4KO8 A;  4G4Q A;  1KFV A;  1ED7 A;  5FTM A;  3GRY A;  2LVO C;  3UZU A;  3M7P A;  4B3T M;  1MJG M;  2MRO B;  1IBK M;  5KQ8 A;  4FWG A;  4M9X A;  4JI2 M;  1XB2 B;  1W1T A;  1OIP A;  1OFI A;  4MGH A;  1N33 M;  4NZ1 A;  3SAT A;  1E32 A;  1QO6 A;  4CJ6 A;  3D8L A;  2DAG A;  1QAQ A;  1D0L A;  1NHW C;  3IEC A;  3TQS A;  1I94 M;  1TH3 A;  1T43 A;  3VDU A;  1EE8 A;  3QWL A;  3KOZ E;  1L2D A;  1E88 A;  4G4O A;  3I04 M;  2DVW B;  3FRI A;  3W0F A;  1E6N A;  1T6O A;  2JE5 A;  3L25 A;  3GRU A;  1OFH A;  5IRE B;  1QVR A;  3RE8 A;  3RGS A;  1IBL M;  1C7Y A;  4JI1 M;  4GC5 A;  3GPY A;  1KS0 A;  4Z2I A;  1WR1 B;  2DKL A;  3HX3 A;  3OTO M;  4JI8 M;  1QDR A;  3DOA A;  3FUW A;  3T15 A;  4NZ5 A;  1C1K A;  1QQW A;  2FH0 A;  4OVZ B;  2KEB A;  2VQF M;  1T3T A;  1E9R A;  5EP4 A;  2Y2M A;  5KQD A;  3RGP A;  1ZAE A;  1PJI A;  1YU4 A;  2K0B X;  3MJ5 A;  4X66 M;  1EAK A;  3J81 S;  3HKP A;  3GPU A;  4NL4 H;  2Y2L A;  1L8Q A;  5KPR A;  2HL7 A;  4RF0 A;  5IT9 S;  2XD5 A;  1LV7 A;  2L2D A;  1CXW A;  1WXQ A;  2JP7 A;  3GLG E;  2CE7 A;  2GNO A;  3C3D A;  1F4I A;  2RGO A;  1IXS A;  5ITT A;  4LJ5 A;  3KOX E;  4L8R C;  1V34 A;  2D49 A;  3DFZ A;  2HKJ A;  4GMQ A;  1R5L A;  3SMP A;  2LH0 A;  2LVN C;  3H4J A;  3JR4 A;  4G4R A;  1AUA A;  1YU0 A;  2QBY A;  2G3Q A;  4GRI A;  1XMQ M;  2LTU A;  4LF8 M;  2KHH A;  3LVW A;  4PCZ A;  2YFQ A;  1AIP C;  5H37 D;  2YQZ A;  3GLG A;  3ZQJ A;  3IG5 A;  2KNV A;  2CP8 A;  1FJG M;  1P3Q Q;  3AL0 C;  4OW0 A;  1UR8 A;  2Y21 A;  2DWZ B;  4L6V 6;  1IN8 A;  1H0I A;  3GQ5 A;  1H0G A;  5DNY A;  1DGH B;  4JI0 M;  2OOA A;  4HMD A;  3E9S A;  2DHR A;  5DFL A;  2JWS A;  3HHZ A;  1N32 M;  2DHY A;  2V6Z M;  3I4V A;  2EKK A;  3N3F A;  4B7F A;  1N34 M;  3J27 B;  4P16 A;  3VLF B;  3SBJ A;  2CWB A;  2DXI A;  1TTE A;  1OGB A;  1GJT A;  1R2Z A;  1QUS A;  2ZAM A;  2DWL A;  2F5Q A;  4DV4 M;  2KA6 B;  1Z5B A;  2CUZ A;  1E94 E;  3CF0 A;  1ZV1 A;  1R4G A;  2VII A;  3IG8 A;  3T1Y M;  1XHB A;  3WHK A;  1EFU B;  4AKH A;  4WUR A;  4NYU A;  4NXN M;  2QHO B;  3K92 A;  4NZ4 A;  2K47 A;  4DV2 M;  1PJT A;  5GKN A;  4I8O A;  2I7P A;  2JY8 A;  1VEG A;  4L16 A;  5EXS A;  3KDS E;  3M7G A;  3SC3 A;  4LG2 A;  4FVM A;  1OAI A;  3UMM A;  1OKS A;  4KT0 F;  4LGM A;  2I7N A;  3FYD A;  4LF5 M;  1GPF A;  1CK7 A;  1VEJ A;  2KNA A;  3CTW B;  1YUB A;  2ZTD A;  2H5X A;  3AOE A;  2D7H A;  3U6O A;  4I81 A;  3WX7 A;  2C99 A;  1O6I A;  4MM3 B;  1QAM A;  2KDL A;  4Z8X A;  4Z2L A;  3PXG A;  4DUZ M;  1E6R A;  4PDG A;  1YLA A;  2J5Y A;  2RRU A;  4IBD A;  3GQ3 A;  2OQ4 A;  3C3E A;  2K6B A;  5KPZ A;  2V1U A;  2DEN A;  5BPV A;  2QCU A;  1NVM A;  2JNH A;  3K8Z A;  4IIW A;  4UN2 B;  4LRS A;  4MB3 A;  3GLF E;  2Z8Y M;  1G3I A;  5L8R F;  4QNL A;  5DYI A;  4LJ4 A;  1NJF A;  2Y2H A;  3AV0 A;  3UJN A;  1IN4 A;  2Y2O A;  2B3T A;  1OJL A;  2DNA A;  5EP2 A;  3J80 S;  1E6Z A;  2BWE A;  4IBJ A;  3FTC A;  2JXN A;  4G3O A;  1NHG C;  3GLF A;  4I4L A;  2JY5 A;  2DAK A;  2JZ1 A;  3CF6 E;  4F2L A;  2RGH A;  2C9O A;  2CV0 A;  4IBF A;  3U5Z A;  4DR3 M;  4DR4 M;  2BJW A;  2ZBK B;  1N77 A;  3J7B A;  3U6E A;  2Z7J A;  3HJQ A;  2O25 A;  4DBG B;  4F1I A;  1PM5 A;  2QNJ A;  1K3X A;  3I51 A;  4D80 A;  3GQ4 A;  4LFC M;  1VEK A;  4IJE A;  1IXS B;  3SYK A;  1WGN A;  3MMP A;  1NSF A;  1SXJ C;  3KS8 A;  4XGI A;  5FTN A;  2RKO A;  2CV1 A;  2XEP A;  4RNA A;  1IBM M;  4Z6Y A;  3LQR A;  4R7G A;  4PDI A;  1UFZ A;  2QBY B;  2FFJ A;  1KYI A;  3K1J A;  2KRU A;  2O01 F;  3L27 A;  4IJF A;  1SXJ D;  3SFZ A;  4CIZ A;  5FLX S;  4QHT A;  3GLG B;  4FD2 A;  4I5S A;  3FTF A;  3TE6 A;  4M9Z A;  3L2A A;  3AKZ A;  3TPZ A;  1YE9 A;  3KOY E;  2KRK A;  1DGG A;  5DYG A;  3B7Q A;  1IN6 A;  3KW6 A;  3TL4 X;  5ITR A;  2OO9 A;  3LCU A;  1BVS A;  1PJQ A;  2R4E A;  1DGB A;  4IBK A;  4OJO A;  2XLJ A;  4DUY M;  3Q8X A;  3SYL A;  1IXR C;  4GHL A;  3BBZ A;  4NZ3 A;  2OOB A;  2Y0Q A;  3M6A A;  1HQY E;  3MK6 A;  2P5T A;  3AOG A;  3IHP A;  4YHH M;  3VDP A;  3HJ8 A;  4MGK E;  3PNY A;  2CHV A;  4MB4 A;  3T1H M;  4B08 A;  2X49 A;  3LMM A;  3VFD A;  1VDD A;  1GOI A;  4LFA M;  4GKJ M;  1L2B A;  1A5T A;  2CFO A;  3Q8G A;  3K9O A;  2APL A;  2UXB M;  3GRR A;  4MGZ E;  3B89 A;  2VF7 A;  3ZH9 B;  2BG1 A;  2DZL A;  1J7K A;  1R7R A;  1V33 A;  5EXT A;  2Y2P A;  4LJA A;  4FCV A;  5BR8 M;  3U6P A;  1GL7 A;  2WSF F;  3A42 A;  4FCW A;  4DV3 M;  4L78 A;  4HL4 A;  4BBA A;  3LQQ A;  4FWH A;  2JZ0 A;  2KZU A;  3F92 A;  2R44 A;  2N35 A;  1OAO C;  1IM2 A;  1WJ7 A;  3WD3 A;  2VDB B;  1W1V A;  1NJG A;  1ZMU A;  1E8B A;  1YU3 A;  4AZF A;  2D7G A;  1I4W A;  1TH2 A;  3DA1 A;  4RKU F;  4MGI E;  4GH9 A;  2Y2G A;  3J2P B;  4QHS A;  3A45 A;  2CV2 A;  1G59 A;  1GLN A;  4QNM A;  2CRU A;  1TR8 A;  2R4J A;  3KSX A;  1PJS A;  4GEW A;  4JI3 M;  5KO3 A;  4DV7 M;  3ZC7 B;  5EP1 A;  4LF4 M;  2UXD M;  1IFY A;  4HLQ A;  2IOU A;  4DV5 M;  4KLN A;  3VKG A;  4TX8 A;  1XMO M;  1PDC A;  4LY6 A;  1CUK A;  4NY2 A;  3KS4 A;  1PRB A;  2LNH C;  3GLF B;  4AW4 A;  2L4E A;  4BLC A;  2KXE A;  3T6P A;  4JV5 M;  2Y2I A;  1MX0 A;  2VF8 A;  3R8F A;  4GHA A;  3U5Z B;  3HGI A;  1WHC A;  7CAT A;  5JI2 E;  3LCV B;  3KSJ A;  3E21 A;  3FYC A;  1NNU C;  4WW0 A;  2F4V M;  1AIW A;  1IXZ A;  3WD4 A;  2HAK A;  1D2N A;  4LZZ A;  2CHQ A;  1XXH E;  3ILK A;  4QOZ C;  1VDL A;  2F5P A;  1UR9 A;  3HU2 A;  2HCB A;  1TF0 B;  4M0D A;  1W1P A;  4HME A;  1XC8 A;  1OIZ A;  3D8B A;  2WSC F;  4NSR A;  4B3R M;  1DV0 A;  1GVN A;  4OUI A;  3K2L A;  2QQ8 A;  2LVA A;  2ZTC A;  1XWI A;  3A98 B;  1MU5 A;  1XXH A;  3DZD A;  3EIE A;  4W5W A;  1YU2 A;  1Y8G A;  3LW5 F;  1KSF X;  3U6M A;  2XSZ D;  4NRV A;  1Z59 A;  3L28 A;  3GLI E;  1L1T A;  1HQC A;  3B7Z A;  2R65 A;  4OJ5 A;  3HSH A;  3W68 A;  2XGN A;  1D0M A;  1TGU A;  3NBI A;  5F3W A;  1H8P A;  2FS1 A;  1GO5 A;  4A3V B;  2M5Z A;  3CF2 A;  1FNN A;  2G8L A;  2YNM D;  2DWN A;  1IQP A;  3B7N A;  4LJ7 A;  1Q39 A;  2QSF X;  2OPF A;  3R9X B;  1SXJ E;  2QPA A;  1G71 A;  3GLI A;  1DO2 A;  4IBE A;  3PNV A;  4M0W A;  5C1B A;  5ITX E;  2VQE M;  4DV0 M;  4OJL A;  2V1C A;  5ITU A;  3U61 A;  4DR6 M;  1DGF A;  3FUT A;  1QAN A;  4L15 A;  4GC9 A;  4IBG A;  3THG A;  1NO1 A;  1GJS A;  1SXJ A;  5E6J A;  4R71 A;  2DAE A;  2QEN A;  2O5R A;  4EIW A;  2J7N A;  2X8A A; 
#chains in the Genus database with same CATH homology
 4JN6 A;  4S12 A;  5ITX A;  3GPP A;  3JAM S;  4DR5 M;  2Y20 A;  3SHG B;  4B7G A;  3TWM A;  4DR7 M;  2Y2K A;  2DZO B;  4B7H A;  5C18 A;  1HT1 E;  1N36 M;  3B9P A;  3GPX A;  4GIP A;  3AOE C;  2A5Y B;  3JR5 A;  1N75 A;  3SAW A;  2XFT A;  3HJS A;  1H6U A;  1JR3 D;  3KVW A;  2X4A A;  4B3M M;  3FUU A;  2UUA M;  2H1R A;  3GP1 A;  1Z6T A;  3HHW A;  3A46 A;  3KXE C;  4OJ6 A;  4GIT A;  4NXM M;  4R3D A;  2Y2J A;  3U60 A;  3HWS A;  2G5G X;  2E5L M;  1Z5A A;  4CHT B;  4X65 M;  4D82 A;  4LJ6 A;  1QAO A;  4M9S A;  5EP3 A;  4JYA M;  1YU1 A;  2D7E A;  4OU7 A;  2UWX A;  3GO8 A;  2EA0 A;  2Z4S A;  1HT2 E;  4K0K M;  4X62 M;  4FCT A;  2CEA A;  1E9S A;  3HHY A;  3U6C A;  4LF7 M;  3AFH A;  3EIH A;  3KP1 E;  3FTD A;  1TH4 A;  4XBO A;  2F5N A;  4FWD A;  2UUB M;  3HU3 A;  4NYY A;  5EXX A;  5EQT A;  1DO0 A;  3KFU G;  2Y2L A;  3SMS A;  2L7I A;  3FD9 A;  2Z3X A;  1NNJ A;  2DWM A;  4AKI A;  2R62 A;  1S3S A;  5FSW A;  1ZQ9 A;  2C5R A;  3J7A S;  2EUC A;  5ITY A;  2LXE A;  2C9C A;  5EXP A;  4IBI A;  2QZ4 A;  5FTJ A;  2W82 A;  3BOS A;  2L7H A;  4DR2 M;  5FTL A;  2HHH M;  2NQ8 C;  5IWA M;  2DZN B;  2UU9 M;  4MH0 E;  2Y2N A;  4JI7 M;  4GKK M;  4RF1 A;  2XZF A;  2R45 A;  4CIS A;  4PT5 A;  1XXH B;  2FOI C;  5E26 A;  1NY6 A;  1TDZ A;  4D81 A;  1GL6 A;  3GLH A;  2FNA A;  4ITQ A;  4LF9 M;  3TWL A;  1NY5 A;  2UUC M;  3SAR A;  3HHX A;  4TUW A;  3LVV A;  2R18 A;  4BB9 A;  2UXC M;  4NRW A;  2L09 A;  4AI6 A;  1QZM A;  2EO2 A;  3ZCB B;  1N78 A;  2JA2 A;  3SAU A;  3GLI B;  4JI4 M;  5IZ7 D;  2ZAO A;  4AG6 A;  1W5T A;  1W5S A;  8CAT A;  2FE8 A;  3VK7 A;  4DV6 M;  3H4M A;  1G8P A;  4LJ9 A;  4CGY B;  3U61 B;  4LF6 M;  4OX9 M;  3VKH A;  3FUV A;  2CHG A;  3UGJ A;  1SXJ B;  2XSZ A;  4B3S M;  3KOW E;  2Y0T A;  2QP9 X;  1UM8 A;  1XNQ M;  2Z4R A;  2ZAN A;  4AKG A;  1Z5C A;  4II7 A;  4MB7 A;  5JI3 E;  3GRV A;  3I4Y A;  2F5O A;  3QAU A;  4G6Z A;  5EJC A;  3RFW A;  3PVS A;  1K3W A;  1TDH A;  1YSY A;  4DR1 M;  2ZM6 M;  3W0L B;  4X64 M;  2XFS A;  4PD2 A;  2XZU A;  1JQJ C;  1G4A E;  4REZ A;  2YR0 A;  2XF3 A;  4G4N A;  4IBC A;  2J7O A;  3U6D A;  3U60 B;  3SAV A;  3NWL A;  4QOS A;  3UK6 A;  5KPT A;  2Y2Q A;  2F5S A;  4LCB A;  1G41 A;  1IY0 A;  4JI5 M;  2AHM A;  4OVZ A;  3L29 A;  1PJJ A;  1GKI A;  4AQY M;  1IY1 A;  5FTK A;  1Q3B A;  2BNK A;  1L2C A;  3FTE A;  1ORY B;  3L26 A;  5ITQ A;  4DV1 M;  3HON A;  1IY2 A;  3SHF A;  4FW9 A;  4NOO B;  2BJV A;  1JR3 A;  4MGY E;  3U6S A;  1QYR A;  1K82 A;  2FFF B;  4YY3 M;  2R46 A;  4LJ8 A;  4ZPX A;  2C98 A;  3PFI A;  4OJP A;  2XH9 A;  3M0E A;  4LZJ A;  3U6L A;  2ERC A;  3FKE A;  3KP0 E;  1XNR M;  5LMN M;  4KOD A;  2C96 A;  2LWX A;  1R2Y A;  4LGY A;  3WHL A;  5LMU M;  3AJI B;  1HR0 M;  3C58 A;  2JCH A;  4JI6 M;  1J5E M;  4JXJ A;  1IN5 A;  1X37 A;  3VK8 A;  4AG5 A;  4LFB M;  2KW0 A;  4KHP M;  3GLH B;  2KZS A;  1HNW M;  3U6Q A;  4LRT A;  1HNX M;  3HU1 A;  1J09 A;  1DGH A;  2Q2E B;  4IBB A;  2XD1 A;  3TWK A;  4L4U A;  2M60 A;  1IN7 A;  1YUE A;  1R6B X;  4QNR A;  3SAS A;  1HNZ M;  1Q3C A;  5A2Q S;  4NSO B;  3T38 A;  3E4R A;  1L1Z A;  3FUX A;  2L6O A;  3MHV C;  4KO8 A;  4G4Q A;  1KFV A;  5FTM A;  3GRY A;  3UZU A;  4B3T M;  1IBK M;  5KQ8 A;  4FWG A;  4M9X A;  4JI2 M;  4MGH A;  1OFI A;  1N33 M;  4NZ1 A;  3SAT A;  1E32 A;  3D8L A;  1QAQ A;  3TQS A;  1NHW C;  1I94 M;  1TH3 A;  3VDU A;  1EE8 A;  3QWL A;  3KOZ E;  1L2D A;  4G4O A;  2DVW B;  3W0F A;  2JE5 A;  3L25 A;  3GRU A;  1OFH A;  5IRE B;  1QVR A;  3RE8 A;  3RGS A;  1IBL M;  4JI1 M;  4GC5 A;  3GPY A;  3OTO M;  4JI8 M;  3FUW A;  3DOA A;  3T15 A;  4NZ5 A;  1C1K A;  1QQW A;  4OVZ B;  2KEB A;  2VQF M;  1T3T A;  1E9R A;  5EP4 A;  2Y2M A;  5KQD A;  3RGP A;  1ZAE A;  1PJI A;  1YU4 A;  3MJ5 A;  4X66 M;  3J81 S;  3HKP A;  3GPU A;  4NL4 H;  1L8Q A;  5KPR A;  2HL7 A;  4RF0 A;  5IT9 S;  2XD5 A;  1LV7 A;  1WXQ A;  2CE7 A;  2RGO A;  5ITT A;  4LJ5 A;  3KOX E;  4L8R C;  3DFZ A;  2HKJ A;  4GMQ A;  3SMP A;  2LH0 A;  3JR4 A;  4G4R A;  1YU0 A;  2QBY A;  4GRI A;  1XMQ M;  4LF8 M;  3LVW A;  4PCZ A;  5H37 D;  2YFQ A;  3GLG A;  2YQZ A;  3IG5 A;  1FJG M;  3AL0 C;  4OW0 A;  2Y21 A;  2DWZ B;  1IN8 A;  3GQ5 A;  5DNY A;  1DGH B;  4JI0 M;  3E9S A;  2DHR A;  3HHZ A;  1N32 M;  2V6Z M;  3I4V A;  3N3F A;  4B7F A;  1N34 M;  3J27 B;  4P16 A;  3VLF B;  3SBJ A;  2DXI A;  1R2Z A;  2ZAM A;  2DWL A;  2F5Q A;  4DV4 M;  2KA6 B;  1Z5B A;  2CUZ A;  1E94 E;  3CF0 A;  2VII A;  3IG8 A;  3T1Y M;  1XHB A;  3WHK A;  4AKH A;  4WUR A;  4NYU A;  4NXN M;  3K92 A;  4NZ4 A;  2K47 A;  4DV2 M;  5GKN A;  4I8O A;  2I7P A;  4L16 A;  5EXS A;  3KDS E;  3M7G A;  3SC3 A;  4LG2 A;  4FVM A;  3UMM A;  4LGM A;  2I7N A;  3FYD A;  4LF5 M;  3CTW B;  1YUB A;  3AOE A;  2D7H A;  3U6O A;  4I81 A;  3WX7 A;  2C99 A;  4MM3 B;  1QAM A;  4Z8X A;  3PXG A;  4DUZ M;  4PDG A;  2OQ4 A;  4IBD A;  3GQ3 A;  5KPZ A;  2V1U A;  5BPV A;  2QCU A;  1NVM A;  4IIW A;  3K8Z A;  4LRS A;  1G3I A;  4QNL A;  5DYI A;  4LJ4 A;  1NJF A;  2Y2H A;  3AV0 A;  3UJN A;  1IN4 A;  2Y2O A;  1OJL A;  5EP2 A;  3J80 S;  4IBJ A;  3FTC A;  1NHG C;  3GLF A;  4I4L A;  3CF6 E;  2RGH A;  2C9O A;  2CV0 A;  4IBF A;  3U5Z A;  4DR3 M;  4DR4 M;  2BJW A;  2ZBK B;  1N77 A;  3J7B A;  3U6E A;  2Z7J A;  3HJQ A;  1PM5 A;  1K3X A;  3I51 A;  4D80 A;  3GQ4 A;  4LFC M;  4IJE A;  1IXS B;  3SYK A;  1NSF A;  1SXJ C;  3KS8 A;  4XGI A;  5FTN A;  2RKO A;  2CV1 A;  2XEP A;  4RNA A;  1IBM M;  4Z6Y A;  3LQR A;  4R7G A;  4PDI A;  2QBY B;  2FFJ A;  1KYI A;  3K1J A;  2KRU A;  4IJF A;  3L27 A;  3SFZ A;  1SXJ D;  5FLX S;  3GLG B;  4QHT A;  4FD2 A;  4I5S A;  3FTF A;  3TE6 A;  4M9Z A;  3L2A A;  3AKZ A;  3TPZ A;  1YE9 A;  3KOY E;  2KRK A;  1DGG A;  5DYG A;  3KW6 A;  1IN6 A;  3TL4 X;  5ITR A;  2R4E A;  1DGB A;  4IBK A;  4OJO A;  2XLJ A;  4DUY M;  3Q8X A;  3SYL A;  1IXR C;  4GHL A;  4NZ3 A;  2Y0Q A;  3M6A A;  1HQY E;  3MK6 A;  2P5T A;  3AOG A;  4YHH M;  3VDP A;  3HJ8 A;  4MGK E;  3PNY A;  2CHV A;  3T1H M;  4B08 A;  2X49 A;  3LMM A;  3VFD A;  1VDD A;  4LFA M;  4GKJ M;  1L2B A;  2CFO A;  2UXB M;  3GRR A;  4MGZ E;  3ZH9 B;  2BG1 A;  1J7K A;  1R7R A;  5EXT A;  2Y2P A;  4LJA A;  4FCV A;  5BR8 M;  3U6P A;  1GL7 A;  3A42 A;  4FCW A;  4DV3 M;  4L78 A;  4HL4 A;  4BBA A;  3LQQ A;  4FWH A;  2KZU A;  1IM2 A;  1NJG A;  1YU3 A;  4AZF A;  2D7G A;  1I4W A;  1TH2 A;  3DA1 A;  4MGI E;  4GH9 A;  2Y2G A;  3J2P B;  4QHS A;  3A45 A;  2CV2 A;  1G59 A;  1GLN A;  4QNM A;  5KO3 A;  2R4J A;  3KSX A;  4JI3 M;  2IOU A;  4LF4 M;  4DV7 M;  3ZC7 B;  5EP1 A;  2UXD M;  4HLQ A;  4DV5 M;  4KLN A;  3VKG A;  1XMO M;  4LY6 A;  4NY2 A;  3KS4 A;  2LNH C;  3GLF B;  4AW4 A;  4BLC A;  2KXE A;  4JV5 M;  2Y2I A;  1MX0 A;  3R8F A;  4GHA A;  3U5Z B;  3HGI A;  7CAT A;  5JI2 E;  3KSJ A;  2F4V M;  3FYC A;  1NNU C;  4WW0 A;  1IXZ A;  1D2N A;  4LZZ A;  2CHQ A;  3ILK A;  4QOZ C;  2F5P A;  3HU2 A;  2HCB A;  4M0D A;  1XC8 A;  3D8B A;  4NSR A;  4B3R M;  1GVN A;  4OUI A;  3K2L A;  1XWI A;  3A98 B;  1MU5 A;  1XXH A;  3DZD A;  3EIE A;  4W5W A;  1YU2 A;  1KSF X;  3U6M A;  2XSZ D;  4NRV A;  1Z59 A;  3L28 A;  1L1T A;  1HQC A;  2R65 A;  4OJ5 A;  3HSH A;  2XGN A;  1TGU A;  3NBI A;  5F3W A;  4A3V B;  2M5Z A;  3CF2 A;  1FNN A;  2G8L A;  2YNM D;  2DWN A;  1IQP A;  4LJ7 A;  1Q39 A;  2OPF A;  3R9X B;  1SXJ E;  2QPA A;  3GLI A;  1DO2 A;  4IBE A;  3PNV A;  4M0W A;  5C1B A;  5ITX E;  2VQE M;  4DV0 M;  4OJL A;  2V1C A;  5ITU A;  3U61 A;  4DR6 M;  1DGF A;  3FUT A;  1QAN A;  4L15 A;  4GC9 A;  4IBG A;  3THG A;  1SXJ A;  5E6J A;  2QEN A;  2O5R A;  4EIW A;  2J7N A;  2X8A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...