4IBKA

Ebola virus vp35 bound to small molecule
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
123
structure length
123
Chain Sequence
b'DISAKDLRNIMYDHLPGFGTAFHQLVQVICKLGKDSNSLDIIHAEFQASLAEGDSPQCALIQITKRVPIFQDAAPPVIHIRSRGDIPRACQKSLRPVPPSPKIDRGWVCVFQLQDGKTLGLKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Polymerase cofactor VP35
molecule tags Transcription/transcription inhibitor
source organism Ebola virus
publication title In Silico Derived Small Molecules Bind the Filovirus VP35 Protein and Inhibit Its Polymerase Cofactor Activity.
pubmed doi rcsb
total genus 43
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-12-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.950 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4ibkA01
2.10.10.70 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 4ibkA02
3KS8A 4IBFA 4GH9A 4GHLA 3L2AA 4IBCA 3KS4A 3L28A 3L26A 4IBEA 3FKEA 4IBJA 3L29A 4GHAA 3L25A 4IJFA 4IBGA 4LG2A 4IBBA 4IBIA 5BPVA 3L27A 4IJEA 4IBDA 4IBKA
chains in the Genus database with same CATH superfamily
4B7HA 5H37D 3KS8A 3FUVA 3R9XB 4LFCM 2WSFF 2Y2JA 3KOZE 3M7GA 4LJ7A 3DZDA 4KHPM 2ZTDA 3WHKA 2I7PA 2XSZD 4RF0A 1I4WA 2XGNA 2R46A 2OOAA 2O5RA 3E9SA 3IG8A 5JI2E 3J80S 3L26A 5EP3A 4IBEA 1NJGA 3U6EA 5EXSA 2J7OA 1CUKA 2R6FA 3AOEC 3N3FA 3SAWA 1QDTA 4Y28F 5FTLA 5F3WA 2LVOC 3BBZA 3KSJA 3AL0C 3M0EA 2LNHC 3SHFA 3AV0A 1H8PA 2JZ1A 2JCHA 1UM8A 2JY5A 2LHGA 3L2AA 4RF1A 1XB2B 2Z8YM 4MB3A 3GLHB 1XNRM 3UZUA 1E6RA 3FUXA 5EXPA 4JI6M 2L6OA 1DGHA 4B3MM 4Z2IA 1SXJB 2D7EA 3NBIA 4IBCA 3GQ3A 2Y2MA 1D0MA 3BXWA 2A5YB 1IXSA 4ITQA 3ILKA 5LMUM 4DR4M 4LF7M 1KS0A 2JWSA 2KEBA 3LVVA 3A45A 5E26A 2UXDM 4NYYA 4MH0E 1LV7A 4IBGA 4MGZE 2F5QA 4JI2M 1W1TA 3WD3A 3HU1A 1KFVA 4LF8M 1Q3BA 1L1ZA 2QQ8A 5BPVA 4JI7M 3E46A 1QZEA 4DBGB 5C18A 2UUAM 1VEKA 2R4JA 3GPUA 1RU3A 1IBMM 4KT0F 4K0KM 4JYAM 2ZAOA 4IBFA 2Y2KA 3RE8A 4GITA 5E6JA 2JZ0A 2DAMA 3D8LA 5DYIA 4D81A 4X64M 4QNMA 2DVWB 2J7NA 1QVRA 4YHHM 1HQYE 4G4OA 2DAKA 3FRIA 3J7AS 5L8RF 1H0IA 2VF8A 2Y2PA 4JN6A 1J09A 2ZTCA 4BBAA 1E6NA 1JQJC 3R8FA 1MX0A 3FTCA 2HCBA 3B74A 3K8ZA 4LJAA 4DV5M 2C5RA 4JI4M 1HNWM 1XNQM 4JXJA 4QHSA 4R7GA 3U6PA 3EIEA 4FWHA 1L8QA 1G4AE 1QDRA 2Y2NA 4NZ4A 3GLFA 2D7HA 4JI0M 1WXQA 3T1HM 3W67A 2M60A 2EJSA 1IM2A 1GABA 4IBIA 3U6CA 4KO8A 3NWLA 5C1BA 3FTDA 1EE8A 1XXHB 5KQDA 3B7QA 4B7FA 2LTUA 2FH0A 4LY6A 5FTNA 4OVZB 3TPZA 1GXDA 3SFZA 3M7PA 3HZJA 4Z8XA 5DYGA 5BR8M 2XD5A 1DO2A 4OW0A 1T43A 2DENA 5GKNA 2G3QA 1WIVA 3UJNA 4HL4A 2KZUA 1NHWC 1C1KA 1AUAA 1OAIA 1IY2A 3J27B 4DR5M 1K3WA 2QNJA 1OKSA 2Z4RA 3HHYA 4G3OA 4JV5M 3ZQJA 1NV9A 1NHGC 2JA2A 2XFTA 4HEOA 4OJ5A 2BWBA 4KODA 4MB4A 4OJ6A 4Z2GA 1E88A 3SYLA 2CHVA 4AG5A 2XEPA 2BG1A 3K92A 1PDCA 5EXTA 1ZAEA 3Q8GA 2LWXA 2DWMA 2KW0A 2LXEA 4UN2B 4DV7M 3U6OA 3GP1A 1L6JA 1G3IA 1YU4A 1K82A 1OFIA 1QAQA 3C58A 4LF9M 4Q7JA 1E9RA 3H4MA 4B3SM 3VKHA 4B7GA 4LJ8A 4EIWA 4A3VB 1JR3D 3QWLA 4AG6A 3E21A 4TUWA 4LFAM 4HMCA 3HHXA 5IWAM 2E5LM 3K1JA 1HR0M 2WSCF 1DO0A 1TGUA 3H4JA 4GC9A 1N33M 3WD4A 1A5TA 1E9SA 4IBJA 1IY0A 8CATA 4GHAA 4BB9A 3W0FA 2QP9X 1GO5A 1IFYA 3AJIB 4PDIA 1E32A 1NSFA 5A2QS 4LG2A 1VDLA 3EIHA 3T38A 3HGIA 3LCUA 3FTFA 1NY6A 1Z6TA 1W1PA 3RFWA 1BVSA 2YR0A 3HONA 5ITXE 4GMQA 1G71A 4WP2A 3I01M 1VEJA 3RGSA 3MK6A 1OJLA 4IBKA 4MGIE 3GPYA 3LCVB 4OJOA 1QAMA 2QBYA 1OIPA 1CK7A 2MJ5B 3MMPA 4CHTB 4LRTA 4AKGA 4DR1M 3GRUA 1W1YA 2O25A 1XWIA 2APLA 4GEWA 1XHBA 2R0IA 1Z5AA 2L2DA 3GLFB 4L6V6 1FJGM 1G41A 3FUTA 1KYIA 3RGPA 2C96A 2FFJA 2BJVA 3GLHA 2R18A 2KRUA 3L25A 1KSFX 4R3DA 3JR5A 3CGWA 1YUEA 4M0DA 1GPFA 4MB7A 3UK6A 2UWXA 4GKJM 3GLIE 1GVNA 2ZAMA 4KLNA 4LZJA 3TWMA 1L2DA 4B3TM 4AW4A 1D2NA 3PFIA 3FRHA 2CV0A 3F92A 4P17A 3NBXX 4FCVA 1HT1E 4REZA 4GKKM 4Z2KA 5ITXA 1TH2A 2L7IA 2XH9A 1MN3A 3A46A 2OQ4A 4XK8F 2JY8A 1AIPC 3SASA 4QOSA 3FD9A 4NZ3A 2YFQA 4FD2A 2X8AA 3SATA 2Y2HA 1T6OA 1G8PA 3HKPA 2ZM6M 1WHCA 1GL6A 1I94M 2CRUA 3ZC7B 2VQFM 3KXEC 2QHOB 1PJSA 1T3TA 3Q8XA 3W0LB 2N35A 1IQPA 1R6BX 3QYBA 4L16A 3SHGB 3OTOM 1N78A 4F2LA 2RRUA 1SXJD 1X37A 2CE7A 1QYRA 4PT5A 2JE5A 3KVWA 3L27A 1L1TA 2R4EA 2CV2A 2WSEF 5DNYA 1IBKM 4JI3M 1P3QQ 3CF6E 3PVSA 1PJQA 3TQSA 4ANRA 3B7ZA 2VF7A 3LMMA 1J7KA 3SAUA 4MB5A 3TL4X 1Z59A 1JR3E 3U6DA 3SC3A 1SXJC 1ZMUA 1QUTA 4FCWA 1GJSA 1DGGA 1OFHA 3I04M 4FWGA 4G4QA 3QYEA 1IN5A 3IG5A 4GRIA 5ITRA 2CUZA 2L7HA 3KFUG 5FTKA 3FTEA 3U61B 1W5SA 2R45A 5EP2A 4L78A 3VDUA 4GC5A 2KNAA 1IN8A 4MGYE 1UR9A 2LVAA 4M9XA 3T1YM 3U6LA 1GJTA 2DNAA 2M5ZA 2Z3XA 2I7NA 4L8RC 2LVPC 1QAOA 4IBBA 3V76A 3VK7A 1XMOM 4CISA 1IN7A 1NV8A 2RGOA 2YQZA 3FUUA 2D49A 2BWEA 2GQFA 2MH8A 3E4RA 3U60B 2CP8A 2JY6B 1IXZA 4DV1M 2C99A 2FFFB 5EXXA 4Z2HA 1GKIA 2ZBKB 2Y2IA 2Z7JA 4BLCA 2WZJA 3AKZA 2W82A 3GPPA 4DR6M 2K9DA 1IXRC 3U6MA 2QCUA 4DR7M 1EAKA 5EJCA 3HWSA 1EFUB 4OVZA 3HY5A 1L2BA 3K2LA 1E6PA 4OJPA 1C7YA 3BOSA 1WGLA 1S3SA 2VDBB 1NJFA 3GLGB 4NY2A 3LQQA 5JI3E 2Y2QA 1N77A 2MROB 3K9PA 1H6UA 1IXSB 3KOYE 4FW9A 1EIJA 3HSHA 4PD2A 2EKFA 1V92A 3K9OA 1YU0A 1TTEA 1SXJE 5EQTA 1GL7A 2OOBA 1OAOC 3WD1A 1Y8GA 2UUCM 2DWNA 2JY7A 4LJ6A 1OGGA 3GQ4A 1YU3A 1AIWA 4X65M 7CATA 1Z5CA 3HX3A 2HWJA 3AOGA 3FYCA 4JI8M 4LFBM 4GH9A 4NYUA 4D80A 4QNRA 3GO8A 4XBOA 1QO6A 3J81S 4LRSA 4G4RA 4NRWA 1YLAA 3C9PA 2YNMD 3IECA 1YSYA 3VDPA 4Z2LA 4HMEA 1DV0A 2XD1A 4R71A 1Q39A 1PJTA 3HU3A 5IZ7D 2G5GX 1IN4A 2H1RA 2DAIA 3CF0A 2K6BA 3CTWB 2DAGA 4B08A 1R2ZA 1E15A 3JAMS 2F5NA 1MJGM 4LF5M 4LJ9A 2Q2EB 5ITUA 1UR8A 2KXEA 1E94E 4RNAA 2JXNA 3UGJA 4G4NA 2MR9A 1QANA 2Y20A 2DHRA 2K47A 3AOEA 1TDZA 5EP4A 1XXHA 4L15A 3QAUA 5KPTA 1F4IA 2F5SA 1NY5A 2KDLA 1J7MA 3MQLA 4CJ6A 4WW0A 1HNZM 2C98A 2V1UA 5ITQA 3KW6A 4NOOB 3SMSA 1ZQ9A 5KPRA 3GLHE 2F4VM 1SG9A 4FVMA 2Y0QA 2Y0TA 2R62A 4II7A 1NO1A 1ZMWA 2C9OA 4DUZM 4XGIA 3W68A 4G6ZA 3GQ5A 2XF3A 1VEGA 3KDSE 3PNVA 2DZNB 2QSFX 4I8OA 3VK8A 3FE3A 4RKUF 1TR8A 4CIZA 1GOIA 1IN6A 4DUYM 2Y2LA 4LJ5A 1V33A 2G8LA 3GRRA 4MGHA 4OJLA 4AKHA 1V34A 2XSZA 4IJEA 1QUSA 2F5OA 4B3RM 2RGHA 2V1CA 4AQYM 1YU1A 2UXCM 2LH0A 5ITYA 3I4VA 5FLXS 1XC8A 4DR3M 4Z2JA 2FNAA 2RKOA 3JR4A 1LTMA 1OTRA 4LZZA 2UU9M 1OIZA 2KHHA 1D0KA 3FUWA 4DV3M 3SAVA 2DXIA 2L4FA 3GRVA 3SBJA 2XZFA 2HHHM 3J2PB 4YY3M 2JNHA 4LF6M 1W1VA 2GNOA 4WURA 3GLGE 5FTMA 1UFZA 3C3DA 3FKEA 4FWDA 2IOUA 2HAKA 1IY1A 2Z4SA 2XLJA 3HHWA 5KQ8A 3DFZA 1WGNA 5IREB 1JR3A 3GLGA 1K3XA 5FTJA 5ITTA 1HQCA 1DGHB 3DOAA 4D82A 3HHZA 3SARA 1WJ7A 1G59A 2LHCA 1HJPA 4NC6A 2NQ8C 1PJJA 1IBLM 5DFLA 1SXJA 2HL7A 4DV6M 2CV1A 1TH4A 4LF4M 1R7RA 2DKLA 2ERCA 1XMQM 2L09A 4X62M 5EP1A 3KP0E 4I81A 2KNZA 2OO9A 4FCTA 3LVWA 2CHQA 1ORYB 4NRVA 3L28A 1QZMA 4X66M 3WD2A 3U6SA 4W5WA 3I51A 2FOIC 3KP1E 4PDGA 1L2CA 2J5YA 3U60A 4AI6A 4HMDA 1PRBA 3T15A 1E8BA 1VG5A 2FE8A 1PGYA 2DI0A 2O01F 5FSWA 1D0LA 1FNNA 2KNVA 3C3EA 4CGYB 2AHMA 2K0BX 4S12A 2X4AA 2DWLA 2CEAA 4IBDA 3AFHA 1NNUC 1J5EM 4GIPA 1Z5BA 1GLNA 1PJIA 2R65A 1HNXM 1VDDA 3HJ8A 3FYDA 4GHLA 2UXBM 3UMMA 1R2YA 4AKIA 2RTSA 3WD0A 3U5ZB 3A98B 3HU2A 4JI5M 3GRYA 3HJQA 3WHLA 3T6PA 3KOWE 2DZOB 2EUCA 3GLIA 2UUBM 3HJSA 1ZV1A 3B7NA 1DGBA 1W5TA 2LVNC 3DA1A 2B3TA 2FS1A 2P5TA 2DWZB 1NVMA 2H5XA 2CFOA 2V6ZM 4LCBA 4JI1M 3L29A 2V5OA 2Y2OA 1YU2A 2JP7A 4OU7A 4IJFA 1OGBA 2HKJA 3J7BA 2BNKA 4PCZA 3VKGA 1HT2E 4IIWA 2X49A 3TWLA 3TE6A 1R5LA 1PM5A 4NZ5A 2VIIA 4DV0M 4NSRA 3THGA 2F5PA 4QOZC 3A42A 4MM3B 3I4YA 3TWKA 2R44A 4M9ZA 2C9CA 3PNYA 1E6ZA 2CWBA 3U5ZA 2KZSA 2DZLA 3GLIB 4QNLA 1WR1B 4NXMM 5KPZA 1N36M 4LGMA 2KA6B 2QENA 3KS4A 1H0GA 1O6IA 4I5SA 1YE9A 2EA0A 4TX8A 2XFSA 3VLFB 3ZH9B 2D7GA 4MGKE 4ZPXA 4OUIA 1N34M 4OX9M 1XXHE 2QBYB 3MHVC 3U61A 3LW5F 2DHYA 2Y2GA 5IT9S 4NL4H 3SMPA 4F1IA 3CF2A 4NSOB 1ED7A 2OPFA 3U6QA 4HLQA 3B9PA 4NXNM 4DR2M 4I4LA 1TH3A 3B89A 4AZFA 5KO3A 2L4EA 1CXWA 4QHTA 2EKKA 2BJWA 2MGWA 1QQWA 1Q02A 4DV4M 5LMNM 4Z6YA 3GPXA 3MJ5A 1DGFA 1VQ1A 1OQYA 3KOXE 3VFDA 3SYKA 1TDHA 3KSXA 3ZCBB 2QPAA 3M6AA 1N32M 3WX7A 3LQRA 2LBCA 2EO2A 1YUBA 1NNJA 1N75A 4M0WA 1JB0F 3IHPA 4LGYA 1TF0B 2ZANA 3D8BA 4NZ1A 2DAEA 1Q3CA 2KRKA 4LJ4A 2CHGA 3GLFE 4M9SA 4P16A 2XZUA 2Y21A 2FN2A 4DV2M 2QZ4A 1MU5A 1ZMVA 4L4UA 2VQEM 2JUJA 1R4GA 2LVQD 3PXGA
chains in the Genus database with same CATH topology
4B7HA 5H37D 3KS8A 3FUVA 3R9XB 4LFCM 2Y2JA 3KOZE 3M7GA 4LJ7A 3DZDA 4KHPM 3WHKA 2I7PA 2XSZD 4RF0A 1I4WA 2XGNA 2R46A 3E9SA 2O5RA 3IG8A 5JI2E 3J80S 3L26A 5EP3A 4IBEA 1NJGA 3U6EA 5EXSA 2J7OA 3AOEC 3N3FA 3SAWA 5FTLA 3AL0C 5F3WA 3KSJA 3M0EA 2LNHC 3SHFA 3AV0A 2JCHA 1UM8A 3L2AA 4RF1A 3GLHB 1XNRM 3UZUA 3FUXA 5EXPA 4JI6M 2L6OA 1DGHA 4B3MM 1SXJB 2D7EA 3NBIA 4IBCA 3GQ3A 2Y2MA 2A5YB 4ITQA 3ILKA 5LMUM 4DR4M 4LF7M 2KEBA 3LVVA 5E26A 3A45A 2UXDM 4NYYA 4MH0E 1LV7A 4IBGA 4MGZE 2F5QA 4JI2M 3HU1A 1KFVA 4LF8M 1Q3BA 1L1ZA 5BPVA 4JI7M 5C18A 2UUAM 2R4JA 3GPUA 1IBMM 4JYAM 4K0KM 2ZAOA 4IBFA 2Y2KA 3RE8A 4GITA 5E6JA 3D8LA 5DYIA 4D81A 4X64M 4QNMA 2DVWB 2J7NA 1QVRA 4YHHM 1HQYE 4G4OA 3J7AS 2Y2PA 4JN6A 1J09A 4BBAA 1JQJC 3R8FA 1MX0A 3FTCA 2HCBA 4LJAA 3K8ZA 4DV5M 2C5RA 4JI4M 1HNWM 1XNQM 4JXJA 4QHSA 4R7GA 3U6PA 3EIEA 4FWHA 1L8QA 1G4AE 2Y2NA 4NZ4A 3GLFA 2D7HA 4JI0M 1WXQA 3T1HM 2M60A 1IM2A 4IBIA 3U6CA 4KO8A 3NWLA 5C1BA 3FTDA 1EE8A 1XXHB 5KQDA 4B7FA 4LY6A 5FTNA 4OVZB 3TPZA 3SFZA 4Z8XA 5DYGA 5BR8M 2XD5A 1DO2A 4OW0A 5GKNA 3UJNA 4HL4A 2KZUA 1NHWC 1C1KA 1IY2A 3J27B 4DR5M 1K3WA 2Z4RA 3HHYA 4JV5M 1NHGC 2JA2A 2XFTA 4OJ5A 4OJ6A 4KODA 3SYLA 2CHVA 4AG5A 2XEPA 2BG1A 3K92A 5EXTA 1ZAEA 2LWXA 2DWMA 2KW0A 2LXEA 4DV7M 3U6OA 3GP1A 1G3IA 1YU4A 1K82A 1OFIA 1QAQA 3C58A 4LF9M 1E9RA 3H4MA 4B3SM 3VKHA 4B7GA 4LJ8A 4EIWA 4A3VB 1JR3D 3QWLA 4AG6A 4TUWA 4LFAM 3HHXA 5IWAM 2E5LM 3K1JA 1HR0M 1DO0A 1TGUA 4GC9A 1N33M 1E9SA 4IBJA 1IY0A 8CATA 4GHAA 4BB9A 3W0FA 2QP9X 3AJIB 4PDIA 1E32A 1NSFA 5A2QS 4LG2A 3FTFA 3EIHA 3T38A 3HGIA 1NY6A 1Z6TA 3RFWA 2YR0A 3HONA 5ITXE 4GMQA 3RGSA 3MK6A 1OJLA 4IBKA 4MGIE 3GPYA 4OJOA 1QAMA 2QBYA 4CHTB 4LRTA 4AKGA 4DR1M 3GRUA 1XWIA 1XHBA 1Z5AA 3GLFB 1FJGM 1G41A 3FUTA 1KYIA 3RGPA 2C96A 2FFJA 2BJVA 3GLHA 2KRUA 2R18A 3L25A 1KSFX 4R3DA 3JR5A 1YUEA 4M0DA 4MB7A 3UK6A 2UWXA 4GKJM 1GVNA 2ZAMA 4KLNA 4LZJA 3TWMA 1L2DA 4B3TM 4AW4A 1D2NA 3PFIA 2CV0A 4REZA 4FCVA 4GKKM 1HT1E 5ITXA 1TH2A 2L7IA 2XH9A 3A46A 2OQ4A 3SASA 4QOSA 3FD9A 4NZ3A 2YFQA 4FD2A 2X8AA 3SATA 2Y2HA 1G8PA 3HKPA 2ZM6M 1GL6A 1I94M 3ZC7B 2VQFM 3KXEC 1T3TA 3Q8XA 3W0LB 1IQPA 1R6BX 4L16A 3OTOM 3SHGB 1N78A 1SXJD 1X37A 2CE7A 1QYRA 4PT5A 2JE5A 3KVWA 3L27A 1L1TA 2R4EA 2CV2A 5DNYA 1IBKM 4JI3M 3CF6E 3PVSA 3TQSA 3LMMA 1J7KA 3SAUA 3TL4X 1Z59A 3U6DA 3SC3A 1SXJC 4FCWA 1DGGA 1OFHA 4FWGA 4G4QA 1IN5A 3IG5A 4GRIA 5ITRA 2CUZA 2L7HA 3KFUG 5FTKA 3FTEA 3U61B 1W5SA 2R45A 5EP2A 4L78A 3VDUA 4GC5A 1IN8A 4MGYE 4M9XA 3T1YM 3U6LA 2M5ZA 2Z3XA 2I7NA 4L8RC 1QAOA 4IBBA 3VK7A 1XMOM 4CISA 1IN7A 2RGOA 2YQZA 3FUUA 3E4RA 3U60B 1IXZA 4DV1M 2C99A 2FFFB 5EXXA 1GKIA 2ZBKB 2Y2IA 2Z7JA 4BLCA 3AKZA 2W82A 3GPPA 4DR6M 3U6MA 1IXRC 4DR7M 2QCUA 5EJCA 3HWSA 4OVZA 1L2BA 4OJPA 3K2LA 3BOSA 1S3SA 1NJFA 3GLGB 4NY2A 3LQQA 5JI3E 2Y2QA 1N77A 3KOYE 1H6UA 1IXSB 4FW9A 3HSHA 4PD2A 1YU0A 1SXJE 5EQTA 1GL7A 2UUCM 2DWNA 4LJ6A 3GQ4A 1YU3A 4X65M 7CATA 1Z5CA 3AOGA 3FYCA 4JI8M 4LFBM 4GH9A 4NYUA 4D80A 4QNRA 3GO8A 4XBOA 3J81S 4LRSA 4G4RA 4NRWA 2YNMD 1YSYA 3VDPA 2XD1A 1Q39A 3HU3A 5IZ7D 2G5GX 1IN4A 2H1RA 3CF0A 3CTWB 4B08A 1R2ZA 3JAMS 2F5NA 4LF5M 4LJ9A 2Q2EB 5ITUA 2KXEA 1E94E 4RNAA 3UGJA 4G4NA 1QANA 2Y20A 2DHRA 2K47A 3AOEA 1TDZA 5EP4A 1XXHA 4L15A 3QAUA 5KPTA 2F5SA 1NY5A 4WW0A 1HNZM 2C98A 2V1UA 5ITQA 3KW6A 4NOOB 3SMSA 1ZQ9A 5KPRA 2F4VM 4FVMA 2Y0QA 2Y0TA 2R62A 4II7A 2C9OA 4DUZM 4XGIA 4G6ZA 3GQ5A 2XF3A 3KDSE 3PNVA 2DZNB 4I8OA 3VK8A 1IN6A 4DUYM 2Y2LA 4LJ5A 2G8LA 3GRRA 4MGHA 4OJLA 4AKHA 2XSZA 4IJEA 2F5OA 4B3RM 2RGHA 2V1CA 4AQYM 1YU1A 2UXCM 2LH0A 5ITYA 3I4VA 5FLXS 1XC8A 4DR3M 2FNAA 2RKOA 3JR4A 4LZZA 2UU9M 2DXIA 3FUWA 4DV3M 3SAVA 3GRVA 3SBJA 2XZFA 2HHHM 3J2PB 4YY3M 4LF6M 4WURA 5FTMA 3FKEA 4FWDA 2IOUA 1IY1A 2Z4SA 2XLJA 3HHWA 5KQ8A 3DFZA 5IREB 1JR3A 3GLGA 1K3XA 5FTJA 5ITTA 1HQCA 1DGHB 3DOAA 4D82A 3HHZA 3SARA 1G59A 1IBLM 1PJJA 2NQ8C 2CV1A 1SXJA 2HL7A 4DV6M 1TH4A 4LF4M 1R7RA 2ERCA 1XMQM 2L09A 4X62M 5EP1A 3KP0E 4I81A 4FCTA 3LVWA 2CHQA 1ORYB 4NRVA 3L28A 1QZMA 4X66M 3U6SA 4W5WA 3I51A 2FOIC 3KP1E 4PDGA 1L2CA 4AI6A 3U60A 3T15A 2FE8A 5FSWA 1FNNA 4CGYB 2AHMA 4S12A 2X4AA 2DWLA 2CEAA 4IBDA 3AFHA 1NNUC 1J5EM 4GIPA 1Z5BA 1GLNA 1PJIA 2R65A 1HNXM 1VDDA 3HJ8A 3FYDA 4GHLA 2UXBM 3UMMA 1R2YA 4AKIA 3U5ZB 3A98B 3HU2A 4JI5M 3GRYA 3HJQA 3WHLA 3KOWE 2DZOB 2EUCA 3GLIA 2UUBM 3HJSA 1DGBA 1W5TA 3DA1A 2P5TA 2DWZB 2V6ZM 1NVMA 2CFOA 4LCBA 4JI1M 3L29A 2Y2OA 1YU2A 4OU7A 4IJFA 2HKJA 3J7BA 2BNKA 4PCZA 3VKGA 1HT2E 4IIWA 2X49A 3TWLA 3TE6A 1PM5A 4NZ5A 2VIIA 4DV0M 4NSRA 3THGA 2F5PA 4QOZC 3A42A 4MM3B 3I4YA 3TWKA 4M9ZA 2C9CA 3PNYA 3U5ZA 2KZSA 3GLIB 4QNLA 4NXMM 5KPZA 1N36M 4LGMA 2KA6B 2QENA 3KS4A 4I5SA 1YE9A 2EA0A 2XFSA 3VLFB 3ZH9B 2D7GA 4MGKE 4ZPXA 4OUIA 1N34M 4OX9M 2QBYB 3MHVC 3U61A 2Y2GA 5IT9S 4NL4H 3SMPA 3CF2A 4NSOB 2OPFA 3U6QA 4HLQA 3B9PA 4NXNM 4DR2M 4I4LA 1TH3A 4AZFA 5KO3A 4QHTA 2BJWA 1QQWA 4DV4M 5LMNM 4Z6YA 3GPXA 3MJ5A 1DGFA 3KOXE 3VFDA 3SYKA 1TDHA 3KSXA 3ZCBB 2QPAA 3M6AA 1N32M 3WX7A 3LQRA 1NNJA 2EO2A 1YUBA 1N75A 4M0WA 4LGYA 2ZANA 3D8BA 4NZ1A 1Q3CA 2KRKA 4LJ4A 2CHGA 4M9SA 4P16A 2XZUA 2Y21A 4DV2M 1MU5A 2QZ4A 4L4UA 2VQEM 3PXGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KS8 A;  4IBF A;  4GH9 A;  4GHL A;  3L2A A;  4IBC A;  3KS4 A;  3L28 A;  3L26 A;  4IBE A;  3FKE A;  4IBJ A;  3L29 A;  4GHA A;  3L25 A;  4IJF A;  4IBG A;  4LG2 A;  4IBB A;  4IBI A;  5BPV A;  3L27 A;  4IJE A;  4IBD A;  4IBK A; 
#chains in the Genus database with same CATH topology
 4B7H A;  5H37 D;  3KS8 A;  3FUV A;  3R9X B;  4LFC M;  2WSF F;  2Y2J A;  3KOZ E;  3M7G A;  4LJ7 A;  3DZD A;  4KHP M;  2ZTD A;  3WHK A;  2I7P A;  2XSZ D;  4RF0 A;  1I4W A;  2XGN A;  2R46 A;  2OOA A;  2O5R A;  3E9S A;  3IG8 A;  5JI2 E;  3J80 S;  3L26 A;  5EP3 A;  4IBE A;  1NJG A;  3U6E A;  5EXS A;  2J7O A;  1CUK A;  2R6F A;  3AOE C;  3N3F A;  3SAW A;  1QDT A;  4Y28 F;  5FTL A;  5F3W A;  2LVO C;  3BBZ A;  3KSJ A;  3AL0 C;  3M0E A;  2LNH C;  3SHF A;  3AV0 A;  1H8P A;  2JZ1 A;  2JCH A;  1UM8 A;  2JY5 A;  2LHG A;  3L2A A;  4RF1 A;  1XB2 B;  2Z8Y M;  4MB3 A;  3GLH B;  1XNR M;  3UZU A;  1E6R A;  3FUX A;  5EXP A;  4JI6 M;  2L6O A;  1DGH A;  4B3M M;  4Z2I A;  1SXJ B;  2D7E A;  3NBI A;  4IBC A;  3GQ3 A;  2Y2M A;  1D0M A;  3BXW A;  2A5Y B;  1IXS A;  4ITQ A;  3ILK A;  5LMU M;  4DR4 M;  4LF7 M;  1KS0 A;  2JWS A;  2KEB A;  3LVV A;  3A45 A;  5E26 A;  2UXD M;  4NYY A;  4MH0 E;  1LV7 A;  4IBG A;  4MGZ E;  2F5Q A;  4JI2 M;  1W1T A;  3WD3 A;  3HU1 A;  1KFV A;  4LF8 M;  1Q3B A;  1L1Z A;  2QQ8 A;  5BPV A;  4JI7 M;  3E46 A;  1QZE A;  4DBG B;  5C18 A;  2UUA M;  1VEK A;  2R4J A;  3GPU A;  1RU3 A;  1IBM M;  4KT0 F;  4K0K M;  4JYA M;  2ZAO A;  4IBF A;  2Y2K A;  3RE8 A;  4GIT A;  5E6J A;  2JZ0 A;  2DAM A;  3D8L A;  5DYI A;  4D81 A;  4X64 M;  4QNM A;  2DVW B;  2J7N A;  1QVR A;  4YHH M;  1HQY E;  4G4O A;  2DAK A;  3FRI A;  3J7A S;  5L8R F;  1H0I A;  2VF8 A;  2Y2P A;  4JN6 A;  1J09 A;  2ZTC A;  4BBA A;  1E6N A;  1JQJ C;  3R8F A;  1MX0 A;  3FTC A;  2HCB A;  3B74 A;  3K8Z A;  4LJA A;  4DV5 M;  2C5R A;  4JI4 M;  1HNW M;  1XNQ M;  4JXJ A;  4QHS A;  4R7G A;  3U6P A;  3EIE A;  4FWH A;  1L8Q A;  1G4A E;  1QDR A;  2Y2N A;  4NZ4 A;  3GLF A;  2D7H A;  4JI0 M;  1WXQ A;  3T1H M;  3W67 A;  2M60 A;  2EJS A;  1IM2 A;  1GAB A;  4IBI A;  3U6C A;  4KO8 A;  3NWL A;  5C1B A;  3FTD A;  1EE8 A;  1XXH B;  5KQD A;  3B7Q A;  4B7F A;  2LTU A;  2FH0 A;  4LY6 A;  5FTN A;  4OVZ B;  3TPZ A;  1GXD A;  3SFZ A;  3M7P A;  3HZJ A;  4Z8X A;  5DYG A;  5BR8 M;  2XD5 A;  1DO2 A;  4OW0 A;  1T43 A;  2DEN A;  5GKN A;  2G3Q A;  1WIV A;  3UJN A;  4HL4 A;  2KZU A;  1NHW C;  1C1K A;  1AUA A;  1OAI A;  1IY2 A;  3J27 B;  4DR5 M;  1K3W A;  2QNJ A;  1OKS A;  2Z4R A;  3HHY A;  4G3O A;  4JV5 M;  3ZQJ A;  1NV9 A;  1NHG C;  2JA2 A;  2XFT A;  4HEO A;  4OJ5 A;  2BWB A;  4KOD A;  4MB4 A;  4OJ6 A;  4Z2G A;  1E88 A;  3SYL A;  2CHV A;  4AG5 A;  2XEP A;  2BG1 A;  3K92 A;  1PDC A;  5EXT A;  1ZAE A;  3Q8G A;  2LWX A;  2DWM A;  2KW0 A;  2LXE A;  4UN2 B;  4DV7 M;  3U6O A;  3GP1 A;  1L6J A;  1G3I A;  1YU4 A;  1K82 A;  1OFI A;  1QAQ A;  3C58 A;  4LF9 M;  4Q7J A;  1E9R A;  3H4M A;  4B3S M;  3VKH A;  4B7G A;  4LJ8 A;  4EIW A;  4A3V B;  1JR3 D;  3QWL A;  4AG6 A;  3E21 A;  4TUW A;  4LFA M;  4HMC A;  3HHX A;  5IWA M;  2E5L M;  3K1J A;  1HR0 M;  2WSC F;  1DO0 A;  1TGU A;  3H4J A;  4GC9 A;  1N33 M;  3WD4 A;  1A5T A;  1E9S A;  4IBJ A;  1IY0 A;  8CAT A;  4GHA A;  4BB9 A;  3W0F A;  2QP9 X;  1GO5 A;  1IFY A;  3AJI B;  4PDI A;  1E32 A;  1NSF A;  5A2Q S;  4LG2 A;  1VDL A;  3EIH A;  3T38 A;  3HGI A;  3LCU A;  3FTF A;  1NY6 A;  1Z6T A;  1W1P A;  3RFW A;  1BVS A;  2YR0 A;  3HON A;  5ITX E;  4GMQ A;  1G71 A;  4WP2 A;  3I01 M;  1VEJ A;  3RGS A;  3MK6 A;  1OJL A;  4IBK A;  4MGI E;  3GPY A;  3LCV B;  4OJO A;  1QAM A;  2QBY A;  1OIP A;  1CK7 A;  2MJ5 B;  3MMP A;  4CHT B;  4LRT A;  4AKG A;  4DR1 M;  3GRU A;  1W1Y A;  2O25 A;  1XWI A;  2APL A;  4GEW A;  1XHB A;  2R0I A;  1Z5A A;  2L2D A;  3GLF B;  4L6V 6;  1FJG M;  1G41 A;  3FUT A;  1KYI A;  3RGP A;  2C96 A;  2FFJ A;  2BJV A;  3GLH A;  2R18 A;  2KRU A;  3L25 A;  1KSF X;  4R3D A;  3JR5 A;  3CGW A;  1YUE A;  4M0D A;  1GPF A;  4MB7 A;  3UK6 A;  2UWX A;  4GKJ M;  3GLI E;  1GVN A;  2ZAM A;  4KLN A;  4LZJ A;  3TWM A;  1L2D A;  4B3T M;  4AW4 A;  1D2N A;  3PFI A;  3FRH A;  2CV0 A;  3F92 A;  4P17 A;  3NBX X;  4FCV A;  1HT1 E;  4REZ A;  4GKK M;  4Z2K A;  5ITX A;  1TH2 A;  2L7I A;  2XH9 A;  1MN3 A;  3A46 A;  2OQ4 A;  4XK8 F;  2JY8 A;  1AIP C;  3SAS A;  4QOS A;  3FD9 A;  4NZ3 A;  2YFQ A;  4FD2 A;  2X8A A;  3SAT A;  2Y2H A;  1T6O A;  1G8P A;  3HKP A;  2ZM6 M;  1WHC A;  1GL6 A;  1I94 M;  2CRU A;  3ZC7 B;  2VQF M;  3KXE C;  2QHO B;  1PJS A;  1T3T A;  3Q8X A;  3W0L B;  2N35 A;  1IQP A;  1R6B X;  3QYB A;  4L16 A;  3SHG B;  3OTO M;  1N78 A;  4F2L A;  2RRU A;  1SXJ D;  1X37 A;  2CE7 A;  1QYR A;  4PT5 A;  2JE5 A;  3KVW A;  3L27 A;  1L1T A;  2R4E A;  2CV2 A;  2WSE F;  5DNY A;  1IBK M;  4JI3 M;  1P3Q Q;  3CF6 E;  3PVS A;  1PJQ A;  3TQS A;  4ANR A;  3B7Z A;  2VF7 A;  3LMM A;  1J7K A;  3SAU A;  4MB5 A;  3TL4 X;  1Z59 A;  1JR3 E;  3U6D A;  3SC3 A;  1SXJ C;  1ZMU A;  1QUT A;  4FCW A;  1GJS A;  1DGG A;  1OFH A;  3I04 M;  4FWG A;  4G4Q A;  3QYE A;  1IN5 A;  3IG5 A;  4GRI A;  5ITR A;  2CUZ A;  2L7H A;  3KFU G;  5FTK A;  3FTE A;  3U61 B;  1W5S A;  2R45 A;  5EP2 A;  4L78 A;  3VDU A;  4GC5 A;  2KNA A;  1IN8 A;  4MGY E;  1UR9 A;  2LVA A;  4M9X A;  3T1Y M;  3U6L A;  1GJT A;  2DNA A;  2M5Z A;  2Z3X A;  2I7N A;  4L8R C;  2LVP C;  1QAO A;  4IBB A;  3V76 A;  3VK7 A;  1XMO M;  4CIS A;  1IN7 A;  1NV8 A;  2RGO A;  2YQZ A;  3FUU A;  2D49 A;  2BWE A;  2GQF A;  2MH8 A;  3E4R A;  3U60 B;  2CP8 A;  2JY6 B;  1IXZ A;  4DV1 M;  2C99 A;  2FFF B;  5EXX A;  4Z2H A;  1GKI A;  2ZBK B;  2Y2I A;  2Z7J A;  4BLC A;  2WZJ A;  3AKZ A;  2W82 A;  3GPP A;  4DR6 M;  2K9D A;  1IXR C;  3U6M A;  2QCU A;  4DR7 M;  1EAK A;  5EJC A;  3HWS A;  1EFU B;  4OVZ A;  3HY5 A;  1L2B A;  3K2L A;  1E6P A;  4OJP A;  1C7Y A;  3BOS A;  1WGL A;  1S3S A;  2VDB B;  1NJF A;  3GLG B;  4NY2 A;  3LQQ A;  5JI3 E;  2Y2Q A;  1N77 A;  2MRO B;  3K9P A;  1H6U A;  1IXS B;  3KOY E;  4FW9 A;  1EIJ A;  3HSH A;  4PD2 A;  2EKF A;  1V92 A;  3K9O A;  1YU0 A;  1TTE A;  1SXJ E;  5EQT A;  1GL7 A;  2OOB A;  1OAO C;  3WD1 A;  1Y8G A;  2UUC M;  2DWN A;  2JY7 A;  4LJ6 A;  1OGG A;  3GQ4 A;  1YU3 A;  1AIW A;  4X65 M;  7CAT A;  1Z5C A;  3HX3 A;  2HWJ A;  3AOG A;  3FYC A;  4JI8 M;  4LFB M;  4GH9 A;  4NYU A;  4D80 A;  4QNR A;  3GO8 A;  4XBO A;  1QO6 A;  3J81 S;  4LRS A;  4G4R A;  4NRW A;  1YLA A;  3C9P A;  2YNM D;  3IEC A;  1YSY A;  3VDP A;  4Z2L A;  4HME A;  1DV0 A;  2XD1 A;  4R71 A;  1Q39 A;  1PJT A;  3HU3 A;  5IZ7 D;  2G5G X;  1IN4 A;  2H1R A;  2DAI A;  3CF0 A;  2K6B A;  3CTW B;  2DAG A;  4B08 A;  1R2Z A;  1E15 A;  3JAM S;  2F5N A;  1MJG M;  4LF5 M;  4LJ9 A;  2Q2E B;  5ITU A;  1UR8 A;  2KXE A;  1E94 E;  4RNA A;  2JXN A;  3UGJ A;  4G4N A;  2MR9 A;  1QAN A;  2Y20 A;  2DHR A;  2K47 A;  3AOE A;  1TDZ A;  5EP4 A;  1XXH A;  4L15 A;  3QAU A;  5KPT A;  1F4I A;  2F5S A;  1NY5 A;  2KDL A;  1J7M A;  3MQL A;  4CJ6 A;  4WW0 A;  1HNZ M;  2C98 A;  2V1U A;  5ITQ A;  3KW6 A;  4NOO B;  3SMS A;  1ZQ9 A;  5KPR A;  3GLH E;  2F4V M;  1SG9 A;  4FVM A;  2Y0Q A;  2Y0T A;  2R62 A;  4II7 A;  1NO1 A;  1ZMW A;  2C9O A;  4DUZ M;  4XGI A;  3W68 A;  4G6Z A;  3GQ5 A;  2XF3 A;  1VEG A;  3KDS E;  3PNV A;  2DZN B;  2QSF X;  4I8O A;  3VK8 A;  3FE3 A;  4RKU F;  1TR8 A;  4CIZ A;  1GOI A;  1IN6 A;  4DUY M;  2Y2L A;  4LJ5 A;  1V33 A;  2G8L A;  3GRR A;  4MGH A;  4OJL A;  4AKH A;  1V34 A;  2XSZ A;  4IJE A;  1QUS A;  2F5O A;  4B3R M;  2RGH A;  2V1C A;  4AQY M;  1YU1 A;  2UXC M;  2LH0 A;  5ITY A;  3I4V A;  5FLX S;  1XC8 A;  4DR3 M;  4Z2J A;  2FNA A;  2RKO A;  3JR4 A;  1LTM A;  1OTR A;  4LZZ A;  2UU9 M;  1OIZ A;  2KHH A;  1D0K A;  3FUW A;  4DV3 M;  3SAV A;  2DXI A;  2L4F A;  3GRV A;  3SBJ A;  2XZF A;  2HHH M;  3J2P B;  4YY3 M;  2JNH A;  4LF6 M;  1W1V A;  2GNO A;  4WUR A;  3GLG E;  5FTM A;  1UFZ A;  3C3D A;  3FKE A;  4FWD A;  2IOU A;  2HAK A;  1IY1 A;  2Z4S A;  2XLJ A;  3HHW A;  5KQ8 A;  3DFZ A;  1WGN A;  5IRE B;  1JR3 A;  3GLG A;  1K3X A;  5FTJ A;  5ITT A;  1HQC A;  1DGH B;  3DOA A;  4D82 A;  3HHZ A;  3SAR A;  1WJ7 A;  1G59 A;  2LHC A;  1HJP A;  4NC6 A;  2NQ8 C;  1PJJ A;  1IBL M;  5DFL A;  1SXJ A;  2HL7 A;  4DV6 M;  2CV1 A;  1TH4 A;  4LF4 M;  1R7R A;  2DKL A;  2ERC A;  1XMQ M;  2L09 A;  4X62 M;  5EP1 A;  3KP0 E;  4I81 A;  2KNZ A;  2OO9 A;  4FCT A;  3LVW A;  2CHQ A;  1ORY B;  4NRV A;  3L28 A;  1QZM A;  4X66 M;  3WD2 A;  3U6S A;  4W5W A;  3I51 A;  2FOI C;  3KP1 E;  4PDG A;  1L2C A;  2J5Y A;  3U60 A;  4AI6 A;  4HMD A;  1PRB A;  3T15 A;  1E8B A;  1VG5 A;  2FE8 A;  1PGY A;  2DI0 A;  2O01 F;  5FSW A;  1D0L A;  1FNN A;  2KNV A;  3C3E A;  4CGY B;  2AHM A;  2K0B X;  4S12 A;  2X4A A;  2DWL A;  2CEA A;  4IBD A;  3AFH A;  1NNU C;  1J5E M;  4GIP A;  1Z5B A;  1GLN A;  1PJI A;  2R65 A;  1HNX M;  1VDD A;  3HJ8 A;  3FYD A;  4GHL A;  2UXB M;  3UMM A;  1R2Y A;  4AKI A;  2RTS A;  3WD0 A;  3U5Z B;  3A98 B;  3HU2 A;  4JI5 M;  3GRY A;  3HJQ A;  3WHL A;  3T6P A;  3KOW E;  2DZO B;  2EUC A;  3GLI A;  2UUB M;  3HJS A;  1ZV1 A;  3B7N A;  1DGB A;  1W5T A;  2LVN C;  3DA1 A;  2B3T A;  2FS1 A;  2P5T A;  2DWZ B;  1NVM A;  2H5X A;  2CFO A;  2V6Z M;  4LCB A;  4JI1 M;  3L29 A;  2V5O A;  2Y2O A;  1YU2 A;  2JP7 A;  4OU7 A;  4IJF A;  1OGB A;  2HKJ A;  3J7B A;  2BNK A;  4PCZ A;  3VKG A;  1HT2 E;  4IIW A;  2X49 A;  3TWL A;  3TE6 A;  1R5L A;  1PM5 A;  4NZ5 A;  2VII A;  4DV0 M;  4NSR A;  3THG A;  2F5P A;  4QOZ C;  3A42 A;  4MM3 B;  3I4Y A;  3TWK A;  2R44 A;  4M9Z A;  2C9C A;  3PNY A;  1E6Z A;  2CWB A;  3U5Z A;  2KZS A;  2DZL A;  3GLI B;  4QNL A;  1WR1 B;  4NXM M;  5KPZ A;  1N36 M;  4LGM A;  2KA6 B;  2QEN A;  3KS4 A;  1H0G A;  1O6I A;  4I5S A;  1YE9 A;  2EA0 A;  4TX8 A;  2XFS A;  3VLF B;  3ZH9 B;  2D7G A;  4MGK E;  4ZPX A;  4OUI A;  1N34 M;  4OX9 M;  1XXH E;  2QBY B;  3MHV C;  3U61 A;  3LW5 F;  2DHY A;  2Y2G A;  5IT9 S;  4NL4 H;  3SMP A;  4F1I A;  3CF2 A;  4NSO B;  1ED7 A;  2OPF A;  3U6Q A;  4HLQ A;  3B9P A;  4NXN M;  4DR2 M;  4I4L A;  1TH3 A;  3B89 A;  4AZF A;  5KO3 A;  2L4E A;  1CXW A;  4QHT A;  2EKK A;  2BJW A;  2MGW A;  1QQW A;  1Q02 A;  4DV4 M;  5LMN M;  4Z6Y A;  3GPX A;  3MJ5 A;  1DGF A;  1VQ1 A;  1OQY A;  3KOX E;  3VFD A;  3SYK A;  1TDH A;  3KSX A;  3ZCB B;  2QPA A;  3M6A A;  1N32 M;  3WX7 A;  3LQR A;  2LBC A;  2EO2 A;  1YUB A;  1NNJ A;  1N75 A;  4M0W A;  1JB0 F;  3IHP A;  4LGY A;  1TF0 B;  2ZAN A;  3D8B A;  4NZ1 A;  2DAE A;  1Q3C A;  2KRK A;  4LJ4 A;  2CHG A;  3GLF E;  4M9S A;  4P16 A;  2XZU A;  2Y21 A;  2FN2 A;  4DV2 M;  2QZ4 A;  1MU5 A;  1ZMV A;  4L4U A;  2VQE M;  2JUJ A;  1R4G A;  2LVQ D;  3PXG A; 
#chains in the Genus database with same CATH homology
 4B7H A;  5H37 D;  3KS8 A;  3FUV A;  3R9X B;  4LFC M;  2Y2J A;  3KOZ E;  3M7G A;  4LJ7 A;  3DZD A;  4KHP M;  3WHK A;  2I7P A;  2XSZ D;  4RF0 A;  1I4W A;  2XGN A;  2R46 A;  3E9S A;  2O5R A;  3IG8 A;  5JI2 E;  3J80 S;  3L26 A;  5EP3 A;  4IBE A;  1NJG A;  3U6E A;  5EXS A;  2J7O A;  3AOE C;  3N3F A;  3SAW A;  5FTL A;  3AL0 C;  5F3W A;  3KSJ A;  3M0E A;  2LNH C;  3SHF A;  3AV0 A;  2JCH A;  1UM8 A;  3L2A A;  4RF1 A;  3GLH B;  1XNR M;  3UZU A;  3FUX A;  5EXP A;  4JI6 M;  2L6O A;  1DGH A;  4B3M M;  1SXJ B;  2D7E A;  3NBI A;  4IBC A;  3GQ3 A;  2Y2M A;  2A5Y B;  4ITQ A;  3ILK A;  5LMU M;  4DR4 M;  4LF7 M;  2KEB A;  3LVV A;  5E26 A;  3A45 A;  2UXD M;  4NYY A;  4MH0 E;  1LV7 A;  4IBG A;  4MGZ E;  2F5Q A;  4JI2 M;  3HU1 A;  1KFV A;  4LF8 M;  1Q3B A;  1L1Z A;  5BPV A;  4JI7 M;  5C18 A;  2UUA M;  2R4J A;  3GPU A;  1IBM M;  4JYA M;  4K0K M;  2ZAO A;  4IBF A;  2Y2K A;  3RE8 A;  4GIT A;  5E6J A;  3D8L A;  5DYI A;  4D81 A;  4X64 M;  4QNM A;  2DVW B;  2J7N A;  1QVR A;  4YHH M;  1HQY E;  4G4O A;  3J7A S;  2Y2P A;  4JN6 A;  1J09 A;  4BBA A;  1JQJ C;  3R8F A;  1MX0 A;  3FTC A;  2HCB A;  4LJA A;  3K8Z A;  4DV5 M;  2C5R A;  4JI4 M;  1HNW M;  1XNQ M;  4JXJ A;  4QHS A;  4R7G A;  3U6P A;  3EIE A;  4FWH A;  1L8Q A;  1G4A E;  2Y2N A;  4NZ4 A;  3GLF A;  2D7H A;  4JI0 M;  1WXQ A;  3T1H M;  2M60 A;  1IM2 A;  4IBI A;  3U6C A;  4KO8 A;  3NWL A;  5C1B A;  3FTD A;  1EE8 A;  1XXH B;  5KQD A;  4B7F A;  4LY6 A;  5FTN A;  4OVZ B;  3TPZ A;  3SFZ A;  4Z8X A;  5DYG A;  5BR8 M;  2XD5 A;  1DO2 A;  4OW0 A;  5GKN A;  3UJN A;  4HL4 A;  2KZU A;  1NHW C;  1C1K A;  1IY2 A;  3J27 B;  4DR5 M;  1K3W A;  2Z4R A;  3HHY A;  4JV5 M;  1NHG C;  2JA2 A;  2XFT A;  4OJ5 A;  4OJ6 A;  4KOD A;  3SYL A;  2CHV A;  4AG5 A;  2XEP A;  2BG1 A;  3K92 A;  5EXT A;  1ZAE A;  2LWX A;  2DWM A;  2KW0 A;  2LXE A;  4DV7 M;  3U6O A;  3GP1 A;  1G3I A;  1YU4 A;  1K82 A;  1OFI A;  1QAQ A;  3C58 A;  4LF9 M;  1E9R A;  3H4M A;  4B3S M;  3VKH A;  4B7G A;  4LJ8 A;  4EIW A;  4A3V B;  1JR3 D;  3QWL A;  4AG6 A;  4TUW A;  4LFA M;  3HHX A;  5IWA M;  2E5L M;  3K1J A;  1HR0 M;  1DO0 A;  1TGU A;  4GC9 A;  1N33 M;  1E9S A;  4IBJ A;  1IY0 A;  8CAT A;  4GHA A;  4BB9 A;  3W0F A;  2QP9 X;  3AJI B;  4PDI A;  1E32 A;  1NSF A;  5A2Q S;  4LG2 A;  3FTF A;  3EIH A;  3T38 A;  3HGI A;  1NY6 A;  1Z6T A;  3RFW A;  2YR0 A;  3HON A;  5ITX E;  4GMQ A;  3RGS A;  3MK6 A;  1OJL A;  4IBK A;  4MGI E;  3GPY A;  4OJO A;  1QAM A;  2QBY A;  4CHT B;  4LRT A;  4AKG A;  4DR1 M;  3GRU A;  1XWI A;  1XHB A;  1Z5A A;  3GLF B;  1FJG M;  1G41 A;  3FUT A;  1KYI A;  3RGP A;  2C96 A;  2FFJ A;  2BJV A;  3GLH A;  2KRU A;  2R18 A;  3L25 A;  1KSF X;  4R3D A;  3JR5 A;  1YUE A;  4M0D A;  4MB7 A;  3UK6 A;  2UWX A;  4GKJ M;  1GVN A;  2ZAM A;  4KLN A;  4LZJ A;  3TWM A;  1L2D A;  4B3T M;  4AW4 A;  1D2N A;  3PFI A;  2CV0 A;  4REZ A;  4FCV A;  4GKK M;  1HT1 E;  5ITX A;  1TH2 A;  2L7I A;  2XH9 A;  3A46 A;  2OQ4 A;  3SAS A;  4QOS A;  3FD9 A;  4NZ3 A;  2YFQ A;  4FD2 A;  2X8A A;  3SAT A;  2Y2H A;  1G8P A;  3HKP A;  2ZM6 M;  1GL6 A;  1I94 M;  3ZC7 B;  2VQF M;  3KXE C;  1T3T A;  3Q8X A;  3W0L B;  1IQP A;  1R6B X;  4L16 A;  3OTO M;  3SHG B;  1N78 A;  1SXJ D;  1X37 A;  2CE7 A;  1QYR A;  4PT5 A;  2JE5 A;  3KVW A;  3L27 A;  1L1T A;  2R4E A;  2CV2 A;  5DNY A;  1IBK M;  4JI3 M;  3CF6 E;  3PVS A;  3TQS A;  3LMM A;  1J7K A;  3SAU A;  3TL4 X;  1Z59 A;  3U6D A;  3SC3 A;  1SXJ C;  4FCW A;  1DGG A;  1OFH A;  4FWG A;  4G4Q A;  1IN5 A;  3IG5 A;  4GRI A;  5ITR A;  2CUZ A;  2L7H A;  3KFU G;  5FTK A;  3FTE A;  3U61 B;  1W5S A;  2R45 A;  5EP2 A;  4L78 A;  3VDU A;  4GC5 A;  1IN8 A;  4MGY E;  4M9X A;  3T1Y M;  3U6L A;  2M5Z A;  2Z3X A;  2I7N A;  4L8R C;  1QAO A;  4IBB A;  3VK7 A;  1XMO M;  4CIS A;  1IN7 A;  2RGO A;  2YQZ A;  3FUU A;  3E4R A;  3U60 B;  1IXZ A;  4DV1 M;  2C99 A;  2FFF B;  5EXX A;  1GKI A;  2ZBK B;  2Y2I A;  2Z7J A;  4BLC A;  3AKZ A;  2W82 A;  3GPP A;  4DR6 M;  3U6M A;  1IXR C;  4DR7 M;  2QCU A;  5EJC A;  3HWS A;  4OVZ A;  1L2B A;  4OJP A;  3K2L A;  3BOS A;  1S3S A;  1NJF A;  3GLG B;  4NY2 A;  3LQQ A;  5JI3 E;  2Y2Q A;  1N77 A;  3KOY E;  1H6U A;  1IXS B;  4FW9 A;  3HSH A;  4PD2 A;  1YU0 A;  1SXJ E;  5EQT A;  1GL7 A;  2UUC M;  2DWN A;  4LJ6 A;  3GQ4 A;  1YU3 A;  4X65 M;  7CAT A;  1Z5C A;  3AOG A;  3FYC A;  4JI8 M;  4LFB M;  4GH9 A;  4NYU A;  4D80 A;  4QNR A;  3GO8 A;  4XBO A;  3J81 S;  4LRS A;  4G4R A;  4NRW A;  2YNM D;  1YSY A;  3VDP A;  2XD1 A;  1Q39 A;  3HU3 A;  5IZ7 D;  2G5G X;  1IN4 A;  2H1R A;  3CF0 A;  3CTW B;  4B08 A;  1R2Z A;  3JAM S;  2F5N A;  4LF5 M;  4LJ9 A;  2Q2E B;  5ITU A;  2KXE A;  1E94 E;  4RNA A;  3UGJ A;  4G4N A;  1QAN A;  2Y20 A;  2DHR A;  2K47 A;  3AOE A;  1TDZ A;  5EP4 A;  1XXH A;  4L15 A;  3QAU A;  5KPT A;  2F5S A;  1NY5 A;  4WW0 A;  1HNZ M;  2C98 A;  2V1U A;  5ITQ A;  3KW6 A;  4NOO B;  3SMS A;  1ZQ9 A;  5KPR A;  2F4V M;  4FVM A;  2Y0Q A;  2Y0T A;  2R62 A;  4II7 A;  2C9O A;  4DUZ M;  4XGI A;  4G6Z A;  3GQ5 A;  2XF3 A;  3KDS E;  3PNV A;  2DZN B;  4I8O A;  3VK8 A;  1IN6 A;  4DUY M;  2Y2L A;  4LJ5 A;  2G8L A;  3GRR A;  4MGH A;  4OJL A;  4AKH A;  2XSZ A;  4IJE A;  2F5O A;  4B3R M;  2RGH A;  2V1C A;  4AQY M;  1YU1 A;  2UXC M;  2LH0 A;  5ITY A;  3I4V A;  5FLX S;  1XC8 A;  4DR3 M;  2FNA A;  2RKO A;  3JR4 A;  4LZZ A;  2UU9 M;  2DXI A;  3FUW A;  4DV3 M;  3SAV A;  3GRV A;  3SBJ A;  2XZF A;  2HHH M;  3J2P B;  4YY3 M;  4LF6 M;  4WUR A;  5FTM A;  3FKE A;  4FWD A;  2IOU A;  1IY1 A;  2Z4S A;  2XLJ A;  3HHW A;  5KQ8 A;  3DFZ A;  5IRE B;  1JR3 A;  3GLG A;  1K3X A;  5FTJ A;  5ITT A;  1HQC A;  1DGH B;  3DOA A;  4D82 A;  3HHZ A;  3SAR A;  1G59 A;  1IBL M;  1PJJ A;  2NQ8 C;  2CV1 A;  1SXJ A;  2HL7 A;  4DV6 M;  1TH4 A;  4LF4 M;  1R7R A;  2ERC A;  1XMQ M;  2L09 A;  4X62 M;  5EP1 A;  3KP0 E;  4I81 A;  4FCT A;  3LVW A;  2CHQ A;  1ORY B;  4NRV A;  3L28 A;  1QZM A;  4X66 M;  3U6S A;  4W5W A;  3I51 A;  2FOI C;  3KP1 E;  4PDG A;  1L2C A;  4AI6 A;  3U60 A;  3T15 A;  2FE8 A;  5FSW A;  1FNN A;  4CGY B;  2AHM A;  4S12 A;  2X4A A;  2DWL A;  2CEA A;  4IBD A;  3AFH A;  1NNU C;  1J5E M;  4GIP A;  1Z5B A;  1GLN A;  1PJI A;  2R65 A;  1HNX M;  1VDD A;  3HJ8 A;  3FYD A;  4GHL A;  2UXB M;  3UMM A;  1R2Y A;  4AKI A;  3U5Z B;  3A98 B;  3HU2 A;  4JI5 M;  3GRY A;  3HJQ A;  3WHL A;  3KOW E;  2DZO B;  2EUC A;  3GLI A;  2UUB M;  3HJS A;  1DGB A;  1W5T A;  3DA1 A;  2P5T A;  2DWZ B;  2V6Z M;  1NVM A;  2CFO A;  4LCB A;  4JI1 M;  3L29 A;  2Y2O A;  1YU2 A;  4OU7 A;  4IJF A;  2HKJ A;  3J7B A;  2BNK A;  4PCZ A;  3VKG A;  1HT2 E;  4IIW A;  2X49 A;  3TWL A;  3TE6 A;  1PM5 A;  4NZ5 A;  2VII A;  4DV0 M;  4NSR A;  3THG A;  2F5P A;  4QOZ C;  3A42 A;  4MM3 B;  3I4Y A;  3TWK A;  4M9Z A;  2C9C A;  3PNY A;  3U5Z A;  2KZS A;  3GLI B;  4QNL A;  4NXM M;  5KPZ A;  1N36 M;  4LGM A;  2KA6 B;  2QEN A;  3KS4 A;  4I5S A;  1YE9 A;  2EA0 A;  2XFS A;  3VLF B;  3ZH9 B;  2D7G A;  4MGK E;  4ZPX A;  4OUI A;  1N34 M;  4OX9 M;  2QBY B;  3MHV C;  3U61 A;  2Y2G A;  5IT9 S;  4NL4 H;  3SMP A;  3CF2 A;  4NSO B;  2OPF A;  3U6Q A;  4HLQ A;  3B9P A;  4NXN M;  4DR2 M;  4I4L A;  1TH3 A;  4AZF A;  5KO3 A;  4QHT A;  2BJW A;  1QQW A;  4DV4 M;  5LMN M;  4Z6Y A;  3GPX A;  3MJ5 A;  1DGF A;  3KOX E;  3VFD A;  3SYK A;  1TDH A;  3KSX A;  3ZCB B;  2QPA A;  3M6A A;  1N32 M;  3WX7 A;  3LQR A;  1NNJ A;  2EO2 A;  1YUB A;  1N75 A;  4M0W A;  4LGY A;  2ZAN A;  3D8B A;  4NZ1 A;  1Q3C A;  2KRK A;  4LJ4 A;  2CHG A;  4M9S A;  4P16 A;  2XZU A;  2Y21 A;  4DV2 M;  1MU5 A;  2QZ4 A;  4L4U A;  2VQE M;  3PXG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...